* incoming @ 2021-05-05 1:32 Andrew Morton 2021-05-05 1:32 ` [patch 001/143] mm: introduce and use mapping_empty() Andrew Morton ` (140 more replies) 0 siblings, 141 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits The remainder of the main mm/ queue. 143 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus previously sent patches. Subsystems affected by this patch series: mm/pagecache mm/hugetlb mm/userfaultfd mm/vmscan mm/compaction mm/migration mm/cma mm/ksm mm/vmstat mm/mmap mm/kconfig mm/util mm/memory-hotplug mm/zswap mm/zsmalloc mm/highmem mm/cleanups mm/kfence Subsystem: mm/pagecache "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Remove nrexceptional tracking", v2: mm: introduce and use mapping_empty() mm: stop accounting shadow entries dax: account DAX entries as nrpages mm: remove nrexceptional from inode Hugh Dickins <hughd@google.com>: mm: remove nrexceptional from inode: remove BUG_ON Subsystem: mm/hugetlb Peter Xu <peterx@redhat.com>: Patch series "hugetlb: Disable huge pmd unshare for uffd-wp", v4: hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share() hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: remove redundant reservation check condition in alloc_huge_page() Anshuman Khandual <anshuman.khandual@arm.com>: mm: generalize HUGETLB_PAGE_SIZE_VARIABLE Miaohe Lin <linmiaohe@huawei.com>: Patch series "Some cleanups for hugetlb": mm/hugetlb: use some helper functions to cleanup code mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state() mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate() mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page() mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case Patch series "Cleanup and fixup for khugepaged", v2: khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps() khugepaged: reuse the smp_wmb() inside __SetPageUptodate() khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter() khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate() mm/huge_memory.c: remove unnecessary local variable ret2 Patch series "Some cleanups for huge_memory", v3: mm/huge_memory.c: rework the function vma_adjust_trans_huge() mm/huge_memory.c: make get_huge_zero_page() return bool mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly mm/huge_memory.c: remove redundant PageCompound() check mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG mm/huge_memory.c: use helper function migration_entry_to_page() Yanfei Xu <yanfei.xu@windriver.com>: mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup for khugepaged": khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp() khugepaged: remove unnecessary out label in collapse_huge_page() khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd() Zi Yan <ziy@nvidia.com>: mm: huge_memory: a new debugfs interface for splitting THP tests mm: huge_memory: debugfs for file-backed THP split Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for hugetlb", v2: mm/hugeltb: remove redundant VM_BUG_ON() in region_add() mm/hugeltb: simplify the return code of __vma_reservation_common() mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages() mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts() mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages() Mike Kravetz <mike.kravetz@oracle.com>: Patch series "make hugetlb put_page safe for all calling contexts", v5: mm/cma: change cma mutex to irq safe spinlock hugetlb: no need to drop hugetlb_lock to call cma_release hugetlb: add per-hstate mutex to synchronize user adjustments hugetlb: create remove_hugetlb_page() to separate functionality hugetlb: call update_and_free_page without hugetlb_lock hugetlb: change free_pool_huge_page to remove_pool_huge_page hugetlb: make free_huge_page irq safe hugetlb: add lockdep_assert_held() calls for hugetlb_lock Oscar Salvador <osalvador@suse.de>: Patch series "Make alloc_contig_range handle Hugetlb pages", v10: mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range mm,compaction: let isolate_migratepages_{range,block} return error codes mm,hugetlb: drop clearing of flag from prep_new_huge_page mm,hugetlb: split prep_new_huge_page functionality mm: make alloc_contig_range handle free hugetlb pages mm: make alloc_contig_range handle in-use hugetlb pages mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig Subsystem: mm/userfaultfd Axel Rasmussen <axelrasmussen@google.com>: Patch series "userfaultfd: add minor fault handling", v9: userfaultfd: add minor fault registration mode userfaultfd: disable huge PMD sharing for MINOR registered VMAs userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled userfaultfd: add UFFDIO_CONTINUE ioctl userfaultfd: update documentation to describe minor fault handling userfaultfd/selftests: add test exercising minor fault handling Subsystem: mm/vmscan Dave Hansen <dave.hansen@linux.intel.com>: mm/vmscan: move RECLAIM* bits to uapi header mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks Yang Shi <shy828301@gmail.com>: Patch series "Make shrinker's nr_deferred memcg aware", v10: mm: vmscan: use nid from shrink_control for tracepoint mm: vmscan: consolidate shrinker_maps handling code mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation mm: vmscan: remove memcg_shrinker_map_size mm: vmscan: use kvfree_rcu instead of call_rcu mm: memcontrol: rename shrinker_map to shrinker_info mm: vmscan: add shrinker_info_protected() helper mm: vmscan: use a new flag to indicate shrinker is registered mm: vmscan: add per memcg shrinker nr_deferred mm: vmscan: use per memcg nr_deferred of shrinker mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers mm: memcontrol: reparent nr_deferred when memcg offline mm: vmscan: shrink deferred objects proportional to priority Subsystem: mm/compaction Pintu Kumar <pintu@codeaurora.org>: mm/compaction: remove unused variable sysctl_compact_memory Charan Teja Reddy <charante@codeaurora.org>: mm: compaction: update the COMPACT[STALL|FAIL] events properly Subsystem: mm/migration Minchan Kim <minchan@kernel.org>: mm: disable LRU pagevec during the migration temporarily mm: replace migrate_[prep|finish] with lru_cache_[disable|enable] mm: fs: invalidate BH LRU during page migration Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for mm/migrate.c", v3: mm/migrate.c: make putback_movable_page() static mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page() mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole() Revert "mm: migrate: skip shared exec THP for NUMA balancing" Subsystem: mm/cma Minchan Kim <minchan@kernel.org>: mm: vmstat: add cma statistics Baolin Wang <baolin.wang@linux.alibaba.com>: mm: cma: use pr_err_ratelimited for CMA warning Liam Mark <lmark@codeaurora.org>: mm: cma: add trace events for CMA alloc perf testing Minchan Kim <minchan@kernel.org>: mm: cma: support sysfs mm: cma: add the CMA instance name to cma trace events mm: use proper type for cma_[alloc|release] Subsystem: mm/ksm Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for ksm": ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search() ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree() ksm: remove dedicated macro KSM_FLAG_MASK ksm: fix potential missing rmap_item for stable_node Chengyang Fan <cy.fan@huawei.com>: mm/ksm: remove unused parameter from remove_trailing_rmap_items() Subsystem: mm/vmstat Hugh Dickins <hughd@google.com>: mm: restore node stat checking in /proc/sys/vm/stat_refresh mm: no more EINVAL from /proc/sys/vm/stat_refresh mm: /proc/sys/vm/stat_refresh skip checking known negative stats mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats Saravanan D <saravanand@fb.com>: x86/mm: track linear mapping split events Subsystem: mm/mmap Liam Howlett <liam.howlett@oracle.com>: mm/mmap.c: don't unlock VMAs in remap_file_pages() Subsystem: mm/kconfig Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm: some config cleanups", v2: mm: generalize ARCH_HAS_CACHE_LINE_SIZE mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS) mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION mm: drop redundant ARCH_ENABLE_SPLIT_PMD_PTLOCK mm: drop redundant HAVE_ARCH_TRANSPARENT_HUGEPAGE Subsystem: mm/util Joe Perches <joe@perches.com>: mm/util.c: reduce mem_dump_obj() object size Bhaskar Chowdhury <unixbhaskar@gmail.com>: mm/util.c: fix typo Subsystem: mm/memory-hotplug Pavel Tatashin <pasha.tatashin@soleen.com>: Patch series "prohibit pinning pages in ZONE_MOVABLE", v11: mm/gup: don't pin migrated cma pages in movable zone mm/gup: check every subpage of a compound page during isolation mm/gup: return an error on migration failure mm/gup: check for isolation errors mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN mm: apply per-task gfp constraints in fast path mm: honor PF_MEMALLOC_PIN for all movable pages mm/gup: do not migrate zero page mm/gup: migrate pinned pages out of movable zone memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning mm/gup: change index type to long as it counts pages mm/gup: longterm pin migration cleanup selftests/vm: gup_test: fix test flag selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages Mel Gorman <mgorman@techsingularity.net>: mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove Oscar Salvador <osalvador@suse.de>: Patch series "Allocate memmap from hotadded memory (per device)", v10: drivers/base/memory: introduce memory_block_{online,offline} mm,memory_hotplug: relax fully spanned sections check David Hildenbrand <david@redhat.com>: mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count() Oscar Salvador <osalvador@suse.de>: mm,memory_hotplug: allocate memmap from the added memory range acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported mm,memory_hotplug: add kernel boot option to enable memmap_on_memory x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE Subsystem: mm/zswap Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/zswap.c: switch from strlcpy to strscpy Subsystem: mm/zsmalloc zhouchuangao <zhouchuangao@vivo.com>: mm/zsmalloc: use BUG_ON instead of if condition followed by BUG. Subsystem: mm/highmem Ira Weiny <ira.weiny@intel.com>: Patch series "btrfs: Convert kmap/memset/kunmap to memzero_user()": iov_iter: lift memzero_page() to highmem.h btrfs: use memzero_page() instead of open coded kmap pattern songqiang <songqiang@uniontech.com>: mm/highmem.c: fix coding style issue Subsystem: mm/cleanups Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/mempool: minor coding style tweaks Zhang Yunkai <zhang.yunkai@zte.com.cn>: mm/process_vm_access.c: remove duplicate include Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: zero guard page after out-of-bounds access Patch series "kfence: optimize timer scheduling", v2: kfence: await for allocation using wait_event kfence: maximize allocation wait timeout duration kfence: use power-efficient work queue to run delayed work Documentation/ABI/testing/sysfs-kernel-mm-cma | 25 Documentation/admin-guide/kernel-parameters.txt | 17 Documentation/admin-guide/mm/memory-hotplug.rst | 9 Documentation/admin-guide/mm/userfaultfd.rst | 105 +- arch/arc/Kconfig | 9 arch/arm/Kconfig | 10 arch/arm64/Kconfig | 34 arch/arm64/mm/hugetlbpage.c | 7 arch/ia64/Kconfig | 14 arch/ia64/mm/hugetlbpage.c | 3 arch/mips/Kconfig | 6 arch/mips/mm/hugetlbpage.c | 4 arch/parisc/Kconfig | 5 arch/parisc/mm/hugetlbpage.c | 2 arch/powerpc/Kconfig | 17 arch/powerpc/mm/hugetlbpage.c | 3 arch/powerpc/platforms/Kconfig.cputype | 16 arch/riscv/Kconfig | 5 arch/s390/Kconfig | 12 arch/s390/mm/hugetlbpage.c | 2 arch/sh/Kconfig | 7 arch/sh/mm/Kconfig | 8 arch/sh/mm/hugetlbpage.c | 2 arch/sparc/mm/hugetlbpage.c | 2 arch/x86/Kconfig | 33 arch/x86/mm/pat/set_memory.c | 8 drivers/acpi/acpi_memhotplug.c | 5 drivers/base/memory.c | 105 ++ fs/Kconfig | 5 fs/block_dev.c | 2 fs/btrfs/compression.c | 5 fs/btrfs/extent_io.c | 22 fs/btrfs/inode.c | 33 fs/btrfs/reflink.c | 6 fs/btrfs/zlib.c | 5 fs/btrfs/zstd.c | 5 fs/buffer.c | 36 fs/dax.c | 8 fs/gfs2/glock.c | 3 fs/hugetlbfs/inode.c | 9 fs/inode.c | 11 fs/proc/task_mmu.c | 3 fs/userfaultfd.c | 149 +++ include/linux/buffer_head.h | 4 include/linux/cma.h | 4 include/linux/compaction.h | 1 include/linux/fs.h | 2 include/linux/gfp.h | 2 include/linux/highmem.h | 7 include/linux/huge_mm.h | 3 include/linux/hugetlb.h | 37 include/linux/memcontrol.h | 27 include/linux/memory.h | 8 include/linux/memory_hotplug.h | 15 include/linux/memremap.h | 2 include/linux/migrate.h | 11 include/linux/mm.h | 28 include/linux/mmzone.h | 20 include/linux/pagemap.h | 5 include/linux/pgtable.h | 12 include/linux/sched.h | 2 include/linux/sched/mm.h | 27 include/linux/shrinker.h | 7 include/linux/swap.h | 21 include/linux/userfaultfd_k.h | 55 + include/linux/vm_event_item.h | 8 include/trace/events/cma.h | 92 +- include/trace/events/migrate.h | 25 include/trace/events/mmflags.h | 7 include/uapi/linux/mempolicy.h | 7 include/uapi/linux/userfaultfd.h | 36 init/Kconfig | 5 kernel/sysctl.c | 2 lib/Kconfig.kfence | 1 lib/iov_iter.c | 8 mm/Kconfig | 28 mm/Makefile | 6 mm/cma.c | 70 + mm/cma.h | 25 mm/cma_debug.c | 8 mm/cma_sysfs.c | 112 ++ mm/compaction.c | 113 ++ mm/filemap.c | 24 mm/frontswap.c | 12 mm/gup.c | 264 +++--- mm/gup_test.c | 29 mm/gup_test.h | 3 mm/highmem.c | 11 mm/huge_memory.c | 326 +++++++- mm/hugetlb.c | 843 ++++++++++++++-------- mm/hugetlb_cgroup.c | 9 mm/internal.h | 10 mm/kfence/core.c | 61 + mm/khugepaged.c | 63 - mm/ksm.c | 17 mm/list_lru.c | 6 mm/memcontrol.c | 137 --- mm/memory_hotplug.c | 220 +++++ mm/mempolicy.c | 16 mm/mempool.c | 2 mm/migrate.c | 103 -- mm/mlock.c | 4 mm/mmap.c | 18 mm/oom_kill.c | 2 mm/page_alloc.c | 83 +- mm/process_vm_access.c | 1 mm/shmem.c | 2 mm/sparse.c | 4 mm/swap.c | 69 + mm/swap_state.c | 4 mm/swapfile.c | 4 mm/truncate.c | 19 mm/userfaultfd.c | 39 - mm/util.c | 26 mm/vmalloc.c | 2 mm/vmscan.c | 543 +++++++++----- mm/vmstat.c | 45 - mm/workingset.c | 1 mm/zsmalloc.c | 6 mm/zswap.c | 2 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 1 tools/testing/selftests/vm/gup_test.c | 38 tools/testing/selftests/vm/split_huge_page_test.c | 400 ++++++++++ tools/testing/selftests/vm/userfaultfd.c | 164 ++++ 125 files changed, 3596 insertions(+), 1668 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 001/143] mm: introduce and use mapping_empty() 2021-05-05 1:32 incoming Andrew Morton @ 2021-05-05 1:32 ` Andrew Morton 2021-05-05 1:32 ` [patch 002/143] mm: stop accounting shadow entries Andrew Morton ` (139 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw) To: akpm, hannes, linux-mm, mm-commits, torvalds, vishal.l.verma, willy From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: mm: introduce and use mapping_empty() Patch series "Remove nrexceptional tracking", v2. We actually use nrexceptional for very little these days. It's a minor pain to keep in sync with nrpages, but the pain becomes much bigger with the THP patches because we don't know how many indices a shadow entry occupies. It's easier to just remove it than keep it accurate. Also, we save 8 bytes per inode which is nothing to sneeze at; on my laptop, it would improve shmem_inode_cache from 22 to 23 objects per 16kB, and inode_cache from 26 to 27 objects. Combined, that saves a megabyte of memory from a combined usage of 25MB for both caches. Unfortunately, ext4 doesn't cross a magic boundary, so it doesn't save any memory for ext4. This patch (of 4): Instead of checking the two counters (nrpages and nrexceptional), we can just check whether i_pages is empty. Link: https://lkml.kernel.org/r/20201026151849.24232-1-willy@infradead.org Link: https://lkml.kernel.org/r/20201026151849.24232-2-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Tested-by: Vishal Verma <vishal.l.verma@intel.com> Acked-by: Johannes Weiner <hannes@cmpxchg.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/block_dev.c | 2 +- fs/dax.c | 2 +- fs/gfs2/glock.c | 3 +-- include/linux/pagemap.h | 5 +++++ mm/truncate.c | 18 +++--------------- 5 files changed, 11 insertions(+), 19 deletions(-) --- a/fs/block_dev.c~mm-introduce-and-use-mapping_empty +++ a/fs/block_dev.c @@ -79,7 +79,7 @@ static void kill_bdev(struct block_devic { struct address_space *mapping = bdev->bd_inode->i_mapping; - if (mapping->nrpages == 0 && mapping->nrexceptional == 0) + if (mapping_empty(mapping)) return; invalidate_bh_lrus(); --- a/fs/dax.c~mm-introduce-and-use-mapping_empty +++ a/fs/dax.c @@ -965,7 +965,7 @@ int dax_writeback_mapping_range(struct a if (WARN_ON_ONCE(inode->i_blkbits != PAGE_SHIFT)) return -EIO; - if (!mapping->nrexceptional || wbc->sync_mode != WB_SYNC_ALL) + if (mapping_empty(mapping) || wbc->sync_mode != WB_SYNC_ALL) return 0; trace_dax_writeback_range(inode, xas.xa_index, end_index); --- a/fs/gfs2/glock.c~mm-introduce-and-use-mapping_empty +++ a/fs/gfs2/glock.c @@ -273,8 +273,7 @@ static void __gfs2_glock_put(struct gfs2 if (mapping) { truncate_inode_pages_final(mapping); if (!gfs2_withdrawn(sdp)) - GLOCK_BUG_ON(gl, mapping->nrpages || - mapping->nrexceptional); + GLOCK_BUG_ON(gl, !mapping_empty(mapping)); } trace_gfs2_glock_put(gl); sdp->sd_lockstruct.ls_ops->lm_put_lock(gl); --- a/include/linux/pagemap.h~mm-introduce-and-use-mapping_empty +++ a/include/linux/pagemap.h @@ -18,6 +18,11 @@ struct pagevec; +static inline bool mapping_empty(struct address_space *mapping) +{ + return xa_empty(&mapping->i_pages); +} + /* * Bits in mapping->flags. */ --- a/mm/truncate.c~mm-introduce-and-use-mapping_empty +++ a/mm/truncate.c @@ -295,7 +295,7 @@ void truncate_inode_pages_range(struct a pgoff_t index; int i; - if (mapping->nrpages == 0 && mapping->nrexceptional == 0) + if (mapping_empty(mapping)) goto out; /* Offsets within partial pages */ @@ -440,9 +440,6 @@ EXPORT_SYMBOL(truncate_inode_pages); */ void truncate_inode_pages_final(struct address_space *mapping) { - unsigned long nrexceptional; - unsigned long nrpages; - /* * Page reclaim can not participate in regular inode lifetime * management (can't call iput()) and thus can race with the @@ -452,16 +449,7 @@ void truncate_inode_pages_final(struct a */ mapping_set_exiting(mapping); - /* - * When reclaim installs eviction entries, it increases - * nrexceptional first, then decreases nrpages. Make sure we see - * this in the right order or we might miss an entry. - */ - nrpages = mapping->nrpages; - smp_rmb(); - nrexceptional = mapping->nrexceptional; - - if (nrpages || nrexceptional) { + if (!mapping_empty(mapping)) { /* * As truncation uses a lockless tree lookup, cycle * the tree lock to make sure any ongoing tree @@ -633,7 +621,7 @@ int invalidate_inode_pages2_range(struct int ret2 = 0; int did_range_unmap = 0; - if (mapping->nrpages == 0 && mapping->nrexceptional == 0) + if (mapping_empty(mapping)) goto out; pagevec_init(&pvec); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 002/143] mm: stop accounting shadow entries 2021-05-05 1:32 incoming Andrew Morton 2021-05-05 1:32 ` [patch 001/143] mm: introduce and use mapping_empty() Andrew Morton @ 2021-05-05 1:32 ` Andrew Morton 2021-05-05 1:32 ` [patch 003/143] dax: account DAX entries as nrpages Andrew Morton ` (138 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw) To: akpm, hannes, linux-mm, mm-commits, torvalds, vishal.l.verma, willy From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: mm: stop accounting shadow entries We no longer need to keep track of how many shadow entries are present in a mapping. This saves a few writes to the inode and memory barriers. Link: https://lkml.kernel.org/r/20201026151849.24232-3-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Tested-by: Vishal Verma <vishal.l.verma@intel.com> Acked-by: Johannes Weiner <hannes@cmpxchg.