From mboxrd@z Thu Jan 1 00:00:00 1970 Received: by 2002:a17:906:cf90:b0:9bd:85f7:2662 with SMTP id um16csp1054604ejb; Fri, 20 Oct 2023 01:07:00 -0700 (PDT) X-Google-Smtp-Source: AGHT+IGfyvLgwuLMGvTfMEGNLUlWA8HyJqSV4Fo3xtEHEKTUV3VWc0+gSOeJOIjUq9lbHXbJNiGM X-Received: by 2002:a05:620a:8e8a:b0:767:8373:a890 with SMTP id rf10-20020a05620a8e8a00b007678373a890mr831944qkn.45.1697789220022; Fri, 20 Oct 2023 01:07:00 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1697789220; cv=none; d=google.com; s=arc-20160816; b=F4hL/Ul55+3hmE+0Km9uvh7D35AHOkNWiFEPKf2k7QiDkIjkWJrlovY3wnRZf65MHc hFGJMAEnJ/Fy8bR4pGxredS7eElpdjPiy73qbNs7tmD+YvUfVwoOJbRNhJIpJJB4JB/K Y2ODyuDchaarSvw9/gGYM3uo8bGwI8rW9Oz6bmpwpRfdcdxEmte/oT+JY173leIXmkht Cvj1+gDVvOwdMm0imk5tW24t9nzB62NuQynaPErx5+/7N7uXFES5yIx353wMqVVSsuB+ pdp8xHv5tN7E3rAiB7gZBSLfS0IgstKJNtqZ4pC2wqyawaYsgn3kiVasCizhgUCBhxWZ RjzQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=sender:errors-to:list-subscribe:list-help:list-post:list-archive :list-unsubscribe:list-id:precedence:content-transfer-encoding :mime-version:references:in-reply-to:message-id:subject:cc:to:from :date; bh=m4Ga8awczG7MZCGjzDTuqAt4GFkXTsRheoKgmZb2DXg=; fh=AqS06bBI2fiG66EUFW2L1h7q+nGqVsFELILF2r+ow1A=; b=ditQ3cZOpk06m9sKys8pnnSCkmyMu8gmVss2iFYW8pVEP1WPzQBkRSi7EXepH8OHwU /qMtmmGtwI+AB9Sbbg1QN+TBm5HbuA36nyoLL1aPsmap7I11K5gNJSLlluBcOzv5EK0b OmSCOs71Xu+out3RZZ8OUAnxipSsLYwiVX7b9jKKWeoW99f38r9m90eJQo8t8n3nVV42 e3u64YfeGzvFitEIWHiLACGqcgQjovF11zvko/fmhGtk1sBYPZNBmmi4GcS/OTgaA7qA JkFv2MXZrpjdiMXTbL8nNqygLts6gsU39T30dPvfvJuKEeu5Z269yUlfhT1bgcB1FHPl XjAw== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of qemu-arm-bounces+alex.bennee=linaro.org@nongnu.org designates 209.51.188.17 as permitted sender) smtp.mailfrom="qemu-arm-bounces+alex.bennee=linaro.org@nongnu.org" Return-Path: Received: from lists.gnu.org (lists.gnu.org. [209.51.188.17]) by mx.google.com with ESMTPS id e25-20020a05620a12d900b0077431227b58si862027qkl.27.2023.10.20.01.06.59 for (version=TLS1_2 cipher=ECDHE-ECDSA-CHACHA20-POLY1305 bits=256/256); Fri, 20 Oct 2023 01:07:00 -0700 (PDT) Received-SPF: pass (google.com: domain of qemu-arm-bounces+alex.bennee=linaro.org@nongnu.org designates 209.51.188.17 as permitted sender) client-ip=209.51.188.17; Authentication-Results: mx.google.com; spf=pass (google.com: domain of qemu-arm-bounces+alex.bennee=linaro.org@nongnu.org designates 209.51.188.17 as permitted sender) smtp.mailfrom="qemu-arm-bounces+alex.bennee=linaro.org@nongnu.org" Received: from localhost ([::1] helo=lists1p.gnu.org) by lists.gnu.org with esmtp (Exim 4.90_1) (envelope-from ) id 1qtkWz-0006m8-T9; Fri, 20 Oct 2023 04:06:53 -0400 Received: from eggs.gnu.org ([2001:470:142:3::10]) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1qtkWy-0006br-G0 for qemu-arm@nongnu.org; Fri, 20 Oct 2023 04:06:52 -0400 Received: from 8.mo552.mail-out.ovh.net ([46.105.37.156]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1qtkWj-0001zJ-5p for qemu-arm@nongnu.org; Fri, 20 Oct 2023 04:06:52 -0400 Received: from mxplan5.mail.ovh.net (unknown [10.109.146.208]) by mo552.mail-out.ovh.net (Postfix) with ESMTPS id 2B2C02D3DE; Fri, 20 Oct 2023 08:06:30 +0000 (UTC) Received: from kaod.org (37.59.142.107) by DAG6EX1.mxp5.local (172.16.2.51) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256) id 15.1.2507.34; Fri, 20 Oct 2023 10:06:28 +0200 Authentication-Results: garm.ovh; auth=pass (GARM-107S001e6886de3-6b4c-417e-bc6f-1385705d3717, C3DE39B25D4A09A1EA5644DCEB8289D547B4AEB9) smtp.auth=groug@kaod.org X-OVh-ClientIp: 88.179.9.154 Date: Fri, 20 Oct 2023 10:06:26 +0200 From: Greg Kurz To: Juan Quintela CC: , Stefan Berger , Marcel Apfelbaum , , Nicholas Piggin , , Gerd Hoffmann , Corey Minyard , Samuel Thibault , Richard Henderson , David Hildenbrand , "Ilya Leoshkevich" , Fabiano Rosas , "Eric Farman" , Peter Xu , "Harsh Prateek Bora" , John Snow , , Mark Cave-Ayland , Christian Borntraeger , =?UTF-8?B?TWFyYy1BbmRy?= =?UTF-8?B?w6k=?= Lureau , Stefan Weil , , Jason Wang , Corey Minyard , Leonardo Bras , "Thomas Huth" , Peter Maydell , "Michael S. Tsirkin" , =?UTF-8?B?Q8OpZHJpYw==?= Le Goater , David Gibson , Halil Pasic , Daniel Henrique Barboza Subject: Re: [PATCH 07/13] RFC migration: icp/server is a mess Message-ID: <20231020100626.57debfa4@bahia> In-Reply-To: <875y313g4b.fsf@secure.mitica> References: <20231019190831.20363-1-quintela@redhat.com> <20231019190831.20363-8-quintela@redhat.com> <20231019233958.17abb488@bahia> <875y313g4b.fsf@secure.mitica> X-Mailer: Claws Mail 4.1.1 (GTK 3.24.38; x86_64-redhat-linux-gnu) MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit X-Originating-IP: [37.59.142.107] X-ClientProxiedBy: DAG8EX1.mxp5.local (172.16.2.71) To DAG6EX1.mxp5.local (172.16.2.51) X-Ovh-Tracer-GUID: 6ec39e93-68a1-4c19-9ab7-ca81b40e15a1 X-Ovh-Tracer-Id: 3820459861057902967 X-VR-SPAMSTATE: OK X-VR-SPAMSCORE: -100 X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvkedrjeejgdduvdegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuqfggjfdpvefjgfevmfevgfenuceurghilhhouhhtmecuhedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhepfffhvfevuffkjghfofggtgfgihesthejredtredtvdenucfhrhhomhepifhrvghgucfmuhhriicuoehgrhhouhhgsehkrghougdrohhrgheqnecuggftrfgrthhtvghrnhepgeekjedtveegkeeileffvdetvddvgedtudduiefghffhgfdvhfegjeetkeehfeeknecukfhppeduvdejrddtrddtrddupdefjedrheelrddugedvrddutdejpdekkedrudejledrledrudehgeenucevlhhushhtvghrufhiiigvpedunecurfgrrhgrmhepihhnvghtpeduvdejrddtrddtrddupdhmrghilhhfrhhomhepoehgrhhouhhgsehkrghougdrohhrgheqpdhnsggprhgtphhtthhopedupdhrtghpthhtohepqhhuihhnthgvlhgrsehrvgguhhgrthdrtghomhdpuggrvhhiugesghhisghsohhnrdgurhhophgsvggrrhdrihgurdgruhdpmhhsthesrhgvughhrghtrdgtohhmpdhpvghtvghrrdhmrgihuggvlhhlsehlihhnrghrohdrohhrghdpthhhuhhthhesrhgvughhrghtrdgtohhmpdhlvghosghrrghssehrvgguhhgrthdrtghomhdpmhhinhihrghrugesrggtmhdrohhrghdpjhgrshhofigrnhhgsehrvgguhhgrthdrtghomhdpqhgvmhhuqdgrrhhmsehnoh hnghhnuhdrohhrghdpshifseifvghilhhnvghtiidruggvpdhmrghrtggrnhgurhgvrdhluhhrvggruhesrhgvughhrghtrdgtohhmpdgsohhrnhhtrhgrvghgvghrsehlihhnuhigrdhisghmrdgtohhmpdhmrghrkhdrtggrvhgvqdgrhihlrghnugesihhlrghnuggvrdgtohdruhhkpdhqvghmuhdqsghlohgtkhesnhhonhhgnhhurdhorhhgpdhjshhnohifsehrvgguhhgrthdrtghomhdpphgrshhitgeslhhinhhugidrihgsmhdrtghomhdphhgrrhhshhhpsgeslhhinhhugidrihgsmhdrtghomhdpfhgrrhhmrghnsehlihhnuhigrdhisghmrdgtohhmpdhfrghrohhsrghssehsuhhsvgdruggvpdhiihhisehlihhnuhigrdhisghmrdgtohhmpdgurghvihgusehrvgguhhgrthdrtghomhdprhhitghhrghrugdrhhgvnhguvghrshhonheslhhinhgrrhhordhorhhgpdhsrghmuhgvlhdrthhhihgsrghulhhtsegvnhhsqdhlhihonhdrohhrghdptghmihhnhigrrhgusehmvhhishhtrgdrtghomhdpkhhrrgigvghlsehrvgguhhgrthdrtghomhdpqhgvmhhuqdhsfeeltdigsehnohhnghhnuhdrohhrghdpnhhpihhgghhinhesghhmrghilhdrtghomhdpqhgvmhhuqdhpphgtsehnohhnghhnuhdrohhrghdpmhgrrhgtvghlrdgrphhfvghlsggruhhmsehgmhgrihhlrdgtohhmpdhsthgvfhgrnhgssehlihhnuhigrdhvnhgvthdrihgsmhdrtghomhdpqhgvmhhuqdguvghvvghlsehnohhnghhnuhdrohhrghdpphgvthgvrhi