From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: Received: by yocto-www.yoctoproject.org (Postfix, from userid 118) id 194C9E00C6F; Fri, 18 Mar 2016 02:00:53 -0700 (PDT) X-Spam-Checker-Version: SpamAssassin 3.3.1 (2010-03-16) on yocto-www.yoctoproject.org X-Spam-Level: X-Spam-Status: No, score=-2.7 required=5.0 tests=BAYES_00,DKIM_SIGNED, DKIM_VALID,DKIM_VALID_AU,FREEMAIL_FROM,HTML_MESSAGE,RCVD_IN_DNSWL_LOW autolearn=ham version=3.3.1 X-Spam-HAM-Report: * -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low * trust * [178.22.154.200 listed in list.dnswl.org] * 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider * (idealsim[at]laposte.net) * -1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1% * [score: 0.0000] * 0.0 HTML_MESSAGE BODY: HTML included in message * -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's * domain * 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily * valid * -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature Received: from smtp.laposte.net (smtpoutz300.laposte.net [178.22.154.200]) by yocto-www.yoctoproject.org (Postfix) with ESMTP id 880E1E00C64 for ; Fri, 18 Mar 2016 02:00:46 -0700 (PDT) Received: from smtp.laposte.net (localhost [127.0.0.1]) by lpn-prd-vrout012 (Postfix) with ESMTP id E25178A61F for ; Fri, 18 Mar 2016 10:00:44 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=laposte.net; s=mail1; t=1458291644; bh=VPLIjS8zrrZi1+Ob8KFcfJHjGDJ1XE4vD48KpvOBx+U=; h=Subject:To:References:From:Date:In-Reply-To; b=qSvRF84Btnua/9yeL92cg1v/Ix+k/w7NO6Qv0ZehS7rCofxoMpNyDGFuZOrhpFej4 P2gZI4wHyICi3kcp0V/jD5nzRd2+xfsZ4Iv1jktQyy2FfPzYRGSp5B+V6+lk8NFaCl ff++QJkrZMVFJUBc7exc5qEtQu119OaSFUBchoHusqGWsSZWU7zwDyyMtR8C3c1Dgt 3KjyB0aZeZpHYzmUlCzeWzhaMsYvFyf2zOX9bc9OVeuUs5KjI1r0yyc8IIjYC4MvDh C8ovih1ouvIyJbV61mNTiaWMrbNwTwbOYSnteGmzlLLnztUz40cg2DrCUTUFa4az5Q 2lydVk7tPLHTw== Received: from lpn-prd-vrin004 (lpn-prd-vrin004.laposte [10.128.63.5]) by lpn-prd-vrout012 (Postfix) with ESMTP id ABF148B2E3 for ; Fri, 18 Mar 2016 10:00:44 +0100 (CET) Received: from lpn-prd-vrin004 (localhost [127.0.0.1]) by lpn-prd-vrin004 (Postfix) with ESMTP id 945D770E255 for ; Fri, 18 Mar 2016 10:00:44 +0100 (CET) Received: from [192.168.1.45] (ARennes-654-1-161-212.w92-139.abo.wanadoo.fr [92.139.120.212]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (No client certificate requested) by lpn-prd-vrin004 (Postfix) with ESMTPSA id 235CF70E23F; Fri, 18 Mar 2016 10:00:44 +0100 (CET) To: Christian Ege , Yocto list discussion References: <56E913A0.2030603@laposte.net> <56E9664F.8000505@laposte.net> <56EAD860.4000306@laposte.net> From: idealsim Message-ID: <56EBC3BB.9030105@laposte.net> Date: Fri, 18 Mar 2016 10:00:43 +0100 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:38.0) Gecko/20100101 Thunderbird/38.6.0 MIME-Version: 1.0 In-Reply-To: X-VR-SrcIP: 92.139.120.212 X-VR-FullState: 0 X-VR-Score: -100 X-VR-Cause-1: gggruggvucftvghtrhhoucdtuddrfeekkedrtdehgddufedtucetufdoteggodetrfdotffvucfrrhho X-VR-Cause-2: fhhilhgvmecunfetrffquffvgfenuceurghilhhouhhtmecuhedttdenucesvcftvggtihhpihgvnhht X-VR-Cause-3: shculddquddttddmnecujfgurhepuffvfhfhkffffgggjggtsegrtdgrrgdtfeejnecuhfhrohhmpehi X-VR-Cause-4: uggvrghlshhimhcuoehiuggvrghlshhimheslhgrphhoshhtvgdrnhgvtheqnecuffhomhgrihhnpeih X-VR-Cause-5: ohgtthhophhrohhjvggtthdrohhrghdpghhithhhuhgsrdgtohhmnecukfhppeelvddrudefledruddv X-VR-Cause-6: tddrvdduvdenucfrrghrrghmpehmohguvgepshhmthhpohhuthdphhgvlhhopegludelvddrudeikedr X-VR-Cause-7: uddrgeehngdpihhnvghtpeelvddrudefledruddvtddrvdduvddpmhgrihhlfhhrohhmpehiuggvrghl X-VR-Cause-8: shhimheslhgrphhoshhtvgdrnhgvthdprhgtphhtthhopehkgedvfedtrheisehgmhgrihhlrdgtohhm X-VR-AvState: No X-VR-State: 0 Subject: Re: Re: Re: Qt5.6 new modules X-BeenThere: yocto@yoctoproject.org X-Mailman-Version: 2.1.13 Precedence: list List-Id: Discussion of all things Yocto Project List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 18 Mar 2016 09:00:53 -0000 Content-Type: multipart/alternative; boundary="------------040802080205070806000604" --------------040802080205070806000604 Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit Hi and thank you, now i know where to find SRCREV ! After adjust this variable and LICENSE.FDL the source is fetched. My bb : / //require qt5.inc// //require qt5-git.inc// // //# There are no LGPLv3-only licensed files in this component.// //# There are no GPLv2 licensed files in this component.