From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org X-Spam-Level: X-Spam-Status: No, score=-0.8 required=3.0 tests=DKIM_SIGNED,DKIM_VALID, HEADER_FROM_DIFFERENT_DOMAINS,MAILING_LIST_MULTI,SPF_HELO_NONE,SPF_PASS autolearn=no autolearn_force=no version=3.4.0 Received: from mail.kernel.org (mail.kernel.org [198.145.29.99]) by smtp.lore.kernel.org (Postfix) with ESMTP id 7A86EC34047 for ; Wed, 19 Feb 2020 14:21:02 +0000 (UTC) Received: from alsa0.perex.cz (alsa0.perex.cz [77.48.224.243]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by mail.kernel.org (Postfix) with ESMTPS id 015B120801 for ; Wed, 19 Feb 2020 14:21:01 +0000 (UTC) Authentication-Results: mail.kernel.org; dkim=pass (1024-bit key) header.d=alsa-project.org header.i=@alsa-project.org header.b="ho++4VcE"; dkim=pass (2048-bit key) header.d=comcastmailservice.net header.i=@comcastmailservice.net header.b="Ib9zCpv8" DMARC-Filter: OpenDMARC Filter v1.3.2 mail.kernel.org 015B120801 Authentication-Results: mail.kernel.org; dmarc=none (p=none dis=none) header.from=buinea.com Authentication-Results: mail.kernel.org; spf=pass smtp.mailfrom=alsa-devel-bounces@alsa-project.org Received: from alsa1.perex.cz (alsa1.perex.cz [207.180.221.201]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by alsa0.perex.cz (Postfix) with ESMTPS id 33DD91685; Wed, 19 Feb 2020 15:20:10 +0100 (CET) DKIM-Filter: OpenDKIM Filter v2.11.0 alsa0.perex.cz 33DD91685 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=alsa-project.org; s=default; t=1582122060; bh=0/GiNjrHW+mHWEnBRrtczwVBBLEGw1R3OFEH/pm/KHc=; h=Date:From:To:Subject:List-Id:List-Unsubscribe:List-Archive: List-Post:List-Help:List-Subscribe:From; b=ho++4VcEZq8TYrAM+KsVhrXfIXnccLQ1kpDjWnB02O4xurMTviKs13YsUFbfzC3Ea t5wdhrStsQvIcYGLGOjEg6en5783LPxzb9VTRg3GPkoRCaC2IUxoBEAmYBSktw40ON DYjjJG5TIV0txB+0WHRPgWf7vocn8GvZ2jB41Yjo= Received: from alsa1.perex.cz (localhost.localdomain [127.0.0.1]) by alsa1.perex.cz (Postfix) with ESMTP id A8D55F8025F; Wed, 19 Feb 2020 15:20:09 +0100 (CET) Received: by alsa1.perex.cz (Postfix, from userid 50401) id D4092F80273; Wed, 19 Feb 2020 15:20:07 +0100 (CET) Received: from resqmta-po-12v.sys.comcast.net (resqmta-po-12v.sys.comcast.net [IPv6:2001:558:fe16:19:96:114:154:171]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by alsa1.perex.cz (Postfix) with ESMTPS id 4E8AAF80142 for ; Wed, 19 Feb 2020 15:20:03 +0100 (CET) DKIM-Filter: OpenDKIM Filter v2.11.0 alsa1.perex.cz 4E8AAF80142 Authentication-Results: alsa1.perex.cz; dkim=pass (2048-bit key) header.d=comcastmailservice.net header.i=@comcastmailservice.net header.b="Ib9zCpv8" Received: from resomta-po-16v.sys.comcast.net ([96.114.154.240]) by resqmta-po-12v.sys.comcast.net with ESMTP id 4PR7jXzYueHaE4QCljUQQZ; Wed, 19 Feb 2020 14:19:59 +0000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcastmailservice.net; s=20180828_2048; t=1582121999; bh=zREuezz2WfRtL5xqeWJSSINvFtPTix3YWiBqn53OwTQ=; h=Received:Received:Received:Date:From:To:Subject:Message-ID: MIME-Version:Content-Type; b=Ib9zCpv8wMtfD3cCPiw//ciAGd1f4AV6z0h5eU2jfQpelbiFKvWBetaCjtnkHA1kd