From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from smtp.kernel.org (aws-us-west-2-korg-mail-1.web.codeaurora.org [10.30.226.201]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 6569929D264 for ; Thu, 23 Apr 2026 13:50:45 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=10.30.226.201 ARC-Seal:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1776952245; cv=none; b=JUUdF4HGnvpZ2o5728yeO0oo/5aMKhKvdXRv4PSXIbM//P3wfSIUWfJdme1UzrM9/tIrgn4JF9GYZer/89tGLTEoZcvIvPGeAtSrXmb9oarl1LQEPtCimpaKj4Y1GZUV8CWcmAcEH77hG4v9xTAlMRnViTzPNmhRM3VlZZcQxcg= ARC-Message-Signature:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1776952245; c=relaxed/simple; bh=lJe5kXTu+YX4D4j9UOQWwEuLNBKj3YHAJXvsvUubzr4=; h=MIME-Version:Date:From:To:Cc:Message-Id:In-Reply-To:References: Subject:Content-Type; b=ezJGyKVK+x0SPDZR0f7ImbH2bgV1tbeKwPnHHP16JKmmIHtqvSBKpiL9zPXsQgsulv5cr1Hk1ag/8dBI2ML2euk5iPN2p7M/28w0832W+vwbMnxChfx8GXUL1SBwbMA/S2hQhOLm3YsY+6QlVOtpI3OxjI8BIJGugZ1enlrzjlU= ARC-Authentication-Results:i=1; smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=kernel.org header.i=@kernel.org header.b=csOiXXMc; arc=none smtp.client-ip=10.30.226.201 Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=kernel.org header.i=@kernel.org header.b="csOiXXMc" Received: by smtp.kernel.org (Postfix) with ESMTPSA id D8109C2BCAF; Thu, 23 Apr 2026 13:50:44 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=kernel.org; s=k20201202; t=1776952245; bh=lJe5kXTu+YX4D4j9UOQWwEuLNBKj3YHAJXvsvUubzr4=; h=Date:From:To:Cc:In-Reply-To:References:Subject:From; b=csOiXXMcJaSlynjFQfteWSMuXBxjYMUkeM8CqG6bQOy4jXIsv9QT6jd3s5rBs6n4p n3en968aXVt55dL/SVBb6MjJ/UNTg4qQa052brFzorYN63f688BnTe9zkURyHyKvhg rWdku/mMxF5YB+f+aE8uIt0I+3ba8a9JQLs0pN+xNF9xq2cg0d/oVRmly4+QC5urHC 5TjNH9UNiKmDnYwss4zKTLfyzbfdl6wt3J+3CO78Jqk46dd7rQrc3C38WwLP4G0Poh +1uLta63+a9RfhIG/6nFNFGYAnMg8xOYfKSpZfKskwny4txT9dxlqFC3bjxrECAfEB qzNE4gWmNIrrg== Received: from phl-compute-10.internal (phl-compute-10.internal [10.202.2.50]) by mailfauth.phl.internal (Postfix) with ESMTP id D9ADEF4006A; Thu, 23 Apr 2026 09:50:43 -0400 (EDT) Received: from phl-imap-15 ([10.202.2.104]) by phl-compute-10.internal (MEProxy); Thu, 23 Apr 2026 09:50:43 -0400 X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefhedrtddtgdeijeefudcutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpuffrtefokffrpgfnqfghnecuuegr ihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjug hrpefoggffhffvvefkjghfufgtgfesthejredtredttdenucfhrhhomhepfdevhhhutghk ucfnvghvvghrfdcuoegtvghlsehkvghrnhgvlhdrohhrgheqnecuggftrfgrthhtvghrnh epheffjeejtddvieehjefhfeeijefggfehjefhgfejtdetudektdelteduiefhveevnecu ffhomhgrihhnpehgihhthhhusgdrtghomhenucevlhhushhtvghrufhiiigvpedtnecurf grrhgrmhepmhgrihhlfhhrohhmpegthhhutghklhgvvhgvrhdomhgvshhmthhprghuthhh phgvrhhsohhnrghlihhthidqudeifeegleelleehledqfedvleekgeegvdefqdgtvghlpe epkhgvrhhnvghlrdhorhhgsehfrghsthhmrghilhdrtghomhdpnhgspghrtghpthhtohep hedpmhhouggvpehsmhhtphhouhhtpdhrtghpthhtohepuggrrdhgohhmvgiisehkvghrnh gvlhdrohhrghdprhgtphhtthhopehmtghgrhhofheskhgvrhhnvghlrdhorhhgpdhrtghp thhtohepkhguvghvohhpsheslhhishhtshdrlhhinhhugidruggvvhdprhgtphhtthhope