// //LICENSE = "GFDL-1.3 & BSD & (LGPL-2.1 & The-Qt-Company-Qt-LGPL-Exception-1.1 | LGPL-3.0)"// //LIC_FILES_CHKSUM = " \// //file://LICENSE.LGPLv3;md5=b8c75190712063cde04e1f41b6fdad98 \// //file://LICENSE.GPLv3;md5=40f9bf30e783ddc201497165dfb32afb \// // file://LICENSE.FDL;md5=f70ee9a6c44ae8917586fea34dff0ab5 \// //file://LICENSE.GPLv2;md5=05832301944453ec79e40ba3c3cfceec \// //"// // //DEPENDS += "qtbase qtserialport"// // //SRCREV = "92c979c6652d55c30ab9118d45db74d8da96fc3b"/ When i launch bitbake qtserialbus, the process build without error, but it seems there is something missing because the compile step is very fast and my neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/qtserialbus/5.5.99+5.6.0-rc+gitAUTOINC+92c979c665-r0/package/ folder is empty ! If i take the qtsensors folder, there are this folder (in package) : usr/ include/ lib/ src/ I'm looking to meta-qt5 BSP to find where i can precise to build my new recipe but didn't find anything can help. Do you know how to proceed ? regards, Le 18/03/2016 08:16, Christian Ege a écrit : > Hi, > > 2016-03-17 17:16 GMT+01:00 idealsim : >> Hi, i have started a build of the image this master Branch, like you said i >> have an error on qtserialbus : >> >> WARNING: Failed to fetch URL >> git://github.com/qtproject/qtserialbus.git;name=qtserialbus;branch=5.6;protocol=git, >> attempting MIRRORS if available >> ERROR: Fetcher failure: Unable to find revision >> 6a16281aceedb713676e16c3074e6f7ea1e70b79 in branch 5.6 even from upstream >> ERROR: Function failed: Fetcher failure for URL: >> 'git://github.com/qtproject/qtserialbus.git;name=qtserialbus;branch=5.6;protocol=git'. >> Unable to fetch URL from any source. >> ERROR: Logfile of failure stored in: >> /media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/qtserialbus/5.5.99+5.6.0-rc+gitAUTOINC+6a16281ace-r0/temp/log.do_fetch.5862 >> ERROR: Task 894 >> (/media/modjo/data1TO/yocto/seco/udoo-community-bsp/sources/meta-qt5/recipes-qt/qt5/qtserialbus_git.bb, >> do_fetch) failed with exit code '1' >> >> This is my qtserialbus_git.bb : >> >> require qt5.inc >> require qt5-git.inc >> >> # There are no LGPLv3-only licensed files in this component. >> # There are no GPLv2 licensed files in this component. >> LICENSE = "GFDL-1.3 & BSD & (LGPL-2.1 & The-Qt-Company-Qt-LGPL-Exception-1.1 >> | LGPL-3.0)" >> LIC_FILES_CHKSUM = " \ >> file://LICENSE.LGPLv3;md5=b8c75190712063cde04e1f41b6fdad98 \ >> file://LICENSE.GPLv3;md5=40f9bf30e783ddc201497165dfb32afb \ >> file://LICENSE.FDL;md5=6d9f2a9af4c8b8c3c769f6cc1b6aaf7e \ >> file://LICENSE.GPLv2;md5=05832301944453ec79e40ba3c3cfceec \ >> " >> >> DEPENDS += "qtbase qtserialport" >> >> SRCREV = "6a16281aceedb713676e16c3074e6f7ea1e70b79" > The SRCREV is the git SHA1 of the repository qtserialbus. For the 5.6 > Branch the latest one is: > > SRCREV = "92c979c6652d55c30ab9118d45db74d8da96fc3b" > > > You can check the SHA1s here: > https://github.com/qtproject/qtserialbus/commits/5.6 > > The MD5 Sums will be complained during configure step and bitbake wil > tell you the right ones. > Please check if the Licences do match > > Regards, > Christian > >> An idea is welcome ! >> >> Regards, >> >> Mickaël >> >> >> >> Le 16/03/2016 14:57, idealsim a écrit : >> >> Thanks for the tip. I will try it out and let you know ... >> >> Regards, >> >> Mickaël >> >> Le 16/03/2016 10:17, Christian Ege a écrit : >> >> Hi,, >> >> 2016-03-16 9:04 GMT+01:00 idealsim : >> >> Hi, we have build an image for udoo neo from meta-qt5 jansa/master-5.6 and >> works fine (thanks to Christian Ege ). The problem is that I'm looking for >> https://github.com/qtproject/qtquickcontrols2 and >> https://github.com/qtproject/qtserialbus. My question is how we can add this >> modules to our build ? I add this to our local.conf : >> >> "qtquickcontrols2 \ >> qtserialbus \ >> " >> But this modules don't have buildable providers ! If someone can help to >> said me how to proceed ... >> >> You can try to add a meta-qt5/recipes-qt/qt5/qtserialbus_git.bb and >> take for example meta-qt5/recipes-qt/qt5/qtsensors_git.bb as reference >> >> require qt5.inc >> require qt5-git.inc >> # There are no LGPLv3-only licensed files in this component. >> # There are no GPLv2 licensed files in this component. >> LICENSE = "GFDL-1.3 & BSD & (LGPL-2.1 & >> The-Qt-Company-Qt-LGPL-Exception-1.1 | LGPL-3.0)" >> LIC_FILES_CHKSUM = " \ >> file://LICENSE.LGPLv21;md5=58a180e1cf84c756c29f782b3a485c29 \ >> file://LICENSE.LGPLv3;md5=b8c75190712063cde04e1f41b6fdad98 \ >> file://LICENSE.GPLv3;md5=40f9bf30e783ddc201497165dfb32afb \ >> file://LGPL_EXCEPTION.txt;md5=9625233da42f9e0ce9d63651a9d97654 \ >> file://LICENSE.FDL;md5=6d9f2a9af4c8b8c3c769f6cc1b6aaf7e \ >> file://LICENSE.GPLv2;md5=05832301944453ec79e40ba3c3cfceec \ >> " >> DEPENDS += "qtbase" >> >> SRCREV = "71a323e1f12df8d213a4052621027e223eb5a343" >> >> The configure step will bail out due to the fact that you have wrong >> checksums but it will show you the right ones >> >> Best, >> Christian >> >> >> regards, >> >> Mickael >> >> >> -- >> _______________________________________________ >> yocto mailing list >> yocto@yoctoproject.org >> https://lists.yoctoproject.org/listinfo/yocto >> >> >> >> >> > > --------------040802080205070806000604 Content-Type: text/html; charset=utf-8 Content-Transfer-Encoding: 8bit Hi and thank you, now i know where to find SRCREV !
After adjust this variable and LICENSE.FDL the source is fetched. My bb :

