From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 8BBB3C433F5 for ; Fri, 29 Apr 2022 17:02:18 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S1379382AbiD2RFf (ORCPT ); Fri, 29 Apr 2022 13:05:35 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:51452 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S1378949AbiD2RFe (ORCPT ); Fri, 29 Apr 2022 13:05:34 -0400 Received: from re-prd-fep-041.btinternet.com (mailomta12-re.btinternet.com [213.120.69.105]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 19F9468300 for ; Fri, 29 Apr 2022 10:02:13 -0700 (PDT) Received: from re-prd-rgout-001.btmx-prd.synchronoss.net ([10.2.54.4]) by re-prd-fep-041.btinternet.com with ESMTP id <20220429170212.CGBC3283.re-prd-fep-041.btinternet.com@re-prd-rgout-001.btmx-prd.synchronoss.net>; Fri, 29 Apr 2022 18:02:12 +0100 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=btinternet.com; s=btmx201904; t=1651251732; bh=UwMRP/+i5AFzKjEyiUZJ13o+So+TS7ncXHzbpac2Sac=; h=To:Message-ID:In-Reply-To:References:Subject:MIME-Version:From:Reply-To:Date; b=QydjkoutUp6hxsKbEuMH7nCQeruJfihKeos/T4u/v5EZih9VzlE2tE1JFrDv+OlVWRa2MwVPp4XpIY6RLkMdU8rvIH5m3W4+CpH44ZSNF10XjGSm125QFPLVdCkwYJ/OyVw9awczo/nxN/ovCTAtuA7CKD6BlThOoIXaCkPyb/OPCMaHc5X8P9niEKLCuhAriNxx7orDZ3IZ9hXgtBEB/kt22ne/icE6bJ/HeRJTm8paGu3FwzYiN8ozArYvS15xdf5RRCpVLc2iDYTbK+ArNSaV/soE8wV5dOyygw1bR8Jshhm3c1iarrMS7ANpsk/NTzvMXUZXMHCrcCFM53TTWg== Authentication-Results: btinternet.com; none X-SNCR-Rigid: 613A8CC320A236B8 X-OWM-Env-Sender: alex.challis@btinternet.com X-VadeSecure-score: verdict=clean score=0/300, class=clean X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedvfedrudelgddutdejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuueftkffvkffujffvgffngfevqffopdfqfgfvnecuuegrihhlohhuthemuceftddunecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefvkfgjfhfugggtgfgfihfhrhffsehtjeertddtreejnecuhfhrohhmpedfrghlvgigrdgthhgrlhhlihhsfdcuoegrlhgvgidrtghhrghllhhishessghtihhnthgvrhhnvghtrdgtohhmqeenucggtffrrghtthgvrhhnpeeiheeuudeigfeiudfhgfeghedutdevkeelueekgeeghfevgfehfeekffeitefhgeenucffohhmrghinheptggrrhhfrgigrdhorhhgrdhukhenucfkphepuddtrddvrdehgedrkeefpdekiedrudejiedrudehhedrleenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopehrvgdqphhrugdquhigfhgvphdqtddtvddrsghtmhigqdhprhgurdhshihntghhrhhonhhoshhsrdhnvghtpdhinhgvthepuddtrddvrdehgedrkeefpdhmrghilhhfrhhomheprghlvgigrdgthhgrlhhlihhssegsthhinhhtvghrnhgvthdrtghomhdpnhgspghrtghpthhtohepvddprhgtphhtthhopehhuhhgohestggrrhhfrgigrdhorhhgrdhukhdprhgtphhtthhopehlihhnuhigqdgsthhrfhhssehvghgvrhdrkhgvrhhnvghlrdhorhhg X-RazorGate-Vade-Verdict: clean 0 X-RazorGate-Vade-Classification: clean X-SNCR-hdrdom: btinternet.com Received: from re-prd-uxfep-002.btmx-prd.synchronoss.net (10.2.54.83) by re-prd-rgout-001.btmx-prd.synchronoss.net (5.8.716.04) id 613A8CC320A236B8; Fri, 29 Apr 2022 18:02:12 +0100 Received: from [86.176.155.9] by email.bt.com with HTTP; Fri, 29 Apr 2022 18:02:12 +0100 To: Hugo Mills , linux-btrfs@vger.kernel.org Message-ID: <7122e22a.9e4d.1807645de56.Webtop.83@btinternet.com> In-Reply-To: <20220428142248.GF15632@savella.carfax.org.uk> References: <24c3cfee.732c.180707358a1.Webtop.117@btinternet.com> <20220428142248.GF15632@savella.carfax.org.uk> Subject: Re: Recovery of BTRFS critical (device md126): corrupt leaf, bad key order: block=10872141938688, root=1, slot=119 MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8; format=flowed; delsp=no Content-Transfer-Encoding: 7bit User-Agent: OWM Mail 3 X-SID: 83 X-Originating-IP: [86.176.155.9] From: "alex.challis" Reply-To: alex.challis@btinternet.com Date: Fri, 29 Apr 2022 18:02:12 +0100 (BST) Precedence: bulk List-ID: X-Mailing-List: linux-btrfs@vger.kernel.org Thank you for the advice Hugo, have now replaced the RAM. Would one of the devs be able to help with custom patch to btrfs check to fix it please? Many thanks! Cheers Alex. ------ Original Message ------ From: "Hugo Mills" To: "alex.challis" Cc: linux-btrfs@vger.kernel.org Sent: Thursday, 28 Apr, 2022 At 15:22 Subject: Re: Recovery of BTRFS critical (device md126): corrupt leaf, bad key order: block=10872141938688, root=1, slot=119 On Thu, Apr 28, 2022 at 02:54:09PM +0100, alex.challis wrote: Dear BTRFS Team Have a NetGear ReadyNas that uses brtfs for the data volume (/dev/disk/by-label/33eaff11\:HDD1). Was attempting