From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from relay6-d.mail.gandi.net (relay6-d.mail.gandi.net [217.70.183.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id A2CD620ADCB; Mon, 3 Feb 2025 16:16:18 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=217.70.183.198 ARC-Seal:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1738599380; cv=none; b=YpJ+wlbBfjeWv8f11cMXME7o+DAVNqdXQ7T4+UXm7aIj/beAOIVH4LgIyOATjaLDPb+twFcJz2F1Z3Hmi6NyPACRB8Nj16o7Gw4ahN5P2Hzjpb35X0Nd6YHiA44ks+FOP4gXjssSa3UwD8ddgVjX2j3C7wauK2CHFWlDfoolk1A= ARC-Message-Signature:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1738599380; c=relaxed/simple; bh=KEP9JHOaQaC7WMar0N1Qoiwz++EeWdHjCPRociZouoM=; h=From:To:Cc:Subject:Date:Message-ID:In-Reply-To:References: MIME-Version; b=i4fXrFIWRCwQ8f3mgQXU+O8IaonE/I0TLYf15zr89a0xUvzP8X/E1L8pJ+ZojkjFBEAFYvxGpPBWBoZMbie0iTlHIZcxgrCOo1loBXBIxsdb1+t00GawlrPpJ4MLXtwOXveiNlNIXp1pnS9jTalXO2GnfAuAFYORTHK27piSgZ4= ARC-Authentication-Results:i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com; spf=pass smtp.mailfrom=bootlin.com; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b=hXQf0yDx; arc=none smtp.client-ip=217.70.183.198 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=bootlin.com Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b="hXQf0yDx" Received: by mail.gandi.net (Postfix) with ESMTPA id 87615442A4; Mon, 3 Feb 2025 16:16:15 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1738599377; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=B35Kx103WOLl6yU6T8SxtTaWfDrXbRxl8yGjTq/oP7o=; b=hXQf0yDx0LAnCMGH7zKihRNxLnYcxV1j8qo2jeU5FhlHd9EwidyJwpm7ScSJ9pbRDcE0cK 9SmjXgmEgthcmYIeI2KZGAIobzI2zkIXIOLXl6/LT7BgM7rNj5lz5EWSijvVyXaNBOuNcN bN4KTx2+BvVi7LI1S+B4YeY+SIacSrPt66rACg4p9ZSwExwodeLhc8/fRo+Bj+PzcRBrzV YJXRGcBRiRAiOiXtCSCCeoRpb23Y5ybNhxELkgF2cFyYpFuHxbql3YT9ktoO8WDz3KOfQ+ MnL+zkWkotmdwKUf+b1sy1x6U4K8ctoV7+EYZZXEGONs0Kt3dPiTDJSr0M+pUw== From: Herve Codina To: Alexander Stein , Andrzej Hajda , Neil Armstrong , Robert Foss , Laurent Pinchart , Jonas Karlman , Jernej Skrabec , David Airlie , Simona Vetter , Maarten Lankhorst , Maxime Ripard , Thomas Zimmermann , Rob Herring , Krzysztof Kozlowski , Conor Dooley , Dave Stevenson , =?UTF-8?q?Ma=C3=ADra=20Canal?= , Raspberry Pi Kernel Maintenance , Marek Vasut Cc: dri-devel@lists.freedesktop.org, devicetree@vger.kernel.org, linux-kernel@vger.kernel.org, Louis Chauvet , Luca Ceresoli , Thomas Petazzoni , Herve Codina Subject: [PATCH v5 4/4] drm: bridge: ti-sn65dsi83: Add error recovery mechanism Date: Mon, 3 Feb 2025 17:16:06 +0100 Message-ID: <20250203161607.223731-5-herve.codina@bootlin.com> X-Mailer: git-send-email 2.47.1 In-Reply-To: <20250203161607.223731-1-herve.codina@bootlin.com> References: <20250203161607.223731-1-herve.codina@bootlin.com> Precedence: bulk X-Mailing-List: devicetree@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddukedtiecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfitefpfffkpdcuggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkofgjfhgggfestdekredtredttdenucfhrhhomhepjfgvrhhvvgcuvehoughinhgruceohhgvrhhvvgdrtghoughinhgrsegsohhothhlihhnrdgtohhmqeenucggtffrrghtthgvrhhnpeehffeigfejueelueeuffelueefgfelhfejhfehieegudekteeiledttdfhffekffenucfkphepledtrdekledrudeifedruddvjeenucevlhhushhtvghrufhiiigvpeefnecurfgrrhgrmhepihhnvghtpeeltddrkeelrdduieefrdduvdejpdhhvghloheplhhotggrlhhhohhsthdrlhhotggrlhguohhmrghinhdpmhgrihhlfhhrohhmpehhvghrvhgvrdgtohguihhnrgessghoohhtlhhinhdrtghomhdpnhgspghrtghpthhtohepvdeipdhrtghpthhtoheprghlvgigrghnuggvrhdrshhtvghinhesvgifrdhtqhdqghhrohhuphdrtghomhdprhgtphhtthhopegrnhgurhiivghjrdhhrghjuggrsehinhhtvghlrdgtohhmpdhrtghpthhtohepnhgvihhlrdgrrhhmshhtrhhonhhgsehlihhnrghrohdrohhrghdprhgtphhtthhopehrfhhoshhssehkvghrnhgvlhdrohhrghdprhgtphhtthhopefnrghurhgvnhhtr