From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from relay4-d.mail.gandi.net (relay4-d.mail.gandi.net [217.70.183.196]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 2EBB31AC891; Wed, 28 May 2025 13:17:25 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=217.70.183.196 ARC-Seal:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1748438248; cv=none; b=iZrJyYhcLrTLpuvxTsR+5t2nxHqt677QrgSv4taKW1nVqI0KijS9pArmLav4QfEnY+ba5riFw3dIVc440XNHiv8u1F4L7kAo1shUenvHGs+tFiViPL9eDsVDMh13llnNQAqsW4omAQtIe+1KNt4eISWUa8yZp47Zmo9QSJfgMis= ARC-Message-Signature:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1748438248; c=relaxed/simple; bh=XyqXMFLpjQUAOlJ4J5EDK/pH8DkmZweApWK3C83/s9M=; h=Date:From:To:Cc:Subject:Message-ID:In-Reply-To:References: MIME-Version:Content-Type; b=lTwtom7UDk55/6MI0z4C4+F/pyV0v0TSW/kNCxSY7+5AP0t7qQpdC1f4/IGu8YpJGJN31zuJnWHJjSRMOOT7/Lyz/cpr4Rw/dBQMqZa7dBuxZA5RPeeHXDuF3ANT82I52wyGgn2Ye5xZ/yYLVDL5dVirbYnSgEGsr6sx/NFOkm8= ARC-Authentication-Results:i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com; spf=pass smtp.mailfrom=bootlin.com; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b=f5pa5OML; arc=none smtp.client-ip=217.70.183.196 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=bootlin.com Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b="f5pa5OML" Received: by mail.gandi.net (Postfix) with ESMTPSA id 6A39F43B39; Wed, 28 May 2025 13:17:16 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1748438238; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=jhe4l8G7g9CuqxjAYyb4mOmnurWtrgOLitbau5hV8GQ=; b=f5pa5OML32eamqT/6wf2JaYwGb0E5OBrE0uNEUr8vEb16KKhlfBTpZDLQHmDC/oAIXmR9t vcX791GXDtrvMNye5H6KAGRHoyE3dUpWmtObyq6EskJBei0K/i9c1Tr4phPLQAOKuAzPHA vi77pjqXAe+bz+l4KaFY9wvE47MJaWIyyfYpJEChna3qJI07jAqbeQEv/h0M1CjLFQOmes rfK8CxgR7KVVBBVCs63WpBYxdL6QLOFCThoNCHt306T6lLopESzqT6oLss/sDpaI5Oj10w mONgTGbx2jnBGcMlY5QDvJTbNctGKdnZTt47lbkAlN3/KKQg5tt6FiHHCwkZYQ== Date: Wed, 28 May 2025 15:17:15 +0200 From: Kory Maincent To: Paolo Abeni Cc: Andrew Lunn , Oleksij Rempel , "David S. Miller" , Eric Dumazet , Jakub Kicinski , Jonathan Corbet , Donald Hunter , Rob Herring , Andrew Lunn , Simon Horman , Heiner Kallweit , Russell King , Krzysztof Kozlowski , Conor Dooley , Liam Girdwood , Mark Brown , Thomas Petazzoni , netdev@vger.kernel.org, linux-doc@vger.kernel.org, Kyle Swenson , Dent Project , kernel@pengutronix.de, Maxime Chevallier , devicetree@vger.kernel.org, linux-kernel@vger.kernel.org, Krzysztof Kozlowski Subject: Re: [PATCH net-next v12 00/13] Add support for PSE budget evaluation strategy Message-ID: <20250528151715.59b8f738@kmaincent-XPS-13-7390> In-Reply-To: <8b3cdc35-8bcc-41f6-84ec-aee50638b929@redhat.com> References: <20250524-feature_poe_port_prio-v12-0-d65fd61df7a7@bootlin.com> <8b3cdc35-8bcc-41f6-84ec-aee50638b929@redhat.com> Organization: bootlin X-Mailer: Claws Mail 4.2.0 (GTK 3.24.41; x86_64-pc-linux-gnu) Precedence: bulk X-Mailing-List: devicetree@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtddtgddvfeefieculddtuddrgeefvddrtddtmdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfitefpfffkpdcuggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhepfffhvfevuffkjghfohfogggtgfesthhqredtredtjeenucfhrhhomhepmfhorhihucforghinhgtvghnthcuoehkohhrhidrmhgrihhntggvnhhtsegsohhothhlihhnrdgtohhmqeenucggtffrrghtthgvrhhnpefguddtfeevtddugeevgfevtdfgvdfhtdeuleetffefffffhffgteekvdefudeiieenucffohhmrghinhepsghoohhtlhhinhdrtghomhenucfkphepledtrdekledrudeifedruddvjeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeeltddrkeelrdduieefrdduvdejpdhhvghlohepkhhmrghinhgtvghnthdqigfrufdqudefqdejfeeltddpmhgrihhlfhhrohhmpehkohhrhidrmhgrihhntggvnhhtsegsohhothhlihhnrdgtohhmpdhnsggprhgtphhtthhopedvkedprhgtphhtthhopehprggsvghnihesrhgvughhrghtrdgtohhmpdhrtghpthhtoheprghnughrvgifsehluhhnnhdrtghhpdhrtghpthhtohepohdrrhgvmhhpvghlsehpvghnghhuthhrohhnihigrdguvgdprhgtphhtthhopegurghvvghmsegurghvvghmlhhofhhtrdhnvghtp