From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: Received: by yocto-www.yoctoproject.org (Postfix, from userid 118) id 34D74E00C1D; Sat, 5 Mar 2016 06:05:56 -0800 (PST) X-Spam-Checker-Version: SpamAssassin 3.3.1 (2010-03-16) on yocto-www.yoctoproject.org X-Spam-Level: X-Spam-Status: No, score=-2.7 required=5.0 tests=BAYES_00,DKIM_SIGNED, DKIM_VALID,DKIM_VALID_AU,FREEMAIL_FROM,HTML_MESSAGE,RCVD_IN_DNSWL_LOW autolearn=ham version=3.3.1 X-Spam-HAM-Report: * 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider * (idealsim[at]laposte.net) * -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low * trust * [178.22.154.199 listed in list.dnswl.org] * -1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1% * [score: 0.0000] * 0.0 HTML_MESSAGE BODY: HTML included in message * -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's * domain * 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily * valid * -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature Received: from smtp.laposte.net (smtpoutz299.laposte.net [178.22.154.199]) by yocto-www.yoctoproject.org (Postfix) with ESMTP id 7467FE00BE2 for ; Sat, 5 Mar 2016 06:05:53 -0800 (PST) Received: from smtp.laposte.net (localhost [127.0.0.1]) by lpn-prd-vrout011 (Postfix) with ESMTP id F1836528997 for ; Sat, 5 Mar 2016 15:05:51 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=laposte.net; s=mail1; t=1457186751; bh=bTuETMNgPE8rQAQqRizsju9s4UOQbV9kb20wwLV8HG4=; h=To:From:Subject:Date; b=GzqBaCM9P5CWVNsQYzup1Co3nSgSzu58/YwZVnyErcdJqzNbvT+LeMebzXNMUMTkn Ihq7Mv2tzOKcvsyINzgirmUhumst0u6h4BXHFe1VIFzpyJO/rytuGg7mRDgxeS9nFa 3lBsTcCcOHDH0/LbA4/1VPxNa3+yOUQeDsdbfWDUz6a4ChDWAxXafqqVfleddGEpVC HSosClA3BfOwuj+yvG5h405Yrj+yraADSHGZeFzXr1BrrW5eZRZiKoA0b9kML97tPY DVh0oBSy6iSnBLpmTtfcjz2m5P7P0EmuyUMl01BAK2AfZnd2CZbSJJ48xmwT3Z0H9s 7fg1lZq0PueTA== Received: from lpn-prd-vrin003 (lpn-prd-vrin003.laposte [10.128.63.4]) by lpn-prd-vrout011 (Postfix) with ESMTP id E80BD528777 for ; Sat, 5 Mar 2016 15:05:51 +0100 (CET) Received: from lpn-prd-vrin003 (localhost [127.0.0.1]) by lpn-prd-vrin003 (Postfix) with ESMTP id DA06748C35A for ; Sat, 5 Mar 2016 15:05:51 +0100 (CET) Received: from [192.168.1.45] (ARennes-654-1-163-28.w92-139.abo.wanadoo.fr [92.139.122.28]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (No client certificate requested) by lpn-prd-vrin003 (Postfix) with ESMTPSA id A545848C353 for ; Sat, 5 Mar 2016 15:05:51 +0100 (CET) To: "meta-freescale@yoctoproject.org" From: idealsim Message-ID: <56DAE7BF.5090902@laposte.net> Date: Sat, 5 Mar 2016 15:05:51 +0100 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:38.0) Gecko/20100101 Thunderbird/38.5.1 MIME-Version: 1.0 X-VR-SrcIP: 92.139.122.28 X-VR-FullState: 0 X-VR-Score: 0 X-VR-Cause-1: gggruggvucftvghtrhhoucdtuddrfeekjedrjeekgdefiecutefuodetggdotefrodftvfcurfhrohhf X-VR-Cause-2: ihhlvgemucfntefrqffuvffgnecuuegrihhlohhuthemucehtddtnecunecujfgurhepvffhuffkffgf X-VR-Cause-3: gggtsegrtdgrrgdtfeejnecuhfhrohhmpehiuggvrghlshhimhcuoehiuggvrghlshhimheslhgrphho X-VR-Cause-4: shhtvgdrnhgvtheqnecuffhomhgrihhnpehgihhthhhusgdrtghomhenucfkphepledvrddufeelrddu X-VR-Cause-5: vddvrddvkeenucfrrghrrghmpehmohguvgepshhmthhpohhuthdphhgvlhhopegludelvddrudeikedr X-VR-Cause-6: uddrgeehngdpihhnvghtpeelvddrudefledruddvvddrvdekpdhmrghilhhfrhhomhepihguvggrlhhs X-VR-Cause-7: ihhmsehlrghpohhsthgvrdhnvghtpdhrtghpthhtohepmhgvthgrqdhfrhgvvghstggrlhgvseihohgt X-VR-Cause-8: thhophhrohhjvggtthdrohhrgh X-VR-AvState: No X-VR-State: 0 Subject: yocto 2.0.1 M2Crypto issue X-BeenThere: meta-freescale@yoctoproject.org X-Mailman-Version: 2.1.13 Precedence: list List-Id: Usage and development list for the meta-fsl-* layers List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 05 Mar 2016 14:05:56 -0000 Content-Type: multipart/alternative; boundary="------------050000050808040708020504" --------------050000050808040708020504 Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit Hi, i'm trying to rebuild an image that worked before i made a repo sync, now i have this error after a bitbake : /ERROR: oe_runmake failed// //ERROR: Function failed: do_compile (log file is located at /media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/crda/3.18-r0/temp/log.do_compile.32621)// //ERROR: Logfile of failure stored in: /media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/crda/3.18-r0/temp/log.do_compile.32621// //Log data follows:// //| DEBUG: Executing shell function do_compile// //| NOTE: make -j 4 MAKEFLAGS= DESTDIR=/media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/crda/3.18-r0/image LIBDIR=/usr/lib/crda LDLIBREG=-Wl,-rpath,/usr/lib/crda -lreg all_noverify// //| GEN keys-gcrypt.c// //| Trusted pubkeys: pubkeys/linville.key.pub.pem pubkeys/sforshee.key.pub.pem// //| ERROR: Failed to import the "M2Crypto" module: /media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/sysroots/x86_64-linux/usr/lib/python2.7/site-packages/M2Crypto/__m2crypto.so: undefined symbol: SSLv2_method// //| Please install the "M2Crypto" Python module.// //| On Debian GNU/Linux the package is called "python-m2crypto".// //| Makefile:113: recipe for target 'keys-gcrypt.c' failed// //| make: *** [keys-gcrypt.c] Error 1// //| WARNING: exit code 1 from a shell command.// //| ERROR: oe_runmake failed// //| ERROR: Function failed: do_compile (log file is located at /media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/crda/3.18-r0/temp/log.do_compile.32621)// //ERROR: Task 4633 (/media/modjo/data1TO/yocto/seco/udoo-community-bsp/sources/meta-openembedded/meta-networking/recipes-connectivity/crda/crda_3.18.bb, do_compile) failed with exit code '1'/ This image is for udoo neo and i use this layer : https://github.com/graugans/meta-udoo (build for qt5.5.1 jethro) Do you have an idea how to resolve this issue ? Mickaël. --------------050000050808040708020504 Content-Type: text/html; charset=utf-8 Content-Transfer-Encoding: 8bit Hi, i'm trying to rebuild an image that worked before i made a repo sync, now i have this error after a bitbake :

