From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from relay3-d.mail.gandi.net (relay3-d.mail.gandi.net [217.70.183.195]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 330618F58; Sun, 3 Aug 2025 01:31:11 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=217.70.183.195 ARC-Seal:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1754184676; cv=none; b=mo+rMVYp2ZNOgANUko8y8IXB9Ff8Z/4IL6BpzPWzfdI5BwvIuvPUCXOJ4U5Ebzfp6r3q2oa65Lgx14eqWG87hBpW1hAfDL4hhF2gDaHYZ120m2aV+BK4dTCC+tjS1z1xvh/zrGiez9oxY+bxt+BeNNEDQ2C+VRM+iMTRBmiV4oY= ARC-Message-Signature:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1754184676; c=relaxed/simple; bh=gtr2b4oDdelE3AR3MetlqDOkVAxXrRLPzqmbARRF+f8=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=F+N4f+/1fnAKHy60rwsrHuR8XwprgvpNet7OM/8e9/9/DEZK+m1CBVeWSoPtqrHhciMO3/8WGLzMD3CTsLoAm0D3WKiiWiW00euB95KEai5JGPhZe1KDvZslbydODvCYJE4Y7M+wxiIgW4rHyeqv3hJ3uMWyK7HKJVkjWJv4d28= ARC-Authentication-Results:i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com; spf=pass smtp.mailfrom=bootlin.com; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b=ik9cPqzD; arc=none smtp.client-ip=217.70.183.195 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=bootlin.com Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b="ik9cPqzD" Received: by mail.gandi.net (Postfix) with ESMTPSA id 9C9A21F68D; Sun, 3 Aug 2025 01:31:09 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1754184670; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=a2+aIfYkPPNmXqv0UTcyAkx9bHVmsS9707Z90k5L7A0=; b=ik9cPqzD8i2zYxIiSjffJRD9UklGLZblw2dckym2bvlQc8bocpgsSL55yJFzFX8uiP/qGD x9svSADhUOR25RDHQptfX8Ym0tuyZ3+wOQ/aWGJfdgK/rVpHvEJk+5VqWsVRcRmhsXAlEC iIWkhN/ikVOJ/EkxNULjIn6asut042+JqHP7rQs5Vl2BXyRkQaoWCgvIN2A2x5c/BQzSpX b7eCUWoVUsefU49o+09zeDEIEsB4D5CUaNd9WYdSx/G9IkvfMNi17XJlmKeGXOFJrrGc4x J2+l+gbJtkWl6/pxp1b6OkKcE6C+FKLgH/P+QygURKQDbMZYN8QnItaFmWV2zg== Date: Sun, 3 Aug 2025 03:31:09 +0200 From: Alexandre Belloni To: Krzysztof Kozlowski Cc: Rob Herring , Krzysztof Kozlowski , Conor Dooley , linux-arm-kernel@lists.infradead.org, devicetree@vger.kernel.org, linux-kernel@vger.kernel.org, linux-mediatek@lists.infradead.org, linux-arm-msm@vger.kernel.org, iommu@lists.linux.dev, linux-leds@vger.kernel.org, linux-mmc@vger.kernel.org, linux-tegra@vger.kernel.org, linux-rtc@vger.kernel.org, linux-renesas-soc@vger.kernel.org, Ulf Hansson , Lee Jones , Thierry Reding , Geert Uytterhoeven Subject: Re: [PATCH v2] dt-bindings: Correct indentation and style in DTS example Message-ID: <2025080301310992daa91a@mail.local> References: <20250725100241.120106-2-krzysztof.kozlowski@linaro.org> Precedence: bulk X-Mailing-List: linux-arm-msm@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <20250725100241.120106-2-krzysztof.kozlowski@linaro.org> X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtdefgddutdekudegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuifetpfffkfdpucggtfgfnhhsuhgsshgtrhhisggvnecuuegrihhlohhuthemuceftddunecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpeffhffvvefukfhfgggtuggjsehttdertddttddvnecuhfhrohhmpeetlhgvgigrnhgurhgvuceuvghllhhonhhiuceorghlvgigrghnughrvgdrsggvlhhlohhnihessghoohhtlhhinhdrtghomheqnecuggftrfgrthhtvghrnhepieejfefhffekjeeuheevueevjedvleevjeetudffheeutdffudefjeduffeuvddtnecuffhomhgrihhnpehkvghrnhgvlhdrohhrghdpsghoohhtlhhinhdrtghomhenucfkphepvdgrtddumegvtdgrmedvugemieefjedtmeejkegvtdemtgdtvgekmedvkedtieemkegrtgeinecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvdgrtddumegvtdgrmedvugemieefjedtmeejkegvtdemtgdtvgekmedvkedtieemkegrtgeipdhhvghloheplhhotggrlhhhohhsthdpmhgrihhlfhhrohhmpegrlhgvgigrnhgurhgvrdgsvghllhhonhhisegsohhothhlihhnrdgtohhmpdhnsggprhgtphhtthhopeduledprhgtphhtthhopehkrhiihihsiihtohhfrdhkohiilhhofihskhhisehlihhnrghrohdrohhrghdprhgtphhtthhopehrohgshheskhgvrhhnvghlrdhorhhgp dhrtghpthhtohepkhhriihkodgutheskhgvrhhnvghlrdhorhhgpdhrtghpthhtoheptghonhhorhdoughtsehkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdgrrhhmqdhkvghrnhgvlheslhhishhtshdrihhnfhhrrgguvggrugdrohhrghdprhgtphhtthhopeguvghvihgtvghtrhgvvgesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhmvgguihgrthgvkheslhhishhtshdrihhnfhhrrgguvggrugdrohhrgh X-GND-Sasl: