From mboxrd@z Thu Jan 1 00:00:00 1970 Received: by 2002:a17:906:80c3:b0:7ae:d8f:8937 with SMTP id a3csp1121117ejx; Wed, 30 Nov 2022 03:20:54 -0800 (PST) X-Google-Smtp-Source: AA0mqf5yiPkp+DNvNjR61g8nC2NCsORrmwDrN3lK8TA9yUTEpVw6HZ5Negjy1ODtqYtWi6d+tK0U X-Received: by 2002:a37:6d8:0:b0:6fa:ece6:7c5e with SMTP id 207-20020a3706d8000000b006faece67c5emr54971067qkg.466.1669807254504; Wed, 30 Nov 2022 03:20:54 -0800 (PST) ARC-Seal: i=1; a=rsa-sha256; t=1669807254; cv=none; d=google.com; s=arc-20160816; b=z0oe4VcorNr5jwD+CEvLEnCZsUEwOicT+qNoi2Zs/eY0v/hRyDdOdZevvUKBeaWbzg SUibQfeESKRyRFPgICyqbEt5wrc5Y/lqzpbp/19ml2Kd6+FhTU3mS087dz3LnrsB9/Tq or6qdkf/FtA0BFyxoJvOTz57jFaPmbvQzNm+ZtUnsqf7t3lv542oL0TPmMpvA2r7BdEq KVltB56vcvsTqreRMtlNjayJtJeic3I85lW1qXOWY67GdguMgvIXxKWEwtkqUpFtH1z3 C9Ix30TM0XFdJnN4IB+n0zsaUnQCOgWuCyTqvb2HKvZ1dicOsy1lr0uIXP+MC1LtH9VP w1+A== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=sender:errors-to:list-subscribe:list-help:list-post:list-archive :list-unsubscribe:list-id:precedence:content-transfer-encoding :mime-version:references:in-reply-to:message-id:subject:cc:to:from :date; bh=6wzFQS3gLuzhLRh2KPqs2eQdltgQ2yAJ5hiWbeHzlwU=; b=z1Ba0NRaP7WVpqo5iYZRNhK9y7D5m1yfFzkqTTySOKSROCOdU1FIa/+xAV3NEIJmDa pjuAdftviU5EayLo2HpCud5tjWV0mtuB1I/osickRGiM5Y9JJCSQnVC5hh7KW1p2eKvE 4QOZeqfDfkr2i4VpJWtBiieuWxfgW+D4edjAql1bid9WrA2SBWeGTE3rlrBAVVz39rbt V1nVVUbVcL/BMVzOcMdpa8M41nEltp29fg3BEg5S+HpWf/Q9FhUFO6Yas59rEn3ZZGF0 wlNjcuksvATUOdxtGRRgRfbVSdEoARMdkslb3eWUSWy8tPRtjQQtmO3m4LR7DkBjLvOj TkiQ== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of qemu-arm-bounces+alex.bennee=linaro.org@nongnu.org designates 209.51.188.17 as permitted sender) smtp.mailfrom="qemu-arm-bounces+alex.bennee=linaro.org@nongnu.org" Return-Path: Received: from lists.gnu.org (lists.gnu.org. [209.51.188.17]) by mx.google.com with ESMTPS id cm14-20020a05622a250e00b003a575a9bc72si664007qtb.340.2022.11.30.03.20.54 for (version=TLS1_2 cipher=ECDHE-ECDSA-CHACHA20-POLY1305 bits=256/256); Wed, 30 Nov 2022 03:20:54 -0800 (PST) Received-SPF: pass (google.com: domain of qemu-arm-bounces+alex.bennee=linaro.org@nongnu.org designates 209.51.188.17 as permitted sender) client-ip=209.51.188.17; Authentication-Results: mx.google.com; spf=pass (google.com: domain of qemu-arm-bounces+alex.bennee=linaro.org@nongnu.org designates 209.51.188.17 as permitted sender) smtp.mailfrom="qemu-arm-bounces+alex.bennee=linaro.org@nongnu.org" Received: from localhost ([::1] helo=lists1p.gnu.org) by lists.gnu.org with esmtp (Exim 4.90_1) (envelope-from ) id 1p0L91-00038G-AV; Wed, 30 Nov 2022 06:20:51 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1p0L8y-00037q-EN for qemu-arm@nongnu.org; Wed, 30 Nov 2022 06:20:49 -0500 Received: from 6.mo552.mail-out.ovh.net ([188.165.49.222]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1p0L8v-0003Hz-DR for qemu-arm@nongnu.org; Wed, 30 Nov 2022 06:20:48 -0500 Received: from