ERROR: oe_runmake failed
ERROR: Function failed: do_compile (log file is located at /media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/crda/3.18-r0/temp/log.do_compile.32621)
ERROR: Logfile of failure stored in: /media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/crda/3.18-r0/temp/log.do_compile.32621
Log data follows:
| DEBUG: Executing shell function do_compile
| NOTE: make -j 4 MAKEFLAGS= DESTDIR=/media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/crda/3.18-r0/image LIBDIR=/usr/lib/crda LDLIBREG=-Wl,-rpath,/usr/lib/crda -lreg all_noverify
|   GEN  keys-gcrypt.c
|   Trusted pubkeys: pubkeys/linville.key.pub.pem pubkeys/sforshee.key.pub.pem
| ERROR: Failed to import the "M2Crypto" module: /media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/sysroots/x86_64-linux/usr/lib/python2.7/site-packages/M2Crypto/__m2crypto.so: undefined symbol: SSLv2_method
| Please install the "M2Crypto" Python module.
| On Debian GNU/Linux the package is called "python-m2crypto".
| Makefile:113: recipe for target 'keys-gcrypt.c' failed
| make: *** [keys-gcrypt.c] Error 1
| WARNING: exit code 1 from a shell command.
| ERROR: oe_runmake failed
| ERROR: Function failed: do_compile (log file is located at /media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/crda/3.18-r0/temp/log.do_compile.32621)
ERROR: Task 4633 (/media/modjo/data1TO/yocto/seco/udoo-community-bsp/sources/meta-openembedded/meta-networking/recipes-connectivity/crda/crda_3.18.bb, do_compile) failed with exit code '1'

This image is for udoo neo and i use this layer : https://github.com/graugans/meta-udoo (build for qt5.5.1 jethro)

Do you have an idea how to resolve this issue ?

Mickaël.
--------------050000050808040708020504--