From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from aws-us-west-2-korg-lkml-1.web.codeaurora.org (localhost.localdomain [127.0.0.1]) by smtp.lore.kernel.org (Postfix) with ESMTP id 5D375C83F17 for ; Tue, 15 Jul 2025 07:06:05 +0000 (UTC) Received: from relay9-d.mail.gandi.net (relay9-d.mail.gandi.net [217.70.183.199]) by mx.groups.io with SMTP id smtpd.web11.1974.1752563156540980946 for ; Tue, 15 Jul 2025 00:05:56 -0700 Authentication-Results: mx.groups.io; dkim=pass header.i=@bootlin.com header.s=gm1 header.b=YKrfFWLx; spf=pass (domain: bootlin.com, ip: 217.70.183.199, mailfrom: antonin.godard@bootlin.com) Received: by mail.gandi.net (Postfix) with ESMTPSA id 4F914443C7; Tue, 15 Jul 2025 07:05:54 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1752563154; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=za2yqU1UGYPDaLwQU6Kzwz5rrSDvcm3gtPk3Gd+2xi8=; b=YKrfFWLxkA1fIuyZP3dIFP5l+tJHa/vvqyQoG0ZARQDAWEfH7QcMSM21ijBO8kUZNk7Ddc 6CZx0TLTGPJKiTrWaZxRws+2glqlczj3YenF8fYtJ9LZIkXniYctTZnskJM6zfkWNYpxW3 K/QrHH+szawrJRz+IHRmL4iBayB5x9K9P0xoOesQ249OjZT7TZBcpitFzSVKSdTrQq6ieA bgven6WQ6TZ+ipxhNh+/7Ap4mrGf2G4VdL7ZxaZ0EM92i51gb9dthpN7EFcw/35tUOLMOK qCj71FiLlkF0TVJdmYwi5IXjS7lYcKMXS0nihOoLmuQTma6wZk5WMR6Hu4xD8A== Mime-Version: 1.0 Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset=UTF-8 Date: Tue, 15 Jul 2025 09:05:53 +0200 Message-Id: From: "Antonin Godard" To: "Richard Purdie" , Subject: Re: [docs] [PATCH 2/4] ref-manual/structure.rst: update with info on PERSISTENT_DIR Cc: , "Matthias Schiffer" , "Thomas Petazzoni" References: <20250709-update-sstate-dir-docs-v1-0-9114688f33d1@bootlin.com> <20250709-update-sstate-dir-docs-v1-2-9114688f33d1@bootlin.com> In-Reply-To: X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtdefgdehgedukecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfitefpfffkpdcuggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhepggfgtgffkffhvffuvehfjgesthhqredttddtjeenucfhrhhomhepfdetnhhtohhnihhnucfiohgurghrugdfuceorghnthhonhhinhdrghhouggrrhgusegsohhothhlihhnrdgtohhmqeenucggtffrrghtthgvrhhnpeejveeuvedvieeuhfefleduvdfgvefhudekleehkeevhfegtedujedtvedukeetjeenucffohhmrghinhephihotghtohhprhhojhgvtghtrdhorhhgpdgsohhothhlihhnrdgtohhmnecukfhppedvrgdtudemtggsudegmeehheeimeejrgdttdemfegtkedumegvsggrjeemudgskegsmegrhegtleenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvrgdtudemtggsudegmeehheeimeejrgdttdemfegtkedumegvsggrjeemudgskegsmegrhegtledphhgvlhhopehlohgtrghlhhhoshhtpdhmrghilhhfrhhomheprghnthhonhhinhdrghhouggrrhgusegsohhothhlihhnrdgtohhmpdhnsggprhgtphhtthhopeehpdhrtghpthhtoheprhhitghhrghrugdrphhurhguihgvsehlihhnuhigfhhouhhnuggrthhiohhnrdhorhhgpdhrtghpthhtoheprghlvgigrdhkrghnrghvi hhnsehgmhgrihhlrdgtohhmpdhrtghpthhtohepughotghssehlihhsthhsrdihohgtthhophhrohhjvggtthdrohhrghdprhgtphhtthhopehmrghtthhhihgrshdrshgthhhifhhfvghrsegvfidrthhqqdhgrhhouhhprdgtohhmpdhrtghpthhtohepthhhohhmrghsrdhpvghtrgiiiihonhhisegsohhothhlihhnrdgtohhm X-GND-Sasl: antonin.godard@bootlin.com List-Id: X-Webhook-Received: from li982-79.members.linode.com [45.33.32.79] by aws-us-west-2-korg-lkml-1.web.codeaurora.org with HTTPS for ; Tue, 15 Jul 2025 07:06:05 -0000 X-Groupsio-URL: https://lists.yoctoproject.org/g/docs/message/7329 On Fri Jul 11, 2025 at 11:45 PM CEST, Richard Purdie wrote: > On Fri, 2025-07-11 at 19:09 +0200, Alexander Kanavin via lists.yoctoproje= ct.org wrote: >> On Wed, 9 Jul 2025 at 09:57, Antonin Godard via lists.yoctoproject.org >> wrote: >> >=20 >> > Since we mention that SSTATE_DIR can be shared for multiple builds, al= so >> > mention that PERSISTENT_DIR should be shared alongside SSTATE_DIR. >>=20 >> NO. These changes are incorrect, please do not merge or revert if >> already merged. >>=20 >> PERSISTENT_DIR can be copied from one build directory to another when >> bitbake is not running, but it cannot be shared between two active >> builds. >>=20 >> If one wants to share sstate, they either have to setup a hash >> equivalence server (and then sharing PERSISTENT_DIR is not needed), or >> disable hash equivalency (in which case it is also not needed). > > The changes did merge and definitely are unclear. > > The point is that if you share sstate, you also need to have common > hash equivalence data. > > That may be via having common hashequiv server, or, of you have a local > sstate directory and delete the build directory, you need to preserve > the hashequiv database file to make the sstate useful. > > You cannot have a common PERSISTENT_DIR shared by two builds, that is > not supported. > > Hopefully Antonin can tweak things to make this all clearer. I should > have caught this, sorry :/ Hi all, Sorry! I drew a wrong conclusion from bug #15921, I will correct this soon this week. Alex, thanks for catching this. Antonin --=20 Antonin Godard, Bootlin Embedded Linux and Kernel engineering https://bootlin.com