require qt5.inc
require qt5-git.inc

# There are no LGPLv3-only licensed files in this component.
# There are no GPLv2 licensed files in this component.
LICENSE = "GFDL-1.3 & BSD & (LGPL-2.1 & The-Qt-Company-Qt-LGPL-Exception-1.1 | LGPL-3.0)"
LIC_FILES_CHKSUM = " \
    file://LICENSE.LGPLv3;md5=b8c75190712063cde04e1f41b6fdad98 \
    file://LICENSE.GPLv3;md5=40f9bf30e783ddc201497165dfb32afb \
    file://LICENSE.FDL;md5=f70ee9a6c44ae8917586fea34dff0ab5 \
    file://LICENSE.GPLv2;md5=05832301944453ec79e40ba3c3cfceec \
"

DEPENDS += "qtbase qtserialport"

SRCREV = "92c979c6652d55c30ab9118d45db74d8da96fc3b"

When i launch bitbake qtserialbus, the process build without error, but it seems there is something missing because the compile step is very fast and my neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/qtserialbus/5.5.99+5.6.0-rc+gitAUTOINC+92c979c665-r0/package/ folder is empty ! If i take the qtsensors folder, there are this folder (in package) :
usr/
    include/
    lib/
    src/

I'm looking to meta-qt5 BSP to find where i can precise to build my new recipe but didn't find anything can help. Do you know how to proceed ?

regards,

Le 18/03/2016 08:16, Christian Ege a écrit :
Hi,

2016-03-17 17:16 GMT+01:00 idealsim <idealsim@laposte.net>:

