From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from aws-us-west-2-korg-lkml-1.web.codeaurora.org (localhost.localdomain [127.0.0.1]) by smtp.lore.kernel.org (Postfix) with ESMTP id 68589C83F27 for ; Wed, 16 Jul 2025 07:28:14 +0000 (UTC) Received: from relay3-d.mail.gandi.net (relay3-d.mail.gandi.net [217.70.183.195]) by mx.groups.io with SMTP id smtpd.web10.16370.1752650889484428934 for ; Wed, 16 Jul 2025 00:28:09 -0700 Authentication-Results: mx.groups.io; dkim=pass header.i=@bootlin.com header.s=gm1 header.b=lwMFFY8U; spf=pass (domain: bootlin.com, ip: 217.70.183.195, mailfrom: antonin.godard@bootlin.com) Received: by mail.gandi.net (Postfix) with ESMTPSA id 5EB2D1FD3B; Wed, 16 Jul 2025 07:28:07 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1752650887; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=ulDVQNOcgqOdrCeHXy1ow5zfibbhCh7AdgpPtx1Ukmg=; b=lwMFFY8UWEHnmNbTqmmqmvAx2sL+WKQibw+H67NyOxQ6sOFWg4kxSajZmF151MAol7au/X yO4RUuk8uA22Quj6x0lMQou3GZ4TTGtno97gPIJr0gUGSPR6iH0VcsWobwOP1P32Sm2Jlz jpxxbljRXd1gG4DhV5NCLfA2KPgpw9kDLRxHZkwzjPCQfUVBllSuxaQpVjWlb6JCsGFH+B LtINJE4222J8v2JXIUSaEIoyIywYcFX3188NDAGLoFN+3d/WWlKB1xOagOBNKapAtMbZLF i1xlIhXqCwe9X5Kfq9Cu+uXwmnY9PmoXjuH/n5JStHXjP2hazO5PH0GMPxHgdA== Mime-Version: 1.0 Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset=UTF-8 Date: Wed, 16 Jul 2025 09:28:07 +0200 Message-Id: Subject: Re: [docs] [PATCH 2/2] dev-manual/start.rst: remove shared PERSISTENT_DIR mentions Cc: , "Thomas Petazzoni" , "Matthias Schiffer" From: "Antonin Godard" To: "Alexander Kanavin" References: <20250715-fix-persistent-dir-v1-0-e3f31214b677@bootlin.com> <20250715-fix-persistent-dir-v1-2-e3f31214b677@bootlin.com> In-Reply-To: X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtdefgdehjeduudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfitefpfffkpdcuggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhepggfgtgffkffuvefhvfhfjgesthhqredttddtjeenucfhrhhomhepfdetnhhtohhnihhnucfiohgurghrugdfuceorghnthhonhhinhdrghhouggrrhgusegsohhothhlihhnrdgtohhmqeenucggtffrrghtthgvrhhnpeffgfekieeufeeiveekkeevjeetveelkeejiefgfeeihfeghfeghfduvdejuddvvdenucffohhmrghinhephihotghtohhprhhojhgvtghtrdhorhhgpdgsohhothhlihhnrdgtohhmnecukfhppedvrgdtudemtggsudegmeehheeimeejrgdttdemfegtkedumegvsggrjeemudgskegsmegrhegtleenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvrgdtudemtggsudegmeehheeimeejrgdttdemfegtkedumegvsggrjeemudgskegsmegrhegtledphhgvlhhopehlohgtrghlhhhoshhtpdhmrghilhhfrhhomheprghnthhonhhinhdrghhouggrrhgusegsohhothhlihhnrdgtohhmpdhnsggprhgtphhtthhopeegpdhrtghpthhtoheprghlvgigrdhkrghnrghvihhnsehgmhgrihhlrdgtohhmpdhrtghpthhtohepughotghssehlihhsthhsrdihohgtthhophhrohhjvggtt hdrohhrghdprhgtphhtthhopehthhhomhgrshdrphgvthgriiiiohhnihessghoohhtlhhinhdrtghomhdprhgtphhtthhopehmrghtthhhihgrshdrshgthhhifhhfvghrsegvfidrthhqqdhgrhhouhhprdgtohhm X-GND-Sasl: antonin.godard@bootlin.com List-Id: X-Webhook-Received: from li982-79.members.linode.com [45.33.32.79] by aws-us-west-2-korg-lkml-1.web.codeaurora.org with HTTPS for ; Wed, 16 Jul 2025 07:28:14 -0000 X-Groupsio-URL: https://lists.yoctoproject.org/g/docs/message/7340 On Tue Jul 15, 2025 at 5:55 PM CEST, Alexander Kanavin wrote: > On Tue, 15 Jul 2025 at 11:56, Antonin Godard via > lists.yoctoproject.org > wrote: > >> + - Set up a local :ref:`overview-manual/concepts:Hash Equivalence` = server >> + with :term:`BB_HASHSERVE` and :term:`BB_SIGNATURE_HANDLER`. A ba= sic setup >> + would be:: >> + >> + BB_HASHSERVE =3D "auto" >> + BB_SIGNATURE_HANDLER =3D "OEEquivHash" > > This is still problematic and should be clarified further: > > 1. BB_HASHSERVE and BB_SIGNATURE_HANDLER do not set up or start a > server, they set up the hash equivalence client built into bitbake. > > 2. The above client configuration (used by poky) also starts a private > server that is specific to a particular build directory. So hash equiv > information would not be shared between multiple build directories, > and this will cause sstate mismatches (as reported in the bug), if > sstate is shared. > > Maybe it's easier to just remove the above, and only refer to the hash > equiv section in the other manual: > > + - Set up a local :ref:`overview-manual/concepts :Hash Equivalence` = server > + > + See the :ref:`overview-manual/concepts:Hash Equivalence` section = of the > + Yocto Project Overview and Concepts Manual for more details on th= e hash > + equivalence feature. > > Then we can do a correct, comprehensive description there. Yes, I also feel that hash equivalence could deserve its own document, and should go further than a server/client local to the build directory only. T= hanks for the clarification. I will try to work on this soon, at least for now the shared PERSISTENT_DIR mention is reverted, which is good. Antonin --=20 Antonin Godard, Bootlin Embedded Linux and Kernel engineering https://bootlin.com