From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 08190EE3F0D for ; Tue, 12 Sep 2023 18:47:53 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S237542AbjILSrz (ORCPT ); Tue, 12 Sep 2023 14:47:55 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:46494 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S237535AbjILSrp (ORCPT ); Tue, 12 Sep 2023 14:47:45 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id F0A7F10F6; Tue, 12 Sep 2023 11:47:40 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 14a9d9dd490c3409; Tue, 12 Sep 2023 20:47:39 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 81E38663C2D; Tue, 12 Sep 2023 20:47:38 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v1 5/9] ACPI: thermal: Simplify critical and hot trips representation Date: Tue, 12 Sep 2023 20:41:06 +0200 Message-ID: <3249479.aeNJFYEL58@kreacher> In-Reply-To: <5708760.DvuYhMxLoT@kreacher> References: <5708760.DvuYhMxLoT@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudeiiedgudeftdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehs rhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki Notice that the only piece of information regarding the critical and hot trips that needs to be stored in the driver's local data structures is whether or not these trips are valid, so drop all of the redundant information from there and adjust the code accordingly. Among other things, this requires acpi_thermal_add() to be rearranged so as to obtain the critical trip temperature before populating the trip points table and for symmetry, the hot trip temperature is obtained earlier too. No intentional functional impact. Signed-off-by: Rafael J. Wysocki --- drivers/acpi/thermal.c | 69 +++++++++++++++++++++++-------------------------- 1 file changed, 33 insertions(+), 36 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -107,10 +107,10 @@ struct acpi_thermal_active { }; struct acpi_thermal_trips { - struct acpi_thermal_trip critical; - struct acpi_thermal_trip hot; struct acpi_thermal_passive passive; struct acpi_thermal_active active[ACPI_THERMAL_MAX_ACTIVE]; + bool critical_valid; + bool hot_valid; }; struct acpi_thermal { @@ -391,7 +391,7 @@ static void acpi_thermal_trips_update(st dev_name(&adev->dev), event, 0); } -static void acpi_thermal_get_critical_trip(struct acpi_thermal *tz) +static long acpi_thermal_get_critical_trip(struct acpi_thermal *tz) { unsigned long long tmp; acpi_status status; @@ -420,34 +420,30 @@ static void acpi_thermal_get_critical_tr } set: - tz->trips.critical.valid = true; - tz->trips.critical.temperature = tmp; - acpi_handle_debug(tz->device->handle, "Critical threshold [%lu]\n", - tz->trips.critical.temperature); - return; + tz->trips.critical_valid = true; + acpi_handle_debug(tz->device->handle, "Critical threshold [%llu]\n", tmp); + return tmp; fail: - tz->trips.critical.valid = false; - tz->trips.critical.temperature = THERMAL_TEMP_INVALID; + tz->trips.critical_valid = false; + return THERMAL_TEMP_INVALID; } -static void acpi_thermal_get_hot_trip(struct acpi_thermal *tz) +static long acpi_thermal_get_hot_trip(struct acpi_thermal *tz) { unsigned long long tmp; acpi_status status; status = acpi_evaluate_integer(tz->device->handle, "_HOT", NULL, &tmp); if (ACPI_FAILURE(status)) { - tz->trips.hot.valid = false; - tz->trips.hot.temperature = THERMAL_TEMP_INVALID; + tz->trips.hot_valid = false; acpi_handle_debug(tz->device->handle, "No hot threshold\n"); - return; + return THERMAL_TEMP_INVALID; } - tz->trips.hot.valid = true; - tz->trips.hot.temperature = tmp; - acpi_handle_debug(tz->device->handle, "Hot threshold [%lu]\n", - tz->trips.hot.temperature); + tz->trips.hot_valid = true; + acpi_handle_debug(tz->device->handle, "Hot threshold [%llu]\n", tmp); + return tmp; } static int acpi_thermal_get_trip_points(struct acpi_thermal *tz) @@ -455,17 +451,9 @@ static int acpi_thermal_get_trip_points( unsigned int count = 0; int i; - acpi_thermal_get_critical_trip(tz); - acpi_thermal_get_hot_trip(tz); /* Passive and active trip points (optional). */ __acpi_thermal_trips_update(tz, ACPI_TRIPS_INIT); - if (tz->trips.critical.valid) - count++; - - if (tz->trips.hot.valid) - count++; - if (tz->trips.passive.trip.valid) count++; @@ -578,10 +566,10 @@ static int acpi_thermal_cooling_device_c int trip = -1; int result = 0; - if (tz->trips.critical.valid) + if (tz->trips.critical_valid) trip++; - if (tz->trips.hot.valid) + if (tz->trips.hot_valid) trip++; if (tz->trips.passive.trip.valid) { @@ -803,10 +791,9 @@ static void acpi_thermal_aml_dependency_ * The heuristic below should work for all ACPI thermal zones which have a * critical trip point with a value being a multiple of 0.5 degree Celsius. */ -static void acpi_thermal_guess_offset(struct acpi_thermal *tz) +static void acpi_thermal_guess_offset(struct acpi_thermal *tz, long crit_temp) { - if (tz->trips.critical.valid && - (tz->trips.critical.temperature % 5) == 1) + if (tz->trips.critical_valid && crit_temp % 5 == 1) tz->kelvin_offset = 273100; else tz->kelvin_offset = 273200; @@ -843,6 +830,7 @@ static int acpi_thermal_add(struct acpi_ struct thermal_trip *trip; struct acpi_thermal *tz; unsigned int trip_count; + int crit_temp, hot_temp; int passive_delay = 0; int result; int i; @@ -864,6 +852,15 @@ static int acpi_thermal_add(struct acpi_ /* Get trip points [_CRT, _PSV, etc.] (required). */ trip_count = acpi_thermal_get_trip_points(tz); + + crit_temp = acpi_thermal_get_critical_trip(tz); + if (tz->trips.critical_valid) + trip_count++; + + hot_temp = acpi_thermal_get_hot_trip(tz); + if (tz->trips.hot_valid) + trip_count++; + if (!trip_count) { pr_warn(FW_BUG "No valid trip points!\n"); result = -ENODEV; @@ -885,7 +882,7 @@ static int acpi_thermal_add(struct acpi_ else acpi_thermal_get_polling_frequency(tz); - acpi_thermal_guess_offset(tz); + acpi_thermal_guess_offset(tz, crit_temp); trip = kcalloc(trip_count, sizeof(*trip), GFP_KERNEL); if (!trip) @@ -893,15 +890,15 @@ static int acpi_thermal_add(struct acpi_ tz->trip_table = trip; - if (tz->trips.critical.valid) { + if (tz->trips.critical_valid) { trip->type = THERMAL_TRIP_CRITICAL; - trip->temperature = acpi_thermal_temp(tz, tz->trips.critical.temperature); + trip->temperature = acpi_thermal_temp(tz, crit_temp); trip++; } - if (tz->trips.hot.valid) { + if (tz->trips.hot_valid) { trip->type = THERMAL_TRIP_HOT; - trip->temperature = acpi_thermal_temp(tz, tz->trips.hot.temperature); + trip->temperature = acpi_thermal_temp(tz, hot_temp); trip++; }