From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from relay5-d.mail.gandi.net (relay5-d.mail.gandi.net [217.70.183.197]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id E71501C3C18; Thu, 20 Mar 2025 16:35:45 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=217.70.183.197 ARC-Seal:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1742488548; cv=none; b=bnqWEFt0beoEGlhtSfKy8jXDK1JzLUMdNaw/oIcdlAF6IfGWC22XIunRkRhfVe66ujudF42+kdhng45Rys/hcFxrptTKL2XPxB6/mhNnWDKPDMz0BIr0zyepj61ebOSLrXsn6j3D1RmNgDkX4CQBlDdteXqaouM4OjcTHYyDdFg= ARC-Message-Signature:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1742488548; c=relaxed/simple; bh=wlu4sa9Hj+H3sQPG7llnh87jaaY4X3w5U4AdeiRKm9U=; h=Date:From:To:Cc:Subject:Message-ID:In-Reply-To:References: MIME-Version:Content-Type; b=T5LiHXsiAkdgRvSMLTDt3cS/X/0xmcOglFt+Y0+mMyAHXlPE+47dV00Vykj0FiDT9/GI3zC7PzZ5VduX68UfQ9ZtkHaWNz+ZUPoZ+DwKUqqTgf+y1qWKGiNJtDp4j8p84bbJew/6tdyqbM4L/2eJvWjvg49sedhfEU1j/hzO1v0= ARC-Authentication-Results:i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com; spf=pass smtp.mailfrom=bootlin.com; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b=onmJiJ6B; arc=none smtp.client-ip=217.70.183.197 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=bootlin.com Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b="onmJiJ6B" Received: by mail.gandi.net (Postfix) with ESMTPSA id 083CC44332; Thu, 20 Mar 2025 16:35:35 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1742488538; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=scN5SQcuDlpnHhPAKZLP9DMButGCxfU8wz03ilg3OEw=; b=onmJiJ6BRNdbkYSvhiAqNWgxgQdogP1QuF5xSqCeaK3tybA0TKsFpXpWGkgthaYaOV8ep4 v73GBtVbm+JWgc4jReTVuw8D3HIGobveAtZ0Aa73CWGEUyw5CpxX0YD/B0MQ0mN8r/La6z pS2mbTEJuE1KD/33tHo5UeqBIP8QHbed4RQPY+XpfGBemhI2VQ6Nwr6Pqjqaw3Q61Y59uT 1JQMBIxpCIXO6Fx628AW4oEbbSchifRTuepeLqrQP3Q5MsY4doUlHBEddo42kkQbmmg6Z6 WJK9H+d2DcKLgCXY5Y4tW7cn/xq0xL/jjatQ7st2NxghWyKIJZZxRt+2OKBMyw== Date: Thu, 20 Mar 2025 17:35:35 +0100 From: Kory Maincent To: Oleksij Rempel Cc: Andrew Lunn , "David S. Miller" , Eric Dumazet , Jakub Kicinski , Paolo Abeni , Jonathan Corbet , Donald Hunter , Rob Herring , Andrew Lunn , Simon Horman , Heiner Kallweit , Russell King , Krzysztof Kozlowski , Conor Dooley , Liam Girdwood , Mark Brown , Thomas Petazzoni , netdev@vger.kernel.org, linux-doc@vger.kernel.org, Kyle Swenson , Dent Project , kernel@pengutronix.de, Maxime Chevallier , devicetree@vger.kernel.org, linux-kernel@vger.kernel.org Subject: Re: [PATCH net-next v6 06/12] net: pse-pd: Add support for budget evaluation strategies Message-ID: <20250320173535.75e6419e@kmaincent-XPS-13-7390> In-Reply-To: References: <20250304-feature_poe_port_prio-v6-0-3dc0c5ebaf32@bootlin.com> <20250304-feature_poe_port_prio-v6-6-3dc0c5ebaf32@bootlin.com> Organization: bootlin X-Mailer: Claws Mail 4.0.0 (GTK+ 3.24.33; x86_64-pc-linux-gnu) Precedence: bulk X-Mailing-List: linux-doc@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddugeekjedtucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuifetpfffkfdpucggtfgfnhhsuhgsshgtrhhisggvnecuuegrihhlohhuthemuceftddunecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpeffhffvvefukfgjfhhoofggtgfgsehtqhertdertdejnecuhfhrohhmpefmohhrhicuofgrihhntggvnhhtuceokhhorhihrdhmrghinhgtvghnthessghoohhtlhhinhdrtghomheqnecuggftrfgrthhtvghrnhepgfdutdefvedtudegvefgvedtgfdvhfdtueeltefffefffffhgfetkedvfeduieeinecuffhomhgrihhnpegsohhothhlihhnrdgtohhmnecukfhppeeltddrkeelrdduieefrdduvdejnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepledtrdekledrudeifedruddvjedphhgvlhhopehkmhgrihhntggvnhhtqdgirffuqddufedqjeefledtpdhmrghilhhfrhhomhepkhhorhihrdhmrghinhgtvghnthessghoohhtlhhinhdrtghomhdpnhgspghrtghpthhtohepvdejpdhrtghpthhtohepohdrrhgvmhhpvghlsehpvghnghhuthhrohhnihigrdguvgdprhgtphhtthhopegrnhgurhgvfieslhhunhhnrdgthhdprhgtphhtthhopegurghvvghmsegurghvvghmlhhofhhtrdhnvghtpdhrtghpthhtohepvgguuhhmrgiivghtsehgohhoghhlvgdrtghomhdprhgtphhtthhopehku hgsrgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepphgrsggvnhhisehrvgguhhgrthdrtghomhdprhgtphhtthhopegtohhrsggvtheslhifnhdrnhgvthdprhgtphhtthhopeguohhnrghlugdrhhhunhhtvghrsehgmhgrihhlrdgtohhm