From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: Received: by yocto-www.yoctoproject.org (Postfix, from userid 118) id E319FE00C23; Thu, 17 Mar 2016 09:16:40 -0700 (PDT) X-Spam-Checker-Version: SpamAssassin 3.3.1 (2010-03-16) on yocto-www.yoctoproject.org X-Spam-Level: X-Spam-Status: No, score=-2.7 required=5.0 tests=BAYES_00,DKIM_SIGNED, DKIM_VALID,DKIM_VALID_AU,FREEMAIL_FROM,HTML_MESSAGE,RCVD_IN_DNSWL_LOW autolearn=ham version=3.3.1 X-Spam-HAM-Report: * 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider * (idealsim[at]laposte.net) * -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low * trust * [194.117.213.103 listed in list.dnswl.org] * -1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1% * [score: 0.0000] * 0.0 HTML_MESSAGE BODY: HTML included in message * -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's * domain * 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily * valid * -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature Received: from smtp.laposte.net (smtpoutz28.laposte.net [194.117.213.103]) by yocto-www.yoctoproject.org (Postfix) with ESMTP id 5EB96E00929 for ; Thu, 17 Mar 2016 09:16:35 -0700 (PDT) Received: from smtp.laposte.net (localhost [127.0.0.1]) by lpn-prd-vrout016 (Postfix) with ESMTP id 1ED51111CA5 for ; Thu, 17 Mar 2016 17:16:34 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=laposte.net; s=mail1; t=1458231394; bh=yXLoapLKMqGNeKFbySArPkkEC0URu8IKZ/sJf2qmMlQ=; h=Subject:To:References:Cc:From:Date:In-Reply-To; b=aDwP07TVtbbfXQuDaxYKfYl6jW/oKkDTFuNmcRdyto50rAY+GuzFIyL48kl/cJzfO WxZAvO7L5kYfIUrn9TcannWt9MCmpl35qT3w5r40su9Wo/tu1tGNRVEHozHCbqOz3S U5J7SO5+xnaAePMWLFJt+OAL2Yd0CdvDeQGO/4ejz2MKMi+vNAN3qUCVu3mJpK/jsX VZTx/AT5nIC4gAZ6q+FhZfQAYesrTCWOP1z36kasUvLf6eP3ziSUTbbTtQc3zCYLji 8Df6iKcM0y2g2r3m9EAZcFbqztCEaRLPOep9ONjUT4wdAzgbo4fEmXaQrYvW7waHUy zw3wF+cxgKiAQ== Received: from lpn-prd-vrin003 (lpn-prd-vrin003.laposte [10.128.63.4]) by lpn-prd-vrout016 (Postfix) with ESMTP id 1AFA2111C63 for ; Thu, 17 Mar 2016 17:16:34 +0100 (CET) Received: from lpn-prd-vrin003 (localhost [127.0.0.1]) by lpn-prd-vrin003 (Postfix) with ESMTP id 048F048C3B2 for ; Thu, 17 Mar 2016 17:16:34 +0100 (CET) Received: from [192.168.1.45] (ARennes-654-1-161-212.w92-139.abo.wanadoo.fr [92.139.120.212]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (No client certificate requested) by lpn-prd-vrin003 (Postfix) with ESMTPSA id 9DF1E48C386; Thu, 17 Mar 2016 17:16:33 +0100 (CET) To: Christian Ege References: <56E913A0.2030603@laposte.net> <56E9664F.8000505@laposte.net> From: idealsim Message-ID: <56EAD860.4000306@laposte.net> Date: Thu, 17 Mar 2016 17:16:32 +0100 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:38.0) Gecko/20100101 Thunderbird/38.6.0 MIME-Version: 1.0 In-Reply-To: <56E9664F.8000505@laposte.net> X-VR-SrcIP: 92.139.120.212 X-VR-FullState: 0 X-VR-Score: -100 X-VR-Cause-1: gggruggvucftvghtrhhoucdtuddrfeekkedrtdeggdekudcutefuodetggdotefrodftvfcurfhrohhf X-VR-Cause-2: ihhlvgemucfntefrqffuvffgnecuuegrihhlohhuthemucehtddtnecusecvtfgvtghiphhivghnthhs X-VR-Cause-3: ucdlqddutddtmdenucfjughrpefuvfhfhffkffgfgggjtgesrgdtrggrtdefjeenucfhrhhomhepihgu X-VR-Cause-4: vggrlhhsihhmuceoihguvggrlhhsihhmsehlrghpohhsthgvrdhnvghtqeenucffohhmrghinhephiho X-VR-Cause-5: tghtohhprhhojhgvtghtrdhorhhgpdhgihhthhhusgdrtghomhenucfkphepledvrddufeelrdduvddt X-VR-Cause-6: rddvuddvnecurfgrrhgrmhepmhhouggvpehsmhhtphhouhhtpdhhvghloheplgduledvrdduieekrddu X-VR-Cause-7: rdeghegnpdhinhgvthepledvrddufeelrdduvddtrddvuddvpdhmrghilhhfrhhomhepihguvggrlhhs X-VR-Cause-8: ihhmsehlrghpohhsthgvrdhnvghtpdhrtghpthhtohepkhegvdeftdhrieesghhmrghilhdrtghomh X-VR-AvState: No X-VR-State: 0 Cc: Yocto list discussion Subject: Re: Re: Qt5.6 new modules X-BeenThere: yocto@yoctoproject.org X-Mailman-Version: 2.1.13 Precedence: list List-Id: Discussion of all things Yocto Project List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 17 Mar 2016 16:16:41 -0000 Content-Type: multipart/alternative; boundary="------------020505080600070509080505" --------------020505080600070509080505 Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit Hi, i have started a build of the image this master Branch, like you said i have an error on qtserialbus : /WARNING: Failed to fetch URL git://github.com/qtproject/qtserialbus.git;name=qtserialbus;branch=5.6;protocol=git, attempting MIRRORS if available// //ERROR: Fetcher failure: Unable to find revision 6a16281aceedb713676e16c3074e6f7ea1e70b79 in branch 5.6 even from upstream// //ERROR: Function failed: Fetcher failure for URL: 'git://github.com/qtproject/qtserialbus.git;name=qtserialbus;branch=5.6;protocol=git'. Unable to fetch URL from any source.// //ERROR: Logfile of failure stored in: /media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/qtserialbus/5.5.99+5.6.0-rc+gitAUTOINC+6a16281ace-r0/temp/log.do_fetch.5862// //ERROR: Task 894 (/media/modjo/data1TO/yocto/seco/udoo-community-bsp/sources/meta-qt5/recipes-qt/qt5/qtserialbus_git.bb, do_fetch) failed with exit code '1'/ This is my /qtserialbus_git.bb : //require qt5.inc// //require qt5-git.inc// // //# There are no LGPLv3-only licensed files in this component.// //# There are no GPLv2 licensed files in this component.// //LICENSE = "GFDL-1.3 & BSD & (LGPL-2.1 & The-Qt-Company-Qt-LGPL-Exception-1.1 | LGPL-3.0)"// //LIC_FILES_CHKSUM = " \// //file://LICENSE.LGPLv3;md5=b8c75190712063cde04e1f41b6fdad98 \// //file://LICENSE.GPLv3;md5=40f9bf30e783ddc201497165dfb32afb \// // file://LICENSE.FDL;md5=6d9f2a9af4c8b8c3c769f6cc1b6aaf7e \// //file://LICENSE.GPLv2;md5=05832301944453ec79e40ba3c3cfceec \// //"// // //DEPENDS += "qtbase qtserialport"// // //SRCREV = "6a16281aceedb713676e16c3074e6f7ea1e70b79"// /An idea is welcome ! Regards, Mickaël Le 16/03/2016 14:57, idealsim a écrit : > Thanks for the tip. I will try it out and let you know ... > > Regards, > > Mickaël > > Le 16/03/2016 10:17, Christian Ege a écrit : >> Hi,, >> >> 2016-03-16 9:04 GMT+01:00 idealsim : >>> Hi, we have build an image for udoo neo from meta-qt5 >>> jansa/master-5.6 and >>> works fine (thanks to Christian Ege ). The problem is that I'm >>> looking for >>> https://github.com/qtproject/qtquickcontrols2 and >>> https://github.com/qtproject/qtserialbus. My question is how we can >>> add this >>> modules to our build ? I add this to our local.conf : >>> >>> "qtquickcontrols2 \ >>> qtserialbus \ >>> " >>> But this modules don't have buildable providers ! If someone can >>> help to >>> said me how to proceed ... >> You can try to add a meta-qt5/recipes-qt/qt5/qtserialbus_git.bb and >> take for example meta-qt5/recipes-qt/qt5/qtsensors_git.bb as reference >> >> require qt5.inc >> require qt5-git.inc >> # There are no LGPLv3-only licensed files in this component. >> # There are no GPLv2 licensed files in this component. >> LICENSE = "GFDL-1.3 & BSD & (LGPL-2.1 & >> The-Qt-Company-Qt-LGPL-Exception-1.1 | LGPL-3.0)" >> LIC_FILES_CHKSUM = " \ >> file://LICENSE.LGPLv21;md5=58a180e1cf84c756c29f782b3a485c29 \ >> file://LICENSE.LGPLv3;md5=b8c75190712063cde04e1f41b6fdad98 \ >> file://LICENSE.GPLv3;md5=40f9bf30e783ddc201497165dfb32afb \ >> file://LGPL_EXCEPTION.txt;md5=9625233da42f9e0ce9d63651a9d97654 \ >> file://LICENSE.FDL;md5=6d9f2a9af4c8b8c3c769f6cc1b6aaf7e \ >> file://LICENSE.GPLv2;md5=05832301944453ec79e40ba3c3cfceec \ >> " >> DEPENDS += "qtbase" >> >> SRCREV = "71a323e1f12df8d213a4052621027e223eb5a343" >> >> The configure step will bail out due to the fact that you have wrong >> checksums but it will show you the right ones >> >> Best, >> Christian >> >> >>> regards, >>> >>> Mickael >>> >>> >>> -- >>> _______________________________________________ >>> yocto mailing list >>> yocto@yoctoproject.org >>> https://lists.yoctoproject.org/listinfo/yocto >> >> > --------------020505080600070509080505 Content-Type: text/html; charset=utf-8 Content-Transfer-Encoding: 8bit Hi, i have started a build of the image this master Branch, like you said i have an error on qtserialbus :