dhpihhntghhrghrthesihguvggrshhonhgsohgrrhgurdgtohhmpdhrtghpthhtohepjhhonhgrsheskhifihgsohhordhsvgdprhgtphhtthhopehjvghrnhgvjhdrshhkrhgrsggvtgesghhmrghilhdrtghomhdprhgtphhtthhopegrihhrlhhivggusehgmhgrihhlrdgtohhm X-GND-Sasl: herve.codina@bootlin.com In some cases observed during ESD tests, the TI SN65DSI83 cannot recover from errors by itself. A full restart of the bridge is needed in those cases to have the bridge output LVDS signals again. Also, during tests, cases were observed where reading the status of the bridge was not even possible. Indeed, in those cases, the bridge stops to acknowledge I2C transactions. Only a full reset of the bridge (power off/on) brings back the bridge to a functional state. The TI SN65DSI83 has some error detection capabilities. Introduce an error recovery mechanism based on this detection. The errors detected are signaled through an interrupt. On system where this interrupt is not available, the driver uses a polling monitoring fallback to check for errors. When an error is present or when reading the bridge status leads to an I2C failure, the recovery process is launched. Restarting the bridge needs to redo the initialization sequence. This initialization sequence has to be done with the DSI data lanes driven in LP11 state. In order to do that, the recovery process resets the whole output path (i.e the path from the encoder to the connector) where the bridge is located. Signed-off-by: Herve Codina --- drivers/gpu/drm/bridge/ti-sn65dsi83.c | 131 ++++++++++++++++++++++++++ 1 file changed, 131 insertions(+) diff --git a/drivers/gpu/drm/bridge/ti-sn65dsi83.c b/drivers/gpu/drm/bridge/ti-sn65dsi83.c index 336380114eea..26a050b13997 100644 --- a/drivers/gpu/drm/bridge/ti-sn65dsi83.c +++ b/drivers/gpu/drm/bridge/ti-sn65dsi83.c @@ -35,9 +35,12 @@ #include #include #include +#include +#include #include #include +#include /* DRM_MODESET_LOCK_ALL_BEGIN() needs drm_drv_uses_atomic_modeset() */ #include #include #include @@ -159,6 +162,9 @@ struct sn65dsi83 { bool lvds_dual_link_even_odd_swap; int lvds_vod_swing_conf[2]; int lvds_term_conf[2]; + int irq; + struct delayed_work monitor_work; + struct work_struct reset_work; }; static const struct regmap_range sn65dsi83_readable_ranges[] = { @@ -363,6 +369,95 @@ static u8 sn65dsi83_get_dsi_div(struct sn65dsi83 *ctx) return dsi_div - 1; } +static int sn65dsi83_reset_pipe(struct sn65dsi83 *sn65dsi83) +{ + struct drm_device *dev = sn65dsi83->bridge.dev; + struct drm_modeset_acquire_ctx ctx; + int err; + + /* + * Reset active outputs of the related CRTC. + * + * This way, drm core will reconfigure each components in the CRTC + * outputs path. In our case, this will force the previous component to + * go back in LP11 mode and so allow the reconfiguration of SN64DSI83 + * bridge. + * + * Keep the lock during the whole operation to be atomic. + */ + + DRM_MODESET_LOCK_ALL_BEGIN(dev, ctx, 0, err); + + err = drm_atomic_helper_reset_crtc(sn65dsi83->bridge.encoder->crtc, &ctx); + + DRM_MODESET_LOCK_ALL_END(dev, ctx, err); + + return err; +} + +static void sn65dsi83_reset_work(struct work_struct *ws) +{ + struct sn65dsi83 *ctx = container_of(ws, struct sn65dsi83, reset_work); + int ret; + + dev_warn(ctx->dev, "reset the pipe\n"); + + /* Reset the pipe */ + ret = sn65dsi83_reset_pipe(ctx); + if (ret) { + dev_err(ctx->dev, "reset pipe failed %pe\n", ERR_PTR(ret)); + return; + } + if (ctx->irq) + enable_irq(ctx->irq); +} + +static void sn65dsi83_handle_errors(struct sn65dsi83 *ctx) +{ + unsigned int irq_stat; + int ret; + + /* + * Schedule a reset in case of: + * - the bridge doesn't answer + * - the bridge signals an error + */ + + ret = regmap_read(ctx->regmap, REG_IRQ_STAT, &irq_stat); + if (ret || irq_stat) { + /* + * IRQ acknowledged is not always possible (the bridge can be in + * a state where it doesn't answer anymore). To prevent an + * interrupt storm, disable interrupt. The interrupt will be + * after the reset. + */ + if (ctx->irq) + disable_irq_nosync(ctx->irq); + + schedule_work(&ctx->reset_work); + } +} + +static void sn65dsi83_monitor_work(struct work_struct *work) +{ + struct sn65dsi83 *ctx = container_of(to_delayed_work(work), + struct sn65dsi83, monitor_work); + + sn65dsi83_handle_errors(ctx); + + schedule_delayed_work(&ctx->monitor_work, msecs_to_jiffies(1000)); +} + +static void sn65dsi83_monitor_start(struct sn65dsi83 *ctx) +{ + schedule_delayed_work(&ctx->monitor_work, msecs_to_jiffies(1000)); +} + +static void sn65dsi83_monitor_stop(struct sn65dsi83 *ctx) +{ + cancel_delayed_work_sync(&ctx->monitor_work); +} + static void sn65dsi83_atomic_pre_enable(struct drm_bridge *bridge, struct drm_bridge_state *old_bridge_state) { @@ -549,6 +644,15 @@ static void sn65dsi83_atomic_enable(struct drm_bridge *bridge, regmap_read(ctx->regmap, REG_IRQ_STAT, &pval); if (pval) dev_err(ctx->dev, "Unexpected link status 0x%02x\n", pval); + + if (ctx->irq) { + /* Enable irq to detect errors */ + regmap_write(ctx->regmap, REG_IRQ_GLOBAL, REG_IRQ_GLOBAL_IRQ_EN); + regmap_write(ctx->regmap, REG_IRQ_EN, 0xff); + } else { + /* Use the polling task */ + sn65dsi83_monitor_start(ctx); + } } static void sn65dsi83_atomic_disable(struct drm_bridge *bridge, @@ -557,6 +661,15 @@ static void sn65dsi83_atomic_disable(struct drm_bridge *bridge, struct sn65dsi83 *ctx = bridge_to_sn65dsi83(bridge); int ret; + if (ctx->irq) { + /* Disable irq */ + regmap_write(ctx->regmap, REG_IRQ_EN, 0x0); + regmap_write(ctx->regmap, REG_IRQ_GLOBAL, 0x0); + } else { + /* Stop the polling task */ + sn65dsi83_monitor_stop(ctx); + } + /* Put the chip in reset, pull EN line low, and assure 10ms reset low timing. */ gpiod_set_value_cansleep(ctx->enable_gpio, 0); usleep_range(10000, 11000); @@ -806,6 +919,14 @@ static int sn65dsi83_host_attach(struct sn65dsi83 *ctx) return 0; } +static irqreturn_t sn65dsi83_irq(int irq, void *data) +{ + struct sn65dsi83 *ctx = data; + + sn65dsi83_handle_errors(ctx); + return IRQ_HANDLED; +} + static int sn65dsi83_probe(struct i2c_client *client) { const struct i2c_device_id *id = i2c_client_get_device_id(client); @@ -819,6 +940,8 @@ static int sn65dsi83_probe(struct i2c_client *client) return -ENOMEM; ctx->dev = dev; + INIT_WORK(&ctx->reset_work, sn65dsi83_reset_work); + INIT_DELAYED_WORK(&ctx->monitor_work, sn65dsi83_monitor_work); if (dev->of_node) { model = (enum sn65dsi83_model)(uintptr_t) @@ -843,6 +966,14 @@ static int sn65dsi83_probe(struct i2c_client *client) if (IS_ERR(ctx->regmap)) return dev_err_probe(dev, PTR_ERR(ctx->regmap), "failed to get regmap\n"); + if (client->irq) { + ctx->irq = client->irq; + ret = devm_request_threaded_irq(ctx->dev, ctx->irq, NULL, sn65dsi83_irq, + IRQF_ONESHOT, dev_name(ctx->dev), ctx); + if (ret) + return dev_err_probe(dev, ret, "failed to request irq\n"); + } + dev_set_drvdata(dev, ctx); i2c_set_clientdata(client, ctx); -- 2.47.1