From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: Received: by yocto-www.yoctoproject.org (Postfix, from userid 118) id B8913E00B37; Wed, 16 Mar 2016 07:20:35 -0700 (PDT) X-Spam-Checker-Version: SpamAssassin 3.3.1 (2010-03-16) on yocto-www.yoctoproject.org X-Spam-Level: X-Spam-Status: No, score=-2.7 required=5.0 tests=BAYES_00,DKIM_SIGNED, DKIM_VALID, DKIM_VALID_AU, FREEMAIL_FROM, RCVD_IN_DNSWL_LOW autolearn=ham version=3.3.1 X-Spam-HAM-Report: * 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider * (idealsim[at]laposte.net) * -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low * trust * [194.117.213.102 listed in list.dnswl.org] * -1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1% * [score: 0.0000] * -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's * domain * 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily * valid * -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature X-Greylist: delayed 1366 seconds by postgrey-1.32 at yocto-www; Wed, 16 Mar 2016 07:20:28 PDT Received: from smtp.laposte.net (smtpoutz27.laposte.net [194.117.213.102]) by yocto-www.yoctoproject.org (Postfix) with ESMTP id 3E24AE00872 for ; Wed, 16 Mar 2016 07:20:28 -0700 (PDT) Received: from smtp.laposte.net (localhost [127.0.0.1]) by lpn-prd-vrout015 (Postfix) with ESMTP id 639F41C78EC for ; Wed, 16 Mar 2016 14:57:40 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=laposte.net; s=mail1; t=1458136660; bh=F9U+wFHlXKH0IUwODTGyXHQ8INcuyENgflDPRZ7IO18=; h=Subject:To:References:Cc:From:Date:In-Reply-To; b=WJtCM39bqKFz/X8rzPwe+ONPzTkw9pHn8y+BcAuJYREDpXE42Mcy5gyK/95O6eQJG OP38vZYBr35+TFm3SBrXg1gyscAgHS9EWcOq8H4Ln74Z/n0XNrIA3i5Dc8Aw28dmuU TaaDMFymHAoG8utCQ99nStCWkXQJozMBz1gtaah7uRJXEvKRb5/TZ8D3CnATVh67+L 6q6fESIYl1WywzPkLETnflkBdsZnsHavYiA2jlWkLJttwPga9c2AjG7plAK6nJ1Dcx CkzBcw5Yz25A8IaTO/VjXqCFFoI8mfSvE24+F2UGYoKCZYvvV9wtI7Hfc+cUrgXXrp kpbAPN47dwNtA== Received: from lpn-prd-vrin003 (lpn-prd-vrin003.laposte [10.128.63.4]) by lpn-prd-vrout015 (Postfix) with ESMTP id AA6B41C7925 for ; Wed, 16 Mar 2016 14:57:36 +0100 (CET) Received: from lpn-prd-vrin003 (localhost [127.0.0.1]) by lpn-prd-vrin003 (Postfix) with ESMTP id 9700B48C3B5 for ; Wed, 16 Mar 2016 14:57:36 +0100 (CET) Received: from [192.168.1.45] (ARennes-654-1-161-212.w92-139.abo.wanadoo.fr [92.139.120.212]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (No client certificate requested) by lpn-prd-vrin003 (Postfix) with ESMTPSA id 6264848C3A9; Wed, 16 Mar 2016 14:57:36 +0100 (CET) To: Christian Ege References: <56E913A0.2030603@laposte.net> From: idealsim Message-ID: <56E9664F.8000505@laposte.net> Date: Wed, 16 Mar 2016 14:57:35 +0100 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:38.0) Gecko/20100101 Thunderbird/38.5.1 MIME-Version: 1.0 In-Reply-To: X-VR-SrcIP: 92.139.120.212 X-VR-FullState: 0 X-VR-Score: -100 X-VR-Cause-1: gggruggvucftvghtrhhoucdtuddrfeekkedrtddvgdehjecutefuodetggdotefrodftvfcurfhrohhf