X-GND-Sasl: kory.maincent@bootlin.com On Mon, 17 Mar 2025 13:40:45 +0100 Oleksij Rempel wrote: > On Tue, Mar 04, 2025 at 11:18:55AM +0100, Kory Maincent wrote: > > From: Kory Maincent (Dent Project) > > +/** > > + * pse_disable_pi_prio - Disable all PIs of a given priority inside a = PSE > > + * power domain > > + * @pcdev: a pointer to the PSE > > + * @pw_d: a pointer to the PSE power domain > > + * @prio: priority > > + * > > + * Return: 0 on success and failure value on error > > + */ > > +static int pse_disable_pi_prio(struct pse_controller_dev *pcdev, > > + struct pse_power_domain *pw_d, > > + int prio) > > +{ > > + int i; > > + =20 >=20 > Should we lock the pi[] array at some level? Lock the pi array? pcdev is already locked in the irq thread handler.=20 =20 > > + for (i =3D 0; i < pcdev->nr_lines; i++) { > > + int ret; > > + > > + if (pcdev->pi[i].prio !=3D prio || > > + pcdev->pi[i].pw_d !=3D pw_d || > > + !pcdev->pi[i].admin_state_enabled) > > + continue; > > + > > + ret =3D pse_disable_pi_pol(pcdev, i); =20 >=20 > If the PSE has many lower-priority ports, the same set of ports could be > repeatedly shut down while higher-priority ports keep power > indefinitely. That is the point of priority. It is not a problem as there is as many prio= rity value as ports. Disabling all the ports configured with a specific priority= is understandable. > This could result in a starvation issue, where lower-priority group of > ports may never get a chance to stay enabled, even if power briefly > becomes available. >=20 > To fix this, we could: > - Disallow identical priorities in static mode to ensure a clear > shutdown order. We can't do this as this imply priority shutdown method is always used and can't be disabled. Having all the ports to the same priority means that the priority strategy = is not used and if new PD is plugged and exceed the budget it simply won't be powered. > > +int pse_ethtool_set_prio(struct pse_control *psec, > > + struct netlink_ext_ack *extack, > > + unsigned int prio) > > +{ > > + struct pse_controller_dev *pcdev =3D psec->pcdev; > > + const struct pse_controller_ops *ops; > > + int ret =3D 0; > > + > > + if (!pcdev->pi[psec->id].pw_d) { > > + NL_SET_ERR_MSG(extack, "no power domain attached"); > > + return -EOPNOTSUPP; > > + } > > + > > + /* We don't want priority change in the middle of an > > + * enable/disable call or a priority mode change > > + */ > > + mutex_lock(&pcdev->lock); > > + switch (pcdev->pi[psec->id].pw_d->budget_eval_strategy) { > > + case ETHTOOL_PSE_BUDGET_EVAL_STRAT_STATIC: > > + if (prio > pcdev->nr_lines) { > > + NL_SET_ERR_MSG_FMT(extack, > > + "priority %d exceed priority > > max %d", > > + prio, pcdev->nr_lines); > > + ret =3D -ERANGE; > > + goto out; > > + } > > + > > + pcdev->pi[psec->id].prio =3D prio; =20 >=20 > In case we already out of the budget, we will need to re-evaluate the > prios. New configuration may affect state of ports. > > Potentially we may need a bulk interface to assign prios, to speed-up > reconfiguration. But it is not needed right now. Oh indeed, I missed that. /o\ I will try to add something but lets keep it not too complex! ^^ Don't add = me more work!! ;) > > + break; > > + > > + case ETHTOOL_PSE_BUDGET_EVAL_STRAT_DYNAMIC: > > + ops =3D psec->pcdev->ops; > > + if (!ops->pi_set_prio) { > > + NL_SET_ERR_MSG(extack, > > + "pse driver does not support > > setting port priority"); > > + ret =3D -EOPNOTSUPP; > > + goto out; > > + } > > + > > + if (prio > pcdev->pis_prio_max) { > > + NL_SET_ERR_MSG_FMT(extack, > > + "priority %d exceed priority > > max %d", > > + prio, pcdev->pis_prio_max); > > + ret =3D -ERANGE; > > + goto out; > > + } > > + > > + ret =3D ops->pi_set_prio(pcdev, psec->id, prio); =20 >=20 > Here too, but in case of microchip PSE it will happen in the firmware. > May be add here a comment that currently it is done in firmware and to > be extended for the kernel based implementation. Ack, I will add a comment. Regards, --=20 K=C3=B6ry Maincent, Bootlin Embedded Linux and kernel engineering https://bootlin.com