mxplan5.mail.ovh.net (unknown [10.108.16.235]) by mo552.mail-out.ovh.net (Postfix) with ESMTPS id B5E0D33F1E; Wed, 30 Nov 2022 11:20:30 +0000 (UTC) Received: from kaod.org (37.59.142.110) by DAG8EX2.mxp5.local (172.16.2.72) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256) id 15.1.2507.16; Wed, 30 Nov 2022 12:20:29 +0100 Authentication-Results: garm.ovh; auth=pass (GARM-110S00484e1f006-89d5-4851-a2b3-20ffab76a8d7, 9433ACEAB4E44C6AFEC55264D2D2BE00F9EACC0D) smtp.auth=groug@kaod.org X-OVh-ClientIp: 78.197.208.248 Date: Wed, 30 Nov 2022 12:20:28 +0100 From: Greg Kurz To: Igor Mammedov CC: , , , , , , , , , , , , , , , Philippe =?UTF-8?B?TWF0aGlldS1EYXVkw6k=?= Subject: Re: [PATCH v2 for-8.0 2/2] pci: drop redundant PCIDeviceClass::is_bridge field Message-ID: <20221130122028.7cf54ef3@bahia> In-Reply-To: <20221129101341.185621-3-imammedo@redhat.com> References: <20221129101341.185621-1-imammedo@redhat.com> <20221129101341.185621-3-imammedo@redhat.com> X-Mailer: Claws Mail 4.1.1 (GTK 3.24.34; x86_64-redhat-linux-gnu) MIME-Version: 1.0 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Originating-IP: [37.59.142.110] X-ClientProxiedBy: DAG7EX2.mxp5.local (172.16.2.62) To DAG8EX2.mxp5.local (172.16.2.72) X-Ovh-Tracer-GUID: 11f0c816-3e71-473b-8fdb-485c62b78c0e X-Ovh-Tracer-Id: 4358921491718904135 X-VR-SPAMSTATE: OK X-VR-SPAMSCORE: -100 X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvhedrtdefgddvhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfqggfjpdevjffgvefmvefgnecuuegrihhlohhuthemucehtddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpeffhffvvefukfgjfhfogggtgfhisehtqhertdertdejnecuhfhrohhmpefirhgvghcumfhurhiiuceoghhrohhugheskhgrohgurdhorhhgqeenucggtffrrghtthgvrhhnpeeuueeijedtleeluedthfetjeffieetffeuvefffeeftedvieefueejgfdugeetueenucfkphepuddvjedrtddrtddruddpfeejrdehledrudegvddruddutdenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduvdejrddtrddtrddupdhmrghilhhfrhhomhepoehgrhhouhhgsehkrghougdrohhrgheqpdhnsggprhgtphhtthhopedupdhrtghpthhtohepihhmrghmmhgvughosehrvgguhhgrthdrtghomhdpqhgvmhhuqdgrrhhmsehnohhnghhnuhdrohhrghdpuggrvhhiugesghhisghsohhnrdgurhhophgsvggrrhdrihgurdgruhdpuggrnhhivghlhhgsgedufeesghhmrghilhdrtghomhdprghlvghkshgrnhgurghrrdhrihhkrghlohesshihrhhmihgrrdgtohhmpdhprghulhgsuhhrthhonheskhgvrhhnvghlrdhorhhgpdhqvghmuhdqphhptgesnhhonhhgnhhurdhorhhgpdgrnhgurhgvfidrshhmihhrnhhovhesghhmrghilhdrtghomh dpmhgrrhhkrdgtrghvvgdqrgihlhgrnhgusehilhgrnhguvgdrtghordhukhdprhhitghhrghrugdrhhgvnhguvghrshhonheslhhinhgrrhhordhorhhgpdhpsghonhiiihhnihesrhgvughhrghtrdgtohhmpdgrnhhisegrnhhishhinhhhrgdrtggrpdhmshhtsehrvgguhhgrthdrtghomhdpqhgvmhhuqdguvghvvghlsehnohhnghhnuhdrohhrghdpphgvthgvrhdrmhgrhiguvghllheslhhinhgrrhhordhorhhgpdhphhhilhhmugeslhhinhgrrhhordhorhhgpdgtlhhgsehkrghougdrohhrghdpoffvtefjohhsthepmhhoheehvddpmhhouggvpehsmhhtphhouhht Received-SPF: pass client-ip=188.165.49.222; envelope-from=groug@kaod.org; helo=6.mo552.mail-out.ovh.net X-Spam_score_int: -18 X-Spam_score: -1.9 X-Spam_bar: - X-Spam_report: (-1.9 / 5.0 requ) BAYES_00=-1.9, RCVD_IN_DNSWL_NONE=-0.0001, SPF_HELO_NONE=0.001, SPF_PASS=-0.001 autolearn=unavailable autolearn_force=no X-Spam_action: no action X-BeenThere: qemu-arm@nongnu.