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/filemap.c | 13 ------------- mm/swap_state.c | 4 ---- mm/truncate.c | 1 - mm/workingset.c | 1 - 4 files changed, 19 deletions(-) --- a/mm/filemap.c~mm-stop-accounting-shadow-entries +++ a/mm/filemap.c @@ -142,17 +142,6 @@ static void page_cache_delete(struct add page->mapping = NULL; /* Leave page->index set: truncation lookup relies upon it */ - - if (shadow) { - mapping->nrexceptional += nr; - /* - * Make sure the nrexceptional update is committed before - * the nrpages update so that final truncate racing - * with reclaim does not see both counters 0 at the - * same time and miss a shadow entry. - */ - smp_wmb(); - } mapping->nrpages -= nr; } @@ -925,8 +914,6 @@ noinline int __add_to_page_cache_locked( if (xas_error(&xas)) goto unlock; - if (old) - mapping->nrexceptional--; mapping->nrpages++; /* hugetlb pages do not participate in page cache accounting */ --- a/mm/swap_state.c~mm-stop-accounting-shadow-entries +++ a/mm/swap_state.c @@ -132,7 +132,6 @@ int add_to_swap_cache(struct page *page, xas_store(&xas, page); xas_next(&xas); } - address_space->nrexceptional -= nr_shadows; address_space->nrpages += nr; __mod_node_page_state(page_pgdat(page), NR_FILE_PAGES, nr); __mod_lruvec_page_state(page, NR_SWAPCACHE, nr); @@ -172,8 +171,6 @@ void __delete_from_swap_cache(struct pag xas_next(&xas); } ClearPageSwapCache(page); - if (shadow) - address_space->nrexceptional += nr; address_space->nrpages -= nr; __mod_node_page_state(page_pgdat(page), NR_FILE_PAGES, -nr); __mod_lruvec_page_state(page, NR_SWAPCACHE, -nr); @@ -275,7 +272,6 @@ void clear_shadow_from_swap_cache(int ty xas_store(&xas, NULL); nr_shadows++; } - address_space->nrexceptional -= nr_shadows; xa_unlock_irq(&address_space->i_pages); /* search the next swapcache until we meet end */ --- a/mm/truncate.c~mm-stop-accounting-shadow-entries +++ a/mm/truncate.c @@ -40,7 +40,6 @@ static inline void __clear_shadow_entry( if (xas_load(&xas) != entry) return; xas_store(&xas, NULL); - mapping->nrexceptional--; } static void clear_shadow_entry(struct address_space *mapping, pgoff_t index, --- a/mm/workingset.c~mm-stop-accounting-shadow-entries +++ a/mm/workingset.c @@ -554,7 +554,6 @@ static enum lru_status shadow_lru_isolat goto out_invalid; if (WARN_ON_ONCE(node->count != node->nr_values)) goto out_invalid; - mapping->nrexceptional -= node->nr_values; xa_delete_node(node, workingset_update_node); __inc_lruvec_kmem_state(node, WORKINGSET_NODERECLAIM); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 003/143] dax: account DAX entries as nrpages 2021-05-05 1:32 incoming Andrew Morton 2021-05-05 1:32 ` [patch 001/143] mm: introduce and use mapping_empty() Andrew Morton 2021-05-05 1:32 ` [patch 002/143] mm: stop accounting shadow entries Andrew Morton @ 2021-05-05 1:32 ` Andrew Morton 2021-05-05 1:32 ` [patch 004/143] mm: remove nrexceptional from inode Andrew Morton ` (137 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw) To: akpm, hannes, linux-mm, mm-commits, torvalds, vishal.l.verma, willy From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: dax: account DAX entries as nrpages Simplify mapping_needs_writeback() by accounting DAX entries as pages instead of exceptional entries. Link: https://lkml.kernel.org/r/20201026151849.24232-4-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Tested-by: Vishal Verma <vishal.l.verma@intel.com> Acked-by: Johannes Weiner <hannes@cmpxchg.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/dax.c | 6 +++--- mm/filemap.c | 3 --- 2 files changed, 3 insertions(+), 6 deletions(-) --- a/fs/dax.c~dax-account-dax-entries-as-nrpages +++ a/fs/dax.c @@ -525,7 +525,7 @@ retry: dax_disassociate_entry(entry, mapping, false); xas_store(xas, NULL); /* undo the PMD join */ dax_wake_entry(xas, entry, true); - mapping->nrexceptional--; + mapping->nrpages -= PG_PMD_NR; entry = NULL; xas_set(xas, index); } @@ -541,7 +541,7 @@ retry: dax_lock_entry(xas, entry); if (xas_error(xas)) goto out_unlock; - mapping->nrexceptional++; + mapping->nrpages += 1UL << order; } out_unlock: @@ -661,7 +661,7 @@ static int __dax_invalidate_entry(struct goto out; dax_disassociate_entry(entry, mapping, trunc); xas_store(&xas, NULL); - mapping->nrexceptional--; + mapping->nrpages -= 1UL << dax_entry_order(entry); ret = 1; out: put_unlocked_entry(&xas, entry); --- a/mm/filemap.c~dax-account-dax-entries-as-nrpages +++ a/mm/filemap.c @@ -618,9 +618,6 @@ EXPORT_SYMBOL(filemap_fdatawait_keep_err /* Returns true if writeback might be needed or already in progress. */ static bool mapping_needs_writeback(struct address_space *mapping) { - if (dax_mapping(mapping)) - return mapping->nrexceptional; - return mapping->nrpages; } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 004/143] mm: remove nrexceptional from inode 2021-05-05 1:32 incoming Andrew Morton ` (2 preceding siblings ...) 2021-05-05 1:32 ` [patch 003/143] dax: account DAX entries as nrpages Andrew Morton @ 2021-05-05 1:32 ` Andrew Morton 2021-05-05 1:32 ` [patch 005/143] mm: remove nrexceptional from inode: remove BUG_ON Andrew Morton ` (136 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw) To: akpm, hannes, linux-mm, mm-commits, torvalds, vishal.l.verma, willy From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: mm: remove nrexceptional from inode We no longer track anything in nrexceptional, so remove it, saving 8 bytes per inode. Link: https://lkml.kernel.org/r/20201026151849.24232-5-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Tested-by: Vishal Verma <vishal.l.verma@intel.com> Acked-by: Johannes Weiner <hannes@cmpxchg.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/inode.c | 2 +- include/linux/fs.h | 2 -- 2 files changed, 1 insertion(+), 3 deletions(-) --- a/fs/inode.c~mm-remove-nrexceptional-from-inode +++ a/fs/inode.c @@ -529,7 +529,7 @@ void clear_inode(struct inode *inode) */ xa_lock_irq(&inode->i_data.i_pages); BUG_ON(inode->i_data.nrpages); - BUG_ON(inode->i_data.nrexceptional); + BUG_ON(!mapping_empty(&inode->i_data)); xa_unlock_irq(&inode->i_data.i_pages); BUG_ON(!list_empty(&inode->i_data.private_list)); BUG_ON(!(inode->i_state & I_FREEING)); --- a/include/linux/fs.h~mm-remove-nrexceptional-from-inode +++ a/include/linux/fs.h @@ -442,7 +442,6 @@ int pagecache_write_end(struct file *, s * @i_mmap: Tree of private and shared mappings. * @i_mmap_rwsem: Protects @i_mmap and @i_mmap_writable. * @nrpages: Number of page entries, protected by the i_pages lock. - * @nrexceptional: Shadow or DAX entries, protected by the i_pages lock. * @writeback_index: Writeback starts here. * @a_ops: Methods. * @flags: Error bits and flags (AS_*). @@ -463,7 +462,6 @@ struct address_space { struct rb_root_cached i_mmap; struct rw_semaphore i_mmap_rwsem; unsigned long nrpages; - unsigned long nrexceptional; pgoff_t writeback_index; const struct address_space_operations *a_ops; unsigned long flags; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 005/143] mm: remove nrexceptional from inode: remove BUG_ON 2021-05-05 1:32 incoming Andrew Morton ` (3 preceding siblings ...) 2021-05-05 1:32 ` [patch 004/143] mm: remove nrexceptional from inode Andrew Morton @ 2021-05-05 1:32 ` Andrew Morton 2021-05-05 1:33 ` [patch 006/143] hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share() Andrew Morton ` (135 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw) To: akpm, hughd, linux-mm, mm-commits, torvalds, willy From: Hugh Dickins <hughd@google.com> Subject: mm: remove nrexceptional from inode: remove BUG_ON clear_inode()'s BUG_ON(!mapping_empty(&inode->i_data)) is unsafe: we know of two ways in which nodes can and do (on rare occasions) get left behind. Until those are fixed, do not BUG_ON() nor even WARN_ON(). Yes, this will then leak those nodes (or the next user of the struct inode may use them); but this has been happening for years, and the new BUG_ON(!mapping_empty) was only guilty of revealing that. A proper fix will follow, but no hurry. Link: https://lkml.kernel.org/r/alpine.LSU.2.11.2104292229380.16080@eggly.anvils Signed-off-by: Hugh Dickins <hughd@google.com> Cc: Matthew Wilcox <willy@infradead.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/inode.c | 9 ++++++++- 1 file changed, 8 insertions(+), 1 deletion(-) --- a/fs/inode.c~mm-remove-nrexceptional-from-inode-remove-bug_on +++ a/fs/inode.c @@ -529,7 +529,14 @@ void clear_inode(struct inode *inode) */ xa_lock_irq(&inode->i_data.i_pages); BUG_ON(inode->i_data.nrpages); - BUG_ON(!mapping_empty(&inode->i_data)); + /* + * Almost always, mapping_empty(&inode->i_data) here; but there are + * two known and long-standing ways in which nodes may get left behind + * (when deep radix-tree node allocation failed partway; or when THP + * collapse_file() failed). Until those two known cases are cleaned up, + * or a cleanup function is called here, do not BUG_ON(!mapping_empty), + * nor even WARN_ON(!mapping_empty). + */ xa_unlock_irq(&inode->i_data.i_pages); BUG_ON(!list_empty(&inode->i_data.private_list)); BUG_ON(!(inode->i_state & I_FREEING)); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 006/143] hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share() 2021-05-05 1:32 incoming Andrew Morton ` (4 preceding siblings ...) 2021-05-05 1:32 ` [patch 005/143] mm: remove nrexceptional from inode: remove BUG_ON Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 007/143] hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled Andrew Morton ` (134 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual, axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang, dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra, mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton, peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli, steven.price, torvalds, vbabka, viro, walken, willy, ying.huang From: Peter Xu <peterx@redhat.com> Subject: hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share() Patch series "hugetlb: Disable huge pmd unshare for uffd-wp", v4. This series tries to disable huge pmd unshare of hugetlbfs backed memory for uffd-wp. Although uffd-wp of hugetlbfs is still during rfc stage, the idea of this series may be needed for multiple tasks (Axel's uffd minor fault series, and Mike's soft dirty series), so I picked it out from the larger series. This patch (of 4): It is a preparation work to be able to behave differently in the per architecture huge_pte_alloc() according to different VMA attributes. Pass it deeper into huge_pmd_share() so that we can avoid the find_vma() call. [peterx@redhat.com: build fix] Link: https://lkml.kernel.org/r/20210304164653.GB397383@xz-x1Link: https://lkml.kernel.org/r/20210218230633.15028-1-peterx@redhat.com Link: https://lkml.kernel.org/r/20210218230633.15028-2-peterx@redhat.com Signed-off-by: Peter Xu <peterx@redhat.com> Suggested-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Adam Ruprecht <ruprecht@google.com> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Axel Rasmussen <axelrasmussen@google.com> Cc: Cannon Matthews <cannonmatthews@google.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Chinwen Chang <chinwen.chang@mediatek.com> Cc: David Rientjes <rientjes@google.com> Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com> Cc: Huang Ying <ying.huang@intel.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jann Horn <jannh@google.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Kirill A. Shutemov <kirill@shutemov.name> Cc: Lokesh Gidra <lokeshgidra@google.com> Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: "Michal Koutn" <mkoutny@suse.com> Cc: Michel Lespinasse <walken@google.com> Cc: Mike Rapoport <rppt@linux.vnet.ibm.com> Cc: Mina Almasry <almasrymina@google.com> Cc: Nicholas Piggin <npiggin@gmail.com> Cc: Oliver Upton <oupton@google.com> Cc: Shaohua Li <shli@fb.com> Cc: Shawn Anastasio <shawn@anastas.io> Cc: Steven Price <steven.price@arm.com> Cc: Steven Rostedt <rostedt@goodmis.org> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm64/mm/hugetlbpage.c | 4 ++-- arch/ia64/mm/hugetlbpage.c | 3 ++- arch/mips/mm/hugetlbpage.c | 4 ++-- arch/parisc/mm/hugetlbpage.c | 2 +- arch/powerpc/mm/hugetlbpage.c | 3 ++- arch/s390/mm/hugetlbpage.c | 2 +- arch/sh/mm/hugetlbpage.c | 2 +- arch/sparc/mm/hugetlbpage.c | 2 +- include/linux/hugetlb.h | 5 +++-- mm/hugetlb.c | 15 ++++++++------- mm/userfaultfd.c | 2 +- 11 files changed, 24 insertions(+), 20 deletions(-) --- a/arch/arm64/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share +++ a/arch/arm64/mm/hugetlbpage.c @@ -252,7 +252,7 @@ void set_huge_swap_pte_at(struct mm_stru set_pte(ptep, pte); } -pte_t *huge_pte_alloc(struct mm_struct *mm, +pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma, unsigned long addr, unsigned long sz) { pgd_t *pgdp; @@ -286,7 +286,7 @@ pte_t *huge_pte_alloc(struct mm_struct * } else if (sz == PMD_SIZE) { if (IS_ENABLED(CONFIG_ARCH_WANT_HUGE_PMD_SHARE) && pud_none(READ_ONCE(*pudp))) - ptep = huge_pmd_share(mm, addr, pudp); + ptep = huge_pmd_share(mm, vma, addr, pudp); else ptep = (pte_t *)pmd_alloc(mm, pudp, addr); } else if (sz == (CONT_PMD_SIZE)) { --- a/arch/ia64/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share +++ a/arch/ia64/mm/hugetlbpage.c @@ -25,7 +25,8 @@ unsigned int hpage_shift = HPAGE_SHIFT_D EXPORT_SYMBOL(hpage_shift); pte_t * -huge_pte_alloc(struct mm_struct *mm, unsigned long addr, unsigned long sz) +huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma, + unsigned long addr, unsigned long sz) { unsigned long taddr = htlbpage_to_page(addr); pgd_t *pgd; --- a/arch/mips/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share +++ a/arch/mips/mm/hugetlbpage.c @@ -21,8 +21,8 @@ #include <asm/tlb.h> #include <asm/tlbflush.h> -pte_t *huge_pte_alloc(struct mm_struct *mm, unsigned long addr, - unsigned long sz) +pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma, + unsigned long addr, unsigned long sz) { pgd_t *pgd; p4d_t *p4d; --- a/arch/parisc/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share +++ a/arch/parisc/mm/hugetlbpage.c @@ -44,7 +44,7 @@ hugetlb_get_unmapped_area(struct file *f } -pte_t *huge_pte_alloc(struct mm_struct *mm, +pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma, unsigned long addr, unsigned long sz) { pgd_t *pgd; --- a/arch/powerpc/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share +++ a/arch/powerpc/mm/hugetlbpage.c @@ -106,7 +106,8 @@ static int __hugepte_alloc(struct mm_str * At this point we do the placement change only for BOOK3S 64. This would * possibly work on other subarchs. */ -pte_t *huge_pte_alloc(struct mm_struct *mm, unsigned long addr, unsigned long sz) +pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma, + unsigned long addr, unsigned long sz) { pgd_t *pg; p4d_t *p4; --- a/arch/s390/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share +++ a/arch/s390/mm/hugetlbpage.c @@ -189,7 +189,7 @@ pte_t huge_ptep_get_and_clear(struct mm_ return pte; } -pte_t *huge_pte_alloc(struct mm_struct *mm, +pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma, unsigned long addr, unsigned long sz) { pgd_t *pgdp; --- a/arch/sh/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share +++ a/arch/sh/mm/hugetlbpage.c @@ -21,7 +21,7 @@ #include <asm/tlbflush.h> #include <asm/cacheflush.h> -pte_t *huge_pte_alloc(struct mm_struct *mm, +pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma, unsigned long addr, unsigned long sz) { pgd_t *pgd; --- a/arch/sparc/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share +++ a/arch/sparc/mm/hugetlbpage.c @@ -279,7 +279,7 @@ unsigned long pud_leaf_size(pud_t pud) { unsigned long pmd_leaf_size(pmd_t pmd) { return 1UL << tte_to_shift(*(pte_t *)&pmd); } unsigned long pte_leaf_size(pte_t pte) { return 1UL << tte_to_shift(pte); } -pte_t *huge_pte_alloc(struct mm_struct *mm, +pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma, unsigned long addr, unsigned long sz) { pgd_t *pgd; --- a/include/linux/hugetlb.h~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share +++ a/include/linux/hugetlb.h @@ -152,7 +152,8 @@ void hugetlb_fix_reserve_counts(struct i extern struct mutex *hugetlb_fault_mutex_table; u32 hugetlb_fault_mutex_hash(struct address_space *mapping, pgoff_t idx); -pte_t *huge_pmd_share(struct mm_struct *mm, unsigned long addr, pud_t *pud); +pte_t *huge_pmd_share(struct mm_struct *mm, struct vm_area_struct *vma, + unsigned long addr, pud_t *pud); struct address_space *hugetlb_page_mapping_lock_write(struct page *hpage); @@ -161,7 +162,7 @@ extern struct list_head huge_boot_pages; /* arch callbacks */ -pte_t *huge_pte_alloc(struct mm_struct *mm, +pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma, unsigned long addr, unsigned long sz); pte_t *huge_pte_offset(struct mm_struct *mm, unsigned long addr, unsigned long sz); --- a/mm/hugetlb.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share +++ a/mm/hugetlb.c @@ -3795,7 +3795,7 @@ int copy_hugetlb_page_range(struct mm_st src_pte = huge_pte_offset(src, addr, sz); if (!src_pte) continue; - dst_pte = huge_pte_alloc(dst, addr, sz); + dst_pte = huge_pte_alloc(dst, vma, addr, sz); if (!dst_pte) { ret = -ENOMEM; break; @@ -4563,7 +4563,7 @@ vm_fault_t hugetlb_fault(struct mm_struc */ mapping = vma->vm_file->f_mapping; i_mmap_lock_read(mapping); - ptep = huge_pte_alloc(mm, haddr, huge_page_size(h)); + ptep = huge_pte_alloc(mm, vma, haddr, huge_page_size(h)); if (!ptep) { i_mmap_unlock_read(mapping); return VM_FAULT_OOM; @@ -5370,9 +5370,9 @@ void adjust_range_if_pmd_sharing_possibl * if !vma_shareable check at the beginning of the routine. i_mmap_rwsem is * only required for subsequent processing. */ -pte_t *huge_pmd_share(struct mm_struct *mm, unsigned long addr, pud_t *pud) +pte_t *huge_pmd_share(struct mm_struct *mm, struct vm_area_struct *vma, + unsigned long addr, pud_t *pud) { - struct vm_area_struct *vma = find_vma(mm, addr); struct address_space *mapping = vma->vm_file->f_mapping; pgoff_t idx = ((addr - vma->vm_start) >> PAGE_SHIFT) + vma->vm_pgoff; @@ -5450,7 +5450,8 @@ int huge_pmd_unshare(struct mm_struct *m } #define want_pmd_share() (1) #else /* !CONFIG_ARCH_WANT_HUGE_PMD_SHARE */ -pte_t *huge_pmd_share(struct mm_struct *mm, unsigned long addr, pud_t *pud) +pte_t *huge_pmd_share(struct mm_struct *mm, struct vm_area_struct *vma, + unsigned long addr, pud_t *pud) { return NULL; } @@ -5469,7 +5470,7 @@ void adjust_range_if_pmd_sharing_possibl #endif /* CONFIG_ARCH_WANT_HUGE_PMD_SHARE */ #ifdef CONFIG_ARCH_WANT_GENERAL_HUGETLB -pte_t *huge_pte_alloc(struct mm_struct *mm, +pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma, unsigned long addr, unsigned long sz) { pgd_t *pgd; @@ -5488,7 +5489,7 @@ pte_t *huge_pte_alloc(struct mm_struct * } else { BUG_ON(sz != PMD_SIZE); if (want_pmd_share() && pud_none(*pud)) - pte = huge_pmd_share(mm, addr, pud); + pte = huge_pmd_share(mm, vma, addr, pud); else pte = (pte_t *)pmd_alloc(mm, pud, addr); } --- a/mm/userfaultfd.