From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from aws-us-west-2-korg-lkml-1.web.codeaurora.org (localhost.localdomain [127.0.0.1]) by smtp.lore.kernel.org (Postfix) with ESMTP id D66B3C83F1B for ; Wed, 16 Jul 2025 09:05:24 +0000 (UTC) Received: from relay1-d.mail.gandi.net (relay1-d.mail.gandi.net [217.70.183.193]) by mx.groups.io with SMTP id smtpd.web10.17899.1752656723916478146 for ; Wed, 16 Jul 2025 02:05:24 -0700 Authentication-Results: mx.groups.io; dkim=pass header.i=@bootlin.com header.s=gm1 header.b=WK11v29j; spf=pass (domain: bootlin.com, ip: 217.70.183.193, mailfrom: kamel.bouhara@bootlin.com) Received: by mail.gandi.net (Postfix) with ESMTPSA id B8FB842E77; Wed, 16 Jul 2025 09:05:21 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1752656721; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=c49cctYaui/o/+zUDgB0xdHt42YMdeB8IskmdbjNF+w=; b=WK11v29jiyyV20apbJvAxy4pVXrllsKfMHzMz+Z299bDU78otj0cUBiWOxzKtfOISPj0Q3 fCoaJgsX4J4Lhvz4G+USH7wGJz/6Sdl+YIGnRF0SsRXQhywkcaCcUaKherPOUd4RB/jRXG 1K/JszkIvsGxAfZoIBJ0hkB3Q2FIvsJfy2USyiz4/c37Se7kC9S9r87Rss8B7Jtl67l2Ds eAvAsQtV5cI5f1whSY4eEtJrJWK1G5yDwfynIruNfUFk6+TEgpEekmudJKl85hIkSQUkzb yGVUosPGAvsl1vqxeuNtP6AmtHtsBsR0T0gu6Ft9UWoIwynW6LA6AAIu7sUg0Q== From: Kamel Bouhara To: openembedded-core@lists.openembedded.org Cc: JPEWhacker@gmail.com, thomas.petazzoni@bootlin.com, mathieu.dubois-briand@bootlin.com, antonin.godard@bootlin.com, Kamel Bouhara Subject: [PATCH 1/1] spdx3: Add optional kernel configuration export to build_parameter for virtual/kernel Date: Wed, 16 Jul 2025 11:05:17 +0200 Message-ID: <20250716090517.481832-2-kamel.bouhara@bootlin.com> X-Mailer: git-send-email 2.47.2 In-Reply-To: <20250716090517.481832-1-kamel.bouhara@bootlin.com> References: <20250716090517.481832-1-kamel.bouhara@bootlin.com> MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-GND-State: clean X-GND-Score: 0 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtdefgdehjeeftdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfitefpfffkpdcuggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucenucfjughrpefhvfevufffkffojghfgggtgfesthekredtredtjeenucfhrhhomhepmfgrmhgvlhcuuehouhhhrghrrgcuoehkrghmvghlrdgsohhuhhgrrhgrsegsohhothhlihhnrdgtohhmqeenucggtffrrghtthgvrhhnpeehudfhieeltdetuedvvdeuvdetfeeuuddvkeeltdeuheevfeehteekvedvledtfeenucfkphepkeekrdduiedtrddvvddvrddvvdelnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepkeekrdduiedtrddvvddvrddvvdelpdhhvghloheplhhotggrlhhhohhsthdpmhgrihhlfhhrohhmpehkrghmvghlrdgsohhuhhgrrhgrsegsohhothhlihhnrdgtohhmpdhnsggprhgtphhtthhopeeipdhrtghpthhtohepohhpvghnvghmsggvugguvgguqdgtohhrvgeslhhishhtshdrohhpvghnvghmsggvugguvggurdhorhhgpdhrtghpthhtoheplffrgfghhhgrtghkvghrsehgmhgrihhlrdgtohhmpdhrtghpthhtohepthhhohhmrghsrdhpvghtrgiiiihonhhisegsohhothhlihhnrdgtohhmpdhrtghpthhtohepmhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomhdprhgtphhtthhopegrnhhtohhnihhnr dhgohgurghrugessghoohhtlhhinhdrtghomhdprhgtphhtthhopehkrghmvghlrdgsohhuhhgrrhgrsegsohhothhlihhnrdgtohhm X-GND-Sasl: kamel.bouhara@bootlin.com List-Id: X-Webhook-Received: from li982-79.members.linode.com [45.33.32.79] by aws-us-west-2-korg-lkml-1.web.codeaurora.org with HTTPS for ; Wed, 16 Jul 2025 09:05:24 -0000 X-Groupsio-URL: https://lists.openembedded.org/g/openembedded-core/message/220439 Enhances SPDX Document by extracting kernel build-time configuration settings from '${B}/.config'. Each CONFIG_* line is parsed and exported as a DictionaryEntry in the build_Build.build_parameter