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: qemu-arm-bounces+alex.bennee=linaro.org@nongnu.org Sender: qemu-arm-bounces+alex.bennee=linaro.org@nongnu.org X-TUID: cFAVcpynxz+E On Tue, 29 Nov 2022 11:13:41 +0100 Igor Mammedov wrote: > and use cast to TYPE_PCI_BRIDGE instead. >=20 > Signed-off-by: Igor Mammedov > Reviewed-by: Philippe Mathieu-Daud=C3=A9 > --- > v2: > (Philippe Mathieu-Daud=C3=A9 ) > - replace leftover IS_PCI_BRIDGE cast with is_bridge variable > --- > include/hw/pci/pci.h | 11 +---------- > include/hw/pci/pci_bridge.h | 1 + > hw/acpi/pcihp.c | 3 +-- > hw/i386/acpi-build.c | 5 ++--- > hw/pci-bridge/cxl_downstream.c | 1 - > hw/pci-bridge/cxl_upstream.c | 1 - > hw/pci-bridge/i82801b11.c | 1 - > hw/pci-bridge/pci_bridge_dev.c | 1 - > hw/pci-bridge/pcie_pci_bridge.c | 1 - > hw/pci-bridge/pcie_root_port.c | 1 - > hw/pci-bridge/simba.c | 1 - > hw/pci-bridge/xio3130_downstream.c | 1 - > hw/pci-bridge/xio3130_upstream.c | 1 - > hw/pci-host/designware.c | 1 - > hw/pci-host/xilinx-pcie.c | 1 - > hw/pci/pci.c | 20 +++++++++----------- > hw/ppc/spapr_pci.c | 15 +++++---------- For ppc changes : Reviewed-by: Greg Kurz > 17 files changed, 19 insertions(+), 47 deletions(-) >=20 > diff --git a/include/hw/pci/pci.h b/include/hw/pci/pci.h > index 6ccaaf5154..8b3a8571bf 100644 > --- a/include/hw/pci/pci.h > +++ b/include/hw/pci/pci.h > @@ -250,16 +250,7 @@ struct PCIDeviceClass { > uint16_t class_id; > uint16_t subsystem_vendor_id; /* only for header type =3D 0 */ > uint16_t subsystem_id; /* only for header type =3D 0 */ > - > - /* > - * pci-to-pci bridge or normal device. > - * This doesn't mean pci host switch. > - * When card bus bridge is supported, this would be enhanced. > - */ > - bool is_bridge; > - > - /* rom bar */ > - const char *romfile; > + const char *romfile; /* rom bar */ > }; > =20 > typedef void (*PCIINTxRoutingNotifier)(PCIDevice *dev); > diff --git a/include/hw/pci/pci_bridge.h b/include/hw/pci/pci_bridge.h > index ba4bafac7c..ca6caf487e 100644 > --- a/include/hw/pci/pci_bridge.h > +++ b/include/hw/pci/pci_bridge.h > @@ -53,6 +53,7 @@ struct PCIBridgeWindows { > =20 > #define TYPE_PCI_BRIDGE "base-pci-bridge" > OBJECT_DECLARE_SIMPLE_TYPE(PCIBridge, PCI_BRIDGE) > +#define IS_PCI_BRIDGE(dev) object_dynamic_cast(OBJECT(dev), TYPE_PCI_BRI= DGE) > =20 > struct PCIBridge { > /*< private >*/ > diff --git a/hw/acpi/pcihp.c b/hw/acpi/pcihp.c > index 84d75e6b84..99a898d9ae 100644 > --- a/hw/acpi/pcihp.c > +++ b/hw/acpi/pcihp.c > @@ -186,7 +186,6 @@ static PCIBus *acpi_pcihp_find_hotplug_bus(AcpiPciHpS= tate *s, int bsel) > =20 > static bool acpi_pcihp_pc_no_hotplug(AcpiPciHpState *s, PCIDevice *dev) > { > - PCIDeviceClass *pc =3D PCI_DEVICE_GET_CLASS(dev); > DeviceClass *dc =3D DEVICE_GET_CLASS(dev); > /* > * ACPI doesn't allow hotplug of bridge devices. Don't allow > @@ -196,7 +195,7 @@ static bool acpi_pcihp_pc_no_hotplug(AcpiPciHpState *= s, PCIDevice *dev) > * Don't allow hot-unplug of SR-IOV Virtual Functions, as they > * will be removed implicitly, when Physical Function is unplugged. > */ > - return (pc->is_bridge && !dev->qdev.hotplugged) || !dc->hotpluggable= || > + return (IS_PCI_BRIDGE(dev) && !dev->qdev.hotplugged) || !dc->hotplug= gable || > pci_is_vf(dev); > } > =20 > diff --git a/hw/i386/acpi-build.c b/hw/i386/acpi-build.c > index d9eaa5fc4d..aa15b11cde 100644 > --- a/hw/i386/acpi-build.c > +++ b/hw/i386/acpi-build.c > @@ -403,7 +403,6 @@ static void build_append_pci_bus_devices(Aml *parent_= scope, PCIBus *bus, > =20 > for (devfn =3D 0; devfn < ARRAY_SIZE(bus->devices); devfn++) { > DeviceClass *dc; > - PCIDeviceClass *pc; > PCIDevice *pdev =3D bus->devices[devfn]; > int slot =3D PCI_SLOT(devfn); > int func =3D PCI_FUNC(devfn); > @@ -414,14 +413,14 @@ static void build_append_pci_bus_devices(Aml *paren= t_scope, PCIBus *bus, > bool cold_plugged_bridge =3D false; > =20 > if (pdev) { > - pc =3D PCI_DEVICE_GET_CLASS(pdev); > dc =3D DEVICE_GET_CLASS(pdev); > =20 > /* > * Cold plugged bridges aren't themselves hot-pluggable. > * Hotplugged bridges *are* hot-pluggable. > */ > - cold_plugged_bridge =3D pc->is_bridge && !DEVICE(pdev)->hotp= lugged; > + cold_plugged_bridge =3D IS_PCI_BRIDGE(pdev) && > + !DEVICE(pdev)->hotplugged; > bridge_in_acpi =3D cold_plugged_bridge && pcihp_bridge_en; > =20 > hotpluggbale_slot =3D bsel && dc->hotpluggable && > diff --git a/hw/pci-bridge/cxl_downstream.c b/hw/pci-bridge/cxl_downstrea= m.c > index a361e519d0..3d4e6b59cd 100644 > --- a/hw/pci-bridge/cxl_downstream.c > +++ b/hw/pci-bridge/cxl_downstream.c > @@ -217,7 +217,6 @@ static void cxl_dsp_class_init(ObjectClass *oc, void = *data) > DeviceClass *dc =3D DEVICE_CLASS(oc); > PCIDeviceClass *k =3D PCI_DEVICE_CLASS(oc); > =20 > - k->is_bridge =3D true; > k->config_write =3D cxl_dsp_config_write; > k->realize =3D cxl_dsp_realize; > k->exit =3D cxl_dsp_exitfn; > diff --git a/hw/pci-bridge/cxl_upstream.c b/hw/pci-bridge/cxl_upstream.c > index 9b8b57df9d..9df436cb73 100644 > --- a/hw/pci-bridge/cxl_upstream.c > +++ b/hw/pci-bridge/cxl_upstream.c > @@ -375,7 +375,6 @@ static void cxl_upstream_class_init(ObjectClass *oc, = void *data) > DeviceClass *dc =3D DEVICE_CLASS(oc); > PCIDeviceClass *k =3D PCI_DEVICE_CLASS(oc); > =20 > - k->is_bridge =3D true; > k->config_write =3D cxl_usp_write_config; > k->config_read =3D cxl_usp_read_config; > k->realize =3D cxl_usp_realize; > diff --git a/hw/pci-bridge/i82801b11.c b/hw/pci-bridge/i82801b11.c > index f28181e210..d9f224818b 100644 > --- a/hw/pci-bridge/i82801b11.c > +++ b/hw/pci-bridge/i82801b11.c > @@ -92,7 +92,6 @@ static void i82801b11_bridge_class_init(ObjectClass *kl= ass, void *data) > PCIDeviceClass *k =3D PCI_DEVICE_CLASS(klass); > DeviceClass *dc =3D DEVICE_CLASS(klass); > =20 > - k->is_bridge =3D true; > k->vendor_id =3D PCI_VENDOR_ID_INTEL; > k->device_id =3D PCI_DEVICE_ID_INTEL_82801BA_11; > k->revision =3D ICH9_D2P_A2_REVISION; > diff --git a/hw/pci-bridge/pci_bridge_dev.c b/hw/pci-bridge/pci_bridge_de= v.c > index 657a06ddbe..3435df8d73 100644 > --- a/hw/pci-bridge/pci_bridge_dev.c > +++ b/hw/pci-bridge/pci_bridge_dev.c > @@ -254,7 +254,6 @@ static void pci_bridge_dev_class_init(ObjectClass *kl= ass, void *data) > k->vendor_id =3D PCI_VENDOR_ID_REDHAT; > k->device_id =3D PCI_DEVICE_ID_REDHAT_BRIDGE; > k->class_id =3D PCI_CLASS_BRIDGE_PCI; > - k->is_bridge =3D true; > dc->desc =3D "Standard PCI Bridge"; > dc->reset =3D qdev_pci_bridge_dev_reset; > device_class_set_props(dc, pci_bridge_dev_properties); > diff --git a/hw/pci-bridge/pcie_pci_bridge.c b/hw/pci-bridge/pcie_pci_bri= dge.c > index 1cd917a459..2301b2ca0b 100644 > --- a/hw/pci-bridge/pcie_pci_bridge.c > +++ b/hw/pci-bridge/pcie_pci_bridge.c > @@ -145,7 +145,6 @@ static void pcie_pci_bridge_class_init(ObjectClass *k= lass, void *data) > DeviceClass *dc =3D DEVICE_CLASS(klass); > HotplugHandlerClass *hc =3D HOTPLUG_HANDLER_CLASS(klass); > =20 > - k->is_bridge =3D true; > k->vendor_id =3D PCI_VENDOR_ID_REDHAT; > k->device_id =3D PCI_DEVICE_ID_REDHAT_PCIE_BRIDGE; > k->realize =3D pcie_pci_bridge_realize; > diff --git a/hw/pci-bridge/pcie_root_port.c b/hw/pci-bridge/pcie_root_por= t.c > index 460e48269d..e0a7a036f5 100644 > --- a/hw/pci-bridge/pcie_root_port.c > +++ b/hw/pci-bridge/pcie_root_port.c > @@ -172,7 +172,6 @@ static void rp_class_init(ObjectClass *klass, void *d= ata) > DeviceClass *dc =3D DEVICE_CLASS(klass); > PCIDeviceClass *k =3D PCI_DEVICE_CLASS(klass); > =20 > - k->is_bridge =3D true; > k->config_write =3D rp_write_config; > k->realize =3D rp_realize; > k->exit =3D rp_exit; > diff --git a/hw/pci-bridge/simba.c b/hw/pci-bridge/simba.c > index ba55ab1939..17aa0d7b21 100644 > --- a/hw/pci-bridge/simba.c > +++ b/hw/pci-bridge/simba.c > @@ -77,7 +77,6 @@ static void simba_pci_bridge_class_init(ObjectClass *kl= ass, void *data) > k->device_id =3D PCI_DEVICE_ID_SUN_SIMBA; > k->revision =3D 0x11; > k->config_write =3D pci_bridge_write_config; > - k->is_bridge =3D true; > set_bit(DEVICE_CATEGORY_BRIDGE, dc->categories); > dc->reset =3D pci_bridge_reset; > dc->vmsd =3D &vmstate_pci_device; > diff --git a/hw/pci-bridge/xio3130_downstream.c b/hw/pci-bridge/xio3130_d= ownstream.c > index 05e2b06c0c..38a2361fa2 100644 > --- a/hw/pci-bridge/xio3130_downstream.c > +++ b/hw/pci-bridge/xio3130_downstream.c > @@ -159,7 +159,6 @@ static void xio3130_downstream_class_init(ObjectClass= *klass, void *data) > DeviceClass *dc =3D DEVICE_CLASS(klass); > PCIDeviceClass *k =3D