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share +++ a/mm/userfaultfd.c @@ -290,7 +290,7 @@ retry: mutex_lock(&hugetlb_fault_mutex_table[hash]); err = -ENOMEM; - dst_pte = huge_pte_alloc(dst_mm, dst_addr, vma_hpagesize); + dst_pte = huge_pte_alloc(dst_mm, dst_vma, dst_addr, vma_hpagesize); if (!dst_pte) { mutex_unlock(&hugetlb_fault_mutex_table[hash]); i_mmap_unlock_read(mapping); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 007/143] hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled 2021-05-05 1:32 incoming Andrew Morton ` (5 preceding siblings ...) 2021-05-05 1:33 ` [patch 006/143] hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share() Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 008/143] mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h Andrew Morton ` (133 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual, axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang, dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra, mike.kravetz, mingo, mkoutny, mm-commits, mpe, naresh.kamboju, npiggin, oupton, peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli, steven.price, torvalds, vbabka, viro, walken, willy, ying.huang From: Peter Xu <peterx@redhat.com> Subject: hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled Huge pmd sharing could bring problem to userfaultfd. The thing is that userfaultfd is running its logic based on the special bits on page table entries, however the huge pmd sharing could potentially share page table entries for different address ranges. That could cause issues on either: - When sharing huge pmd page tables for an uffd write protected range, the newly mapped huge pmd range will also be write protected unexpectedly, or, - When we try to write protect a range of huge pmd shared range, we'll first do huge_pmd_unshare() in hugetlb_change_protection(), however that also means the UFFDIO_WRITEPROTECT could be silently skipped for the shared region, which could lead to data loss. Since at it, a few other things are done altogether: - Move want_pmd_share() from mm/hugetlb.c into linux/hugetlb.h, because that's definitely something that arch code would like to use too - ARM64 currently directly check against CONFIG_ARCH_WANT_HUGE_PMD_SHARE when trying to share huge pmd. Switch to the want_pmd_share() helper. Since at it, move vma_shareable() from huge_pmd_share() into want_pmd_share(). [peterx@redhat.com: fix build with !ARCH_WANT_HUGE_PMD_SHARE] Link: https://lkml.kernel.org/r/20210310185359.88297-1-peterx@redhat.com Link: https://lkml.kernel.org/r/20210218231202.15426-1-peterx@redhat.com Signed-off-by: Peter Xu <peterx@redhat.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Reviewed-by: Axel Rasmussen <axelrasmussen@google.com> Tested-by: Naresh Kamboju <naresh.kamboju@linaro.org> Cc: Adam Ruprecht <ruprecht@google.com> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Cannon Matthews <cannonmatthews@google.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Chinwen Chang <chinwen.chang@mediatek.com> Cc: David Rientjes <rientjes@google.com> Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com> Cc: Huang Ying <ying.huang@intel.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jann Horn <jannh@google.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Kirill A. Shutemov <kirill@shutemov.name> Cc: Lokesh Gidra <lokeshgidra@google.com> Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: "Michal Koutn" <mkoutny@suse.com> Cc: Michel Lespinasse <walken@google.com> Cc: Mike Rapoport <rppt@linux.vnet.ibm.com> Cc: Mina Almasry <almasrymina@google.com> Cc: Nicholas Piggin <npiggin@gmail.com> Cc: Oliver Upton <oupton@google.com> Cc: Shaohua Li <shli@fb.com> Cc: Shawn Anastasio <shawn@anastas.io> Cc: Steven Price <steven.price@arm.com> Cc: Steven Rostedt <rostedt@goodmis.org> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm64/mm/hugetlbpage.c | 3 +-- include/linux/hugetlb.h | 2 ++ include/linux/userfaultfd_k.h | 9 +++++++++ mm/hugetlb.c | 22 ++++++++++++++++------ 4 files changed, 28 insertions(+), 8 deletions(-) --- a/arch/arm64/mm/hugetlbpage.c~hugetlb-userfaultfd-forbid-huge-pmd-sharing-when-uffd-enabled +++ a/arch/arm64/mm/hugetlbpage.c @@ -284,8 +284,7 @@ pte_t *huge_pte_alloc(struct mm_struct * */ ptep = pte_alloc_map(mm, pmdp, addr); } else if (sz == PMD_SIZE) { - if (IS_ENABLED(CONFIG_ARCH_WANT_HUGE_PMD_SHARE) && - pud_none(READ_ONCE(*pudp))) + if (want_pmd_share(vma, addr) && pud_none(READ_ONCE(*pudp))) ptep = huge_pmd_share(mm, vma, addr, pudp); else ptep = (pte_t *)pmd_alloc(mm, pudp, addr); --- a/include/linux/hugetlb.h~hugetlb-userfaultfd-forbid-huge-pmd-sharing-when-uffd-enabled +++ a/include/linux/hugetlb.h @@ -1040,4 +1040,6 @@ static inline __init void hugetlb_cma_ch } #endif +bool want_pmd_share(struct vm_area_struct *vma, unsigned long addr); + #endif /* _LINUX_HUGETLB_H */ --- a/include/linux/userfaultfd_k.h~hugetlb-userfaultfd-forbid-huge-pmd-sharing-when-uffd-enabled +++ a/include/linux/userfaultfd_k.h @@ -52,6 +52,15 @@ static inline bool is_mergeable_vm_userf return vma->vm_userfaultfd_ctx.ctx == vm_ctx.ctx; } +/* + * Never enable huge pmd sharing on uffd-wp registered vmas, because uffd-wp + * protect information is per pgtable entry. + */ +static inline bool uffd_disable_huge_pmd_share(struct vm_area_struct *vma) +{ + return vma->vm_flags & VM_UFFD_WP; +} + static inline bool userfaultfd_missing(struct vm_area_struct *vma) { return vma->vm_flags & VM_UFFD_MISSING; --- a/mm/hugetlb.c~hugetlb-userfaultfd-forbid-huge-pmd-sharing-when-uffd-enabled +++ a/mm/hugetlb.c @@ -5326,6 +5326,15 @@ static bool vma_shareable(struct vm_area return false; } +bool want_pmd_share(struct vm_area_struct *vma, unsigned long addr) +{ +#ifdef CONFIG_USERFAULTFD + if (uffd_disable_huge_pmd_share(vma)) + return false; +#endif + return vma_shareable(vma, addr); +} + /* * Determine if start,end range within vma could be mapped by shared pmd. * If yes, adjust start and end to cover range associated with possible @@ -5382,9 +5391,6 @@ pte_t *huge_pmd_share(struct mm_struct * pte_t *pte; spinlock_t *ptl; - if (!vma_shareable(vma, addr)) - return (pte_t *)pmd_alloc(mm, pud, addr); - i_mmap_assert_locked(mapping); vma_interval_tree_foreach(svma, &mapping->i_mmap, idx, idx) { if (svma == vma) @@ -5448,7 +5454,7 @@ int huge_pmd_unshare(struct mm_struct *m *addr = ALIGN(*addr, HPAGE_SIZE * PTRS_PER_PTE) - HPAGE_SIZE; return 1; } -#define want_pmd_share() (1) + #else /* !CONFIG_ARCH_WANT_HUGE_PMD_SHARE */ pte_t *huge_pmd_share(struct mm_struct *mm, struct vm_area_struct *vma, unsigned long addr, pud_t *pud) @@ -5466,7 +5472,11 @@ void adjust_range_if_pmd_sharing_possibl unsigned long *start, unsigned long *end) { } -#define want_pmd_share() (0) + +bool want_pmd_share(struct vm_area_struct *vma, unsigned long addr) +{ + return false; +} #endif /* CONFIG_ARCH_WANT_HUGE_PMD_SHARE */ #ifdef CONFIG_ARCH_WANT_GENERAL_HUGETLB @@ -5488,7 +5498,7 @@ pte_t *huge_pte_alloc(struct mm_struct * pte = (pte_t *)pud; } else { BUG_ON(sz != PMD_SIZE); - if (want_pmd_share() && pud_none(*pud)) + if (want_pmd_share(vma, addr) && pud_none(*pud)) pte = huge_pmd_share(mm, vma, addr, pud); else pte = (pte_t *)pmd_alloc(mm, pud, addr); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 008/143] mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h 2021-05-05 1:32 incoming Andrew Morton ` (6 preceding siblings ...) 2021-05-05 1:33 ` [patch 007/143] hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 009/143] hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp Andrew Morton ` (132 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual, axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang, dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra, mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton, peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli, steven.price, torvalds, vbabka, viro, walken, willy, ying.huang From: Peter Xu <peterx@redhat.com> Subject: mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h Prepare for it to be called outside of mm/hugetlb.c. Link: https://lkml.kernel.org/r/20210218231204.15474-1-peterx@redhat.com Signed-off-by: Peter Xu <peterx@redhat.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Reviewed-by: Axel Rasmussen <axelrasmussen@google.com> Cc: Adam Ruprecht <ruprecht@google.com> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Cannon Matthews <cannonmatthews@google.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Chinwen Chang <chinwen.chang@mediatek.com> Cc: David Rientjes <rientjes@google.com> Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com> Cc: Huang Ying <ying.huang@intel.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jann Horn <jannh@google.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Kirill A. Shutemov <kirill@shutemov.name> Cc: Lokesh Gidra <lokeshgidra@google.com> Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: "Michal Koutn" <mkoutny@suse.com> Cc: Michel Lespinasse <walken@google.com> Cc: Mike Rapoport <rppt@linux.vnet.ibm.com> Cc: Mina Almasry <almasrymina@google.com> Cc: Nicholas Piggin <npiggin@gmail.com> Cc: Oliver Upton <oupton@google.com> Cc: Shaohua Li <shli@fb.com> Cc: Shawn Anastasio <shawn@anastas.io> Cc: Steven Price <steven.price@arm.com> Cc: Steven Rostedt <rostedt@goodmis.org> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/hugetlb.h | 8 ++++++++ mm/hugetlb.c | 8 -------- 2 files changed, 8 insertions(+), 8 deletions(-) --- a/include/linux/hugetlb.h~mm-hugetlb-move-flush_hugetlb_tlb_range-into-hugetlbh +++ a/include/linux/hugetlb.h @@ -1042,4 +1042,12 @@ static inline __init void hugetlb_cma_ch bool want_pmd_share(struct vm_area_struct *vma, unsigned long addr); +#ifndef __HAVE_ARCH_FLUSH_HUGETLB_TLB_RANGE +/* + * ARCHes with special requirements for evicting HUGETLB backing TLB entries can + * implement this. + */ +#define flush_hugetlb_tlb_range(vma, addr, end) flush_tlb_range(vma, addr, end) +#endif + #endif /* _LINUX_HUGETLB_H */ --- a/mm/hugetlb.c~mm-hugetlb-move-flush_hugetlb_tlb_range-into-hugetlbh +++ a/mm/hugetlb.c @@ -4996,14 +4996,6 @@ long follow_hugetlb_page(struct mm_struc return i ? i : err; } -#ifndef __HAVE_ARCH_FLUSH_HUGETLB_TLB_RANGE -/* - * ARCHes with special requirements for evicting HUGETLB backing TLB entries can - * implement this. - */ -#define flush_hugetlb_tlb_range(vma, addr, end) flush_tlb_range(vma, addr, end) -#endif - unsigned long hugetlb_change_protection(struct vm_area_struct *vma, unsigned long address, unsigned long end, pgprot_t newprot) { _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 009/143] hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp 2021-05-05 1:32 incoming Andrew Morton ` (7 preceding siblings ...) 2021-05-05 1:33 ` [patch 008/143] mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 010/143] mm/hugetlb: remove redundant reservation check condition in alloc_huge_page() Andrew Morton ` (131 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual, axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang, dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra, mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton, peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli, steven.price, torvalds, vbabka, viro, walken, willy, ying.huang From: Peter Xu <peterx@redhat.com> Subject: hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp Huge pmd sharing for hugetlbfs is racy with userfaultfd-wp because userfaultfd-wp is always based on pgtable entries, so they cannot be shared. Walk the hugetlb range and unshare all such mappings if there is, right before UFFDIO_REGISTER will succeed and return to userspace. This will pair with want_pmd_share() in hugetlb code so that huge pmd sharing is completely disabled for userfaultfd-wp registered range. Link: https://lkml.kernel.org/r/20210218231206.15524-1-peterx@redhat.com Signed-off-by: Peter Xu <peterx@redhat.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Peter Xu <peterx@redhat.com> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Axel Rasmussen <axelrasmussen@google.com> Cc: Mike Rapoport <rppt@linux.vnet.ibm.com> Cc: Kirill A. Shutemov <kirill@shutemov.name> Cc: Matthew Wilcox (Oracle) <willy@infradead.org> Cc: Adam Ruprecht <ruprecht@google.com> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Cannon Matthews <cannonmatthews@google.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Chinwen Chang <chinwen.chang@mediatek.com> Cc: David Rientjes <rientjes@google.com> Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com> Cc: Huang Ying <ying.huang@intel.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jann Horn <jannh@google.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Lokesh Gidra <lokeshgidra@google.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: "Michal Koutn" <mkoutny@suse.com> Cc: Michel Lespinasse <walken@google.com> Cc: Mina Almasry <almasrymina@google.com> Cc: Nicholas Piggin <npiggin@gmail.com> Cc: Oliver Upton <oupton@google.com> Cc: Shaohua Li <shli@fb.com> Cc: Shawn Anastasio <shawn@anastas.io> Cc: Steven Price <steven.price@arm.com> Cc: Steven Rostedt <rostedt@goodmis.org> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/userfaultfd.c | 4 ++ include/linux/hugetlb.h | 3 ++ mm/hugetlb.c | 51 ++++++++++++++++++++++++++++++++++++++ 3 files changed, 58 insertions(+) --- a/fs/userfaultfd.c~hugetlb-userfaultfd-unshare-all-pmds-for-hugetlbfs-when-register-wp +++ a/fs/userfaultfd.c @@ -15,6 +15,7 @@ #include <linux/sched/signal.h> #include <linux/sched/mm.h> #include <linux/mm.h> +#include <linux/mmu_notifier.h> #include <linux/poll.h> #include <linux/slab.h> #include <linux/seq_file.h> @@ -1449,6 +1450,9 @@ static int userfaultfd_register(struct u vma->vm_flags = new_flags; vma->vm_userfaultfd_ctx.ctx = ctx; + if (is_vm_hugetlb_page(vma) && uffd_disable_huge_pmd_share(vma)) + hugetlb_unshare_all_pmds(vma); + skip: prev = vma; start = vma->vm_end; --- a/include/linux/hugetlb.h~hugetlb-userfaultfd-unshare-all-pmds-for-hugetlbfs-when-register-wp +++ a/include/linux/hugetlb.h @@ -188,6 +188,7 @@ unsigned long hugetlb_change_protection( unsigned long address, unsigned long end, pgprot_t newprot); bool is_hugetlb_entry_migration(pte_t pte); +void hugetlb_unshare_all_pmds(struct vm_area_struct *vma); #else /* !CONFIG_HUGETLB_PAGE */ @@ -369,6 +370,8 @@ static inline vm_fault_t hugetlb_fault(s return 0; } +static inline void hugetlb_unshare_all_pmds(struct vm_area_struct *vma) { } + #endif /* !CONFIG_HUGETLB_PAGE */ /* * hugepages at page global directory. If arch support --- a/mm/hugetlb.c~hugetlb-userfaultfd-unshare-all-pmds-for-hugetlbfs-when-register-wp +++ a/mm/hugetlb.c @@ -5691,6 +5691,57 @@ void move_hugetlb_state(struct page *old } } +/* + * This function will unconditionally remove all the shared pmd pgtable entries + * within the specific vma for a hugetlbfs memory range. + */ +void hugetlb_unshare_all_pmds(struct vm_area_struct *vma) +{ + struct hstate *h = hstate_vma(vma); + unsigned long sz = huge_page_size(h); + struct mm_struct *mm = vma->vm_mm; + struct mmu_notifier_range range; + unsigned long address, start, end; + spinlock_t *ptl; + pte_t *ptep; + + if (!(vma->vm_flags & VM_MAYSHARE)) + return; + + start = ALIGN(vma->vm_start, PUD_SIZE); + end = ALIGN_DOWN(vma->vm_end, PUD_SIZE); + + if (start >= end) + return; + + /* + * No need to call adjust_range_if_pmd_sharing_possible(), because + * we have already done the PUD_SIZE alignment. + */ + mmu_notifier_range_init(&range, MMU_NOTIFY_CLEAR, 0, vma, mm, + start, end); + mmu_notifier_invalidate_range_start(&range); + i_mmap_lock_write(vma->vm_file->f_mapping); + for (address = start; address < end; address += PUD_SIZE) { + unsigned long tmp = address; + + ptep = huge_pte_offset(mm, address, sz); + if (!ptep) + continue; + ptl = huge_pte_lock(h, mm, ptep); + /* We don't want 'address' to be changed */ + huge_pmd_unshare(mm, vma, &tmp, ptep); + spin_unlock(ptl); + } + flush_hugetlb_tlb_range(vma, start, end); + i_mmap_unlock_write(vma->vm_file->f_mapping); + /* + * No need to call mmu_notifier_invalidate_range(), see + * Documentation/vm/mmu_notifier.rst. + */ + mmu_notifier_invalidate_range_end(&range); +} + #ifdef CONFIG_CMA static bool cma_reserve_called __initdata; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 010/143] mm/hugetlb: remove redundant reservation check condition in alloc_huge_page() 2021-05-05 1:32 incoming Andrew Morton ` (8 preceding siblings ...) 2021-05-05 1:33 ` [patch 009/143] hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 011/143] mm: generalize HUGETLB_PAGE_SIZE_VARIABLE Andrew Morton ` (130 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/hugetlb: remove redundant reservation check condition in alloc_huge_page() vma_resv_map(vma) checks if a reserve map is associated with the vma. The routine vma_needs_reservation() will check vma_resv_map(vma) and return 1 if no reserv map is present. map_chg is set to the return value of vma_needs_reservation(). Therefore, !vma_resv_map(vma) is redundant in the expression: map_chg || avoid_reserve || !vma_resv_map(vma); Remove the redundant check. [Thanks Mike Kravetz for reshaping this commit message!] Link: https://lkml.kernel.org/r/20210301104726.45159-1-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/hugetlb.c~mm-hugetlb-remove-redundant-reservation-check-condition-in-alloc_huge_page +++ a/mm/hugetlb.c @@ -2316,7 +2316,7 @@ struct page *alloc_huge_page(struct vm_a /* If this allocation is not consuming a reservation, charge it now. */ - deferred_reserve = map_chg || avoid_reserve || !vma_resv_map(vma); + deferred_reserve = map_chg || avoid_reserve; if (deferred_reserve) { ret = hugetlb_cgroup_charge_cgroup_rsvd( idx, pages_per_huge_page(h), &h_cg); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 011/143] mm: generalize HUGETLB_PAGE_SIZE_VARIABLE 2021-05-05 1:32 incoming Andrew Morton ` (9 preceding siblings ...) 