From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: Received: by yocto-www.yoctoproject.org (Postfix, from userid 118) id 6E6A2E00C75; Fri, 18 Mar 2016 02:04:02 -0700 (PDT) X-Spam-Checker-Version: SpamAssassin 3.3.1 (2010-03-16) on yocto-www.yoctoproject.org X-Spam-Level: X-Spam-Status: No, score=-2.7 required=5.0 tests=BAYES_00,DKIM_SIGNED, DKIM_VALID,DKIM_VALID_AU,FREEMAIL_FROM,HTML_MESSAGE,RCVD_IN_DNSWL_LOW autolearn=ham version=3.3.1 X-Spam-HAM-Report: * 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider * (idealsim[at]laposte.net) * -1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1% * [score: 0.0000] * 0.0 HTML_MESSAGE BODY: HTML included in message * -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's * domain * 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily * valid * -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature * -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low * trust * [194.117.213.103 listed in list.dnswl.org] Received: from smtp.laposte.net (smtpoutz28.laposte.net [194.117.213.103]) by yocto-www.yoctoproject.org (Postfix) with ESMTP id C1340E00C64 for ; Fri, 18 Mar 2016 02:03:59 -0700 (PDT) Received: from smtp.laposte.net (localhost [127.0.0.1]) by lpn-prd-vrout016 (Postfix) with ESMTP id CE108111BFD for ; Fri, 18 Mar 2016 10:03:58 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=laposte.net; s=mail1; t=1458291838; bh=LqrR9ngW2fSoM4v9Q079b02SHRrS9Nste4TPQAYlK2s=; h=Subject:To:References:Cc:From:Date:In-Reply-To; b=RocWgzr0DPC2XP3dopqtvi3tqHLUfQhAAQ7sNLJ3mM4fzZ+BBetzEYKHySPLN0iCG rHQ1HnWZDtS/w+3pmdgjPVlFhLqJMUIZiNkU5+v9zsD3TY6X4w/1NI3z5fgWH5P2Bp fAHo8lwbDVMl38asxm3y4pipUx+2JbylOEo6kK2EX6GsG3O76J/zm/6wgTewKZEcr6 MrdY3frHMEg+OSzIn2HSMPd+/Q3klu1YpFPYke+1k8hiVtBv+Y2QTj8k/HsRiVXbxM 29C7J7mvIp/bz01wd7+pnXMs4xUhL2A9pDzqPONrrE6CZBu4ySJV9E/hJPMMyJhzN7 9nA0Wd+wtSpFw== Received: from lpn-prd-vrin001 (lpn-prd-vrin001.prosodie [10.128.63.2]) by lpn-prd-vrout016 (Postfix) with ESMTP id CAEDF111B42 for ; Fri, 18 Mar 2016 10:03:58 +0100 (CET) Received: from lpn-prd-vrin001 (localhost [127.0.0.1]) by lpn-prd-vrin001 (Postfix) with ESMTP id B920F365404 for ; Fri, 18 Mar 2016 10:03:58 +0100 (CET) Received: from [192.168.1.45] (ARennes-654-1-161-212.w92-139.abo.wanadoo.fr [92.139.120.212]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (No client certificate requested) by lpn-prd-vrin001 (Postfix) with ESMTPSA id 585E73653F0; Fri, 18 Mar 2016 10:03:58 +0100 (CET) To: "meta-freescale@yoctoproject.org" References: <56E720C8.1070508@laposte.net> <56EADA2A.1060406@laposte.net> From: idealsim Message-ID: <56EBC47D.2020108@laposte.net> Date: Fri, 18 Mar 2016 10:03:57 +0100 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:38.0) Gecko/20100101 Thunderbird/38.6.0 MIME-Version: 1.0 In-Reply-To: <56EADA2A.1060406@laposte.net> X-VR-SrcIP: 92.139.120.212 X-VR-FullState: 0 X-VR-Score: -100 X-VR-Cause-1: gggruggvucftvghtrhhoucdtuddrfeekkedrtdehgddufedtucetufdoteggodetrfdotffvucfrrhho X-VR-Cause-2: fhhilhgvmecunfetrffquffvgfenuceurghilhhouhhtmecuhedttdenucesvcftvggtihhpihgvnhht X-VR-Cause-3: shculddquddttddmnecujfgurhepuffvfhfhkffffgggjggtsegrtdgrrgdtfeelnecuhfhrohhmpehi X-VR-Cause-4: uggvrghlshhimhcuoehiuggvrghlshhimheslhgrphhoshhtvgdrnhgvtheqnecuffhomhgrihhnpehg X-VR-Cause-5: ihhthhhusgdrtghomhenucfkphepledvrddufeelrdduvddtrddvuddvnecurfgrrhgrmhepmhhouggv X-VR-Cause-6: pehsmhhtphhouhhtpdhhvghloheplgduledvrdduieekrddurdeghegnpdhinhgvthepledvrddufeel X-VR-Cause-7: rdduvddtrddvuddvpdhmrghilhhfrhhomhepihguvggrlhhsihhmsehlrghpohhsthgvrdhnvghtpdhr X-VR-Cause-8: tghpthhtohepmhgvthgrqdhfrhgvvghstggrlhgvseihohgtthhophhrohhjvggtthdrohhrgh X-VR-AvState: No X-VR-State: 0 Cc: Otavio Salvador Subject: Re: Re: Qt5.6 new modules X-BeenThere: meta-freescale@yoctoproject.org X-Mailman-Version: 2.1.13 Precedence: list List-Id: Usage and development list for the meta-fsl-* layers List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 18 Mar 2016 09:04:02 -0000 Content-Type: multipart/alternative; boundary="------------020308020006040300020406" --------------020308020006040300020406 Content-Type: text/plain; charset=iso-8859-15; format=flowed Content-Transfer-Encoding: 8bit After adjust SRCREV and LICENSE.FDL the source is fetched. My bb : / //require qt5.inc// //require qt5-git.inc// // //# There are no LGPLv3-only licensed files in this component.// //# There are no GPLv2 licensed files in this component.// //LICENSE = "GFDL-1.3 & BSD & (LGPL-2.1 & The-Qt-Company-Qt-LGPL-Exception-1.1 | LGPL-3.0)"// //LIC_FILES_CHKSUM = " \// //file://LICENSE.LGPLv3;md5=b8c75190712063cde04e1f41b6fdad98 \// //file://LICENSE.GPLv3;md5=40f9bf30e783ddc201497165dfb32afb \// //file://LICENSE.FDL;md5=f70ee9a6c44ae8917586fea34dff0ab5 \// //file://LICENSE.GPLv2;md5=05832301944453ec79e40ba3c3cfceec \// //"// // //DEPENDS += "qtbase qtserialport"// // //SRCREV = "92c979c6652d55c30ab9118d45db74d8da96fc3b"/ When i launch bitbake qtserialbus, the process build without error, but it seems there is something missing because the compile step is very fast and my neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/qtserialbus/5.5.99+5.6.0-rc+gitAUTOINC+92c979c665-r0/package/ folder is empty ! If i take the qtsensors folder, there are this folder (in package) : usr/ include/ lib/ src/ I'm looking to meta-qt5 BSP to find where i can precise to build my new recipe but didn't find anything can help. Can you explain how to proceed please ? regards, Le 17/03/2016 17:24, idealsim a écrit : > Like another user advise me on yocto project mailling list, i create a > qtserialbus_git.bb based on qtsensor_git.bb, this is the file : > > /require qt5.inc// > //require qt5-git.inc// > // > //# There are no LGPLv3-only licensed files in this component.