alexandre.belloni@bootlin.com On 25/07/2025 12:02:42+0200, Krzysztof Kozlowski wrote: > DTS example in the bindings should be indented with 2- or 4-spaces and > aligned with opening '- |', so correct any differences like 3-spaces or > mixtures 2- and 4-spaces in one binding. > > No functional changes here, but saves some comments during reviews of > new patches built on existing code. > > Acked-by: Ulf Hansson # For MMC > Acked-by: Lee Jones > Acked-by: Thierry Reding > Reviewed-by: Geert Uytterhoeven # renesas > Link: https://lore.kernel.org/r/20250107131456.247610-1-krzysztof.kozlowski@linaro.org > Signed-off-by: Krzysztof Kozlowski > Acked-by: Alexandre Belloni > --- > > Changes in v2: > 1. Rebase on latest Rob's for-next tree, collect tags. > 2. Patch also applies cleanly on next, so there are no cross tree > conflicts expected. > --- > .../arm/arm,trace-buffer-extension.yaml | 10 +- > .../bindings/arm/stm32/st,mlahb.yaml | 20 +- > .../bindings/dsp/mediatek,mt8195-dsp.yaml | 42 ++-- > ...ntel,ixp4xx-network-processing-engine.yaml | 52 ++--- > .../bindings/fpga/xlnx,versal-fpga.yaml | 2 +- > .../bindings/iommu/riscv,iommu.yaml | 6 +- > .../devicetree/bindings/leds/leds-mt6360.yaml | 195 +++++++++--------- > .../devicetree/bindings/mips/brcm/soc.yaml | 42 ++-- > .../misc/intel,ixp4xx-ahb-queue-manager.yaml | 6 +- > .../devicetree/bindings/mmc/renesas,sdhi.yaml | 78 +++---- > .../bindings/mtd/technologic,nand.yaml | 2 +- > .../bindings/nvmem/amlogic,meson6-efuse.yaml | 2 +- > .../bindings/pci/ti,j721e-pci-ep.yaml | 34 +-- > .../bindings/power/reset/qcom,pon.yaml | 62 +++--- > .../nvidia,tegra264-bpmp-shmem.yaml | 15 +- > .../bindings/rtc/renesas,rzn1-rtc.yaml | 22 +- > .../amlogic/amlogic,meson-gx-hhi-sysctrl.yaml | 26 +-- > .../bindings/soc/qcom/qcom,eud.yaml | 38 ++-- > .../bindings/soc/ti/wkup-m3-ipc.yaml | 32 +-- > 19 files changed, 343 insertions(+), 343 deletions(-) > > diff --git a/Documentation/devicetree/bindings/arm/arm,trace-buffer-extension.yaml b/Documentation/devicetree/bindings/arm/arm,trace-buffer-extension.yaml > index 87128e7b7d28..f5b54b4fc55d 100644 > --- a/Documentation/devicetree/bindings/arm/arm,trace-buffer-extension.yaml > +++ b/Documentation/devicetree/bindings/arm/arm,trace-buffer-extension.yaml > @@ -41,10 +41,10 @@ additionalProperties: false > examples: > > - | > - #include > + #include > > - trbe { > - compatible = "arm,trace-buffer-extension"; > - interrupts = ; > - }; > + trbe { > + compatible = "arm,trace-buffer-extension"; > + interrupts = ; > + }; > ... > diff --git a/Documentation/devicetree/bindings/arm/stm32/st,mlahb.yaml b/Documentation/devicetree/bindings/arm/stm32/st,mlahb.yaml > index 3e996346b264..4970b9167d1c 100644 > --- a/Documentation/devicetree/bindings/arm/stm32/st,mlahb.yaml > +++ b/Documentation/devicetree/bindings/arm/stm32/st,mlahb.yaml > @@ -55,17 +55,17 @@ unevaluatedProperties: false > examples: > - | > ahb { > - compatible = "st,mlahb", "simple-bus"; > - #address-cells = <1>; > - #size-cells = <1>; > - ranges; > - dma-ranges = <0x00000000 0x38000000 0x10000>, > - <0x10000000 0x10000000 0x60000>, > - <0x30000000 0x30000000 0x60000>; > + compatible = "st,mlahb", "simple-bus"; > + #address-cells = <1>; > + #size-cells = <1>; > + ranges; > + dma-ranges = <0x00000000 0x38000000 0x10000>, > + <0x10000000 0x10000000 0x60000>, > + <0x30000000 0x30000000 0x60000>; > > - m4_rproc: m4@10000000 { > - reg = <0x10000000 0x40000>; > - }; > + m4_rproc: m4@10000000 { > + reg = <0x10000000 0x40000>; > + }; > }; > > ... > diff --git a/Documentation/devicetree/bindings/dsp/mediatek,mt8195-dsp.yaml b/Documentation/devicetree/bindings/dsp/mediatek,mt8195-dsp.yaml > index ca8d8661f872..abc52978be7a 100644 > --- a/Documentation/devicetree/bindings/dsp/mediatek,mt8195-dsp.yaml > +++ b/Documentation/devicetree/bindings/dsp/mediatek,mt8195-dsp.yaml > @@ -81,25 +81,25 @@ examples: > #include > #include > dsp@10803000 { > - compatible = "mediatek,mt8195-dsp"; > - reg = <0x10803000 0x1000>, > - <0x10840000 0x40000>; > - reg-names = "cfg", "sram"; > - clocks = <&topckgen 10>, //CLK_TOP_ADSP > - <&clk26m>, > - <&topckgen 107>, //CLK_TOP_AUDIO_LOCAL_BUS > - <&topckgen 136>, //CLK_TOP_MAINPLL_D7_D2 > - <&scp_adsp 0>, //CLK_SCP_ADSP_AUDIODSP > - <&topckgen 34>; //CLK_TOP_AUDIO_H > - clock-names = "adsp_sel", > - "clk26m_ck", > - "audio_local_bus", > - "mainpll_d7_d2", > - "scp_adsp_audiodsp", > - "audio_h"; > - memory-region = <&adsp_dma_mem_reserved>, > - <&adsp_mem_reserved>; > - power-domains = <&spm 6>; //MT8195_POWER_DOMAIN_ADSP > - mbox-names = "rx", "tx"; > - mboxes = <&adsp_mailbox0>, <&adsp_mailbox1>; > + compatible = "mediatek,mt8195-dsp"; > + reg = <0x10803000 0x1000>, > + <0x10840000 0x40000>; > + reg-names = "cfg", "sram"; > + clocks = <&topckgen 10>, //CLK_TOP_ADSP > + <&clk26m>, > + <&topckgen 107>, //CLK_TOP_AUDIO_LOCAL_BUS > + <&topckgen 136>, //CLK_TOP_MAINPLL_D7_D2 > + <&scp_adsp 0>, //CLK_SCP_ADSP_AUDIODSP > + <&topckgen 34>; //CLK_TOP_AUDIO_H > + clock-names = "adsp_sel", > + "clk26m_ck", > + "audio_local_bus", > + "mainpll_d7_d2", > + "scp_adsp_audiodsp", > + "audio_h"; > + memory-region = <&adsp_dma_mem_reserved>, > + <&adsp_mem_reserved>; > + power-domains = <&spm 6>; //MT8195_POWER_DOMAIN_ADSP > + mbox-names = "rx", "tx"; > + mboxes = <&adsp_mailbox0>, <&adsp_mailbox1>; > }; > diff --git a/Documentation/devicetree/bindings/firmware/intel,ixp4xx-network-processing-engine.yaml b/Documentation/devicetree/bindings/firmware/intel,ixp4xx-network-processing-engine.yaml > index e6bed7d93e2d..50f1f08744a1 100644 > --- a/Documentation/devicetree/bindings/firmware/intel,ixp4xx-network-processing-engine.yaml > +++ b/Documentation/devicetree/bindings/firmware/intel,ixp4xx-network-processing-engine.yaml > @@ -62,33 +62,33 @@ examples: > #include > > npe: npe@c8006000 { > - compatible = "intel,ixp4xx-network-processing-engine"; > - reg = <0xc8006000 0x1000>, <0xc8007000 0x1000>, <0xc8008000 0x1000>; > - #address-cells = <1>; > - #size-cells = <0>; > + compatible = "intel,ixp4xx-network-processing-engine"; > + reg = <0xc8006000 0x1000>, <0xc8007000 0x1000>, <0xc8008000 0x1000>; > + #address-cells = <1>; > + #size-cells = <0>; > > - hss@0 { > - compatible = "intel,ixp4xx-hss"; > - reg = <0>; > - intel,npe-handle = <&npe 0>; > - intel,queue-chl-rxtrig = <&qmgr 12>; > - intel,queue-chl-txready = <&qmgr 34>; > - intel,queue-pkt-rx = <&qmgr 13>; > - intel,queue-pkt-tx = <&qmgr 14>, <&qmgr 15>, <&qmgr 16>, <&qmgr 17>; > - intel,queue-pkt-rxfree = <&qmgr 18>, <&qmgr 19>, <&qmgr 20>, <&qmgr 21>; > - intel,queue-pkt-txdone = <&qmgr 22>; > - cts-gpios = <&gpio0 10 GPIO_ACTIVE_LOW>; > - rts-gpios = <&gpio0 14 GPIO_ACTIVE_LOW>; > - dcd-gpios = <&gpio0 6 GPIO_ACTIVE_LOW>; > - dtr-gpios = <&gpio_74 2 GPIO_ACTIVE_LOW>; > - clk-internal-gpios = <&gpio_74 0 GPIO_ACTIVE_HIGH>; > - }; > + hss@0 { > + compatible = "intel,ixp4xx-hss"; > + reg = <0>; > + intel,npe-handle = <&npe 0>; > + intel,queue-chl-rxtrig = <&qmgr 12>; > + intel,queue-chl-txready = <&qmgr 34>; > + intel,queue-pkt-rx = <&qmgr 13>; > + intel,queue-pkt-tx = <&qmgr 14>, <&qmgr 15>, <&qmgr 16>, <&qmgr 17>; > + intel,queue-pkt-rxfree = <&qmgr 18>, <&qmgr 19>, <&qmgr 20>, <&qmgr 21>; > + intel,queue-pkt-txdone = <&qmgr 22>; > + cts-gpios = <&gpio0 10 GPIO_ACTIVE_LOW>; > + rts-gpios = <&gpio0 14 GPIO_ACTIVE_LOW>; > + dcd-gpios = <&gpio0 6 GPIO_ACTIVE_LOW>; > + dtr-gpios = <&gpio_74 2 GPIO_ACTIVE_LOW>; > + clk-internal-gpios = <&gpio_74 0 GPIO_ACTIVE_HIGH>; > + }; > > - crypto { > - compatible = "intel,ixp4xx-crypto"; > - intel,npe-handle = <&npe 2>; > - queue-rx = <&qmgr 30>; > - queue-txready = <&qmgr 29>; > - }; > + crypto { > + compatible = "intel,ixp4xx-crypto"; > + intel,npe-handle = <&npe 2>; > + queue-rx = <&qmgr 30>; > + queue-txready = <&qmgr 29>; > + }; > }; > ... > diff --git a/Documentation/devicetree/bindings/fpga/xlnx,versal-fpga.yaml b/Documentation/devicetree/bindings/fpga/xlnx,versal-fpga.yaml > index 80833462f620..41b368d54557 100644 > --- a/Documentation/devicetree/bindings/fpga/xlnx,versal-fpga.yaml > +++ b/Documentation/devicetree/bindings/fpga/xlnx,versal-fpga.yaml > @@ -27,7 +27,7 @@ additionalProperties: false > examples: > - | > versal_fpga: versal-fpga { > - compatible = "xlnx,versal-fpga"; > + compatible = "xlnx,versal-fpga"; > }; > > ... > diff --git