dhrtghpthhtohepvgguuhhmrgiivghtsehgohhoghhlvgdrtghomhdprhgtphhtthhopehkuhgsrgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtoheptghorhgsvghtsehlfihnrdhnvghtpdhrtghpthhtohepughonhgrlhgurdhhuhhnthgvrhesghhmrghilhdrtghomh X-GND-Sasl: kory.maincent@bootlin.com Le Wed, 28 May 2025 09:31:20 +0200, Paolo Abeni a =C3=A9crit : > On 5/24/25 12:56 PM, Kory Maincent wrote: > > From: Kory Maincent (Dent Project) > >=20 > > This series brings support for budget evaluation strategy in the PSE > > subsystem. PSE controllers can set priorities to decide which ports sho= uld > > be turned off in case of special events like over-current. > >=20 > > This patch series adds support for two budget evaluation strategy. > > 1. Static Method: > >=20 > > This method involves distributing power based on PD classification. > > It=E2=80=99s straightforward and stable, the PSE core keeping track = of the > > budget and subtracting the power requested by each PD=E2=80=99s clas= s. > >=20 > > Advantages: Every PD gets its promised power at any time, which > > guarantees reliability. > >=20 > > Disadvantages: PD classification steps are large, meaning devices > > request much more power than they actually need. As a result, the po= wer > > supply may only operate at, say, 50% capacity, which is inefficient = and > > wastes money. > >=20 > > 2. Dynamic Method: > >=20 > > To address the inefficiencies of the static method, vendors like > > Microchip have introduced dynamic power budgeting, as seen in the > > PD692x0 firmware. This method monitors the current consumption per p= ort > > and subtracts it from the available power budget. When the budget is > > exceeded, lower-priority ports are shut down. > >=20 > > Advantages: This method optimizes resource utilization, saving costs. > >=20 > > Disadvantages: Low-priority devices may experience instability. > >=20 > > The UAPI allows adding support for software port priority mode managed = from > > userspace later if needed. > >=20 > > Patches 1-2: Add support for interrupt event report in PSE core, ethtool > > and ethtool specs. > > Patch 3: Adds support for interrupt and event report in TPS23881 driver. > > Patches 4,5: Add support for PSE power domain in PSE core and ethtool. > > Patches 6-8: Add support for budget evaluation strategy in PSE core, > > ethtool and ethtool specs. > > Patches 9-11: Add support for port priority and power supplies in PD692= x0 > > drivers. > > Patches 12,13: Add support for port priority in TPS23881 drivers. > >=20 > > Signed-off-by: Kory Maincent (Dent Project) = =20 >=20 > I'm sorry, even if this has been posted (just) before the merge window, > I think an uAPI extension this late is a bit too dangerous, please > repost when net-next will reopen after the merge window. Ok I will. Would it be possible to review the netlink part of the series? (patch 2, 7 = and 8)=20 Regard, --=20 K=C3=B6ry Maincent, Bootlin Embedded Linux and kernel engineering https://bootlin.com