to stop a running container (Docker CE) around the time the failure happened. Had just docker pulled a new version of container. Not 100% sure they were related but NAS dropped data volume into RO mode around the time of stopping the container. Subsequent attempts to docker rm the container failed with read-only file system errors. Upon re-boot the data volume would no longer mount. uname -a: Linux fatterboy 4.4.218.x86_64.1 #1 SMP Sun Nov 7 15:20:05 UTC 2021 x86_64 GNU/Linux btrfs --version: btrfs-progs v4.16 btrfs fi show: Label: '33eaff11:root' uuid: e360cd8a-7496-4714-a0b7-dadb4829e6f5 Total devices 1 FS bytes used 993.29MiB devid 1 size 4.00GiB used 2.45GiB path /dev/md0 Label: '33eaff11:HDD1' uuid: 9dbd11f2-da2f-4f68-a4e9-552cbc90d1e0 Total devices 2 FS bytes used 4.25TiB devid 1 size 5.44TiB used 4.41TiB path /dev/md126 devid 2 size 461.13GiB used 7.03GiB path /dev/md127 btrfs fi df /HDD1 : Data, single: total=2.04GiB, used=979.09MiB System, DUP: total=8.00MiB, used=16.00KiB Metadata, DUP: total=204.56MiB, used=14.19MiB GlobalReserve, single: total=16.00MiB, used=0.00B dmesg > dmesg.log Attached Culprit seems to be: dmesg | grep -i btrfs [ 1.337264] Btrfs loaded, crc32c=crc32c-generic [ 23.296969] BTRFS: device label 33eaff11:root devid 1 transid 2341967 /dev/md0 [ 23.297437] BTRFS info (device md0): has skinny extents [ 24.505292] BTRFS: device label 33eaff11:HDD1 devid 2 transid 1424350 /dev/md127 [ 24.643613] BTRFS: device label 33eaff11:HDD1 devid 1 transid 1424350 /dev/md126 [ 24.800256] BTRFS info (device md126): has skinny extents [ 24.894582] BTRFS critical (device md126): corrupt leaf, bad key order: block=10872141938688, root=1, slot=119 [ 24.894596] BTRFS error (device md126): failed to read block groups: -5 [ 24.894811] BTRFS error (device md126): failed to read block groups: -17 [ 24.898074] BTRFS error (device md126): failed to read block groups: -17 [ 24.912298] BTRFS error (device md126): failed to read block groups: -17 [ 24.912851] BTRFS error (device md126): parent transid verify failed on 10872188272640 wanted 1424347 found 1424349 [ 24.912857] BTRFS warning (device md126): failed to read tree root [ 24.933058] BTRFS error (device md126): open_ctree failed btrfs-debug-tree -b 10872141938688 /dev/disk/by-label/33eaff11\:HDD1 item 117 key (1127493074944 METADATA_ITEM 0) itemoff 27954 itemsize 33 refs 1 gen 23101 flags TREE_BLOCK tree block skinny level 0 tree block backref root 7 item 118 key (1127493107712 METADATA_ITEM 0) itemoff 27894 itemsize 60 refs 4 gen 718838 flags TREE_BLOCK|FULL_BACKREF tree block skinny level 0 shared block backref parent 4593432821760 shared block backref parent 4593432788992 shared block backref parent 4593432756224 shared block backref parent 4593432723456 item 119 key (2211708928 UNKNOWN.0 0) itemoff 27834 itemsize 60 item 120 key (1127493173248 METADATA_ITEM 0) itemoff 27801 itemsize 33 refs 1 gen 29828 flags TREE_BLOCK tree block skinny level 0 tree block backref root 7 Key 119 is out of sequence and type UNKNOWN (!?) The first elements of the key tuples for 118-120 are: 0x10683d38000 0x00083d40000 0x10683d48000 This, along with the UNKNOWN.0, suggests that something has written a very small number of zero bytes into the metadata page while it was in RAM (probably 4 or 8 bytes, as nothing else seems to be damaged). It's definitely happened in RAM, as the checksum is correct. We'd have had a csum failure if the corruption happened on disk. This is an indication either of a broken driver that's done some bad pointer arithmetic and stomped on memory that it doesn't own, or (more likely, in my opinion) some bad RAM that's flipped a bit on an address held in kernel memory somewhere, and led something to zero the wrong area of RAM. Please advise on recovery please? I don't think there's anything in btrfs check that could fix this (although I might be wrong). Your first task, though, should be to try to identify and replace the broken RAM on this machine. Once that's done, one of the devs may be able to help you with a custom patch to btrfs check to fix it -- but don't do that until the hardware's repaired. Hugo. -- Hugo Mills | I spent most of my money on drink, women and fast hugo@... carfax.org.uk | cars. The rest I wasted. http://carfax.org.uk/ | PGP: E2AB1DE4 | James Hunt