a/Documentation/devicetree/bindings/iommu/riscv,iommu.yaml b/Documentation/devicetree/bindings/iommu/riscv,iommu.yaml > index 5d015eeb06d0..d4838c3b3741 100644 > --- a/Documentation/devicetree/bindings/iommu/riscv,iommu.yaml > +++ b/Documentation/devicetree/bindings/iommu/riscv,iommu.yaml > @@ -139,9 +139,9 @@ examples: > > /* The IOMMU programming interface uses slot 00:01.0 */ > iommu0: iommu@1,0 { > - compatible = "pci1efd,edf1", "riscv,pci-iommu"; > - reg = <0x800 0 0 0 0>; > - #iommu-cells = <1>; > + compatible = "pci1efd,edf1", "riscv,pci-iommu"; > + reg = <0x800 0 0 0 0>; > + #iommu-cells = <1>; > }; > }; > }; > diff --git a/Documentation/devicetree/bindings/leds/leds-mt6360.yaml b/Documentation/devicetree/bindings/leds/leds-mt6360.yaml > index d84e28e616d7..d2e1d8afc302 100644 > --- a/Documentation/devicetree/bindings/leds/leds-mt6360.yaml > +++ b/Documentation/devicetree/bindings/leds/leds-mt6360.yaml > @@ -87,106 +87,105 @@ additionalProperties: false > > examples: > - | > - #include > - led-controller { > - compatible = "mediatek,mt6360-led"; > - #address-cells = <1>; > - #size-cells = <0>; > + #include > + led-controller { > + compatible = "mediatek,mt6360-led"; > + #address-cells = <1>; > + #size-cells = <0>; > > - multi-led@0 { > - reg = <0>; > - function = LED_FUNCTION_INDICATOR; > - color = ; > - led-max-microamp = <24000>; > - #address-cells = <1>; > - #size-cells = <0>; > - led@0 { > - reg = <0>; > - color = ; > - }; > - led@1 { > - reg = <1>; > - color = ; > - }; > - led@2 { > - reg = <2>; > - color = ; > - }; > - }; > - led@3 { > - reg = <3>; > - function = LED_FUNCTION_INDICATOR; > - color = ; > - led-max-microamp = <150000>; > - }; > - led@4 { > - reg = <4>; > - function = LED_FUNCTION_FLASH; > - color = ; > - function-enumerator = <1>; > - led-max-microamp = <200000>; > - flash-max-microamp = <500000>; > - flash-max-timeout-us = <1024000>; > - }; > - led@5 { > - reg = <5>; > - function = LED_FUNCTION_FLASH; > - color = ; > - function-enumerator = <2>; > - led-max-microamp = <200000>; > - flash-max-microamp = <500000>; > - flash-max-timeout-us = <1024000>; > - }; > - }; > + multi-led@0 { > + reg = <0>; > + function = LED_FUNCTION_INDICATOR; > + color = ; > + led-max-microamp = <24000>; > + #address-cells = <1>; > + #size-cells = <0>; > + led@0 { > + reg = <0>; > + color = ; > + }; > + led@1 { > + reg = <1>; > + color = ; > + }; > + led@2 { > + reg = <2>; > + color = ; > + }; > + }; > + led@3 { > + reg = <3>; > + function = LED_FUNCTION_INDICATOR; > + color = ; > + led-max-microamp = <150000>; > + }; > + led@4 { > + reg = <4>; > + function = LED_FUNCTION_FLASH; > + color = ; > + function-enumerator = <1>; > + led-max-microamp = <200000>; > + flash-max-microamp = <500000>; > + flash-max-timeout-us = <1024000>; > + }; > + led@5 { > + reg = <5>; > + function = LED_FUNCTION_FLASH; > + color = ; > + function-enumerator = <2>; > + led-max-microamp = <200000>; > + flash-max-microamp = <500000>; > + flash-max-timeout-us = <1024000>; > + }; > + }; > > - | > + led-controller { > + compatible = "mediatek,mt6360-led"; > + #address-cells = <1>; > + #size-cells = <0>; > > - led-controller { > - compatible = "mediatek,mt6360-led"; > - #address-cells = <1>; > - #size-cells = <0>; > - > - led@0 { > - reg = <0>; > - function = LED_FUNCTION_INDICATOR; > - color = ; > - led-max-microamp = <24000>; > - }; > - led@1 { > - reg = <1>; > - function = LED_FUNCTION_INDICATOR; > - color = ; > - led-max-microamp = <24000>; > - }; > - led@2 { > - reg = <2>; > - function = LED_FUNCTION_INDICATOR; > - color = ; > - led-max-microamp = <24000>; > - }; > - led@3 { > - reg = <3>; > - function = LED_FUNCTION_INDICATOR; > - color = ; > - led-max-microamp = <150000>; > - }; > - led@4 { > - reg = <4>; > - function = LED_FUNCTION_FLASH; > - color = ; > - function-enumerator = <1>; > - led-max-microamp = <200000>; > - flash-max-microamp = <500000>; > - flash-max-timeout-us = <1024000>; > - }; > - led@5 { > - reg = <5>; > - function = LED_FUNCTION_FLASH; > - color = ; > - function-enumerator = <2>; > - led-max-microamp = <200000>; > - flash-max-microamp = <500000>; > - flash-max-timeout-us = <1024000>; > - }; > - }; > + led@0 { > + reg = <0>; > + function = LED_FUNCTION_INDICATOR; > + color = ; > + led-max-microamp = <24000>; > + }; > + led@1 { > + reg = <1>; > + function = LED_FUNCTION_INDICATOR; > + color = ; > + led-max-microamp = <24000>; > + }; > + led@2 { > + reg = <2>; > + function = LED_FUNCTION_INDICATOR; > + color = ; > + led-max-microamp = <24000>; > + }; > + led@3 { > + reg = <3>; > + function = LED_FUNCTION_INDICATOR; > + color = ; > + led-max-microamp = <150000>; > + }; > + led@4 { > + reg = <4>; > + function = LED_FUNCTION_FLASH; > + color = ; > + function-enumerator = <1>; > + led-max-microamp = <200000>; > + flash-max-microamp = <500000>; > + flash-max-timeout-us = <1024000>; > + }; > + led@5 { > + reg = <5>; > + function = LED_FUNCTION_FLASH; > + color = ; > + function-enumerator = <2>; > + led-max-microamp = <200000>; > + flash-max-microamp = <500000>; > + flash-max-timeout-us = <1024000>; > + }; > + }; > ... > diff --git a/Documentation/devicetree/bindings/mips/brcm/soc.yaml b/Documentation/devicetree/bindings/mips/brcm/soc.yaml > index 0cc634482a6a..461a8c063313 100644 > --- a/Documentation/devicetree/bindings/mips/brcm/soc.yaml > +++ b/Documentation/devicetree/bindings/mips/brcm/soc.yaml > @@ -92,29 +92,29 @@ additionalProperties: true > > examples: > - | > - / { > - compatible = "brcm,bcm3368"; > - #address-cells = <1>; > - #size-cells = <1>; > - model = "Broadcom 3368"; > + / { > + compatible = "brcm,bcm3368"; > + #address-cells = <1>; > + #size-cells = <1>; > + model = "Broadcom 3368"; > > - cpus { > - #address-cells = <1>; > - #size-cells = <0>; > + cpus { > + #address-cells = <1>; > + #size-cells = <0>; > > - mips-hpt-frequency = <150000000>; > + mips-hpt-frequency = <150000000>; > > - cpu@0 { > - compatible = "brcm,bmips4350"; > - device_type = "cpu"; > - reg = <0>; > - }; > + cpu@0 { > + compatible = "brcm,bmips4350"; > + device_type = "cpu"; > + reg = <0>; > + }; > > - cpu@1 { > - compatible = "brcm,bmips4350"; > - device_type = "cpu"; > - reg = <1>; > - }; > - }; > - }; > + cpu@1 { > + compatible = "brcm,bmips4350"; > + device_type = "cpu"; > + reg = <1>; > + }; > + }; > + }; > ... > diff --git a/Documentation/devicetree/bindings/misc/intel,ixp4xx-ahb-queue-manager.yaml b/Documentation/devicetree/bindings/misc/intel,ixp4xx-ahb-queue-manager.yaml > index 36a9dbdf3f03..aab89946b04f 100644 > --- a/Documentation/devicetree/bindings/misc/intel,ixp4xx-ahb-queue-manager.yaml > +++ b/Documentation/devicetree/bindings/misc/intel,ixp4xx-ahb-queue-manager.yaml > @@ -45,7 +45,7 @@ examples: > #include > > qmgr: queue-manager@60000000 { > - compatible = "intel,ixp4xx-ahb-queue-manager"; > - reg = <0x60000000 0x4000>; > - interrupts = <3 IRQ_TYPE_LEVEL_HIGH>, <4 IRQ_TYPE_LEVEL_HIGH>; > + compatible = "intel,ixp4xx-ahb-queue-manager"; > + reg = <0x60000000 0x4000>; > + interrupts = <3 IRQ_TYPE_LEVEL_HIGH>, <4 IRQ_TYPE_LEVEL_HIGH>; > }; > diff --git a/Documentation/devicetree/bindings/mmc/renesas,sdhi.yaml b/Documentation/devicetree/bindings/mmc/renesas,sdhi.yaml > index ba15ccbda61a..c754ea71f51f 100644 > --- a/Documentation/devicetree/bindings/mmc/renesas,sdhi.yaml > +++ b/Documentation/devicetree/bindings/mmc/renesas,sdhi.yaml > @@ -266,49 +266,49 @@ examples: > #include > > sdhi0: mmc@ee100000 { > - compatible = "renesas,sdhi-r8a7790", "renesas,rcar-gen2-sdhi"; > - reg = <0xee100000 0x328>; > - interrupts = ; > - clocks = <&cpg CPG_MOD 314>; > - dmas = <&dmac0 0xcd>, <&dmac0 0xce>, <&dmac1 0xcd>, <&dmac1 0xce>; > - dma-names = "tx", "rx", "tx", "rx"; > - max-frequency = <195000000>; > - power-domains = <&sysc R8A7790_PD_ALWAYS_ON>; > - resets = <&cpg 314>; > + compatible = "renesas,sdhi-r8a7790", "renesas,rcar-gen2-sdhi"; > + reg = <0xee100000 0x328>; > + interrupts = ; > + clocks = <&cpg CPG_MOD 314>; > + dmas = <&dmac0 0xcd>, <&dmac0 0xce>, <&dmac1 0xcd>, <&dmac1 0xce>; > + dma-names = "tx", "rx", "tx", "rx"; > + max-frequency = <195000000>; > + power-domains = <&sysc R8A7790_PD_ALWAYS_ON>; > + resets = <&cpg 314>; > }; > > sdhi1: mmc@ee120000 { > - compatible = "renesas,sdhi-r8a7790", "renesas,rcar-gen2-sdhi"; > - reg = <0xee120000 0x328>; > - interrupts = ; > - clocks = <&cpg CPG_MOD 313>; > - dmas = <&dmac0 0xc9>, <&dmac0 0xca>, <&dmac1 0xc9>, <&dmac1 0xca>; > - dma-names = "tx", "rx", "tx", "rx"; > - max-frequency = <195000000>; > - power-domains = <&sysc R8A7790_PD_ALWAYS_ON>; > - resets = <&cpg 313>; > + compatible = "renesas,sdhi-r8a7790", "renesas,rcar-gen2-sdhi"; > + reg = <0xee120000 0x328>; > + interrupts = ; > + clocks = <&cpg CPG_MOD 313>; > + dmas = <&dmac0 0xc9>, <&dmac0 0xca>, <&dmac1 0xc9>, <&dmac1 0xca>; > + dma-names = "tx", "rx", "tx", "rx"; > + max-frequency = <195000000>; > + power-domains = <&sysc R8A7790_PD_ALWAYS_ON>; > + resets = <&cpg 313>; > }; > > sdhi2: mmc@ee140000 { > - compatible = "renesas,sdhi-r8a7790", "renesas,rcar-gen2-sdhi"; > - reg = <0xee140000 0x100>; > - interrupts = ; > - clocks = <&cpg CPG_MOD 312>; > - dmas = <&dmac0 0xc1>, <&dmac0 0xc2>, <&dmac1 0xc1>, <&dmac1 0xc2>; > - dma-names = "tx", "rx", "tx", "rx"; > - max-frequency = <97500000>; > - power-domains = <&sysc R8A7790_PD_ALWAYS_ON>; > - resets = <&cpg 312>; > - }; > - > - sdhi3: mmc@ee160000 { > - compatible = "renesas,sdhi-r8a7790", "renesas,rcar-gen2-sdhi"; > - reg = <0xee160000 0x100>; > - interrupts = ; > - clocks = <&cpg CPG_MOD 311>; > - dmas = <&dmac0 0xd3>, <&dmac0 0xd4>, <&dmac1 0xd3>, <&dmac1 0xd4>; > - dma-names = "tx", "rx", "tx", "rx"; > - max-frequency = <97500000>; > - power-domains = <&sysc R8A7790_PD_ALWAYS_ON>; > - resets = <&cpg 311>; > + compatible = "renesas,sdhi-r8a7790", "renesas,rcar-gen2-sdhi"; > + reg = <0xee140000 0x100>; > + interrupts = ; > + clocks = <&cpg CPG_MOD 312>; > + dmas = <&dmac0 0xc1>, <&dmac0 0xc2>, <&dmac1 0xc1>, <&dmac1 0xc2>; > + dma-names = "tx", "rx", "tx", "rx"; > + max-frequency = <97500000>; > + power-domains = <&sysc R8A7790_PD_ALWAYS_ON>; > + resets = <&cpg 312>; > + }; > + > + sdhi3: mmc@ee160000 { > + compatible = "renesas,sdhi-r8a7790", "renesas,rcar-gen2-sdhi"; > + reg = <0xee160000 0x100>; > + interrupts = ; > + clocks = <&cpg CPG_MOD 311>; > + dmas = <&dmac0 0xd3>, <&dmac0 0xd4>, <&dmac1 0xd3>, <&dmac1 0xd4>; > + dma-names = "tx", "rx", "tx", "rx"; > + max-frequency = <97500000>; > + power-domains = <&sysc R8A7790_PD_ALWAYS_ON>; > + resets = <&cpg 311>; > }; > diff --git a/Documentation/devicetree/bindings/mtd/technologic,nand.yaml b/Documentation/devicetree/bindings/mtd/technologic,nand.yaml > index f9d87c46094b..a3c316436317 100644 > --- a/Documentation/devicetree/bindings/mtd/technologic,nand.yaml > +++ b/Documentation/devicetree/bindings/mtd/technologic,nand.yaml > @@ -40,6 +40,6 @@ examples: > #address-cells = <1>; > #size-cells = <0>; > nand@0 { > - reg = <0>; > + reg = <0>; > }; > }; > diff --git a/Documentation/devicetree/bindings/nvmem/amlogic,meson6-efuse.yaml b/Documentation/devicetree/bindings/nvmem/amlogic,meson6-efuse.yaml > index b5cf740f96fa..9879d521842e 100644 > --- a/Documentation/devicetree/bindings/nvmem/amlogic,meson6-efuse.yaml > +++ b/Documentation/devicetree/bindings/nvmem/amlogic,meson6-efuse.yaml > @@ -53,6 +53,6 @@ examples: > }; > > temperature_calib: calib@1f4 { > - reg = <0x1f4 0x4>; > + reg = <0x1f4 0x4>; > }; > }; > diff --git a/Documentation/devicetree/bindings/pci/ti,j721e-pci-ep.yaml b/Documentation/devicetree/bindings/pci/ti,j721e-pci-ep.yaml > index 97f2579ea908..29580cbd1767 100644 > --- a/Documentation/devicetree/bindings/pci/ti,j721e-pci-ep.yaml > +++ b/Documentation/devicetree/bindings/pci/ti,j721e-pci-ep.yaml > @@ -123,21 +123,21 @@ examples: > #size-cells = <2>; > > pcie0_ep: pcie-ep@d000000 { > - compatible = "ti,j721e-pcie-ep"; > - reg = <0x00 0x02900000 0x00 0x1000>, > - <0x00 0x02907000 0x00 0x400>, > - <0x00 0x0d000000 0x00 0x00800000>, > - <0x00 0x10000000 0x00 0x08000000>; > - reg-names = "intd_cfg", "user_cfg", "reg", "mem"; > - ti,syscon-pcie-ctrl = <&pcie0_ctrl 0x4070>; > - max-link-speed = <3>; > - num-lanes = <2>; > - power-domains = <&k3_pds 239 TI_SCI_PD_EXCLUSIVE>; > - clocks = <&k3_clks 239 1>; > - clock-names = "fck"; > - max-functions = /bits/ 8 <6>; > - dma-coherent; > - phys = <&serdes0_pcie_link>; > - phy-names = "pcie-phy"; > - }; > + compatible = "ti,j721e-pcie-ep"; > + reg = <0x00 0x02900000 0x00 0x1000>, > + <0x00 