Hi, i have started a build of the image this master Branch, like you said i
have an error on qtserialbus :

WARNING: Failed to fetch URL
git://github.com/qtproject/qtserialbus.git;name=qtserialbus;branch=5.6;protocol=git,
attempting MIRRORS if available
ERROR: Fetcher failure: Unable to find revision
6a16281aceedb713676e16c3074e6f7ea1e70b79 in branch 5.6 even from upstream
ERROR: Function failed: Fetcher failure for URL:
'git://github.com/qtproject/qtserialbus.git;name=qtserialbus;branch=5.6;protocol=git'.
Unable to fetch URL from any source.
ERROR: Logfile of failure stored in:
/media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/qtserialbus/5.5.99+5.6.0-rc+gitAUTOINC+6a16281ace-r0/temp/log.do_fetch.5862
ERROR: Task 894
(/media/modjo/data1TO/yocto/seco/udoo-community-bsp/sources/meta-qt5/recipes-qt/qt5/qtserialbus_git.bb,
do_fetch) failed with exit code '1'

This is my qtserialbus_git.bb :

require qt5.inc
require qt5-git.inc

# There are no LGPLv3-only licensed files in this component.
# There are no GPLv2 licensed files in this component.
LICENSE = "GFDL-1.3 & BSD & (LGPL-2.1 & The-Qt-Company-Qt-LGPL-Exception-1.1
| LGPL-3.0)"
LIC_FILES_CHKSUM = " \
    file://LICENSE.LGPLv3;md5=b8c75190712063cde04e1f41b6fdad98 \
    file://LICENSE.GPLv3;md5=40f9bf30e783ddc201497165dfb32afb \
    file://LICENSE.FDL;md5=6d9f2a9af4c8b8c3c769f6cc1b6aaf7e \
    file://LICENSE.GPLv2;md5=05832301944453ec79e40ba3c3cfceec \
"

DEPENDS += "qtbase qtserialport"

SRCREV = "6a16281aceedb713676e16c3074e6f7ea1e70b79"

The SRCREV is the git SHA1 of the repository qtserialbus. For the 5.6
Branch the latest one is:

SRCREV = "92c979c6652d55c30ab9118d45db74d8da96fc3b"


You can check the SHA1s here:
https://github.com/qtproject/qtserialbus/commits/5.6

The MD5 Sums will be complained during configure step and bitbake wil
tell you the right ones.
Please check if the Licences do match

Regards,
Christian


An idea is welcome !

Regards,

Mickaël



Le 16/03/2016 14:57, idealsim a écrit :

Thanks for the tip. I will try it out and let you know ...

Regards,

Mickaël

Le 16/03/2016 10:17, Christian Ege a écrit :

Hi,,

2016-03-16 9:04 GMT+01:00 idealsim <idealsim@laposte.net>:

Hi, we have build an image for udoo neo from meta-qt5 jansa/master-5.6 and
works fine (thanks to Christian Ege ). The problem is that I'm looking for
https://github.com/qtproject/qtquickcontrols2 and
https://github.com/qtproject/qtserialbus. My question is how we can add this
modules to our build ?  I add this to our local.conf :

     "qtquickcontrols2 \
      qtserialbus \
     "
But this modules don't have buildable providers ! If someone can help to
said me how to proceed ...

You can try to add a meta-qt5/recipes-qt/qt5/qtserialbus_git.bb and
take for example meta-qt5/recipes-qt/qt5/qtsensors_git.bb as reference

require qt5.inc
require qt5-git.inc
# There are no LGPLv3-only licensed files in this component.
# There are no GPLv2 licensed files in this component.
LICENSE = "GFDL-1.3 & BSD & (LGPL-2.1 &
The-Qt-Company-Qt-LGPL-Exception-1.1 | LGPL-3.0)"
LIC_FILES_CHKSUM = " \
file://LICENSE.LGPLv21;md5=58a180e1cf84c756c29f782b3a485c29 \
file://LICENSE.LGPLv3;md5=b8c75190712063cde04e1f41b6fdad98 \
file://LICENSE.GPLv3;md5=40f9bf30e783ddc201497165dfb32afb \
file://LGPL_EXCEPTION.txt;md5=9625233da42f9e0ce9d63651a9d97654 \
file://LICENSE.FDL;md5=6d9f2a9af4c8b8c3c769f6cc1b6aaf7e \
file://LICENSE.GPLv2;md5=05832301944453ec79e40ba3c3cfceec \
"
DEPENDS += "qtbase"

SRCREV = "71a323e1f12df8d213a4052621027e223eb5a343"

The configure step will bail out due to the fact that you have wrong
checksums but it will show you the right ones

Best,
Christian


regards,

Mickael


--
_______________________________________________
yocto mailing list
yocto@yoctoproject.org
https://lists.yoctoproject.org/listinfo/yocto

--------------040802080205070806000604--