// > //# There are no GPLv2 licensed files in this component.// > //LICENSE = "GFDL-1.3 & BSD & (LGPL-2.1 & > The-Qt-Company-Qt-LGPL-Exception-1.1 | LGPL-3.0)"// > //LIC_FILES_CHKSUM = " \// > //file://LICENSE.LGPLv3;md5=b8c75190712063cde04e1f41b6fdad98 \// > //file://LICENSE.GPLv3;md5=40f9bf30e783ddc201497165dfb32afb \// > //file://LICENSE.FDL;md5=6d9f2a9af4c8b8c3c769f6cc1b6aaf7e \// > //file://LICENSE.GPLv2;md5=05832301944453ec79e40ba3c3cfceec \// > //"// > // > //DEPENDS += "qtbase qtserialport"// > // > //SRCREV = "6a16281aceedb713676e16c3074e6f7ea1e70b79"// > > > /I didn't change the md5 and SRCREV from qtsensor (i don't know how to > obtain it !), i have this error during the build : > > /WARNING: Failed to fetch URL > git://github.com/qtproject/qtserialbus.git;name=qtserialbus;branch=5.6;protocol=git, > attempting MIRRORS if available// > //ERROR: Fetcher failure: Unable to find revision > 6a16281aceedb713676e16c3074e6f7ea1e70b79 in branch 5.6 even from > upstream// > //ERROR: Function failed: Fetcher failure for URL: > 'git://github.com/qtproject/qtserialbus.git;name=qtserialbus;branch=5.6;protocol=git'. > Unable to fetch URL from any source.// > //ERROR: Logfile of failure stored in: > /media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/qtserialbus/5.5.99+5.6.0-rc+gitAUTOINC+6a16281ace-r0/temp/log.do_fetch.5862// > //ERROR: Task 894 > (/media/modjo/data1TO/yocto/seco/udoo-community-bsp/sources/meta-qt5/recipes-qt/qt5/qtserialbus_git.bb, > do_fetch) failed with exit code '1' > > /If someone can help please .../ > > regards > / > Le 15/03/2016 13:39, idealsim a écrit : >> I have tried to add qtquickcontrols2 and qtserialbus to my conf but this >> modules have not buildable providers. >> This modules are not included to meta qt5 ? If someone can just explain >> how to add this modules for yocto build (if is possible)this is very >> helpful ! >> >> regards >> >> Mickaël >> >> Le Mon, 14 Mar 2016 21:36:24 +0100, idealsim a >> écrit: >> >>> Hi, we have build an image for udoo neo from meta-qt5 >>> jansa/master-5.6 and works fine (thanks to Christian Ege ;-) ). The >>> problem is that I'm looking for >>> https://github.com/qtproject/qtquickcontrols2 and >>> https://github.com/qtproject/qtserialbus. My question is, to add >>> this modules to our build, what do we need to add to our local.conf : >>> >>> "qtquickcontrols2 \ >>> qtserialbus \ >>> " >>> This is sufficient ? >>> >>> regards, >>> >>> Mickael. >> >> > --------------020308020006040300020406 Content-Type: text/html; charset=iso-8859-15 Content-Transfer-Encoding: 8bit After adjust SRCREV and LICENSE.FDL the source is fetched. My bb :