2021-05-05 1:33 ` [patch 010/143] mm/hugetlb: remove redundant reservation check condition in alloc_huge_page() Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 012/143] mm/hugetlb: use some helper functions to cleanup code Andrew Morton ` (129 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: akpm, anshuman.khandual, benh, christophe.leroy, hch, linux-mm, mike.kravetz, mm-commits, mpe, paulus, torvalds From: Anshuman Khandual <anshuman.khandual@arm.com> Subject: mm: generalize HUGETLB_PAGE_SIZE_VARIABLE HUGETLB_PAGE_SIZE_VARIABLE need not be defined for each individual platform subscribing it. Instead just make it generic. Link: https://lkml.kernel.org/r/1614914928-22039-1-git-send-email-anshuman.khandual@arm.com Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com> Suggested-by: Christoph Hellwig <hch@lst.de> Reviewed-by: Christoph Hellwig <hch@lst.de> Acked-by: Michael Ellerman <mpe@ellerman.id.au> [powerpc] Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Paul Mackerras <paulus@samba.org> Cc: Christophe Leroy <christophe.leroy@csgroup.eu> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/ia64/Kconfig | 6 +----- arch/powerpc/Kconfig | 6 +----- mm/Kconfig | 7 +++++++ 3 files changed, 9 insertions(+), 10 deletions(-) --- a/arch/ia64/Kconfig~mm-generalize-hugetlb_page_size_variable +++ a/arch/ia64/Kconfig @@ -32,6 +32,7 @@ config IA64 select TTY select HAVE_ARCH_TRACEHOOK select HAVE_VIRT_CPU_ACCOUNTING + select HUGETLB_PAGE_SIZE_VARIABLE if HUGETLB_PAGE select VIRT_TO_BUS select GENERIC_IRQ_PROBE select GENERIC_PENDING_IRQ if SMP @@ -82,11 +83,6 @@ config STACKTRACE_SUPPORT config GENERIC_LOCKBREAK def_bool n -config HUGETLB_PAGE_SIZE_VARIABLE - bool - depends on HUGETLB_PAGE - default y - config GENERIC_CALIBRATE_DELAY bool default y --- a/arch/powerpc/Kconfig~mm-generalize-hugetlb_page_size_variable +++ a/arch/powerpc/Kconfig @@ -232,6 +232,7 @@ config PPC select HAVE_HARDLOCKUP_DETECTOR_PERF if PERF_EVENTS && HAVE_PERF_EVENTS_NMI && !HAVE_HARDLOCKUP_DETECTOR_ARCH select HAVE_PERF_REGS select HAVE_PERF_USER_STACK_DUMP + select HUGETLB_PAGE_SIZE_VARIABLE if PPC_BOOK3S_64 && HUGETLB_PAGE select MMU_GATHER_RCU_TABLE_FREE select MMU_GATHER_PAGE_SIZE select HAVE_REGS_AND_STACK_ACCESS_API @@ -416,11 +417,6 @@ config HIGHMEM source "kernel/Kconfig.hz" -config HUGETLB_PAGE_SIZE_VARIABLE - bool - depends on HUGETLB_PAGE && PPC_BOOK3S_64 - default y - config MATH_EMULATION bool "Math emulation" depends on 4xx || PPC_8xx || PPC_MPC832x || BOOKE --- a/mm/Kconfig~mm-generalize-hugetlb_page_size_variable +++ a/mm/Kconfig @@ -273,6 +273,13 @@ config ARCH_ENABLE_HUGEPAGE_MIGRATION config ARCH_ENABLE_THP_MIGRATION bool +config HUGETLB_PAGE_SIZE_VARIABLE + def_bool n + help + Allows the pageblock_order value to be dynamic instead of just standard + HUGETLB_PAGE_ORDER when there are multiple HugeTLB page sizes available + on a platform. + config CONTIG_ALLOC def_bool (MEMORY_ISOLATION && COMPACTION) || CMA _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 012/143] mm/hugetlb: use some helper functions to cleanup code 2021-05-05 1:32 incoming Andrew Morton ` (10 preceding siblings ...) 2021-05-05 1:33 ` [patch 011/143] mm: generalize HUGETLB_PAGE_SIZE_VARIABLE Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 013/143] mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state() Andrew Morton ` (128 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/hugetlb: use some helper functions to cleanup code Patch series "Some cleanups for hugetlb". This series contains cleanups to remove unnecessary VM_BUG_ON_PAGE, use helper function and so on. I also collect some previous patches into this series in case they are forgotten. This patch (of 5): We could use pages_per_huge_page to get the number of pages per hugepage, use get_hstate_idx to calculate hstate index, and use hstate_is_gigantic to check if a hstate is gigantic to make code more succinct. Link: https://lkml.kernel.org/r/20210308112809.26107-1-linmiaohe@huawei.com Link: https://lkml.kernel.org/r/20210308112809.26107-2-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/hugetlbfs/inode.c | 2 +- mm/hugetlb.c | 6 +++--- 2 files changed, 4 insertions(+), 4 deletions(-) --- a/fs/hugetlbfs/inode.c~mm-hugetlb-use-some-helper-functions-to-cleanup-code +++ a/fs/hugetlbfs/inode.c @@ -1435,7 +1435,7 @@ static int get_hstate_idx(int page_size_ if (!h) return -1; - return h - hstates; + return hstate_index(h); } /* --- a/mm/hugetlb.c~mm-hugetlb-use-some-helper-functions-to-cleanup-code +++ a/mm/hugetlb.c @@ -1273,7 +1273,7 @@ static void free_gigantic_page(struct pa static struct page *alloc_gigantic_page(struct hstate *h, gfp_t gfp_mask, int nid, nodemask_t *nodemask) { - unsigned long nr_pages = 1UL << huge_page_order(h); + unsigned long nr_pages = pages_per_huge_page(h); if (nid == NUMA_NO_NODE) nid = numa_mem_id(); @@ -3267,10 +3267,10 @@ static int __init hugepages_setup(char * /* * Global state is always initialized later in hugetlb_init. - * But we need to allocate >= MAX_ORDER hstates here early to still + * But we need to allocate gigantic hstates here early to still * use the bootmem allocator. */ - if (hugetlb_max_hstate && parsed_hstate->order >= MAX_ORDER) + if (hugetlb_max_hstate && hstate_is_gigantic(parsed_hstate)) hugetlb_hstate_alloc_pages(parsed_hstate); last_mhp = mhp; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 013/143] mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state() 2021-05-05 1:32 incoming Andrew Morton ` (11 preceding siblings ...) 2021-05-05 1:33 ` [patch 012/143] mm/hugetlb: use some helper functions to cleanup code Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 014/143] mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate() Andrew Morton ` (127 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state() We should not transfer the per-node surplus state when we do not cross the node in order to save some cpu cycles Link: https://lkml.kernel.org/r/20210308112809.26107-3-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 6 ++++++ 1 file changed, 6 insertions(+) --- a/mm/hugetlb.c~mm-hugetlb-optimize-the-surplus-state-transfer-code-in-move_hugetlb_state +++ a/mm/hugetlb.c @@ -5682,6 +5682,12 @@ void move_hugetlb_state(struct page *old SetHPageTemporary(oldpage); ClearHPageTemporary(newpage); + /* + * There is no need to transfer the per-node surplus state + * when we do not cross the node. + */ + if (new_nid == old_nid) + return; spin_lock(&hugetlb_lock); if (h->surplus_huge_pages_node[old_nid]) { h->surplus_huge_pages_node[old_nid]--; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 014/143] mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate() 2021-05-05 1:32 incoming Andrew Morton ` (12 preceding siblings ...) 2021-05-05 1:33 ` [patch 013/143] mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state() Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 015/143] mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page() Andrew Morton ` (126 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate() !PageHuge(oldhpage) is implicitly checked in page_hstate() above, so we remove this explicit one. Link: https://lkml.kernel.org/r/20210308112809.26107-4-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb_cgroup.c | 1 - 1 file changed, 1 deletion(-) --- a/mm/hugetlb_cgroup.c~hugetlb_cgroup-remove-unnecessary-vm_bug_on_page-in-hugetlb_cgroup_migrate +++ a/mm/hugetlb_cgroup.c @@ -784,7 +784,6 @@ void hugetlb_cgroup_migrate(struct page if (hugetlb_cgroup_disabled()) return; - VM_BUG_ON_PAGE(!PageHuge(oldhpage), oldhpage); spin_lock(&hugetlb_lock); h_cg = hugetlb_cgroup_from_page(oldhpage); h_cg_rsvd = hugetlb_cgroup_from_page_rsvd(oldhpage); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 015/143] mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page() 2021-05-05 1:32 incoming Andrew Morton ` (13 preceding siblings ...) 2021-05-05 1:33 ` [patch 014/143] mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate() Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 016/143] mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case Andrew Morton ` (125 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page() Rework the error handling code when alloc_huge_page() failed to remove some duplicated code and simplify the code slightly. Link: https://lkml.kernel.org/r/20210308112809.26107-5-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 9 +++------ 1 file changed, 3 insertions(+), 6 deletions(-) --- a/mm/hugetlb.c~mm-hugetlb-simplify-the-code-when-alloc_huge_page-failed-in-hugetlb_no_page +++ a/mm/hugetlb.c @@ -4395,13 +4395,10 @@ retry: * sure there really is no pte entry. */ ptl = huge_pte_lock(h, mm, ptep); - if (!huge_pte_none(huge_ptep_get(ptep))) { - ret = 0; - spin_unlock(ptl); - goto out; - } + ret = 0; + if (huge_pte_none(huge_ptep_get(ptep))) + ret = vmf_error(PTR_ERR(page)); spin_unlock(ptl); - ret = vmf_error(PTR_ERR(page)); goto out; } clear_huge_page(page, address, pages_per_huge_page(h)); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 016/143] mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case 2021-05-05 1:32 incoming Andrew Morton ` (14 preceding siblings ...) 2021-05-05 1:33 ` [patch 015/143] mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page() Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 017/143] khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps() Andrew Morton ` (124 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case The fault_mutex hashing overhead can be avoided in truncate_op case because page faults can not race with truncation in this routine. So calculate hash for fault_mutex only in !truncate_op case to save some cpu cycles. Link: https://lkml.kernel.org/r/20210308112809.26107-6-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/hugetlbfs/inode.c | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) --- a/fs/hugetlbfs/inode.c~mm-hugetlb-avoid-calculating-fault_mutex_hash-in-truncate_op-case +++ a/fs/hugetlbfs/inode.c @@ -482,10 +482,9 @@ static void remove_inode_hugepages(struc for (i = 0; i < pagevec_count(&pvec); ++i) { struct page *page = pvec.pages[i]; - u32 hash; + u32 hash = 0; index = page->index; - hash = hugetlb_fault_mutex_hash(mapping, index); if (!truncate_op) { /* * Only need to hold the fault mutex in the @@ -493,6 +492,7 @@ static void remove_inode_hugepages(struc * page faults. Races are not possible in the * case of truncation. */ + hash = hugetlb_fault_mutex_hash(mapping, index); mutex_lock(&hugetlb_fault_mutex_table[hash]); } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 017/143] khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps() 2021-05-05 1:32 incoming Andrew Morton ` (15 preceding siblings ...) 2021-05-05 1:33 ` [patch 016/143] mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 018/143] khugepaged: reuse the smp_wmb() inside __SetPageUptodate() Andrew Morton ` (123 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: akpm, dan.carpenter, ebru.akagunduz, kirill.shutemov, linmiaohe, linux-mm, mike.kravetz, mm-commits, riel, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps() Patch series "Cleanup and fixup for khugepaged", v2. This series contains cleanups to remove unneeded return value, use helper function and so on. And there is one fix to correct the wrong result value for trace_mm_collapse_huge_page_isolate(). This patch (of 4): The return value of khugepaged_collapse_pte_mapped_thps() is never checked since it's introduced. We should remove such unneeded return value. Link: https://lkml.kernel.org/r/20210306032947.35921-1-linmiaohe@huawei.com Link: https://lkml.kernel.org/r/20210306032947.35921-2-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: Rik van Riel <riel@redhat.com> Cc: Ebru Akagunduz <ebru.akagunduz@gmail.com> Cc: Dan Carpenter <dan.carpenter@oracle.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/khugepaged.c | 10 ++++------ 1 file changed, 4 insertions(+), 6 deletions(-) --- a/mm/khugepaged.c~khugepaged-remove-unneeded-return-value-of-khugepaged_collapse_pte_mapped_thps +++ a/mm/khugepaged.c @@ -1533,16 +1533,16 @@ abort: goto drop_hpage; } -static int khugepaged_collapse_pte_mapped_thps(struct mm_slot *mm_slot) +static void khugepaged_collapse_pte_mapped_thps(struct mm_slot *mm_slot) { struct mm_struct *mm = mm_slot->mm; int i; if (likely(mm_slot->nr_pte_mapped_thp == 0)) - return 0; + return; if (!mmap_write_trylock(mm)) - return -EBUSY; + return; if (unlikely(khugepaged_test_exit(mm))) goto out; @@ -1553,7 +1553,6 @@ static int khugepaged_collapse_pte_mappe out: mm_slot->nr_pte_mapped_thp = 0; mmap_write_unlock(mm); - return 0; } static void retract_page_tables(struct address_space *mapping, pgoff_t pgoff) @@ -2057,9 +2056,8 @@ static void khugepaged_scan_file(struct BUILD_BUG(); } -static int khugepaged_collapse_pte_mapped_thps(struct mm_slot *mm_slot) +static void khugepaged_collapse_pte_mapped_thps(struct mm_slot *mm_slot) { - return 0; } #endif _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 018/143] khugepaged: reuse the smp_wmb() inside __SetPageUptodate() 2021-05-05 1:32 incoming Andrew Morton ` (16 preceding siblings ...) 2021-05-05 1:33 ` [patch 017/143] khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps() Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 019/143] khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter() Andrew Morton ` (122 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: akpm, dan.carpenter, ebru.akagunduz, kirill.shutemov, linmiaohe, linux-mm, mike.kravetz, mm-commits, riel, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: khugepaged: reuse the smp_wmb() inside __SetPageUptodate() smp_wmb() is needed to avoid the copy_huge_page writes to become visible after the set_pmd_at() write here. But we can reuse the smp_wmb() inside __SetPageUptodate() to remove this redundant one. Link: https://lkml.kernel.org/r/20210306032947.35921-3-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: Dan Carpenter <dan.carpenter@oracle.com> Cc: Ebru Akagunduz <ebru.akagunduz@gmail.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Rik van Riel <riel@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/khugepaged.c | 13 ++++++------- 1 file changed, 6 insertions(+), 7 deletions(-) --- a/mm/khugepaged.c~khugepaged-reuse-the-smp_wmb-inside-__setpageuptodate +++ a/mm/khugepaged.c @@ -1183,19 +1183,18 @@ static void collapse_huge_page(struct mm __collapse_huge_page_copy(pte, new_page, vma, address, pte_ptl, &compound_pagelist); pte_unmap(pte); + /* + * spin_lock() below is not the equivalent of smp_wmb(), but + * the smp_wmb() inside __SetPageUptodate() can be reused to + * avoid the copy_huge_page writes to become visible after + * the set_pmd_at() write. + */ __SetPageUptodate(new_page); pgtable = pmd_pgtable(_pmd); _pmd = mk_huge_pmd(new_page, vma->vm_page_prot); _pmd = maybe_pmd_mkwrite(pmd_mkdirty(_pmd), vma); - /* - * spin_lock() below is not the equivalent of smp_wmb(), so - * this is needed to avoid the copy_huge_page writes to become - * visible after the set_pmd_at() write. - */ - smp_wmb(); - spin_lock(pmd_ptl); BUG_ON(!pmd_none(*pmd)); page_add_new_anon_rmap(new_page, vma, address, true); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 019/143] khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter() 2021-05-05 1:32 incoming Andrew Morton ` (17 preceding siblings ...) 2021-05-05 1:33 ` [patch 018/143] khugepaged: reuse the smp_wmb() inside __SetPageUptodate() Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 020/143] khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate() Andrew Morton ` (121 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: akpm, dan.carpenter, ebru.akagunduz, kirill.shutemov, linmiaohe, linux-mm, mike.kravetz, mm-commits, riel, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter() Commit 4d45e75a9955 ("mm: remove the now-unnecessary mmget_still_valid() hack") have made khugepaged_test_exit() suitable for check mm->mm_users against 0. Use this helper here. Link: https://lkml.kernel.org/r/20210306032947.35921-4-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: Dan Carpenter <dan.carpenter@oracle.com> Cc: Ebru Akagunduz <ebru.akagunduz@gmail.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Rik van Riel <riel@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/khugepaged.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/khugepaged.c~khugepaged-use-helper-khugepaged_test_exit-in-__khugepaged_enter +++ a/mm/khugepaged.c @@ -481,7 +481,7 @@ int __khugepaged_enter(struct mm_struct return -ENOMEM; /* __khugepaged_exit() must not run from under us */ - VM_BUG_ON_MM(atomic_read(&mm->mm_users) == 0, mm); + VM_BUG_ON_MM(khugepaged_test_exit(mm), mm); if (unlikely(test_and_set_bit(MMF_VM_HUGEPAGE, &mm->flags))) { free_mm_slot(mm_slot); return 0; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 020/143] khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate() 2021-05-05 1:32 incoming Andrew Morton ` (18 preceding siblings ...) 2021-05-05 1:33 ` [patch 019/143] khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter() Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 021/143] mm/huge_memory.c: remove unnecessary local variable ret2 Andrew Morton ` (120 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: akpm, dan.carpenter, ebru.akagunduz, kirill.shutemov, linmiaohe, linux-mm, mike.kravetz, mm-commits, riel, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate() In writable and !referenced case, the result value should be SCAN_LACK_REFERENCED_PAGE for trace_mm_collapse_huge_page_isolate() instead of default 0 (SCAN_FAIL) here. Link: https://lkml.kernel.org/r/20210306032947.35921-5-linmiaohe@huawei.com Fixes: 7d2eba0557c1 ("mm: add tracepoint for scanning pages") Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: Dan Carpenter <dan.carpenter@oracle.com> Cc: Ebru Akagunduz <ebru.akagunduz@gmail.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Rik van Riel <riel@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/khugepaged.c | 18 +++++++++--------- 1 file changed, 9 insertions(+), 9 deletions(-) --- a/mm/khugepaged.c~khugepaged-fix-wrong-result-value-for-trace_mm_collapse_huge_page_isolate +++ a/mm/khugepaged.c @@ -716,17 +716,17 @@ next: if (pte_write(pteval)) writable = true; } - if (likely(writable)) { - if (likely(referenced)) { - result = SCAN_SUCCEED; - trace_mm_collapse_huge_page_isolate(page, none_or_zero, - referenced, writable, result); - return 1; - } - } else { + + if (unlikely(!writable)) { result = SCAN_PAGE_RO; + } else if (unlikely(!referenced)) { + result = SCAN_LACK_REFERENCED_PAGE; + } else { + result = SCAN_SUCCEED; + trace_mm_collapse_huge_page_isolate(page, none_or_zero, + referenced, writable, result); + return 1; } - out: release_pte_pages(pte, _pte, compound_pagelist); trace_mm_collapse_huge_page_isolate(page, none_or_zero, _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 021/143] mm/huge_memory.c: remove unnecessary local variable ret2 2021-05-05 1:32 incoming Andrew Morton ` (19 preceding siblings ...) 2021-05-05 1:33 ` [patch 020/143] khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate() Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 022/143] mm/huge_memory.c: rework the function vma_adjust_trans_huge() Andrew Morton ` (119 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/huge_memory.c: remove unnecessary local variable ret2 There is no need to use a new local variable ret2 to get the return value of handle_userfault(). Use ret directly to make code more succinct. Link: https://lkml.kernel.org/r/20210210072409.60587-1-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/huge_memory.c | 8 +++----- 1 file changed, 3 insertions(+), 5 deletions(-) --- a/mm/huge_memory.c~mm-huge_memoryc-remove-unnecessary-local-variable-ret2 +++ a/mm/huge_memory.c @@ -624,14 +624,12 @@ static vm_fault_t __do_huge_pmd_anonymou /* Deliver the page fault to userland */ if (userfaultfd_missing(vma)) { - vm_fault_t ret2; - spin_unlock(vmf->ptl); put_page(page); pte_free(vma->vm_mm, pgtable); - ret2 = handle_userfault(vmf, VM_UFFD_MISSING); - VM_BUG_ON(ret2 & VM_FAULT_FALLBACK); - return ret2; + ret = handle_userfault(vmf, VM_UFFD_MISSING); + VM_BUG_ON(ret & VM_FAULT_FALLBACK); + return ret; } entry = mk_huge_pmd(page, vma->vm_page_prot); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 022/143] mm/huge_memory.c: rework the function vma_adjust_trans_huge() 2021-05-05 1:32 incoming Andrew Morton ` (20 preceding siblings ...) 