0x02907000 0x00 0x400>, > + <0x00 0x0d000000 0x00 0x00800000>, > + <0x00 0x10000000 0x00 0x08000000>; > + reg-names = "intd_cfg", "user_cfg", "reg", "mem"; > + ti,syscon-pcie-ctrl = <&pcie0_ctrl 0x4070>; > + max-link-speed = <3>; > + num-lanes = <2>; > + power-domains = <&k3_pds 239 TI_SCI_PD_EXCLUSIVE>; > + clocks = <&k3_clks 239 1>; > + clock-names = "fck"; > + max-functions = /bits/ 8 <6>; > + dma-coherent; > + phys = <&serdes0_pcie_link>; > + phy-names = "pcie-phy"; > + }; > }; > diff --git a/Documentation/devicetree/bindings/power/reset/qcom,pon.yaml b/Documentation/devicetree/bindings/power/reset/qcom,pon.yaml > index 3da3d02a6690..979a377cb4ff 100644 > --- a/Documentation/devicetree/bindings/power/reset/qcom,pon.yaml > +++ b/Documentation/devicetree/bindings/power/reset/qcom,pon.yaml > @@ -115,40 +115,40 @@ allOf: > > examples: > - | > - #include > - #include > - #include > + #include > + #include > + #include > > - spmi@c440000 { > - reg = <0x0c440000 0x1100>; > - #address-cells = <2>; > - #size-cells = <0>; > + spmi@c440000 { > + reg = <0x0c440000 0x1100>; > + #address-cells = <2>; > + #size-cells = <0>; > > - pmic@0 { > - reg = <0x0 SPMI_USID>; > - #address-cells = <1>; > - #size-cells = <0>; > + pmic@0 { > + reg = <0x0 SPMI_USID>; > + #address-cells = <1>; > + #size-cells = <0>; > > - pon@800 { > - compatible = "qcom,pm8998-pon"; > - reg = <0x800>; > + pon@800 { > + compatible = "qcom,pm8998-pon"; > + reg = <0x800>; > > - pwrkey { > - compatible = "qcom,pm8941-pwrkey"; > - interrupts = <0x0 0x8 0 IRQ_TYPE_EDGE_BOTH>; > - debounce = <15625>; > - bias-pull-up; > - linux,code = ; > - }; > + pwrkey { > + compatible = "qcom,pm8941-pwrkey"; > + interrupts = <0x0 0x8 0 IRQ_TYPE_EDGE_BOTH>; > + debounce = <15625>; > + bias-pull-up; > + linux,code = ; > + }; > > - resin { > - compatible = "qcom,pm8941-resin"; > - interrupts = <0x0 0x8 1 IRQ_TYPE_EDGE_BOTH>; > - debounce = <15625>; > - bias-pull-up; > - linux,code = ; > - }; > - }; > - }; > - }; > + resin { > + compatible = "qcom,pm8941-resin"; > + interrupts = <0x0 0x8 1 IRQ_TYPE_EDGE_BOTH>; > + debounce = <15625>; > + bias-pull-up; > + linux,code = ; > + }; > + }; > + }; > + }; > ... > diff --git a/Documentation/devicetree/bindings/reserved-memory/nvidia,tegra264-bpmp-shmem.yaml b/Documentation/devicetree/bindings/reserved-memory/nvidia,tegra264-bpmp-shmem.yaml > index f9b2f0fdc282..4380f622f9a9 100644 > --- a/Documentation/devicetree/bindings/reserved-memory/nvidia,tegra264-bpmp-shmem.yaml > +++ b/Documentation/devicetree/bindings/reserved-memory/nvidia,tegra264-bpmp-shmem.yaml > @@ -36,12 +36,13 @@ required: > examples: > - | > reserved-memory { > - #address-cells = <2>; > - #size-cells = <2>; > - dram_cpu_bpmp_mail: shmem@f1be0000 { > - compatible = "nvidia,tegra264-bpmp-shmem"; > - reg = <0x0 0xf1be0000 0x0 0x2000>; > - no-map; > - }; > + #address-cells = <2>; > + #size-cells = <2>; > + > + shmem@f1be0000 { > + compatible = "nvidia,tegra264-bpmp-shmem"; > + reg = <0x0 0xf1be0000 0x0 0x2000>; > + no-map; > + }; > }; > ... > diff --git a/Documentation/devicetree/bindings/rtc/renesas,rzn1-rtc.yaml b/Documentation/devicetree/bindings/rtc/renesas,rzn1-rtc.yaml > index f6fdcc7090b6..1860f0e4c31a 100644 > --- a/Documentation/devicetree/bindings/rtc/renesas,rzn1-rtc.yaml > +++ b/Documentation/devicetree/bindings/rtc/renesas,rzn1-rtc.yaml > @@ -61,14 +61,14 @@ examples: > #include > #include > rtc@40006000 { > - compatible = "renesas,r9a06g032-rtc", "renesas,rzn1-rtc"; > - reg = <0x40006000 0x1000>; > - interrupts = , > - , > - ; > - interrupt-names = "alarm", "timer", "pps"; > - clocks = <&sysctrl R9A06G032_HCLK_RTC>; > - clock-names = "hclk"; > - power-domains = <&sysctrl>; > - start-year = <2000>; > - }; > + compatible = "renesas,r9a06g032-rtc", "renesas,rzn1-rtc"; > + reg = <0x40006000 0x1000>; > + interrupts = , > + , > + ; > + interrupt-names = "alarm", "timer", "pps"; > + clocks = <&sysctrl R9A06G032_HCLK_RTC>; > + clock-names = "hclk"; > + power-domains = <&sysctrl>; > + start-year = <2000>; > + }; > diff --git a/Documentation/devicetree/bindings/soc/amlogic/amlogic,meson-gx-hhi-sysctrl.yaml