require qt5.inc
require qt5-git.inc

# There are no LGPLv3-only licensed files in this component.
# There are no GPLv2 licensed files in this component.
LICENSE = "GFDL-1.3 & BSD & (LGPL-2.1 & The-Qt-Company-Qt-LGPL-Exception-1.1 | LGPL-3.0)"
LIC_FILES_CHKSUM = " \
    file://LICENSE.LGPLv3;md5=b8c75190712063cde04e1f41b6fdad98 \
    file://LICENSE.GPLv3;md5=40f9bf30e783ddc201497165dfb32afb \
    file://LICENSE.FDL;md5=f70ee9a6c44ae8917586fea34dff0ab5 \
    file://LICENSE.GPLv2;md5=05832301944453ec79e40ba3c3cfceec \
"

DEPENDS += "qtbase qtserialport"

SRCREV = "92c979c6652d55c30ab9118d45db74d8da96fc3b"

When i launch bitbake qtserialbus, the process build without error, but it seems there is something missing because the compile step is very fast and my neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/qtserialbus/5.5.99+5.6.0-rc+gitAUTOINC+92c979c665-r0/package/ folder is empty ! If i take the qtsensors folder, there are this folder (in package) :
usr/
    include/
    lib/
    src/

I'm looking to meta-qt5 BSP to find where i can precise to build my new recipe but didn't find anything can help. Can you explain how to proceed please ?

regards,

Le 17/03/2016 17:24, idealsim a écrit :
Like another user advise me on yocto project mailling list, i create a qtserialbus_git.bb based on qtsensor_git.bb, this is the file :

require qt5.inc
require qt5-git.inc

# There are no LGPLv3-only licensed files in this component.
# There are no GPLv2 licensed files in this component.
LICENSE = "GFDL-1.3 & BSD & (LGPL-2.1 & The-Qt-Company-Qt-LGPL-Exception-1.1 | LGPL-3.0)"
LIC_FILES_CHKSUM = " \
    file://LICENSE.LGPLv3;md5=b8c75190712063cde04e1f41b6fdad98 \
    file://LICENSE.GPLv3;md5=40f9bf30e783ddc201497165dfb32afb \
    file://LICENSE.FDL;md5=6d9f2a9af4c8b8c3c769f6cc1b6aaf7e \
    file://LICENSE.GPLv2;md5=05832301944453ec79e40ba3c3cfceec \
"

DEPENDS += "qtbase qtserialport"

SRCREV = "6a16281aceedb713676e16c3074e6f7ea1e70b79"


I didn't change the md5 and SRCREV from qtsensor (i don't know how to obtain it !), i have this error during the build :

WARNING: Failed to fetch URL git://github.com/qtproject/qtserialbus.git;name=qtserialbus;branch=5.6;protocol=git, attempting MIRRORS if available
ERROR: Fetcher failure: Unable to find revision 6a16281aceedb713676e16c3074e6f7ea1e70b79 in branch 5.6 even from upstream
ERROR: Function failed: Fetcher failure for URL: 'git://github.com/qtproject/qtserialbus.git;name=qtserialbus;branch=5.6;protocol=git'. Unable to fetch URL from any source.
ERROR: Logfile of failure stored in: /media/modjo/data1TO/yocto/seco/udoo-community-bsp/neoBuild/tmp/work/cortexa9hf-vfp-neon-poky-linux-gnueabi/qtserialbus/5.5.99+5.6.0-rc+gitAUTOINC+6a16281ace-r0/temp/log.do_fetch.5862
ERROR: Task 894 (/media/modjo/data1TO/yocto/seco/udoo-community-bsp/sources/meta-qt5/recipes-qt/qt5/qtserialbus_git.bb, do_fetch) failed with exit code '1'

If someone can help please ...

regards

Le 15/03/2016 13:39, idealsim a écrit :
I have tried to add qtquickcontrols2 and qtserialbus to my conf but this
modules have not buildable providers.
This modules are not included to meta qt5 ? If someone can just explain
how to add this modules for yocto build (if is possible)this is very
helpful !

regards

Mickaël

Le Mon, 14 Mar 2016 21:36:24 +0100, idealsim <idealsim@laposte.net> a
écrit:

Hi, we have build an image for udoo neo from meta-qt5 jansa/master-5.6 and works fine (thanks to Christian Ege ;-) ). The problem is that I'm looking for https://github.com/qtproject/qtquickcontrols2 and https://github.com/qtproject/qtserialbus. My question is, to add this modules to our build, what do we need to add to our local.conf :

     "qtquickcontrols2 \
      qtserialbus \
     "
     This is sufficient ?

regards,

Mickael.




--------------020308020006040300020406--