gthhhutghkrdhlvghvvghrsehorhgrtghlvgdrtghomhdprhgtphhtthhopegurgdrghho mhgviiesshgrmhhsuhhnghdrtghomh X-ME-Proxy: Feedback-ID: ifa6e4810:Fastmail Received: by mailuser.phl.internal (Postfix, from userid 501) id BA461780070; Thu, 23 Apr 2026 09:50:43 -0400 (EDT) X-Mailer: MessagingEngine.com Webmail Interface Precedence: bulk X-Mailing-List: kdevops@lists.linux.dev List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 X-ThreadId: A1PDt4UYK_lo Date: Thu, 23 Apr 2026 09:50:23 -0400 From: "Chuck Lever" To: "Daniel Gomez" , "Luis Chamberlain" , "Chuck Lever" Cc: kdevops@lists.linux.dev, "Daniel Gomez" Message-Id: In-Reply-To: <20260423-kdevops-series-a-fixes-v1-0-69a82d0e1631@samsung.com> References: <20260423-kdevops-series-a-fixes-v1-0-69a82d0e1631@samsung.com> Subject: Re: [PATCH 0/8] kdevops: small NIXOS and gen_hosts fixes Content-Type: text/plain Content-Transfer-Encoding: 7bit On Wed, Apr 22, 2026, at 6:16 PM, Daniel Gomez wrote: > Small cleanups picked up while building the new bringup backend that > depends on this series. Each patch is independent and stands on its > own: duplicated Makefile vars, ineffective silent recipe guards, libvirt > XML and cleanup path drift on the NIXOS role, and gen_hosts rough edges > around inventory group scoping and inventory owner refresh. > > Preparatory series for the upstreaming of nixos-qemu [1] and > qemu-system-units [2] as git subtrees. The two projects provide an > alternative to kdevops libvirtd, libguestfs, and virsh stack for local > VM bringup, one that sidesteps the sudo and privilege escalation the > Ansible host-setup playbooks currently need on the control node to drive > that stack. libvirt bringup stays the default and is untouched; the > alternative is opt-in via Kconfig. qemu-system-units renders the QEMU > command line from templates into a systemd user service, so VMs run in > the user session with no root daemon and no new wrapper on top of QEMU. > nixos-qemu builds image-based and imageless guests declaratively through > a NixOS flake, with no libguestfs in the loop. > > Link: https://github.com/linux-kdevops/nixos-qemu [1] > Link: https://github.com/linux-kdevops/qemu-system-units [2] > Signed-off-by: Daniel Gomez > --- > Daniel Gomez (8): > nixos: remove duplicate nixos_channel extra-var from Makefile > nixos: do not emit comment-only recipe lines under $(Q) > nixos: drop hardcoded qxl video model from libvirt XML > nixos: destroy the libvirt domain before cleaning up local artefacts > gen_hosts: scope the python interpreter per inventory group > gen_hosts: make the linux workflow node name follow bootlinux_builder > defconfigs/nixos: name NIXOS hosts with the "nixos" prefix > gen_hosts: drop sudo become on inventory owner refresh Not needing root privilege for local virtualization sounds great to me! The only hesitation is I would like to test the gen_hosts changes in this series with the cloud providers, but I currently don't have any kdevops branch that is newer than 6 months old. I will need to update something and try it out. -- Chuck Lever