b/Documentation/devicetree/bindings/soc/amlogic/amlogic,meson-gx-hhi-sysctrl.yaml > index 3dc66f1de023..f3a85c67ce8a 100644 > --- a/Documentation/devicetree/bindings/soc/amlogic/amlogic,meson-gx-hhi-sysctrl.yaml > +++ b/Documentation/devicetree/bindings/soc/amlogic/amlogic,meson-gx-hhi-sysctrl.yaml > @@ -186,22 +186,22 @@ examples: > }; > > power-controller { > - compatible = "amlogic,meson-axg-pwrc"; > - #power-domain-cells = <1>; > - amlogic,ao-sysctrl = <&sysctrl_AO>; > + compatible = "amlogic,meson-axg-pwrc"; > + #power-domain-cells = <1>; > + amlogic,ao-sysctrl = <&sysctrl_AO>; > > - resets = <&reset_viu>, > - <&reset_venc>, > - <&reset_vcbus>, > - <&reset_vencl>, > - <&reset_vid_lock>; > - reset-names = "viu", "venc", "vcbus", "vencl", "vid_lock"; > - clocks = <&clk_vpu>, <&clk_vapb>; > - clock-names = "vpu", "vapb"; > + resets = <&reset_viu>, > + <&reset_venc>, > + <&reset_vcbus>, > + <&reset_vencl>, > + <&reset_vid_lock>; > + reset-names = "viu", "venc", "vcbus", "vencl", "vid_lock"; > + clocks = <&clk_vpu>, <&clk_vapb>; > + clock-names = "vpu", "vapb"; > }; > > phy { > - compatible = "amlogic,axg-mipi-pcie-analog-phy"; > - #phy-cells = <0>; > + compatible = "amlogic,axg-mipi-pcie-analog-phy"; > + #phy-cells = <0>; > }; > }; > diff --git a/Documentation/devicetree/bindings/soc/qcom/qcom,eud.yaml b/Documentation/devicetree/bindings/soc/qcom/qcom,eud.yaml > index f2c5ec7e6437..84218636c0d8 100644 > --- a/Documentation/devicetree/bindings/soc/qcom/qcom,eud.yaml > +++ b/Documentation/devicetree/bindings/soc/qcom/qcom,eud.yaml > @@ -55,25 +55,25 @@ additionalProperties: false > examples: > - | > eud@88e0000 { > - compatible = "qcom,sc7280-eud", "qcom,eud"; > - reg = <0x88e0000 0x2000>, > - <0x88e2000 0x1000>; > + compatible = "qcom,sc7280-eud", "qcom,eud"; > + reg = <0x88e0000 0x2000>, > + <0x88e2000 0x1000>; > > - ports { > - #address-cells = <1>; > - #size-cells = <0>; > - port@0 { > - reg = <0>; > - eud_ep: endpoint { > - remote-endpoint = <&usb2_role_switch>; > - }; > - }; > + ports { > + #address-cells = <1>; > + #size-cells = <0>; > + port@0 { > + reg = <0>; > + eud_ep: endpoint { > + remote-endpoint = <&usb2_role_switch>; > + }; > + }; > > - port@1 { > - reg = <1>; > - eud_con: endpoint { > - remote-endpoint = <&con_eud>; > - }; > - }; > - }; > + port@1 { > + reg = <1>; > + eud_con: endpoint { > + remote-endpoint = <&con_eud>; > + }; > + }; > + }; > }; > diff --git a/Documentation/devicetree/bindings/soc/ti/wkup-m3-ipc.yaml b/Documentation/devicetree/bindings/soc/ti/wkup-m3-ipc.yaml > index 0df41c4f60c1..56b16183c885 100644 > --- a/Documentation/devicetree/bindings/soc/ti/wkup-m3-ipc.yaml > +++ b/Documentation/devicetree/bindings/soc/ti/wkup-m3-ipc.yaml > @@ -121,13 +121,13 @@ examples: > }; > > wkup_m3_ipc@1324 { > - compatible = "ti,am3352-wkup-m3-ipc"; > - reg = <0x1324 0x24>; > - interrupts = <78>; > - ti,rproc = <&wkup_m3>; > - mboxes = <&am335x_mailbox &mbox_wkupm3>; > - ti,vtt-gpio-pin = <7>; > - firmware-name = "am335x-evm-scale-data.bin"; > + compatible = "ti,am3352-wkup-m3-ipc"; > + reg = <0x1324 0x24>; > + interrupts = <78>; > + ti,rproc = <&wkup_m3>; > + mboxes = <&am335x_mailbox &mbox_wkupm3>; > + ti,vtt-gpio-pin = <7>; > + firmware-name = "am335x-evm-scale-data.bin"; > }; > }; > > @@ -155,20 +155,20 @@ examples: > pinctrl-0 = <&ddr3_vtt_toggle_default>; > > ddr3_vtt_toggle_default: ddr_vtt_toggle_default { > - pinctrl-single,pins = < > + pinctrl-single,pins = < > 0x25C (DS0_PULL_UP_DOWN_EN | PIN_OUTPUT_PULLUP | DS0_FORCE_OFF_MODE | MUX_MODE7) > - >; > + >; > }; > }; > > wkup_m3_ipc@1324 { > - compatible = "ti,am4372-wkup-m3-ipc"; > - reg = <0x1324 0x24>; > - interrupts = <78>; > - ti,rproc = <&wkup_m3>; > - mboxes = <&am437x_mailbox &mbox_wkupm3>; > - ti,set-io-isolation; > - firmware-name = "am43x-evm-scale-data.bin"; > + compatible = "ti,am4372-wkup-m3-ipc"; > + reg = <0x1324 0x24>; > + interrupts = <78>; > + ti,rproc = <&wkup_m3>; > + mboxes = <&am437x_mailbox &mbox_wkupm3>; > + ti,set-io-isolation; > + firmware-name = "am43x-evm-scale-data.bin"; > }; > }; > > -- > 2.48.1 > > -- Alexandre Belloni, co-owner and COO, Bootlin Embedded Linux and Kernel engineering https://bootlin.com