X-VR-Cause-2: ihhlvgemucfntefrqffuvffgnecuuegrihhlohhuthemucehtddtnecusecvtfgvtghiphhivghnthhs X-VR-Cause-3: ucdlqddutddtmdenucfjughrpefuvfhfhffkffgfgggjtgfgsehtkegrtddtfeejnecuhfhrohhmpehi X-VR-Cause-4: uggvrghlshhimhcuoehiuggvrghlshhimheslhgrphhoshhtvgdrnhgvtheqnecuffhomhgrihhnpeih X-VR-Cause-5: ohgtthhophhrohhjvggtthdrohhrghdpghhithhhuhgsrdgtohhmnecukfhppeelvddrudefledruddv X-VR-Cause-6: tddrvdduvdenucfrrghrrghmpehmohguvgepshhmthhpohhuthdphhgvlhhopegludelvddrudeikedr X-VR-Cause-7: uddrgeehngdpihhnvghtpeelvddrudefledruddvtddrvdduvddpmhgrihhlfhhrohhmpehiuggvrghl X-VR-Cause-8: shhimheslhgrphhoshhtvgdrnhgvthdprhgtphhtthhopehkgedvfedtrheisehgmhgrihhlrdgtohhm X-VR-AvState: No X-VR-State: 0 Cc: Yocto list discussion Subject: Re: Qt5.6 new modules X-BeenThere: yocto@yoctoproject.org X-Mailman-Version: 2.1.13 Precedence: list List-Id: Discussion of all things Yocto Project List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 16 Mar 2016 14:20:35 -0000 Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit Thanks for the tip. I will try it out and let you know ... Regards, Mickaël Le 16/03/2016 10:17, Christian Ege a écrit : > Hi,, > > 2016-03-16 9:04 GMT+01:00 idealsim : >> Hi, we have build an image for udoo neo from meta-qt5 jansa/master-5.6 and >> works fine (thanks to Christian Ege ). The problem is that I'm looking for >> https://github.com/qtproject/qtquickcontrols2 and >> https://github.com/qtproject/qtserialbus. My question is how we can add this >> modules to our build ? I add this to our local.conf : >> >> "qtquickcontrols2 \ >> qtserialbus \ >> " >> But this modules don't have buildable providers ! If someone can help to >> said me how to proceed ... > You can try to add a meta-qt5/recipes-qt/qt5/qtserialbus_git.bb and > take for example meta-qt5/recipes-qt/qt5/qtsensors_git.bb as reference > > require qt5.inc > require qt5-git.inc > # There are no LGPLv3-only licensed files in this component. > # There are no GPLv2 licensed files in this component. > LICENSE = "GFDL-1.3 & BSD & (LGPL-2.1 & > The-Qt-Company-Qt-LGPL-Exception-1.1 | LGPL-3.0)" > LIC_FILES_CHKSUM = " \ > file://LICENSE.LGPLv21;md5=58a180e1cf84c756c29f782b3a485c29 \ > file://LICENSE.LGPLv3;md5=b8c75190712063cde04e1f41b6fdad98 \ > file://LICENSE.GPLv3;md5=40f9bf30e783ddc201497165dfb32afb \ > file://LGPL_EXCEPTION.txt;md5=9625233da42f9e0ce9d63651a9d97654 \ > file://LICENSE.FDL;md5=6d9f2a9af4c8b8c3c769f6cc1b6aaf7e \ > file://LICENSE.GPLv2;md5=05832301944453ec79e40ba3c3cfceec \ > " > DEPENDS += "qtbase" > > SRCREV = "71a323e1f12df8d213a4052621027e223eb5a343" > > The configure step will bail out due to the fact that you have wrong > checksums but it will show you the right ones > > Best, > Christian > > >> regards, >> >> Mickael >> >> >> -- >> _______________________________________________ >> yocto mailing list >> yocto@yoctoproject.org >> https://lists.yoctoproject.org/listinfo/yocto > >