PCI_DEVICE_CLASS(klass); > =20 > - k->is_bridge =3D true; > k->config_write =3D xio3130_downstream_write_config; > k->realize =3D xio3130_downstream_realize; > k->exit =3D xio3130_downstream_exitfn; > diff --git a/hw/pci-bridge/xio3130_upstream.c b/hw/pci-bridge/xio3130_ups= tream.c > index 5ff46ef050..a48bfe3bc5 100644 > --- a/hw/pci-bridge/xio3130_upstream.c > +++ b/hw/pci-bridge/xio3130_upstream.c > @@ -128,7 +128,6 @@ static void xio3130_upstream_class_init(ObjectClass *= klass, void *data) > DeviceClass *dc =3D DEVICE_CLASS(klass); > PCIDeviceClass *k =3D PCI_DEVICE_CLASS(klass); > =20 > - k->is_bridge =3D true; > k->config_write =3D xio3130_upstream_write_config; > k->realize =3D xio3130_upstream_realize; > k->exit =3D xio3130_upstream_exitfn; > diff --git a/hw/pci-host/designware.c b/hw/pci-host/designware.c > index bde3a343a2..9e183caa48 100644 > --- a/hw/pci-host/designware.c > +++ b/hw/pci-host/designware.c > @@ -600,7 +600,6 @@ static void designware_pcie_root_class_init(ObjectCla= ss *klass, void *data) > k->device_id =3D 0xABCD; > k->revision =3D 0; > k->class_id =3D PCI_CLASS_BRIDGE_PCI; > - k->is_bridge =3D true; > k->exit =3D pci_bridge_exitfn; > k->realize =3D designware_pcie_root_realize; > k->config_read =3D designware_pcie_root_config_read; > diff --git a/hw/pci-host/xilinx-pcie.c b/hw/pci-host/xilinx-pcie.c > index 38d5901a45..c9ab7052f4 100644 > --- a/hw/pci-host/xilinx-pcie.c > +++ b/hw/pci-host/xilinx-pcie.c > @@ -298,7 +298,6 @@ static void xilinx_pcie_root_class_init(ObjectClass *= klass, void *data) > k->device_id =3D 0x7021; > k->revision =3D 0; > k->class_id =3D PCI_CLASS_BRIDGE_HOST; > - k->is_bridge =3D true; > k->realize =3D xilinx_pcie_root_realize; > k->exit =3D pci_bridge_exitfn; > dc->reset =3D pci_bridge_reset; > diff --git a/hw/pci/pci.c b/hw/pci/pci.c > index 2f450f6a72..fe05b868e1 100644 > --- a/hw/pci/pci.c > +++ b/hw/pci/pci.c > @@ -576,7 +576,7 @@ void pci_bus_range(PCIBus *bus, int *min_bus, int *ma= x_bus) > for (i =3D 0; i < ARRAY_SIZE(bus->devices); ++i) { > PCIDevice *dev =3D bus->devices[i]; > =20 > - if (dev && PCI_DEVICE_GET_CLASS(dev)->is_bridge) { > + if (dev && IS_PCI_BRIDGE(dev)) { > *min_bus =3D MIN(*min_bus, dev->config[PCI_SECONDARY_BUS]); > *max_bus =3D MAX(*max_bus, dev->config[PCI_SUBORDINATE_BUS]); > } > @@ -592,7 +592,6 @@ static int get_pci_config_device(QEMUFile *f, void *p= v, size_t size, > const VMStateField *field) > { > PCIDevice *s =3D container_of(pv, PCIDevice, config); > - PCIDeviceClass *pc =3D PCI_DEVICE_GET_CLASS(s); > uint8_t *config; > int i; > =20 > @@ -614,9 +613,8 @@ static int get_pci_config_device(QEMUFile *f, void *p= v, size_t size, > memcpy(s->config, config, size); > =20 > pci_update_mappings(s); > - if (pc->is_bridge) { > - PCIBridge *b =3D PCI_BRIDGE(s); > - pci_bridge_update_mappings(b); > + if (IS_PCI_BRIDGE(s)) { > + pci_bridge_update_mappings(PCI_BRIDGE(s)); > } > =20 > memory_region_set_enabled(&s->bus_master_enable_region, > @@ -1090,9 +1088,10 @@ static PCIDevice *do_pci_register_device(PCIDevice= *pci_dev, > Error *local_err =3D NULL; > DeviceState *dev =3D DEVICE(pci_dev); > PCIBus *bus =3D pci_get_bus(pci_dev); > + bool is_bridge =3D IS_PCI_BRIDGE(pci_dev); > =20 > /* Only pci bridges can be attached to extra PCI root buses */ > - if (pci_bus_is_root(bus) && bus->parent_dev && !pc->is_bridge) { > + if (pci_bus_is_root(bus) && bus->parent_dev && !is_bridge) { > error_setg(errp, > "PCI: Only PCI/PCIe bridges can be plugged into %s", > bus->parent_dev->name); > @@ -1154,7 +1153,7 @@ static PCIDevice *do_pci_register_device(PCIDevice = *pci_dev, > pci_config_set_revision(pci_dev->config, pc->revision); > pci_config_set_class(pci_dev->config, pc->class_id); > =20 > - if (!pc->is_bridge) { > + if (!is_bridge) { > if (pc->subsystem_vendor_id || pc->subsystem_id) { > pci_set_word(pci_dev->config + PCI_SUBSYSTEM_VENDOR_ID, > pc->subsystem_vendor_id); > @@ -1171,7 +1170,7 @@ static PCIDevice *do_pci_register_device(PCIDevice = *pci_dev, > pci_init_cmask(pci_dev); > pci_init_wmask(pci_dev); > pci_init_w1cmask(pci_dev); > - if (pc->is_bridge) { > + if (is_bridge) { > pci_init_mask_bridge(pci_dev); > } > pci_init_multifunction(bus, pci_dev, &local_err); > @@ -2096,7 +2095,7 @@ static bool pci_root_bus_in_range(PCIBus *bus, int = bus_num) > for (i =3D 0; i < ARRAY_SIZE(bus->devices); ++i) { > PCIDevice *dev =3D bus->devices[i]; > =20 > - if (dev && PCI_DEVICE_GET_CLASS(dev)->is_bridge) { > + if (dev && IS_PCI_BRIDGE(dev)) { > if (pci_secondary_bus_in_range(dev, bus_num)) { > return true; > } > @@ -2841,7 +2840,6 @@ void pci_setup_iommu(PCIBus *bus, PCIIOMMUFunc fn, = void *opaque) > static void pci_dev_get_w64(PCIBus *b, PCIDevice *dev, void *opaque) > { > Range *range =3D opaque; > - PCIDeviceClass *pc =3D PCI_DEVICE_GET_CLASS(dev); > uint16_t cmd =3D pci_get_word(dev->config + PCI_COMMAND); > int i; > =20 > @@ -2849,7 +2847,7 @@ static void pci_dev_get_w64(PCIBus *b, PCIDevice *d= ev, void *opaque) > return; > } > =20 > - if (pc->is_bridge) { > + if (IS_PCI_BRIDGE(dev)) { > pcibus_t base =3D pci_bridge_get_base(dev, PCI_BASE_ADDRESS_MEM_= PREFETCH); > pcibus_t limit =3D pci_bridge_get_limit(dev, PCI_BASE_ADDRESS_ME= M_PREFETCH); > =20 > diff --git a/hw/ppc/spapr_pci.c b/hw/ppc/spapr_pci.c > index 7b7618d5da..75aacda65a 100644 > --- a/hw/ppc/spapr_pci.c > +++ b/hw/ppc/spapr_pci.c > @@ -1361,7 +1361,6 @@ static int spapr_dt_pci_device(SpaprPhbState *sphb,= PCIDevice *dev, > { > int offset; > g_autofree gchar *nodename =3D spapr_pci_fw_dev_name(dev); > - PCIDeviceClass *pc =3D PCI_DEVICE_GET_CLASS(dev); > ResourceProps rp; > SpaprDrc *drc =3D drc_from_dev(sphb, dev); > uint32_t vendor_id =3D pci_default_read_config(dev, PCI_VENDOR_ID, 2= ); > @@ -1446,7 +1445,7 @@ static int spapr_dt_pci_device(SpaprPhbState *sphb,= PCIDevice *dev, > =20 > spapr_phb_nvgpu_populate_pcidev_dt(dev, fdt, offset, sphb); > =20 > - if (!pc->is_bridge) { > + if (!IS_PCI_BRIDGE(dev)) { > /* Properties only for non-bridges */ > uint32_t min_grant =3D pci_default_read_config(dev, PCI_MIN_GNT,= 1); > uint32_t max_latency =3D pci_default_read_config(dev, PCI_MAX_LA= T, 1); > @@ -1544,7 +1543,6 @@ static void spapr_pci_pre_plug(HotplugHandler *plug= _handler, > { > SpaprPhbState *phb =3D SPAPR_PCI_HOST_BRIDGE(DEVICE(plug_handler)); > PCIDevice *pdev =3D PCI_DEVICE(plugged_dev); > - PCIDeviceClass *pc =3D PCI_DEVICE_GET_CLASS(plugged_dev); > SpaprDrc *drc =3D drc_from_dev(phb, pdev); > PCIBus *bus =3D PCI_BUS(qdev_get_parent_bus(DEVICE(pdev))); > uint32_t slotnr =3D PCI_SLOT(pdev->devfn); > @@ -1560,7 +1558,7 @@ static void spapr_pci_pre_plug(HotplugHandler *plug= _handler, > } > } > =20 > - if (pc->is_bridge) { > + if (IS_PCI_BRIDGE(plugged_dev)) { > if (!bridge_has_valid_chassis_nr(OBJECT(plugged_dev), errp)) { > return; > } > @@ -1589,7 +1587,6 @@ static void spapr_pci_plug(HotplugHandler *plug_han= dler, > { > SpaprPhbState *phb =3D SPAPR_PCI_HOST_BRIDGE(DEVICE(plug_handler)); > PCIDevice *pdev =3D PCI_DEVICE(plugged_dev); > - PCIDeviceClass *pc =3D PCI_DEVICE_GET_CLASS(plugged_dev); > SpaprDrc *drc =3D drc_from_dev(phb, pdev); > uint32_t slotnr =3D PCI_SLOT(pdev->devfn); > =20 > @@ -1603,7 +1600,7 @@ static void spapr_pci_plug(HotplugHandler *plug_han= dler, > =20 > g_assert(drc); > =20 > - if (pc->is_bridge) { > + if (IS_PCI_BRIDGE(plugged_dev)) { > spapr_pci_bridge_plug(phb, PCI_BRIDGE(plugged_dev)); > } > =20 > @@ -1646,7 +1643,6 @@ static void spapr_pci_bridge_unplug(SpaprPhbState *= phb, > static void spapr_pci_unplug(HotplugHandler *plug_handler, > DeviceState *plugged_dev, Error **errp) > { > - PCIDeviceClass *pc =3D PCI_DEVICE_GET_CLASS(plugged_dev); > SpaprPhbState *phb =3D SPAPR_PCI_HOST_BRIDGE(DEVICE(plug_handler)); > =20 > /* some version guests do not wait for completion of a device > @@ -1661,7 +1657,7 @@ static void spapr_pci_unplug(HotplugHandler *plug_h= andler, > */ > pci_device_reset(PCI_DEVICE(plugged_dev)); > =20 > - if (pc->is_bridge) { > + if (IS_PCI_BRIDGE(plugged_dev)) { > spapr_pci_bridge_unplug(phb, PCI_BRIDGE(plugged_dev)); > return; > } > @@ -1686,7 +1682,6 @@ static void spapr_pci_unplug_request(HotplugHandler= *plug_handler, > g_assert(drc->dev =3D=3D plugged_dev); > =20 > if (!spapr_drc_unplug_requested(drc)) { > - PCIDeviceClass *pc =3D PCI_DEVICE_GET_CLASS(plugged_dev); > uint32_t slotnr =3D PCI_SLOT(pdev->devfn); > SpaprDrc *func_drc; > SpaprDrcClass *func_drck; > @@ -1694,7 +1689,7 @@ static void spapr_pci_unplug_request(HotplugHandler= *plug_handler, > int i; > uint8_t chassis =3D chassis_from_bus(pci_get_bus(pdev)); > =20 > - if (pc->is_bridge) { > + if (IS_PCI_BRIDGE(plugged_dev)) { > error_setg(errp, "PCI: Hot unplug of PCI bridges not support= ed"); > return; > }