section of the SPDX document. This provides better visibility into kernel build behavior and configuration, in alignment with the SPDX3 metadata model. The feature is gated by a new tunable variable: SPDX_INCLUDE_KERNEL_CONFIG (default: "1") Setting this to "0" disables exporting the kernel configuration, which may be useful to improve performance or reduce the size of generated SPDX documents. Example: CONFIG_FOO=y → { key: "CONFIG_FOO", value: "y" } This complements existing metadata export features and enables a more complete audit trail of how the kernel is built within a given build. Signed-off-by: Kamel Bouhara --- meta/classes/create-spdx-3.0.bbclass | 6 ++++++ meta/lib/oe/spdx30_tasks.py | 32 ++++++++++++++++++++++++++++ 2 files changed, 38 insertions(+) diff --git a/meta/classes/create-spdx-3.0.bbclass b/meta/classes/create-spdx-3.0.bbclass index c0a5436ad6..cdb9422f37 100644 --- a/meta/classes/create-spdx-3.0.bbclass +++ b/meta/classes/create-spdx-3.0.bbclass @@ -50,6 +50,12 @@ SPDX_INCLUDE_TIMESTAMPS[doc] = "Include time stamps in SPDX output. This is \ useful if you want to know when artifacts were produced and when builds \ occurred, but will result in non-reproducible SPDX output" +SPDX_INCLUDE_KERNEL_CONFIG ??= "1" +SPDX_INCLUDE_KERNEL_CONFIG[doc] = "If set to '1', the .config file for the kernel will be parsed \ +and each CONFIG_* value will be included in the Build.build_parameter list as DictionaryEntry \ +items. Set to '0' to disable exporting kernel configuration to improve performance or reduce \ +SPDX document size." + SPDX_IMPORTS ??= "" SPDX_IMPORTS[doc] = "SPDX_IMPORTS is the base variable that describes how to \ reference external SPDX ids. Each import is defined as a key in this \ diff --git a/meta/lib/oe/spdx30_tasks.py b/meta/lib/oe/spdx30_tasks.py index c352dab152..f87d079cb0 100644 --- a/meta/lib/oe/spdx30_tasks.py +++ b/meta/lib/oe/spdx30_tasks.py @@ -18,6 +18,28 @@ from contextlib import contextmanager from datetime import datetime, timezone from pathlib import Path +def parse_kernel_config(config_path): + entries = [] + if not os.path.exists(config_path): + bb.warn(f"Kernel config file not found at: {config_path}") + return entries + + try: + with open(config_path, 'r') as f: + for line in f: + line = line.strip() + if not line or line.startswith("#"): + continue + if "=" in line: + key, value = line.split("=", 1) + entries.append(oe.spdx30.DictionaryEntry( + key=key, + value=value.strip('"') + )) + bb.note(f"Parsed {len(entries)} kernel config entries from {config_path}") + except Exception as e: + bb.error(f"Failed to parse kernel config file: {e}") + return entries def walk_error(err): bb.error(f"ERROR walking {err.filename}: {err}") @@ -495,6 +517,8 @@ def create_spdx(d): build_objset.doc.rootElement.append(build) + build.build_parameter = [] + build_objset.set_is_native(is_native) for var in (d.getVar("SPDX_CUSTOM_ANNOTATION_VARS") or "").split(): @@ -815,6 +839,14 @@ def create_spdx(d): sorted(list(build_inputs)) + sorted(list(debug_source_ids)), ) + if d.getVar("SPDX_INCLUDE_KERNEL_CONFIG", True) != "0": + if "virtual/kernel" in (d.getVar("PROVIDES") or "").split(): + bb.note("Detected virtual/kernel provider, extracting kernel configuration") + config_path = d.expand("${B}/.config") + kernel_params = parse_kernel_config(config_path) + if kernel_params: + build.build_parameter.extend(kernel_params) + oe.sbom30.write_recipe_jsonld_doc(d, build_objset, "recipes", deploydir) -- 2.43.0