From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 09EF8C04FE0 for ; Fri, 4 Aug 2023 21:26:18 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231196AbjHDV0Q (ORCPT ); Fri, 4 Aug 2023 17:26:16 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:44072 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S231140AbjHDV0M (ORCPT ); Fri, 4 Aug 2023 17:26:12 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id AED66E46; Fri, 4 Aug 2023 14:26:10 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id cae361074099a2a1; Fri, 4 Aug 2023 23:26:09 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 7A7AB661680; Fri, 4 Aug 2023 23:26:08 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v4 04/10] thermal: core: Add thermal_zone_update_trip_temp() helper routine Date: Fri, 04 Aug 2023 23:05:40 +0200 Message-ID: <1967710.PYKUYFuaPT@kreacher> In-Reply-To: <4878513.31r3eYUQgx@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4878513.31r3eYUQgx@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkeeggdduheelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgepvdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki Introduce a helper routine called thermal_zone_update_trip_temp() that can be used to update a trip point's temperature with the help of a pointer to local data associated with that trip point provided by the thermal driver that created it. Signed-off-by: Rafael J. Wysocki --- New patch in v4. --- drivers/thermal/thermal_trip.c | 37 +++++++++++++++++++++++++++++++++++++ include/linux/thermal.h | 4 ++++ 2 files changed, 41 insertions(+) Index: linux-pm/drivers/thermal/thermal_trip.c =================================================================== --- linux-pm.orig/drivers/thermal/thermal_trip.c +++ linux-pm/drivers/thermal/thermal_trip.c @@ -180,3 +180,40 @@ int thermal_zone_set_trip(struct thermal return 0; } + +/** + * thermal_zone_update_trip_temp - Update the trip point temperature. + * @tz: Thermal zone. + * @trip_priv: Trip tag. + * @temp: New trip temperature. + * + * This only works for thermal zones using trip tables and its caller must + * ensure that the zone lock is held before using it. + * + * @trip_priv is expected to be the value that has been stored by the driver + * in the struct thermal_trip representing the trip point in question, so it + * can be matched against the value of the priv field in that structure. + * + * If @trip_priv does not match any trip point in the trip table of @tz, + * nothing happens. + */ +void thermal_zone_update_trip_temp(struct thermal_zone_device *tz, + void *trip_priv, int temperature) +{ + int i; + + lockdep_assert_held(&tz->lock); + + if (!tz->trips || !trip_priv) + return; + + for (i = 0; i < tz->num_trips; i++) { + struct thermal_trip *trip = &tz->trips[i]; + + if (trip->priv == trip_priv) { + trip->temperature = temperature; + return; + } + } +} +EXPORT_SYMBOL_GPL(thermal_zone_update_trip_temp); Index: linux-pm/include/linux/thermal.h =================================================================== --- linux-pm.orig/include/linux/thermal.h +++ linux-pm/include/linux/thermal.h @@ -286,9 +286,13 @@ int __thermal_zone_get_trip(struct therm struct thermal_trip *trip); int thermal_zone_get_trip(struct thermal_zone_device *tz, int trip_id, struct thermal_trip *trip); +void thermal_zone_update_trip_temp(struct thermal_zone_device *tz, + void *trip_priv, int temperature); int thermal_zone_set_trip(struct thermal_zone_device *tz, int trip_id, const struct thermal_trip *trip); +void thermal_zone_update_trip_temp(struct thermal_zone_device *tz, + void *trip_priv, int temperature); int thermal_zone_get_num_trips(struct thermal_zone_device *tz);