2021-05-05 1:33 ` [patch 021/143] mm/huge_memory.c: remove unnecessary local variable ret2 Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 023/143] mm/huge_memory.c: make get_huge_zero_page() return bool Andrew Morton ` (118 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx, rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken, william.kucharski, willy, yang.shi, yulei.kernel, ziy From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/huge_memory.c: rework the function vma_adjust_trans_huge() Patch series "Some cleanups for huge_memory", v3. This series contains cleanups to rework some function logics to make it more readable, use helper function and so on. More details can be found in the respective changelogs. This patch (of 6): The current implementation of vma_adjust_trans_huge() contains some duplicated codes. Add helper function to get rid of these codes to make it more succinct. Link: https://lkml.kernel.org/r/20210318122722.13135-1-linmiaohe@huawei.com Link: https://lkml.kernel.org/r/20210318122722.13135-2-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Peter Xu <peterx@redhat.com> Cc: Zi Yan <ziy@nvidia.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: William Kucharski <william.kucharski@oracle.com> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Peter Xu <peterx@redhat.com> Cc: yuleixzhang <yulei.kernel@gmail.com> Cc: Michel Lespinasse <walken@google.com> Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com> Cc: Ralph Campbell <rcampbell@nvidia.com> Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org> Cc: Yang Shi <yang.shi@linux.alibaba.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/huge_memory.c | 44 +++++++++++++++++++------------------------- 1 file changed, 19 insertions(+), 25 deletions(-) --- a/mm/huge_memory.c~mm-huge_memoryc-rework-the-function-vma_adjust_trans_huge +++ a/mm/huge_memory.c @@ -2301,44 +2301,38 @@ void split_huge_pmd_address(struct vm_ar __split_huge_pmd(vma, pmd, address, freeze, page); } +static inline void split_huge_pmd_if_needed(struct vm_area_struct *vma, unsigned long address) +{ + /* + * If the new address isn't hpage aligned and it could previously + * contain an hugepage: check if we need to split an huge pmd. + */ + if (!IS_ALIGNED(address, HPAGE_PMD_SIZE) && + range_in_vma(vma, ALIGN_DOWN(address, HPAGE_PMD_SIZE), + ALIGN(address, HPAGE_PMD_SIZE))) + split_huge_pmd_address(vma, address, false, NULL); +} + void vma_adjust_trans_huge(struct vm_area_struct *vma, unsigned long start, unsigned long end, long adjust_next) { - /* - * If the new start address isn't hpage aligned and it could - * previously contain an hugepage: check if we need to split - * an huge pmd. - */ - if (start & ~HPAGE_PMD_MASK && - (start & HPAGE_PMD_MASK) >= vma->vm_start && - (start & HPAGE_PMD_MASK) + HPAGE_PMD_SIZE <= vma->vm_end) - split_huge_pmd_address(vma, start, false, NULL); + /* Check if we need to split start first. */ + split_huge_pmd_if_needed(vma, start); - /* - * If the new end address isn't hpage aligned and it could - * previously contain an hugepage: check if we need to split - * an huge pmd. - */ - if (end & ~HPAGE_PMD_MASK && - (end & HPAGE_PMD_MASK) >= vma->vm_start && - (end & HPAGE_PMD_MASK) + HPAGE_PMD_SIZE <= vma->vm_end) - split_huge_pmd_address(vma, end, false, NULL); + /* Check if we need to split end next. */ + split_huge_pmd_if_needed(vma, end); /* - * If we're also updating the vma->vm_next->vm_start, if the new - * vm_next->vm_start isn't hpage aligned and it could previously - * contain an hugepage: check if we need to split an huge pmd. + * If we're also updating the vma->vm_next->vm_start, + * check if we need to split it. */ if (adjust_next > 0) { struct vm_area_struct *next = vma->vm_next; unsigned long nstart = next->vm_start; nstart += adjust_next; - if (nstart & ~HPAGE_PMD_MASK && - (nstart & HPAGE_PMD_MASK) >= next->vm_start && - (nstart & HPAGE_PMD_MASK) + HPAGE_PMD_SIZE <= next->vm_end) - split_huge_pmd_address(next, nstart, false, NULL); + split_huge_pmd_if_needed(next, nstart); } } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 023/143] mm/huge_memory.c: make get_huge_zero_page() return bool 2021-05-05 1:32 incoming Andrew Morton ` (21 preceding siblings ...) 2021-05-05 1:33 ` [patch 022/143] mm/huge_memory.c: rework the function vma_adjust_trans_huge() Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:33 ` [patch 024/143] mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly Andrew Morton ` (117 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx, rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken, william.kucharski, willy, yang.shi, yulei.kernel, ziy From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/huge_memory.c: make get_huge_zero_page() return bool It's guaranteed that huge_zero_page will not be NULL if huge_zero_refcount is increased successfully. When READ_ONCE(huge_zero_page) is returned, there must be a huge_zero_page and it can be replaced with returning 'true' when we do not care about the value of huge_zero_page. We can thus make it return bool to save READ_ONCE cpu cycles as the return value is just used to check if huge_zero_page exists. Link: https://lkml.kernel.org/r/20210318122722.13135-3-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Zi Yan <ziy@nvidia.com> Reviewed-by: Peter Xu <peterx@redhat.com> Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Michel Lespinasse <walken@google.com> Cc: Ralph Campbell <rcampbell@nvidia.com> Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: William Kucharski <william.kucharski@oracle.com> Cc: Yang Shi <yang.shi@linux.alibaba.com> Cc: yuleixzhang <yulei.kernel@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/huge_memory.c | 8 ++++---- 1 file changed, 4 insertions(+), 4 deletions(-) --- a/mm/huge_memory.c~mm-huge_memoryc-make-get_huge_zero_page-return-bool +++ a/mm/huge_memory.c @@ -77,18 +77,18 @@ bool transparent_hugepage_enabled(struct return false; } -static struct page *get_huge_zero_page(void) +static bool get_huge_zero_page(void) { struct page *zero_page; retry: if (likely(atomic_inc_not_zero(&huge_zero_refcount))) - return READ_ONCE(huge_zero_page); + return true; zero_page = alloc_pages((GFP_TRANSHUGE | __GFP_ZERO) & ~__GFP_MOVABLE, HPAGE_PMD_ORDER); if (!zero_page) { count_vm_event(THP_ZERO_PAGE_ALLOC_FAILED); - return NULL; + return false; } count_vm_event(THP_ZERO_PAGE_ALLOC); preempt_disable(); @@ -101,7 +101,7 @@ retry: /* We take additional reference here. It will be put back by shrinker */ atomic_set(&huge_zero_refcount, 2); preempt_enable(); - return READ_ONCE(huge_zero_page); + return true; } static void put_huge_zero_page(void) _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 024/143] mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly 2021-05-05 1:32 incoming Andrew Morton ` (22 preceding siblings ...) 2021-05-05 1:33 ` [patch 023/143] mm/huge_memory.c: make get_huge_zero_page() return bool Andrew Morton @ 2021-05-05 1:33 ` Andrew Morton 2021-05-05 1:34 ` [patch 025/143] mm/huge_memory.c: remove redundant PageCompound() check Andrew Morton ` (116 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw) To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx, rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken, william.kucharski, willy, yang.shi, yulei.kernel, ziy From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly The current code that checks if migrating misplaced transhuge page is needed is pretty hard to follow. Rework it and add a comment to make its logic more clear and improve readability. Link: https://lkml.kernel.org/r/20210318122722.13135-4-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Zi Yan <ziy@nvidia.com> Reviewed-by: Peter Xu <peterx@redhat.com> Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Michel Lespinasse <walken@google.com> Cc: Ralph Campbell <rcampbell@nvidia.com> Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: William Kucharski <william.kucharski@oracle.com> Cc: Yang Shi <yang.shi@linux.alibaba.com> Cc: yuleixzhang <yulei.kernel@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/huge_memory.c | 11 +++++------ 1 file changed, 5 insertions(+), 6 deletions(-) --- a/mm/huge_memory.c~mm-huge_memoryc-rework-the-function-do_huge_pmd_numa_page-slightly +++ a/mm/huge_memory.c @@ -1462,12 +1462,6 @@ vm_fault_t do_huge_pmd_numa_page(struct */ page_locked = trylock_page(page); target_nid = mpol_misplaced(page, vma, haddr); - if (target_nid == NUMA_NO_NODE) { - /* If the page was locked, there are no parallel migrations */ - if (page_locked) - goto clear_pmdnuma; - } - /* Migration could have started since the pmd_trans_migrating check */ if (!page_locked) { page_nid = NUMA_NO_NODE; @@ -1476,6 +1470,11 @@ vm_fault_t do_huge_pmd_numa_page(struct spin_unlock(vmf->ptl); put_and_wait_on_page_locked(page, TASK_UNINTERRUPTIBLE); goto out; + } else if (target_nid == NUMA_NO_NODE) { + /* There are no parallel migrations and page is in the right + * node. Clear the numa hinting info in this pmd. + */ + goto clear_pmdnuma; } /* _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 025/143] mm/huge_memory.c: remove redundant PageCompound() check 2021-05-05 1:32 incoming Andrew Morton ` (23 preceding siblings ...) 2021-05-05 1:33 ` [patch 024/143] mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 026/143] mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG Andrew Morton ` (115 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx, rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken, william.kucharski, willy, yang.shi, yulei.kernel, ziy From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/huge_memory.c: remove redundant PageCompound() check The !PageCompound() check limits the page must be head or tail while !PageHead() further limits it to page head only. So !PageHead() check is equivalent here. Link: https://lkml.kernel.org/r/20210318122722.13135-5-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Peter Xu <peterx@redhat.com> Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Michel Lespinasse <walken@google.com> Cc: Ralph Campbell <rcampbell@nvidia.com> Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: William Kucharski <william.kucharski@oracle.com> Cc: Yang Shi <yang.shi@linux.alibaba.com> Cc: yuleixzhang <yulei.kernel@gmail.com> Cc: Zi Yan <ziy@nvidia.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/huge_memory.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/huge_memory.c~mm-huge_memoryc-remove-redundant-pagecompound-check +++ a/mm/huge_memory.c @@ -1291,7 +1291,7 @@ vm_fault_t do_huge_pmd_wp_page(struct vm } page = pmd_page(orig_pmd); - VM_BUG_ON_PAGE(!PageCompound(page) || !PageHead(page), page); + VM_BUG_ON_PAGE(!PageHead(page), page); /* Lock page for reuse_swap_page() */ if (!trylock_page(page)) { _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 026/143] mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG 2021-05-05 1:32 incoming Andrew Morton ` (24 preceding siblings ...) 2021-05-05 1:34 ` [patch 025/143] mm/huge_memory.c: remove redundant PageCompound() check Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 027/143] mm/huge_memory.c: use helper function migration_entry_to_page() Andrew Morton ` (114 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx, rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken, william.kucharski, willy, yang.shi, yulei.kernel, ziy From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG Commit 4958e4d86ecb ("mm: thp: remove debug_cow switch") forgot to remove TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG macro. Remove it here. Link: https://lkml.kernel.org/r/20210318122722.13135-6-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Zi Yan <ziy@nvidia.com> Reviewed-by: Peter Xu <peterx@redhat.com> Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Michel Lespinasse <walken@google.com> Cc: Ralph Campbell <rcampbell@nvidia.com> Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: William Kucharski <william.kucharski@oracle.com> Cc: Yang Shi <yang.shi@linux.alibaba.com> Cc: yuleixzhang <yulei.kernel@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/huge_mm.h | 3 --- 1 file changed, 3 deletions(-) --- a/include/linux/huge_mm.h~mm-huge_memoryc-remove-unused-macro-transparent_hugepage_debug_cow_flag +++ a/include/linux/huge_mm.h @@ -87,9 +87,6 @@ enum transparent_hugepage_flag { TRANSPARENT_HUGEPAGE_DEFRAG_REQ_MADV_FLAG, TRANSPARENT_HUGEPAGE_DEFRAG_KHUGEPAGED_FLAG, TRANSPARENT_HUGEPAGE_USE_ZERO_PAGE_FLAG, -#ifdef CONFIG_DEBUG_VM - TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG, -#endif }; struct kobject; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 027/143] mm/huge_memory.c: use helper function migration_entry_to_page() 2021-05-05 1:32 incoming Andrew Morton ` (25 preceding siblings ...) 2021-05-05 1:34 ` [patch 026/143] mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 028/143] mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable Andrew Morton ` (113 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx, rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken, william.kucharski, willy, yang.shi, yulei.kernel, ziy From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/huge_memory.c: use helper function migration_entry_to_page() It's more recommended to use helper function migration_entry_to_page() to get the page via migration entry. We can also enjoy the PageLocked() check there. Link: https://lkml.kernel.org/r/20210318122722.13135-7-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Peter Xu <peterx@redhat.com> Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Michel Lespinasse <walken@google.com> Cc: Ralph Campbell <rcampbell@nvidia.com> Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: William Kucharski <william.kucharski@oracle.com> Cc: Yang Shi <yang.shi@linux.alibaba.com> Cc: yuleixzhang <yulei.kernel@gmail.com> Cc: Zi Yan <ziy@nvidia.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/huge_memory.c | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) --- a/mm/huge_memory.c~mm-huge_memoryc-use-helper-function-migration_entry_to_page +++ a/mm/huge_memory.c @@ -1693,7 +1693,7 @@ int zap_huge_pmd(struct mmu_gather *tlb, VM_BUG_ON(!is_pmd_migration_entry(orig_pmd)); entry = pmd_to_swp_entry(orig_pmd); - page = pfn_to_page(swp_offset(entry)); + page = migration_entry_to_page(entry); flush_needed = 0; } else WARN_ONCE(1, "Non present huge pmd without pmd migration enabled!"); @@ -2101,7 +2101,7 @@ static void __split_huge_pmd_locked(stru swp_entry_t entry; entry = pmd_to_swp_entry(old_pmd); - page = pfn_to_page(swp_offset(entry)); + page = migration_entry_to_page(entry); write = is_write_migration_entry(entry); young = false; soft_dirty = pmd_swp_soft_dirty(old_pmd); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 028/143] mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable 2021-05-05 1:32 incoming Andrew Morton ` (26 preceding siblings ...) 2021-05-05 1:34 ` [patch 027/143] mm/huge_memory.c: use helper function migration_entry_to_page() Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 029/143] khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp() Andrew Morton ` (112 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, kirill.shutemov, linux-mm, mike.kravetz, mm-commits, torvalds, yanfei.xu From: Yanfei Xu <yanfei.xu@windriver.com> Subject: mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable READ_ONCE() is more selective and lightweight. It is more appropriate that using a READ_ONCE() for the certain variable to prevent the compiler from reordering. Link: https://lkml.kernel.org/r/20210323092730.247583-1-yanfei.xu@windriver.com Signed-off-by: Yanfei Xu <yanfei.xu@windriver.com> Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/khugepaged.c | 4 +--- 1 file changed, 1 insertion(+), 3 deletions(-) --- a/mm/khugepaged.c~khugepaged-raplace-barrier-with-read_once-for-a-selective-variable +++ a/mm/khugepaged.c @@ -2202,11 +2202,9 @@ static void khugepaged_do_scan(void) { struct page *hpage = NULL; unsigned int progress = 0, pass_through_head = 0; - unsigned int pages = khugepaged_pages_to_scan; + unsigned int pages = READ_ONCE(khugepaged_pages_to_scan); bool wait = true; - barrier(); /* write khugepaged_pages_to_scan to local stack */ - lru_add_drain_all(); while (progress < pages) { _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 029/143] khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp() 2021-05-05 1:32 incoming Andrew Morton ` (27 preceding siblings ...) 2021-05-05 1:34 ` [patch 028/143] mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 030/143] khugepaged: remove unnecessary out label in collapse_huge_page() Andrew Morton ` (111 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds, ziy From: Miaohe Lin <linmiaohe@huawei.com> Subject: khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp() Patch series "Cleanup for khugepaged". This series contains cleanups to remove unnecessary out label and meaningless !pte_present() check. Also use helper function to simplify the code. More details can be found in the respective changelogs. This patch (of 3): We could use helper function range_in_vma() to check whether the desired range is inside the vma to simplify the code. Link: https://lkml.kernel.org/r/20210325135647.64106-1-linmiaohe@huawei.com Link: https://lkml.kernel.org/r/20210325135647.64106-2-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Zi Yan <ziy@nvidia.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/khugepaged.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/khugepaged.c~khugepaged-use-helper-function-range_in_vma-in-collapse_pte_mapped_thp +++ a/mm/khugepaged.c @@ -1446,7 +1446,7 @@ void collapse_pte_mapped_thp(struct mm_s int i; if (!vma || !vma->vm_file || - vma->vm_start > haddr || vma->vm_end < haddr + HPAGE_PMD_SIZE) + !range_in_vma(vma, haddr, haddr + HPAGE_PMD_SIZE)) return; /* _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 030/143] khugepaged: remove unnecessary out label in collapse_huge_page() 2021-05-05 1:32 incoming Andrew Morton ` (28 preceding siblings ...) 2021-05-05 1:34 ` [patch 029/143] khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp() Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 031/143] khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd() Andrew Morton ` (110 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds, ziy From: Miaohe Lin <linmiaohe@huawei.com> Subject: khugepaged: remove unnecessary out label in collapse_huge_page() The out label here is unneeded because it just goes to out_up_write label. Remove it to make code more concise. Link: https://lkml.kernel.org/r/20210325135647.64106-3-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Zi Yan <ziy@nvidia.