ZEfk+Kumx35R9ha0n7gY+2LG0mOzfeKh1pLv5/anlbzAqLQpJN9szYeIBNQlq2oeDb O10IqY67sLgyFnEElb3YM8lxiEtjWaYFYYd08MRXg/+yp8i6UjeI/KCVZ9xg75Gaj8 jgfz03rP0R6g35CItUc3Rd3/vL1XGcQbam2gsmlwBuYdtp/krorsvtHU/t4yuoSf6k yhAs7NqGMHuhfZS5fxxEDBn2bpYYZYdMecvrgs7rIQMzqeV2gR4W+YcTSN18IzHLVX Rt8xnTH3nBIIw== Received: from moe ([76.21.90.186]) by resomta-po-16v.sys.comcast.net with ESMTPA id 4QCijzAv5y3NM4QCjj7udY; Wed, 19 Feb 2020 14:19:59 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedugedrkedtgdeifecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecunecujfgurhepfffhvffukfggtggusehttdertddttddvnecuhfhrohhmpefuthgvvhgvucfoohhrrhhishcuoehmohhrrhhishessghuihhnvggrrdgtohhmqeenucfkphepjeeirddvuddrledtrddukeeinecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehhvghlohepmhhovgdpihhnvghtpeejiedrvddurdeltddrudekiedpmhgrihhlfhhrohhmpehmohhrrhhishessghuihhnvggrrdgtohhmpdhrtghpthhtoheprghlshgrqdguvghvvghlsegrlhhsrgdqphhrohhjvggtthdrohhrgh X-Xfinity-VMeta: sc=0.00;st=legit Received: by moe (Postfix, from userid 1000) id 84C1C2011B; Wed, 19 Feb 2020 06:19:56 -0800 (PST) Date: Wed, 19 Feb 2020 06:19:56 -0800 From: Steve Morris To: alsa-devel@alsa-project.org Subject: sytem reboots when initializing Edirol FA-101 firewire audio interface Message-ID: <20200219141956.GA14216@buinea.com> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline X-BeenThere: alsa-devel@alsa-project.org X-Mailman-Version: 2.1.15 Precedence: list List-Id: "Alsa-devel mailing list for ALSA developers - http://www.alsa-project.org" List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: alsa-devel-bounces@alsa-project.org Sender: "Alsa-devel" Hi All, I'm running Arch Linux x86_64 My system consistently reboots when I power on my FA-101 when running kernels 5.5.1-4. Downgrading to 5.4.15 allows everything to work properly. Here's the outpu of: journalctl | grep -E 'Reboot|firewire|fw|bebob|alsa|jack' This is a good init under 5.4.15: -- Reboot -- powered on interface while running 5.4.15, initialized properly Feb 18 18:35:37 hostname kernel: firewire_ohci 0000:05:00.0: enabling device (0080 -> 0083) Feb 18 18:35:37 hostname kernel: firewire_ohci 0000:05:00.0: added OHCI v1.10 device as card 0, 4 IR + 8 IT contexts, quirks 0x11 Feb 18 18:35:37 hostname kernel: firewire_core 0000:05:00.0: created device fw0: GUID 0011223333666677, S400 Feb 18 18:35:37 hostname systemd-udevd[541]: controlC0: Process '/usr/bin/alsactl restore 0' failed with exit code 99. Feb 18 18:35:37 hostname systemd-udevd[541]: controlC1: Process '/usr/bin/alsactl restore 1' failed with exit code 99. Feb 18 18:35:38 hostname kernel: amdgpu: [powerplay] smu driver if version = 0x00000033, smu fw if version = 0x00000035, smu fw version = 0x002a3200 (42.50.0) Feb 18 18:36:08 hostname kernel: firewire_ohci 0000:05:00.0: isochronous cycle inconsistent Feb 18 18:36:08 hostname kernel: firewire_core 0000:05:00.0: created device fw1: GUID 0040ab0000c20bc1, S400 Feb 18 18:36:08 hostname kernel: firewire_core 0000:05:00.0: phy config: new root=ffc1, gap_count=5 