WARNING: Failed to fetch URL git://github.com/qtproject/qtserialbus.git;name=qtserialbus;branch=5.6;protocol=git, attempting MIRRORS if available
ERROR: Fetcher failure: Unable to find revision 6a16281aceedb713676e16c3074e6f7ea1e70b79 in branch 5.6 even from upstream
ERROR: Function failed: Fetcher failure for URL: 'git://github.com/qtproject/qtserialbus.git;name=qtserialbus;branch=5.6;protocol=git'. Unable to fetch URL from any source.
ERROR: Logfile of failure stored in: /media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/qtserialbus/5.5.99+5.6.0-rc+gitAUTOINC+6a16281ace-r0/temp/log.do_fetch.5862
ERROR: Task 894 (/media/modjo/data1TO/yocto/seco/udoo-community-bsp/sources/meta-qt5/recipes-qt/qt5/qtserialbus_git.bb, do_fetch) failed with exit code '1'

This is my qtserialbus_git.bb :

require qt5.inc
require qt5-git.inc

# There are no LGPLv3-only licensed files in this component.
# There are no GPLv2 licensed files in this component.
LICENSE = "GFDL-1.3 & BSD & (LGPL-2.1 & The-Qt-Company-Qt-LGPL-Exception-1.1 | LGPL-3.0)"
LIC_FILES_CHKSUM = " \
    file://LICENSE.LGPLv3;md5=b8c75190712063cde04e1f41b6fdad98 \
    file://LICENSE.GPLv3;md5=40f9bf30e783ddc201497165dfb32afb \
    file://LICENSE.FDL;md5=6d9f2a9af4c8b8c3c769f6cc1b6aaf7e \
    file://LICENSE.GPLv2;md5=05832301944453ec79e40ba3c3cfceec \
"

DEPENDS += "qtbase qtserialport"

SRCREV = "6a16281aceedb713676e16c3074e6f7ea1e70b79"

An idea is welcome !

Regards,

Mickaël



Le 16/03/2016 14:57, idealsim a écrit :
Thanks for the tip. I will try it out and let you know ...

Regards,

Mickaël

Le 16/03/2016 10:17, Christian Ege a écrit :
Hi,,

2016-03-16 9:04 GMT+01:00 idealsim <idealsim@laposte.net>:
Hi, we have build an image for udoo neo from meta-qt5 jansa/master-5.6 and
works fine (thanks to Christian Ege ). The problem is that I'm looking for
https://github.com/qtproject/qtquickcontrols2 and
https://github.com/qtproject/qtserialbus. My question is how we can add this
modules to our build ?  I add this to our local.conf :

     "qtquickcontrols2 \
      qtserialbus \
     "
But this modules don't have buildable providers ! If someone can help to
said me how to proceed ...
You can try to add a meta-qt5/recipes-qt/qt5/qtserialbus_git.bb and
take for example meta-qt5/recipes-qt/qt5/qtsensors_git.bb as reference

require qt5.inc
require qt5-git.inc
# There are no LGPLv3-only licensed files in this component.
# There are no GPLv2 licensed files in this component.
LICENSE = "GFDL-1.3 & BSD & (LGPL-2.1 &
The-Qt-Company-Qt-LGPL-Exception-1.1 | LGPL-3.0)"
LIC_FILES_CHKSUM = " \
file://LICENSE.LGPLv21;md5=58a180e1cf84c756c29f782b3a485c29 \
file://LICENSE.LGPLv3;md5=b8c75190712063cde04e1f41b6fdad98 \
file://LICENSE.GPLv3;md5=40f9bf30e783ddc201497165dfb32afb \
file://LGPL_EXCEPTION.txt;md5=9625233da42f9e0ce9d63651a9d97654 \
file://LICENSE.FDL;md5=6d9f2a9af4c8b8c3c769f6cc1b6aaf7e \
file://LICENSE.GPLv2;md5=05832301944453ec79e40ba3c3cfceec \
"
DEPENDS += "qtbase"

SRCREV = "71a323e1f12df8d213a4052621027e223eb5a343"

The configure step will bail out due to the fact that you have wrong
checksums but it will show you the right ones

Best,
Christian


regards,

Mickael


--
_______________________________________________
yocto mailing list
yocto@yoctoproject.org
https://lists.yoctoproject.org/listinfo/yocto




--------------020505080600070509080505--