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/khugepaged.c | 8 +++----- 1 file changed, 3 insertions(+), 5 deletions(-) --- a/mm/khugepaged.c~khugepaged-remove-unnecessary-out-label-in-collapse_huge_page +++ a/mm/khugepaged.c @@ -1128,10 +1128,10 @@ static void collapse_huge_page(struct mm mmap_write_lock(mm); result = hugepage_vma_revalidate(mm, address, &vma); if (result) - goto out; + goto out_up_write; /* check if the pmd is still valid */ if (mm_find_pmd(mm, address) != pmd) - goto out; + goto out_up_write; anon_vma_lock_write(vma->anon_vma); @@ -1171,7 +1171,7 @@ static void collapse_huge_page(struct mm spin_unlock(pmd_ptl); anon_vma_unlock_write(vma->anon_vma); result = SCAN_FAIL; - goto out; + goto out_up_write; } /* @@ -1215,8 +1215,6 @@ out_nolock: mem_cgroup_uncharge(*hpage); trace_mm_collapse_huge_page(mm, isolated, result); return; -out: - goto out_up_write; } static int khugepaged_scan_pmd(struct mm_struct *mm, _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 031/143] khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd() 2021-05-05 1:32 incoming Andrew Morton ` (29 preceding siblings ...) 2021-05-05 1:34 ` [patch 030/143] khugepaged: remove unnecessary out label in collapse_huge_page() Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 032/143] mm: huge_memory: a new debugfs interface for splitting THP tests Andrew Morton ` (109 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds, ziy From: Miaohe Lin <linmiaohe@huawei.com> Subject: khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd() We know it must meet the !is_swap_pte() and !pte_none() condition if we reach here. Since !is_swap_pte() indicates pte_none() or pte_present() is met, it's guaranteed that pte must be present here. Link: https://lkml.kernel.org/r/20210325135647.64106-4-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Zi Yan <ziy@nvidia.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/khugepaged.c | 4 ---- 1 file changed, 4 deletions(-) --- a/mm/khugepaged.c~khugepaged-remove-meaningless-pte_present-check-in-khugepaged_scan_pmd +++ a/mm/khugepaged.c @@ -1271,10 +1271,6 @@ static int khugepaged_scan_pmd(struct mm goto out_unmap; } } - if (!pte_present(pteval)) { - result = SCAN_PTE_NON_PRESENT; - goto out_unmap; - } if (pte_uffd_wp(pteval)) { /* * Don't collapse the page if any of the small _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 032/143] mm: huge_memory: a new debugfs interface for splitting THP tests 2021-05-05 1:32 incoming Andrew Morton ` (30 preceding siblings ...) 2021-05-05 1:34 ` [patch 031/143] khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd() Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 033/143] mm: huge_memory: debugfs for file-backed THP split Andrew Morton ` (108 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, david, jhubbard, kirill.shutemov, linux-mm, mika.penttila, mm-commits, rientjes, sandipan, shuah, shy828301, torvalds, willy, ziy From: Zi Yan <ziy@nvidia.com> Subject: mm: huge_memory: a new debugfs interface for splitting THP tests We did not have a direct user interface of splitting the compound page backing a THP and there is no need unless we want to expose the THP implementation details to users. Make <debugfs>/split_huge_pages accept a new command to do that. By writing "<pid>,<vaddr_start>,<vaddr_end>" to <debugfs>/split_huge_pages, THPs within the given virtual address range from the process with the given pid are split. It is used to test split_huge_page function. In addition, a selftest program is added to tools/testing/selftests/vm to utilize the interface by splitting PMD THPs and PTE-mapped THPs. This does not change the old behavior, i.e., writing 1 to the interface to split all THPs in the system. Link: https://lkml.kernel.org/r/20210331235309.332292-1-zi.yan@sent.com Signed-off-by: Zi Yan <ziy@nvidia.com> Reviewed-by: Yang Shi <shy828301@gmail.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: "Kirill A . Shutemov" <kirill.shutemov@linux.intel.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mika Penttila <mika.penttila@nextfour.com> Cc: Sandipan Das <sandipan@linux.ibm.com> Cc: Shuah Khan <shuah@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/huge_memory.c | 155 +++++ tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 1 tools/testing/selftests/vm/split_huge_page_test.c | 318 ++++++++++++ 4 files changed, 467 insertions(+), 8 deletions(-) --- a/mm/huge_memory.c~mm-huge_memory-a-new-debugfs-interface-for-splitting-thp-tests +++ a/mm/huge_memory.c @@ -7,6 +7,7 @@ #include <linux/mm.h> #include <linux/sched.h> +#include <linux/sched/mm.h> #include <linux/sched/coredump.h> #include <linux/sched/numa_balancing.h> #include <linux/highmem.h> @@ -2915,16 +2916,14 @@ static struct shrinker deferred_split_sh }; #ifdef CONFIG_DEBUG_FS -static int split_huge_pages_set(void *data, u64 val) +static void split_huge_pages_all(void) { struct zone *zone; struct page *page; unsigned long pfn, max_zone_pfn; unsigned long total = 0, split = 0; - if (val != 1) - return -EINVAL; - + pr_debug("Split all THPs\n"); for_each_populated_zone(zone) { max_zone_pfn = zone_end_pfn(zone); for (pfn = zone->zone_start_pfn; pfn < max_zone_pfn; pfn++) { @@ -2948,15 +2947,155 @@ static int split_huge_pages_set(void *da unlock_page(page); next: put_page(page); + cond_resched(); } } - pr_info("%lu of %lu THP split\n", split, total); + pr_debug("%lu of %lu THP split\n", split, total); +} - return 0; +static inline bool vma_not_suitable_for_thp_split(struct vm_area_struct *vma) +{ + return vma_is_special_huge(vma) || (vma->vm_flags & VM_IO) || + is_vm_hugetlb_page(vma); +} + +static int split_huge_pages_pid(int pid, unsigned long vaddr_start, + unsigned long vaddr_end) +{ + int ret = 0; + struct task_struct *task; + struct mm_struct *mm; + unsigned long total = 0, split = 0; + unsigned long addr; + + vaddr_start &= PAGE_MASK; + vaddr_end &= PAGE_MASK; + + /* Find the task_struct from pid */ + rcu_read_lock(); + task = find_task_by_vpid(pid); + if (!task) { + rcu_read_unlock(); + ret = -ESRCH; + goto out; + } + get_task_struct(task); + rcu_read_unlock(); + + /* Find the mm_struct */ + mm = get_task_mm(task); + put_task_struct(task); + + if (!mm) { + ret = -EINVAL; + goto out; + } + + pr_debug("Split huge pages in pid: %d, vaddr: [0x%lx - 0x%lx]\n", + pid, vaddr_start, vaddr_end); + + mmap_read_lock(mm); + /* + * always increase addr by PAGE_SIZE, since we could have a PTE page + * table filled with PTE-mapped THPs, each of which is distinct. + */ + for (addr = vaddr_start; addr < vaddr_end; addr += PAGE_SIZE) { + struct vm_area_struct *vma = find_vma(mm, addr); + unsigned int follflags; + struct page *page; + + if (!vma || addr < vma->vm_start) + break; + + /* skip special VMA and hugetlb VMA */ + if (vma_not_suitable_for_thp_split(vma)) { + addr = vma->vm_end; + continue; + } + + /* FOLL_DUMP to ignore special (like zero) pages */ + follflags = FOLL_GET | FOLL_DUMP; + page = follow_page(vma, addr, follflags); + + if (IS_ERR(page)) + continue; + if (!page) + continue; + + if (!is_transparent_hugepage(page)) + goto next; + + total++; + if (!can_split_huge_page(compound_head(page), NULL)) + goto next; + + if (!trylock_page(page)) + goto next; + + if (!split_huge_page(page)) + split++; + + unlock_page(page); +next: + put_page(page); + cond_resched(); + } + mmap_read_unlock(mm); + mmput(mm); + + pr_debug("%lu of %lu THP split\n", split, total); + +out: + return ret; } -DEFINE_DEBUGFS_ATTRIBUTE(split_huge_pages_fops, NULL, split_huge_pages_set, - "%llu\n"); + +#define MAX_INPUT_BUF_SZ 255 + +static ssize_t split_huge_pages_write(struct file *file, const char __user *buf, + size_t count, loff_t *ppops) +{ + static DEFINE_MUTEX(split_debug_mutex); + ssize_t ret; + char input_buf[MAX_INPUT_BUF_SZ]; /* hold pid, start_vaddr, end_vaddr */ + int pid; + unsigned long vaddr_start, vaddr_end; + + ret = mutex_lock_interruptible(&split_debug_mutex); + if (ret) + return ret; + + ret = -EFAULT; + + memset(input_buf, 0, MAX_INPUT_BUF_SZ); + if (copy_from_user(input_buf, buf, min_t(size_t, count, MAX_INPUT_BUF_SZ))) + goto out; + + input_buf[MAX_INPUT_BUF_SZ - 1] = '\0'; + ret = sscanf(input_buf, "%d,0x%lx,0x%lx", &pid, &vaddr_start, &vaddr_end); + if (ret == 1 && pid == 1) { + split_huge_pages_all(); + ret = strlen(input_buf); + goto out; + } else if (ret != 3) { + ret = -EINVAL; + goto out; + } + + ret = split_huge_pages_pid(pid, vaddr_start, vaddr_end); + if (!ret) + ret = strlen(input_buf); +out: + mutex_unlock(&split_debug_mutex); + return ret; + +} + +static const struct file_operations split_huge_pages_fops = { + .owner = THIS_MODULE, + .write = split_huge_pages_write, + .llseek = no_llseek, +}; static int __init split_huge_pages_debugfs(void) { --- a/tools/testing/selftests/vm/.gitignore~mm-huge_memory-a-new-debugfs-interface-for-splitting-thp-tests +++ a/tools/testing/selftests/vm/.gitignore @@ -22,3 +22,4 @@ map_fixed_noreplace write_to_hugetlbfs hmm-tests local_config.* +split_huge_page_test --- a/tools/testing/selftests/vm/Makefile~mm-huge_memory-a-new-debugfs-interface-for-splitting-thp-tests +++ a/tools/testing/selftests/vm/Makefile @@ -42,6 +42,7 @@ TEST_GEN_FILES += on-fault-limit TEST_GEN_FILES += thuge-gen TEST_GEN_FILES += transhuge-stress TEST_GEN_FILES += userfaultfd +TEST_GEN_FILES += split_huge_page_test ifeq ($(MACHINE),x86_64) CAN_BUILD_I386 := $(shell ./../x86/check_cc.sh $(CC) ../x86/trivial_32bit_program.c -m32) --- /dev/null +++ a/tools/testing/selftests/vm/split_huge_page_test.c @@ -0,0 +1,318 @@ +// SPDX-License-Identifier: GPL-2.0 +/* + * A test of splitting PMD THPs and PTE-mapped THPs from a specified virtual + * address range in a process via <debugfs>/split_huge_pages interface. + */ + +#define _GNU_SOURCE +#include <stdio.h> +#include <stdlib.h> +#include <unistd.h> +#include <inttypes.h> +#include <string.h> +#include <fcntl.h> +#include <sys/mman.h> +#include <malloc.h> +#include <stdbool.h> + +uint64_t pagesize; +unsigned int pageshift; +uint64_t pmd_pagesize; + +#define PMD_SIZE_PATH "/sys/kernel/mm/transparent_hugepage/hpage_pmd_size" +#define SPLIT_DEBUGFS "/sys/kernel/debug/split_huge_pages" +#define SMAP_PATH "/proc/self/smaps" +#define INPUT_MAX 80 + +#define PFN_MASK ((1UL<<55)-1) +#define KPF_THP (1UL<<22) + +int is_backed_by_thp(char *vaddr, int pagemap_file, int kpageflags_file) +{ + uint64_t paddr; + uint64_t page_flags; + + if (pagemap_file) { + pread(pagemap_file, &paddr, sizeof(paddr), + ((long)vaddr >> pageshift) * sizeof(paddr)); + + if (kpageflags_file) { + pread(kpageflags_file, &page_flags, sizeof(page_flags), + (paddr & PFN_MASK) * sizeof(page_flags)); + + return !!(page_flags & KPF_THP); + } + } + return 0; +} + + +static uint64_t read_pmd_pagesize(void) +{ + int fd; + char buf[20]; + ssize_t num_read; + + fd = open(PMD_SIZE_PATH, O_RDONLY); + if (fd == -1) { + perror("Open hpage_pmd_size failed"); + exit(EXIT_FAILURE); + } + num_read = read(fd, buf, 19); + if (num_read < 1) { + close(fd); + perror("Read hpage_pmd_size failed"); + exit(EXIT_FAILURE); + } + buf[num_read] = '\0'; + close(fd); + + return strtoul(buf, NULL, 10); +} + +static int write_file(const char *path, const char *buf, size_t buflen) +{ + int fd; + ssize_t numwritten; + + fd = open(path, O_WRONLY); + if (fd == -1) + return 0; + + numwritten = write(fd, buf, buflen - 1); + close(fd); + if (numwritten < 1) + return 0; + + return (unsigned int) numwritten; +} + +static void write_debugfs(int pid, uint64_t vaddr_start, uint64_t vaddr_end) +{ + char input[INPUT_MAX]; + int ret; + + ret = snprintf(input, INPUT_MAX, "%d,0x%lx,0x%lx", pid, vaddr_start, + vaddr_end); + if (ret >= INPUT_MAX) { + printf("%s: Debugfs input is too long\n", __func__); + exit(EXIT_FAILURE); + } + + if (!write_file(SPLIT_DEBUGFS, input, ret + 1)) { + perror(SPLIT_DEBUGFS); + exit(EXIT_FAILURE); + } +} + +#define MAX_LINE_LENGTH 500 + +static bool check_for_pattern(FILE *fp, const char *pattern, char *buf) +{ + while (fgets(buf, MAX_LINE_LENGTH, fp) != NULL) { + if (!strncmp(buf, pattern, strlen(pattern))) + return true; + } + return false; +} + +static uint64_t check_huge(void *addr) +{ + uint64_t thp = 0; + int ret; + FILE *fp; + char buffer[MAX_LINE_LENGTH]; + char addr_pattern[MAX_LINE_LENGTH]; + + ret = snprintf(addr_pattern, MAX_LINE_LENGTH, "%08lx-", + (unsigned long) addr); + if (ret >= MAX_LINE_LENGTH) { + printf("%s: Pattern is too long\n", __func__); + exit(EXIT_FAILURE); + } + + + fp = fopen(SMAP_PATH, "r"); + if (!fp) { + printf("%s: Failed to open file %s\n", __func__, SMAP_PATH); + exit(EXIT_FAILURE); + } + if (!check_for_pattern(fp, addr_pattern, buffer)) + goto err_out; + + /* + * Fetch the AnonHugePages: in the same block and check the number of + * hugepages. + */ + if (!check_for_pattern(fp, "AnonHugePages:", buffer)) + goto err_out; + + if (sscanf(buffer, "AnonHugePages:%10ld kB", &thp) != 1) { + printf("Reading smap error\n"); + exit(EXIT_FAILURE); + } + +err_out: + fclose(fp); + return thp; +} + +void split_pmd_thp(void) +{ + char *one_page; + size_t len = 4 * pmd_pagesize; + uint64_t thp_size; + size_t i; + + one_page = memalign(pmd_pagesize, len); + + if (!one_page) { + printf("Fail to allocate memory\n"); + exit(EXIT_FAILURE); + } + + madvise(one_page, len, MADV_HUGEPAGE); + + for (i = 0; i < len; i++) + one_page[i] = (char)i; + + thp_size = check_huge(one_page); + if (!thp_size) { + printf("No THP is allocated\n"); + exit(EXIT_FAILURE); + } + + /* split all THPs */ + write_debugfs(getpid(), (uint64_t)one_page, (uint64_t)one_page + len); + + for (i = 0; i < len; i++) + if (one_page[i] != (char)i) { + printf("%ld byte corrupted\n", i); + exit(EXIT_FAILURE); + } + + + thp_size = check_huge(one_page); + if (thp_size) { + printf("Still %ld kB AnonHugePages not split\n", thp_size); + exit(EXIT_FAILURE); + } + + printf("Split huge pages successful\n"); + free(one_page); +} + +void split_pte_mapped_thp(void) +{ + char *one_page, *pte_mapped, *pte_mapped2; + size_t len = 4 * pmd_pagesize; + uint64_t thp_size; + size_t i; + const char *pagemap_template = "/proc/%d/pagemap"; + const char *kpageflags_proc = "/proc/kpageflags"; + char pagemap_proc[255]; + int pagemap_fd; + int kpageflags_fd; + + if (snprintf(pagemap_proc, 255, pagemap_template, getpid()) < 0) { + perror("get pagemap proc error"); + exit(EXIT_FAILURE); + } + pagemap_fd = open(pagemap_proc, O_RDONLY); + + if (pagemap_fd == -1) { + perror("read pagemap:"); + exit(EXIT_FAILURE); + } + + kpageflags_fd = open(kpageflags_proc, O_RDONLY); + + if (kpageflags_fd == -1) { + perror("read kpageflags:"); + exit(EXIT_FAILURE); + } + + one_page = mmap((void *)(1UL << 30), len, PROT_READ | PROT_WRITE, + MAP_ANONYMOUS | MAP_PRIVATE, -1, 0); + + madvise(one_page, len, MADV_HUGEPAGE); + + for (i = 0; i < len; i++) + one_page[i] = (char)i; + + thp_size = check_huge(one_page); + if (!thp_size) { + printf("No THP is allocated\n"); + exit(EXIT_FAILURE); + } + + /* remap the first pagesize of first THP */ + pte_mapped = mremap(one_page, pagesize, pagesize, MREMAP_MAYMOVE); + + /* remap the Nth pagesize of Nth THP */ + for (i = 1; i < 4; i++) { + pte_mapped2 = mremap(one_page + pmd_pagesize * i + pagesize * i, + pagesize, pagesize, + MREMAP_MAYMOVE|MREMAP_FIXED, + pte_mapped + pagesize * i); + if (pte_mapped2 == (char *)-1) { + perror("mremap failed"); + exit(EXIT_FAILURE); + } + } + + /* smap does not show THPs after mremap, use kpageflags instead */ + thp_size = 0; + for (i = 0; i < pagesize * 4; i++) + if (i % pagesize == 0 && + is_backed_by_thp(&pte_mapped[i], pagemap_fd, kpageflags_fd)) + thp_size++; + + if (thp_size != 4) { + printf("Some THPs are missing during mremap\n"); + exit(EXIT_FAILURE); + } + + /* split all remapped THPs */ + write_debugfs(getpid(), (uint64_t)pte_mapped, + (uint64_t)pte_mapped + pagesize * 4); + + /* smap does not show THPs after mremap, use kpageflags instead */ + thp_size = 0; + for (i = 0; i < pagesize * 4; i++) { + if (pte_mapped[i] != (char)i) { + printf("%ld byte corrupted\n", i); + exit(EXIT_FAILURE); + } + if (i % pagesize == 0 && + is_backed_by_thp(&pte_mapped[i], pagemap_fd, kpageflags_fd)) + thp_size++; + } + + if (thp_size) { + printf("Still %ld THPs not split\n", thp_size); + exit(EXIT_FAILURE); + } + + printf("Split PTE-mapped huge pages successful\n"); + munmap(one_page, len); + close(pagemap_fd); + close(kpageflags_fd); +} + +int main(int argc, char **argv) +{ + if (geteuid() != 0) { + printf("Please run the benchmark as root\n"); + exit(EXIT_FAILURE); + } + + pagesize = getpagesize(); + pageshift = ffs(pagesize) - 1; + pmd_pagesize = read_pmd_pagesize(); + + split_pmd_thp(); + split_pte_mapped_thp(); + + return 0; +} _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 033/143] mm: huge_memory: debugfs for file-backed THP split 2021-05-05 1:32 incoming Andrew Morton ` (31 preceding siblings ...) 2021-05-05 1:34 ` [patch 032/143] mm: huge_memory: a new debugfs interface for splitting THP tests Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 034/143] mm/hugeltb: remove redundant VM_BUG_ON() in region_add() Andrew Morton ` (107 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, david, jhubbard, kirill.shutemov, linux-mm, mika.penttila, mm-commits, rientjes, sandipan, shuah, shy828301, torvalds, willy, ziy From: Zi Yan <ziy@nvidia.com> Subject: mm: huge_memory: debugfs for file-backed THP split Further extend <debugfs>/split_huge_pages to accept "<path>,<pgoff_start>,<pgoff_end>" for file-backed THP split tests since tmpfs may have file backed by THP that mapped nowhere. Update selftest program to test file-backed THP split too. Link: https://lkml.kernel.org/r/20210331235309.332292-2-zi.yan@sent.com Signed-off-by: Zi Yan <ziy@nvidia.com> Suggested-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Reviewed-by: Yang Shi <shy828301@gmail.com> Cc: "Kirill A . Shutemov" <kirill.shutemov@linux.intel.com> Cc: Shuah Khan <shuah@kernel.org> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Sandipan Das <sandipan@linux.ibm.com> Cc: David Hildenbrand <david@redhat.com> Cc: Mika Penttila <mika.penttila@nextfour.com> Cc: David Rientjes <rientjes@google.com> Cc: Matthew Wilcox <willy@infradead.