Feb 18 18:36:10 hostname kernel: firewire_core 0000:05:00.0: BM lock failed (timeout), making local node (ffc0) root Feb 18 18:36:10 hostname kernel: firewire_core 0000:05:00.0: phy config: new root=ffc0, gap_count=5 Feb 18 18:36:12 hostname systemd-udevd[1532]: controlC2: Process '/usr/bin/alsactl restore 2' failed with exit code 99. Feb 18 18:36:15 hostname kernel: snd-bebob fw1.0: transaction failed: no ack Feb 18 18:36:15 hostname kernel: snd-bebob fw1.0: fail to get an input for MSU in plug 7: -5 Feb 18 18:36:15 hostname kernel: snd-bebob fw1.0: transaction failed: no ack Feb 18 18:36:15 hostname kernel: snd-bebob fw1.0: fail to get an input for MSU in plug 7: -5 This is a bad init under 5.5.4: -- Reboot -- Powered on interface when machine was running. Feb 18 18:13:37 hostname kernel: firewire_ohci 0000:05:00.0: enabling device (0080 -> 0083) Feb 18 18:13:37 hostname kernel: firewire_ohci 0000:05:00.0: added OHCI v1.10 device as card 0, 4 IR + 8 IT contexts, quirks 0x11 Feb 18 18:13:37 hostname kernel: firewire_core 0000:05:00.0: created device fw0: GUID 0011223333666677, S400 Feb 18 18:13:37 hostname kernel: audit: type=1130 audit(1582078417.360:3): pid=1 uid=0 auid=4294967295 ses=4294967295 msg='unit=ufw comm="systemd" exe="/usr/lib/systemd/systemd" hostname=? addr=? terminal=? res=success' Feb 18 18:13:37 hostname audit[1]: SERVICE_START pid=1 uid=0 auid=4294967295 ses=4294967295 msg='unit=ufw comm="systemd" exe="/usr/lib/systemd/systemd" hostname=? addr=? terminal=? res=success' Feb 18 18:13:37 hostname systemd-udevd[539]: controlC0: Process '/usr/bin/alsactl restore 0' failed with exit code 99. Feb 18 18:13:37 hostname systemd-udevd[530]: controlC1: Process '/usr/bin/alsactl restore 1' failed with exit code 99. Feb 18 18:13:38 hostname kernel: amdgpu: [powerplay] smu driver if version = 0x00000033, smu fw if version = 0x00000035, smu fw version = 0x002a3200 (42.50.0) Feb 18 18:19:45 hostname kernel: firewire_core 0000:05:00.0: phy config: new root=ffc1, gap_count=5 Feb 18 18:19:48 hostname kernel: firewire_core 0000:05:00.0: phy config: new root=ffc1, gap_count=5 Feb 18 18:19:48 hostname kernel: firewire_core 0000:05:00.0: created device fw1: GUID 0040ab0000c20bc1, S400 Feb 18 18:19:52 hostname systemd-udevd[1682]: controlC2: Process '/usr/bin/alsactl restore 2' failed with exit code 99. Feb 18 18:20:08 hostname kernel: snd-bebob fw1.0: transaction failed: no ack Feb 18 18:20:08 hostname kernel: snd-bebob fw1.0: fail to get an input for MSU in plug 7: -5 Feb 18 18:20:08 hostname kernel: snd-bebob fw1.0: transaction failed: no ack Feb 18 18:20:08 hostname kernel: snd-bebob fw1.0: fail to get an input for MSU in plug 7: -5 Feb 18 18:20:12 hostname kernel: firewire_core 0000:05:00.0: phy config: new root=ffc1, gap_count=5 Feb 18 18:21:24 hostname kernel: firewire_ohci 0000:05:00.0: AMD-Vi: Event logged [IO_PAGE_FAULT domain=0x0001 address=0xd5080000 flags=0x0000] Followed by 125 more O_PAGE_FAULT and then the reboot, I'll be happy to provide additional information if needed. Steve