gsehrvgguhhgrthdrtghomhdpuggrnhhivghlhhgsgedufeesghhmrghilhdrtghomhdpoffvtefjohhsthepmhhoheehvddpmhhouggvpehsmhhtphhouhht Received-SPF: pass client-ip=46.105.37.156; envelope-from=groug@kaod.org; helo=8.mo552.mail-out.ovh.net X-Spam_score_int: -18 X-Spam_score: -1.9 X-Spam_bar: - X-Spam_report: (-1.9 / 5.0 requ) BAYES_00=-1.9, SPF_HELO_NONE=0.001, SPF_PASS=-0.001 autolearn=unavailable autolearn_force=no X-Spam_action: no action X-BeenThere: qemu-arm@nongnu.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: qemu-arm-bounces+alex.bennee=linaro.org@nongnu.org Sender: qemu-arm-bounces+alex.bennee=linaro.org@nongnu.org X-TUID: CqWRg2/uTFtI On Fri, 20 Oct 2023 09:30:44 +0200 Juan Quintela wrote: > Greg Kurz wrote: > > On Thu, 19 Oct 2023 21:08:25 +0200 > > Juan Quintela wrote: > > > >> Current code does: > >> - register pre_2_10_vmstate_dummy_icp with "icp/server" and instance > >> dependinfg on cpu number > >> - for newer machines, it register vmstate_icp with "icp/server" name > >> and instance 0 > >> - now it unregisters "icp/server" for the 1st instance. > >> > >> This is wrong at many levels: > >> - we shouldn't have two VMSTATEDescriptions with the same name > >> - In case this is the only solution that we can came with, it needs to > >> be: > >> * register pre_2_10_vmstate_dummy_icp > >> * unregister pre_2_10_vmstate_dummy_icp > >> * register real vmstate_icp > >> > >> As the initialization of this machine is already complex enough, I > >> need help from PPC maintainers to fix this. > >> > >> Volunteers? > >> > >> CC: Cedric Le Goater > >> CC: Daniel Henrique Barboza > >> CC: David Gibson > >> CC: Greg Kurz > >> > >> Signed-off-by: Juan Quintela > >> --- > >> hw/ppc/spapr.c | 7 ++++++- > >> 1 file changed, 6 insertions(+), 1 deletion(-) > >> > >> diff --git a/hw/ppc/spapr.c b/hw/ppc/spapr.c > >> index cb840676d3..8531d13492 100644 > >> --- a/hw/ppc/spapr.c > >> +++ b/hw/ppc/spapr.c > >> @@ -143,7 +143,12 @@ static bool pre_2_10_vmstate_dummy_icp_needed(void *opaque) > >> } > >> > >> static const VMStateDescription pre_2_10_vmstate_dummy_icp = { > >> - .name = "icp/server", > >> + /* > >> + * Hack ahead. We can't have two devices with the same name and > >> + * instance id. So I rename this to pass make check. > >> + * Real help from people who knows the hardware is needed. > >> + */ > >> + .name = "pre-2.10-icp/server", > >> .version_id = 1, > >> .minimum_version_id = 1, > >> .needed = pre_2_10_vmstate_dummy_icp_needed, > > > > I guess this fix is acceptable as well and a lot simpler than > > reverting the hack actually. Outcome is the same : drop > > compat with pseries-2.9 and older. > > > > Reviewed-by: Greg Kurz > > I fully agree with you here. > The other options given on this thread is deprecate that machines, but I > would like to have this series sooner than 2 releases. Yeah and, especially, the deprecation of all these machine types is itself a massive chunk of work as it will call to identify and remove other related workarounds as well. Given that pretty much everyone working in PPC/PAPR moved away, can the community handle such a big change ? > And what ppc is > doing here is (and has always been) a hack and an abuse about how > vmstate registrations is supposed to work. > Sorry again... We should have involved migration experts at the time. :-) > Thanks, Juan. > Cheers, -- Greg