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/huge_memory.c | 90 +++++++++++- tools/testing/selftests/vm/split_huge_page_test.c | 82 ++++++++++ 2 files changed, 166 insertions(+), 6 deletions(-) --- a/mm/huge_memory.c~mm-huge_memory-debugfs-for-file-backed-thp-split +++ a/mm/huge_memory.c @@ -3050,6 +3050,65 @@ out: return ret; } +static int split_huge_pages_in_file(const char *file_path, pgoff_t off_start, + pgoff_t off_end) +{ + struct filename *file; + struct file *candidate; + struct address_space *mapping; + int ret = -EINVAL; + pgoff_t index; + int nr_pages = 1; + unsigned long total = 0, split = 0; + + file = getname_kernel(file_path); + if (IS_ERR(file)) + return ret; + + candidate = file_open_name(file, O_RDONLY, 0); + if (IS_ERR(candidate)) + goto out; + + pr_debug("split file-backed THPs in file: %s, page offset: [0x%lx - 0x%lx]\n", + file_path, off_start, off_end); + + mapping = candidate->f_mapping; + + for (index = off_start; index < off_end; index += nr_pages) { + struct page *fpage = pagecache_get_page(mapping, index, + FGP_ENTRY | FGP_HEAD, 0); + + nr_pages = 1; + if (xa_is_value(fpage) || !fpage) + continue; + + if (!is_transparent_hugepage(fpage)) + goto next; + + total++; + nr_pages = thp_nr_pages(fpage); + + if (!trylock_page(fpage)) + goto next; + + if (!split_huge_page(fpage)) + split++; + + unlock_page(fpage); +next: + put_page(fpage); + cond_resched(); + } + + filp_close(candidate, NULL); + ret = 0; + + pr_debug("%lu of %lu file-backed THP split\n", split, total); +out: + putname(file); + return ret; +} + #define MAX_INPUT_BUF_SZ 255 static ssize_t split_huge_pages_write(struct file *file, const char __user *buf, @@ -3057,7 +3116,8 @@ static ssize_t split_huge_pages_write(st { static DEFINE_MUTEX(split_debug_mutex); ssize_t ret; - char input_buf[MAX_INPUT_BUF_SZ]; /* hold pid, start_vaddr, end_vaddr */ + /* hold pid, start_vaddr, end_vaddr or file_path, off_start, off_end */ + char input_buf[MAX_INPUT_BUF_SZ]; int pid; unsigned long vaddr_start, vaddr_end; @@ -3072,6 +3132,34 @@ static ssize_t split_huge_pages_write(st goto out; input_buf[MAX_INPUT_BUF_SZ - 1] = '\0'; + + if (input_buf[0] == '/') { + char *tok; + char *buf = input_buf; + char file_path[MAX_INPUT_BUF_SZ]; + pgoff_t off_start = 0, off_end = 0; + size_t input_len = strlen(input_buf); + + tok = strsep(&buf, ","); + if (tok) { + strncpy(file_path, tok, MAX_INPUT_BUF_SZ); + } else { + ret = -EINVAL; + goto out; + } + + ret = sscanf(buf, "0x%lx,0x%lx", &off_start, &off_end); + if (ret != 2) { + ret = -EINVAL; + goto out; + } + ret = split_huge_pages_in_file(file_path, off_start, off_end); + if (!ret) + ret = input_len; + + goto out; + } + ret = sscanf(input_buf, "%d,0x%lx,0x%lx", &pid, &vaddr_start, &vaddr_end); if (ret == 1 && pid == 1) { split_huge_pages_all(); --- a/tools/testing/selftests/vm/split_huge_page_test.c~mm-huge_memory-debugfs-for-file-backed-thp-split +++ a/tools/testing/selftests/vm/split_huge_page_test.c @@ -7,11 +7,13 @@ #define _GNU_SOURCE #include <stdio.h> #include <stdlib.h> +#include <stdarg.h> #include <unistd.h> #include <inttypes.h> #include <string.h> #include <fcntl.h> #include <sys/mman.h> +#include <sys/mount.h> #include <malloc.h> #include <stdbool.h> @@ -24,6 +26,9 @@ uint64_t pmd_pagesize; #define SMAP_PATH "/proc/self/smaps" #define INPUT_MAX 80 +#define PID_FMT "%d,0x%lx,0x%lx" +#define PATH_FMT "%s,0x%lx,0x%lx" + #define PFN_MASK ((1UL<<55)-1) #define KPF_THP (1UL<<22) @@ -87,13 +92,16 @@ static int write_file(const char *path, return (unsigned int) numwritten; } -static void write_debugfs(int pid, uint64_t vaddr_start, uint64_t vaddr_end) +static void write_debugfs(const char *fmt, ...) { char input[INPUT_MAX]; int ret; + va_list argp; + + va_start(argp, fmt); + ret = vsnprintf(input, INPUT_MAX, fmt, argp); + va_end(argp); - ret = snprintf(input, INPUT_MAX, "%d,0x%lx,0x%lx", pid, vaddr_start, - vaddr_end); if (ret >= INPUT_MAX) { printf("%s: Debugfs input is too long\n", __func__); exit(EXIT_FAILURE); @@ -183,7 +191,8 @@ void split_pmd_thp(void) } /* split all THPs */ - write_debugfs(getpid(), (uint64_t)one_page, (uint64_t)one_page + len); + write_debugfs(PID_FMT, getpid(), (uint64_t)one_page, + (uint64_t)one_page + len); for (i = 0; i < len; i++) if (one_page[i] != (char)i) { @@ -274,7 +283,7 @@ void split_pte_mapped_thp(void) } /* split all remapped THPs */ - write_debugfs(getpid(), (uint64_t)pte_mapped, + write_debugfs(PID_FMT, getpid(), (uint64_t)pte_mapped, (uint64_t)pte_mapped + pagesize * 4); /* smap does not show THPs after mremap, use kpageflags instead */ @@ -300,6 +309,68 @@ void split_pte_mapped_thp(void) close(kpageflags_fd); } +void split_file_backed_thp(void) +{ + int status; + int fd; + ssize_t num_written; + char tmpfs_template[] = "/tmp/thp_split_XXXXXX"; + const char *tmpfs_loc = mkdtemp(tmpfs_template); + char testfile[INPUT_MAX]; + uint64_t pgoff_start = 0, pgoff_end = 1024; + + printf("Please enable pr_debug in split_huge_pages_in_file() if you need more info.\n"); + + status = mount("tmpfs", tmpfs_loc, "tmpfs", 0, "huge=always,size=4m"); + + if (status) { + printf("Unable to create a tmpfs for testing\n"); + exit(EXIT_FAILURE); + } + + status = snprintf(testfile, INPUT_MAX, "%s/thp_file", tmpfs_loc); + if (status >= INPUT_MAX) { + printf("Fail to create file-backed THP split testing file\n"); + goto cleanup; + } + + fd = open(testfile, O_CREAT|O_WRONLY); + if (fd == -1) { + perror("Cannot open testing file\n"); + goto cleanup; + } + + /* write something to the file, so a file-backed THP can be allocated */ + num_written = write(fd, tmpfs_loc, sizeof(tmpfs_loc)); + close(fd); + + if (num_written < 1) { + printf("Fail to write data to testing file\n"); + goto cleanup; + } + + /* split the file-backed THP */ + write_debugfs(PATH_FMT, testfile, pgoff_start, pgoff_end); + + status = unlink(testfile); + if (status) + perror("Cannot remove testing file\n"); + +cleanup: + status = umount(tmpfs_loc); + if (status) { + printf("Unable to umount %s\n", tmpfs_loc); + exit(EXIT_FAILURE); + } + status = rmdir(tmpfs_loc); + if (status) { + perror("cannot remove tmp dir"); + exit(EXIT_FAILURE); + } + + printf("file-backed THP split test done, please check dmesg for more information\n"); +} + int main(int argc, char **argv) { if (geteuid() != 0) { @@ -313,6 +384,7 @@ int main(int argc, char **argv) split_pmd_thp(); split_pte_mapped_thp(); + split_file_backed_thp(); return 0; } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 034/143] mm/hugeltb: remove redundant VM_BUG_ON() in region_add() 2021-05-05 1:32 incoming Andrew Morton ` (32 preceding siblings ...) 2021-05-05 1:34 ` [patch 033/143] mm: huge_memory: debugfs for file-backed THP split Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 035/143] mm/hugeltb: simplify the return code of __vma_reservation_common() Andrew Morton ` (106 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, linfeilong, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/hugeltb: remove redundant VM_BUG_ON() in region_add() Patch series "Cleanup and fixup for hugetlb", v2. This series contains cleanups to remove redundant VM_BUG_ON() and simplify the return code. Also this handles the error case in hugetlb_fix_reserve_counts() correctly. More details can be found in the respective changelogs. This patch (of 5): The same VM_BUG_ON() check is already done in the callee. Remove this extra one to simplify the code slightly. Link: https://lkml.kernel.org/r/20210410072348.20437-1-linmiaohe@huawei.com Link: https://lkml.kernel.org/r/20210410072348.20437-2-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Feilong Lin <linfeilong@huawei.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 1 - 1 file changed, 1 deletion(-) --- a/mm/hugetlb.c~mm-hugeltb-remove-redundant-vm_bug_on-in-region_add +++ a/mm/hugetlb.c @@ -553,7 +553,6 @@ retry: resv->adds_in_progress -= in_regions_needed; spin_unlock(&resv->lock); - VM_BUG_ON(add < 0); return add; } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 035/143] mm/hugeltb: simplify the return code of __vma_reservation_common() 2021-05-05 1:32 incoming Andrew Morton ` (33 preceding siblings ...) 2021-05-05 1:34 ` [patch 034/143] mm/hugeltb: remove redundant VM_BUG_ON() in region_add() Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 036/143] mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages() Andrew Morton ` (105 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, linfeilong, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/hugeltb: simplify the return code of __vma_reservation_common() It's guaranteed that the vma is associated with a resv_map, i.e. either VM_MAYSHARE or HPAGE_RESV_OWNER, when the code reaches here or we would have returned via !resv check above. So it's unneeded to check whether HPAGE_RESV_OWNER is set here. Simplify the return code to make it more clear. Link: https://lkml.kernel.org/r/20210410072348.20437-3-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Cc: Feilong Lin <linfeilong@huawei.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 41 ++++++++++++++++++++--------------------- 1 file changed, 20 insertions(+), 21 deletions(-) --- a/mm/hugetlb.c~mm-hugeltb-simplify-the-return-code-of-__vma_reservation_common +++ a/mm/hugetlb.c @@ -2174,27 +2174,26 @@ static long __vma_reservation_common(str if (vma->vm_flags & VM_MAYSHARE) return ret; - else if (is_vma_resv_set(vma, HPAGE_RESV_OWNER) && ret >= 0) { - /* - * In most cases, reserves always exist for private mappings. - * However, a file associated with mapping could have been - * hole punched or truncated after reserves were consumed. - * As subsequent fault on such a range will not use reserves. - * Subtle - The reserve map for private mappings has the - * opposite meaning than that of shared mappings. If NO - * entry is in the reserve map, it means a reservation exists. - * If an entry exists in the reserve map, it means the - * reservation has already been consumed. As a result, the - * return value of this routine is the opposite of the - * value returned from reserve map manipulation routines above. - */ - if (ret) - return 0; - else - return 1; - } - else - return ret < 0 ? ret : 0; + /* + * We know private mapping must have HPAGE_RESV_OWNER set. + * + * In most cases, reserves always exist for private mappings. + * However, a file associated with mapping could have been + * hole punched or truncated after reserves were consumed. + * As subsequent fault on such a range will not use reserves. + * Subtle - The reserve map for private mappings has the + * opposite meaning than that of shared mappings. If NO + * entry is in the reserve map, it means a reservation exists. + * If an entry exists in the reserve map, it means the + * reservation has already been consumed. As a result, the + * return value of this routine is the opposite of the + * value returned from reserve map manipulation routines above. + */ + if (ret > 0) + return 0; + if (ret == 0) + return 1; + return ret; } static long vma_needs_reservation(struct hstate *h, _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 036/143] mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages() 2021-05-05 1:32 incoming Andrew Morton ` (34 preceding siblings ...) 2021-05-05 1:34 ` [patch 035/143] mm/hugeltb: simplify the return code of __vma_reservation_common() Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 037/143] mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts() Andrew Morton ` (104 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, linfeilong, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages() The resv_map could be NULL since this routine can be called in the evict inode path for all hugetlbfs inodes and we will have chg = 0 in this case. But (chg - freed) won't go negative as Mike pointed out: "If resv_map is NULL, then no hugetlb pages can be allocated/associated with the file. As a result, remove_inode_hugepages will never find any huge pages associated with the inode and the passed value 'freed' will always be zero." Add a comment clarifying this to make it clear and also avoid confusion. Link: https://lkml.kernel.org/r/20210410072348.20437-4-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Cc: Feilong Lin <linfeilong@huawei.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 3 +++ 1 file changed, 3 insertions(+) --- a/mm/hugetlb.c~mm-hugeltb-clarify-chg-freed-wont-go-negative-in-hugetlb_unreserve_pages +++ a/mm/hugetlb.c @@ -5267,6 +5267,9 @@ long hugetlb_unreserve_pages(struct inod /* * If the subpool has a minimum size, the number of global * reservations to be released may be adjusted. + * + * Note that !resv_map implies freed == 0. So (chg - freed) + * won't go negative. */ gbl_reserve = hugepage_subpool_put_pages(spool, (chg - freed)); hugetlb_acct_memory(h, -gbl_reserve); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 037/143] mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts() 2021-05-05 1:32 incoming Andrew Morton ` (35 preceding siblings ...) 2021-05-05 1:34 ` [patch 036/143] mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages() Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 038/143] mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages() Andrew Morton ` (103 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, linfeilong, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts() A rare out of memory error would prevent removal of the reserve map region for a page. hugetlb_fix_reserve_counts() handles this rare case to avoid dangling with incorrect counts. Unfortunately, hugepage_subpool_get_pages and hugetlb_acct_memory could possibly fail too. We should correctly handle these cases. Link: https://lkml.kernel.org/r/20210410072348.20437-5-linmiaohe@huawei.com Fixes: b5cec28d36f5 ("hugetlbfs: truncate_hugepages() takes a range of pages") Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Cc: Feilong Lin <linfeilong@huawei.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 11 +++++++++-- 1 file changed, 9 insertions(+), 2 deletions(-) --- a/mm/hugetlb.c~mm-hugeltb-handle-the-error-case-in-hugetlb_fix_reserve_counts +++ a/mm/hugetlb.c @@ -742,13 +742,20 @@ void hugetlb_fix_reserve_counts(struct i { struct hugepage_subpool *spool = subpool_inode(inode); long rsv_adjust; + bool reserved = false; rsv_adjust = hugepage_subpool_get_pages(spool, 1); - if (rsv_adjust) { + if (rsv_adjust > 0) { struct hstate *h = hstate_inode(inode); - hugetlb_acct_memory(h, 1); + if (!hugetlb_acct_memory(h, 1)) + reserved = true; + } else if (!rsv_adjust) { + reserved = true; } + + if (!reserved) + pr_warn("hugetlb: Huge Page Reserved count may go negative.\n"); } /* _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 038/143] mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages() 2021-05-05 1:32 incoming Andrew Morton ` (36 preceding siblings ...) 2021-05-05 1:34 ` [patch 037/143] mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts() Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 039/143] mm/cma: change cma mutex to irq safe spinlock Andrew Morton ` (102 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, linfeilong, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages() The local variable pseudo_vma is not used anymore. Link: https://lkml.kernel.org/r/20210410072348.20437-6-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Cc: Feilong Lin <linfeilong@huawei.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/hugetlbfs/inode.c | 3 --- 1 file changed, 3 deletions(-) --- a/fs/hugetlbfs/inode.c~mm-hugetlb-remove-unused-variable-pseudo_vma-in-remove_inode_hugepages +++ a/fs/hugetlbfs/inode.c @@ -463,14 +463,11 @@ static void remove_inode_hugepages(struc struct address_space *mapping = &inode->i_data; const pgoff_t start = lstart >> huge_page_shift(h); const pgoff_t end = lend >> huge_page_shift(h); - struct vm_area_struct pseudo_vma; struct pagevec pvec; pgoff_t next, index; int i, freed = 0; bool truncate_op = (lend == LLONG_MAX); - vma_init(&pseudo_vma, current->mm); - pseudo_vma.vm_flags = (VM_HUGETLB | VM_MAYSHARE | VM_SHARED); pagevec_init(&pvec); next = start; while (next < end) { _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 039/143] mm/cma: change cma mutex to irq safe spinlock 2021-05-05 1:32 incoming Andrew Morton ` (37 preceding siblings ...) 2021-05-05 1:34 ` [patch 038/143] mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages() Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 040/143] hugetlb: no need to drop hugetlb_lock to call cma_release Andrew Morton ` (101 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton, iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko, mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx, peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds, will, willy From: Mike Kravetz <mike.kravetz@oracle.com> Subject: mm/cma: change cma mutex to irq safe spinlock Patch series "make hugetlb put_page safe for all calling contexts", v5. This effort is the result a recent bug report [1]. Syzbot found a potential deadlock in the hugetlb put_page/free_huge_page_path. WARNING: SOFTIRQ-safe -> SOFTIRQ-unsafe lock order detected Since the free_huge_page_path already has code to 'hand off' page free requests to a workqueue, a suggestion was proposed to make the in_irq() detection accurate by always enabling PREEMPT_COUNT [2]. The outcome of that discussion was that the hugetlb put_page path (free_huge_page) path should be properly fixed and safe for all calling contexts. This patch (of 8): cma_release is currently a sleepable operatation because the bitmap manipulation is protected by cma->lock mutex. Hugetlb code which relies on cma_release for CMA backed (giga) hugetlb pages, however, needs to be irq safe. The lock doesn't protect any sleepable operation so it can be changed to a (irq aware) spin lock. The bitmap processing should be quite fast in typical case but if cma sizes grow to TB then we will likely need to replace the lock by a more optimized bitmap implementation. Link: https://lkml.kernel.org/r/20210409205254.242291-1-mike.kravetz@oracle.com Link: https://lkml.kernel.org/r/20210409205254.242291-2-mike.kravetz@oracle.com Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com> Acked-by: Michal Hocko <mhocko@suse.com> Reviewed-by: David Hildenbrand <david@redhat.com> Acked-by: Roman Gushchin <guro@fb.com> Cc: Shakeel Butt <shakeelb@google.com> Cc: Oscar Salvador <osalvador@suse.de> Cc: Muchun Song <songmuchun@bytedance.com> Cc: David Rientjes <rientjes@google.com> Cc: Miaohe Lin <linmiaohe@huawei.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Matthew Wilcox <willy@infradead.org> Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com> Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com> Cc: Waiman Long <longman@redhat.com> Cc: Peter Xu <peterx@redhat.com> Cc: Mina Almasry <almasrymina@google.com> Cc: Hillf Danton <hdanton@sina.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Barry Song <song.bao.hua@hisilicon.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/cma.c | 18 +++++++++--------- mm/cma.h | 2 +- mm/cma_debug.c | 8 ++++---- 3 files changed, 14 insertions(+), 14 deletions(-) --- a/mm/cma.c~mm-cma-change-cma-mutex-to-irq-safe-spinlock +++ a/mm/cma.c @@ -24,7 +24,6 @@ #include <linux/memblock.h> #include <linux/err.h> #include <linux/mm.h> -#include <linux/mutex.h> #include <linux/sizes.h> #include <linux/slab.h> #include <linux/log2.h> @@ -83,13 +82,14 @@ static void cma_clear_bitmap(struct cma unsigned int count) { unsigned long bitmap_no, bitmap_count; + unsigned long flags; bitmap_no = (pfn - cma->base_pfn) >> cma->order_per_bit; bitmap_count = cma_bitmap_pages_to_bits(cma, count); - mutex_lock(&cma->lock); + spin_lock_irqsave(&cma->lock, flags); bitmap_clear(cma->bitmap, bitmap_no, bitmap_count); - mutex_unlock(&cma->lock); + spin_unlock_irqrestore(&cma->lock, flags); } static void __init cma_activate_area(struct cma *cma) @@ -118,7 +118,7 @@ static void __init cma_activate_area(str pfn += pageblock_nr_pages) init_cma_reserved_pageblock(pfn_to_page(pfn)); - mutex_init(&cma->lock); + spin_lock_init(&cma->lock); #ifdef CONFIG_CMA_DEBUGFS INIT_HLIST_HEAD(&cma->mem_head); @@ -392,7 +392,7 @@ static void cma_debug_show_areas(struct unsigned long nr_part, nr_total = 0; unsigned long nbits = cma_bitmap_maxno(cma); - mutex_lock(&cma->lock); + spin_lock_irq(&cma->lock); pr_info("number of available pages: "); for (;;) { next_zero_bit = find_next_zero_bit(cma->bitmap, nbits, start); @@ -407,7 +407,7 @@ static void cma_debug_show_areas(struct start = next_zero_bit + nr_zero; } pr_cont("=> %lu free of %lu total pages\n", nr_total, cma->count); - mutex_unlock(&cma->lock); + spin_unlock_irq(&cma->lock); } #else static inline void cma_debug_show_areas(struct cma *cma) { } @@ -452,12 +452,12 @@ struct page *cma_alloc(struct cma *cma, return NULL; for (;;) { - mutex_lock(&cma->lock); + spin_lock_irq(&cma->lock); bitmap_no = bitmap_find_next_zero_area_off(cma->bitmap, bitmap_maxno, start, bitmap_count, mask, offset); if (bitmap_no >= bitmap_maxno) { - mutex_unlock(&cma->lock); + spin_unlock_irq(&cma->lock); break; } bitmap_set(cma->bitmap, bitmap_no, bitmap_count); @@ -466,7 +466,7 @@ struct page *cma_alloc(struct cma *cma, * our exclusive use. If the migration fails we will take the * lock again and unmark it. */ - mutex_unlock(&cma->lock); + spin_unlock_irq(&cma->lock); pfn = cma->base_pfn + (bitmap_no << cma->order_per_bit); ret = alloc_contig_range(pfn, pfn + count, MIGRATE_CMA, --- a/mm/cma_debug.c~mm-cma-change-cma-mutex-to-irq-safe-spinlock +++ a/mm/cma_debug.c @@ -36,10 +36,10 @@ static int cma_used_get(void *data, u64 struct cma *cma = data; unsigned long used; - mutex_lock(&cma->lock); + spin_lock_irq(&cma->lock); /* pages counter is smaller than sizeof(int) */ used = bitmap_weight(cma->bitmap, (int)cma_bitmap_maxno(cma)); - mutex_unlock(&cma->lock); + spin_unlock_irq(&cma->lock); *val = (u64)used << cma->order_per_bit; return 0; @@ -53,7 +53,7 @@ static int cma_maxchunk_get(void *data, unsigned long start, end = 0; unsigned long bitmap_maxno = cma_bitmap_maxno(cma); - mutex_lock(&cma->lock); + spin_lock_irq(&cma->lock); for (;;) { start = find_next_zero_bit(cma->bitmap, bitmap_maxno, end); if (start >= bitmap_maxno) @@ -61,7 +61,7 @@ static int cma_maxchunk_get(void *data, end = find_next_bit(cma->bitmap, bitmap_maxno, start); maxchunk = max(end - start, maxchunk); } - mutex_unlock(&cma->lock); + spin_unlock_irq(&cma->lock); *val = (u64)maxchunk << cma->order_per_bit; return 0; --- a/mm/cma.h~mm-cma-change-cma-mutex-to-irq-safe-spinlock +++ a/mm/cma.h @@ -9,7 +9,7 @@ struct cma { unsigned long count; unsigned long *bitmap; unsigned int order_per_bit; /* Order of pages represented by one bit */ - struct mutex lock; + spinlock_t lock; #ifdef CONFIG_CMA_DEBUGFS struct hlist_head mem_head; spinlock_t mem_head_lock; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 040/143] hugetlb: no need to drop hugetlb_lock to call cma_release 2021-05-05 1:32 incoming Andrew Morton ` (38 preceding siblings ...) 2021-05-05 1:34 ` [patch 039/143] mm/cma: change cma mutex to irq safe spinlock Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 041/143] hugetlb: add per-hstate mutex to synchronize user adjustments Andrew Morton ` (100 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton, iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko, mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx, peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds, will, willy From: Mike Kravetz <mike.kravetz@oracle.com> Subject: hugetlb: no need to drop hugetlb_lock to call cma_release Now that cma_release is non-blocking and irq safe, there is no need to drop hugetlb_lock before calling. Link: https://lkml.kernel.org/r/20210409205254.242291-3-mike.kravetz@oracle.com Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com> Acked-by: Roman Gushchin <guro@fb.com> Acked-by: Michal Hocko <mhocko@suse.com> Reviewed-by: Oscar Salvador <osalvador@suse.de> Reviewed-by: David Hildenbrand <david@redhat.com> Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com> Cc: Barry Song <song.bao.hua@hisilicon.com> Cc: David Rientjes <rientjes@google.com> Cc: Hillf Danton <hdanton@sina.com> Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Miaohe Lin <linmiaohe@huawei.com> Cc: Mina Almasry <almasrymina@google.com> Cc: Muchun Song <songmuchun@bytedance.com> Cc: Peter Xu <peterx@redhat.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Shakeel Butt <shakeelb@google.com> Cc: Waiman Long <longman@redhat.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 6 ------ 1 file changed, 6 deletions(-) --- a/mm/hugetlb.c~hugetlb-no-need-to-drop-hugetlb_lock-to-call-cma_release +++ a/mm/hugetlb.c @@ -1355,14 +1355,8 @@ static void update_and_free_page(struct set_compound_page_dtor(page, NULL_COMPOUND_DTOR); set_page_refcounted(page); if (hstate_is_gigantic(h)) { - /* - * Temporarily drop the hugetlb_lock, because - * we might block in free_gigantic_page(). - */ - spin_unlock(&hugetlb_lock); destroy_compound_gigantic_page(page, huge_page_order(h)); free_gigantic_page(page, huge_page_order(h)); - spin_lock(&hugetlb_lock); } else { __free_pages(page, huge_page_order(h)); } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 041/143] hugetlb: add per-hstate mutex to synchronize user adjustments 2021-05-05 1:32 incoming Andrew Morton ` (39 preceding siblings ...) 2021-05-05 1:34 ` [patch 040/143] hugetlb: no need to drop hugetlb_lock to call cma_release Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 042/143] hugetlb: create remove_hugetlb_page() to separate functionality Andrew Morton ` (99 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton, iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko, mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx, peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds, will, willy From: Mike Kravetz <mike.kravetz@oracle.com> Subject: hugetlb: add per-hstate mutex to synchronize user adjustments The helper routine hstate_next_node_to_alloc accesses and modifies the hstate variable next_nid_to_alloc. The helper is used by the routines alloc_pool_huge_page and adjust_pool_surplus. adjust_pool_surplus is called with hugetlb_lock held. However, alloc_pool_huge_page can not be called with the hugetlb lock held as it will call the page allocator. Two instances of alloc_pool_huge_page could be run in parallel or alloc_pool_huge_page could run in parallel with adjust_pool_surplus which may result in the variable next_nid_to_alloc becoming invalid for the caller and pages being allocated on the wrong node. Both alloc_pool_huge_page and adjust_pool_surplus are only called from the routine set_max_huge_pages after boot. set_max_huge_pages is only called as the reusult of a user writing to the proc/sysfs nr_hugepages, or nr_hugepages_mempolicy file to adjust the number of hugetlb pages. It makes little sense to allow multiple adjustment to the number of hugetlb pages in parallel. Add a mutex to the hstate and use it to only allow one hugetlb page adjustment at a time. This will synchronize modifications to the next_nid_to_alloc variable. Link: https://lkml.kernel.org/r/20210409205254.242291-4-mike.kravetz@oracle.com Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com> Acked-by: Michal Hocko <mhocko@suse.com> Reviewed-by: Oscar Salvador <osalvador@suse.de> Reviewed-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Muchun Song <songmuchun@bytedance.com> Reviewed-by: David Hildenbrand <david@redhat.com> Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com> Cc: Barry Song <song.bao.hua@hisilicon.com> Cc: David Rientjes <rientjes@google.com> Cc: Hillf Danton <hdanton@sina.com> Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mina Almasry <almasrymina@google.com> Cc: Peter Xu <peterx@redhat.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Roman Gushchin <guro@fb.com> Cc: Shakeel Butt <shakeelb@google.com> Cc: Waiman Long <longman@redhat.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/hugetlb.h | 1 + mm/hugetlb.c | 8 ++++++++ 2 files changed, 9 insertions(+) --- a/include/linux/hugetlb.h~hugetlb-add-per-hstate-mutex-to-synchronize-user-adjustments +++ a/include/linux/hugetlb.h @@ -559,6 +559,7 @@ HPAGEFLAG(Freed, freed) #define HSTATE_NAME_LEN 32 /* Defines one hugetlb page size */ struct hstate { + struct mutex resize_lock; int next_nid_to_alloc; int next_nid_to_free; unsigned int order; --- a/mm/hugetlb.c~hugetlb-add-per-hstate-mutex-to-synchronize-user-adjustments +++ a/mm/hugetlb.c @@ -2621,6 +2621,11 @@ static int set_max_huge_pages(struct hst else return -ENOMEM; + /* + * resize_lock mutex prevents concurrent adjustments to number of + * pages in hstate via the proc/sysfs interfaces. + */ + mutex_lock(&h->resize_lock); spin_lock(&hugetlb_lock); /* @@ -2653,6 +2658,7 @@ static int set_max_huge_pages(struct hst if (hstate_is_gigantic(h) && !IS_ENABLED(CONFIG_CONTIG_ALLOC)) { if (count > persistent_huge_pages(h)) { spin_unlock(&hugetlb_lock); + mutex_unlock(&h->resize_lock); NODEMASK_FREE(node_alloc_noretry); return -EINVAL; } @@ -2727,6 +2733,7 @@ static int set_max_huge_pages(struct hst out: h->max_huge_pages = persistent_huge_pages(h); spin_unlock(&hugetlb_lock); + mutex_unlock(&h->resize_lock); NODEMASK_FREE(node_alloc_noretry); @@ -3214,6 +3221,7 @@ void __init hugetlb_add_hstate(unsigned BUG_ON(hugetlb_max_hstate >= HUGE_MAX_HSTATE); BUG_ON(order == 0); h = &hstates[hugetlb_max_hstate++]; + mutex_init(&h->resize_lock); h->order = order; h->mask = ~(huge_page_size(h) - 1); for (i = 0; i < MAX_NUMNODES; ++i) _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 042/143] hugetlb: create remove_hugetlb_page() to separate functionality 2021-05-05 1:32 incoming Andrew Morton ` (40 preceding siblings ...) 2021-05-05 1:34 ` [patch 041/143] hugetlb: add per-hstate mutex to synchronize user adjustments Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:34 ` [patch 043/143] hugetlb: call update_and_free_page without hugetlb_lock Andrew Morton ` (98 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton, iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko, mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx, peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds, will, willy From: Mike Kravetz <mike.kravetz@oracle.com> Subject: hugetlb: create remove_hugetlb_page() to separate functionality The new remove_hugetlb_page() routine is designed to remove a hugetlb page from hugetlbfs processing. It will remove the page from the active or free list, update global counters and set the compound page destructor to NULL so that PageHuge() will return false for the 'page'. After this call, the 'page' can be treated as a normal compound page or a collection of base size pages. update_and_free_page no longer decrements h->nr_huge_pages{_node} as this is performed in remove_hugetlb_page. The only functionality performed by update_and_free_page is to free the base pages to the lower level allocators. update_and_free_page is typically called after remove_hugetlb_page. remove_hugetlb_page is to be called with the hugetlb_lock held. Creating this routine and separating functionality is in preparation for restructuring code to reduce lock hold times. This commit should not introduce any changes to functionality. Link: https://lkml.kernel.org/r/20210409205254.242291-5-mike.kravetz@oracle.com Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com> Acked-by: Michal Hocko <mhocko@suse.com> Reviewed-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Muchun Song <songmuchun@bytedance.com> Reviewed-by: Oscar Salvador <osalvador@suse.de> Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com> Cc: Barry Song <song.bao.hua@hisilicon.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Hillf Danton <hdanton@sina.com> Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mina Almasry <almasrymina@google.com> Cc: Peter Xu <peterx@redhat.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Roman Gushchin <guro@fb.com> Cc: Shakeel Butt <shakeelb@google.com> Cc: Waiman Long <longman@redhat.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 65 ++++++++++++++++++++++++++++++------------------- 1 file changed, 40 insertions(+), 25 deletions(-) --- a/mm/hugetlb.c~hugetlb-create-remove_hugetlb_page-to-separate-functionality +++ a/mm/hugetlb.c @@ -1333,6 +1333,41 @@ static inline void destroy_compound_giga unsigned int order) { } #endif +/* + * Remove hugetlb page from lists, and update dtor so that page appears + * as just a compound page. A reference is held on the page. + * + * Must be called with hugetlb lock held. + */ +static void remove_hugetlb_page(struct hstate *h, struct page *page, + bool adjust_surplus) +{ + int nid = page_to_nid(page); + + VM_BUG_ON_PAGE(hugetlb_cgroup_from_page(page), page); + VM_BUG_ON_PAGE(hugetlb_cgroup_from_page_rsvd(page), page); + + if (hstate_is_gigantic(h) && !gigantic_page_runtime_supported()) + return; + + list_del(&page->lru); + + if (HPageFreed(page)) { + h->free_huge_pages--; + h->free_huge_pages_node[nid]--; + } + if (adjust_surplus) { + h->surplus_huge_pages--; + h->surplus_huge_pages_node[nid]--; + } + + set_page_refcounted(page); + set_compound_page_dtor(page, NULL_COMPOUND_DTOR); + + h->nr_huge_pages--; + h->nr_huge_pages_node[nid]--; +} + static void update_and_free_page(struct hstate *h, struct page *page) { int i; @@ -1341,8 +1376,6 @@ static void update_and_free_page(struct if (hstate_is_gigantic(h) && !gigantic_page_runtime_supported()) return; - h->nr_huge_pages--; - h->nr_huge_pages_node[page_to_nid(page)]--; for (i = 0; i < pages_per_huge_page(h); i++, subpage = mem_map_next(subpage, page, i)) { subpage->flags &= ~(1 << PG_locked | 1 << PG_error | @@ -1350,10 +1383,6 @@ static void update_and_free_page(struct 1 << PG_active | 1 << PG_private | 1 << PG_writeback); } - VM_BUG_ON_PAGE(hugetlb_cgroup_from_page(page), page); - VM_BUG_ON_PAGE(hugetlb_cgroup_from_page_rsvd(page), page); - set_compound_page_dtor(page, NULL_COMPOUND_DTOR); - set_page_refcounted(page); if (hstate_is_gigantic(h)) { destroy_compound_gigantic_page(page, huge_page_order(h)); free_gigantic_page(page, huge_page_order(h)); @@ -1421,15 +1450,12 @@ static void __free_huge_page(struct page h->resv_huge_pages++; if (HPageTemporary(page)) { - list_del(&page->lru); - ClearHPageTemporary(page); + remove_hugetlb_page(h, page, false); update_and_free_page(h, page); } else if (h->surplus_huge_pages_node[nid]) { /* remove the page from active list */ - list_del(&page->lru); + remove_hugetlb_page(h, page, true); update_and_free_page(h, page); - h->surplus_huge_pages--; - h->surplus_huge_pages_node[nid]--; } else { arch_clear_hugepage_flags(page); enqueue_huge_page(h, page); @@ -1714,13 +1740,7 @@ static int free_pool_huge_page(struct hs struct page *page = list_entry(h->hugepage_freelists[node].next, struct page, lru); - list_del(&page->lru); - h->free_huge_pages--; - h->free_huge_pages_node[node]--; - if (acct_surplus) { - h->surplus_huge_pages--; - h->surplus_huge_pages_node[node]--; - } + remove_hugetlb_page(h, page, acct_surplus); update_and_free_page(h, page); ret = 1; break; @@ -1758,7 +1778,6 @@ retry: if (!page_count(page)) { struct page *head = compound_head(page); struct hstate *h = page_hstate(head); - int nid = page_to_nid(head); if (h->free_huge_pages - h->resv_huge_pages == 0) goto out; @@ -1789,9 +1808,7 @@ retry: SetPageHWPoison(page); ClearPageHWPoison(head); } - list_del(&head->lru); - h->free_huge_pages--; - h->free_huge_pages_node[nid]--; + remove_hugetlb_page(h, page, false); h->max_huge_pages--; update_and_free_page(h, head); rc = 0; @@ -2558,10 +2575,8 @@ static void try_to_free_low(struct hstat return; if (PageHighMem(page)) continue; - list_del(&page->lru); + remove_hugetlb_page(h, page, false); update_and_free_page(h, page); - h->free_huge_pages--; - h->free_huge_pages_node[page_to_nid(page)]--; } } } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 043/143] hugetlb: call update_and_free_page without hugetlb_lock 2021-05-05 1:32 incoming Andrew Morton ` (41 preceding siblings ...) 2021-05-05 1:34 ` [patch 042/143] hugetlb: create remove_hugetlb_page() to separate functionality Andrew Morton @ 2021-05-05 1:34 ` Andrew Morton 2021-05-05 1:35 ` [patch 044/143] hugetlb: change free_pool_huge_page to remove_pool_huge_page Andrew Morton ` (97 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw) To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton, iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko, mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx, peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds, will, willy From: Mike Kravetz <mike.kravetz@oracle.com> Subject: hugetlb: call update_and_free_page without hugetlb_lock With the introduction of remove_hugetlb_page(), there is no need for update_and_free_page to hold the hugetlb lock. Change all callers to drop the lock before calling. With additional code modifications, this will allow loops which decrease the huge page pool to drop the hugetlb_lock with each page to reduce long hold times. The ugly unlock/lock cycle in free_pool_huge_page will be removed in a subsequent patch which restructures free_pool_huge_page. Link: https://lkml.kernel.org/r/20210409205254.242291-6-mike.kravetz@oracle.com Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com> Acked-by: Michal Hocko <mhocko@suse.com> Reviewed-by: Muchun Song <songmuchun@bytedance.com> Reviewed-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Oscar Salvador <osalvador@suse.de> Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com> Cc: Barry Song <song.bao.hua@hisilicon.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Hillf Danton <hdanton@sina.com> Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mina Almasry <almasrymina@google.com> Cc: Peter Xu <peterx@redhat.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Roman Gushchin <guro@fb.com> Cc: Shakeel Butt <shakeelb@google.com> Cc: Waiman Long <longman@redhat.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 31 ++++++++++++++++++++++++++----- 1 file changed, 26 insertions(+), 5 deletions(-) --- a/mm/hugetlb.c~hugetlb-call-update_and_free_page-without-hugetlb_lock +++ a/mm/hugetlb.c @@ -1451,16 +1451,18 @@ static void __free_huge_page(struct page if (HPageTemporary(page)) { remove_hugetlb_page(h, page, false); + spin_unlock(&hugetlb_lock); update_and_free_page(h, page); } else if (h->surplus_huge_pages_node[nid]) { /* remove the page from active list */ remove_hugetlb_page(h, page, true); + spin_unlock(&hugetlb_lock); update_and_free_page(h, page); } else { arch_clear_hugepage_flags(page); enqueue_huge_page(h, page); + spin_unlock(&hugetlb_lock); } - spin_unlock(&hugetlb_lock); } /* @@ -1741,7 +1743,13 @@ static int free_pool_huge_page(struct hs list_entry(h->hugepage_freelists[node].next, struct page, lru); remove_hugetlb_page(h, page, acct_surplus); + /* + * unlock/lock around update_and_free_page is temporary + * and will be removed with subsequent patch. + */ + spin_unlock(&hugetlb_lock); update_and_free_page(h, page); + spin_lock(&hugetlb_lock); ret = 1; break; } @@ -1810,8 +1818,9 @@ retry: } remove_hugetlb_page(h, page, false); h->max_huge_pages--; + spin_unlock(&hugetlb_lock); update_and_free_page(h, head); - rc = 0; + return 0; } out: spin_unlock(&hugetlb_lock); @@ -2563,22 +2572,34 @@ static void try_to_free_low(struct hstat nodemask_t *nodes_allowed) { int i; + struct page *page, *next; + LIST_HEAD(page_list); if (hstate_is_gigantic(h)) return; + /* + * Collect pages to be freed on a list, and free after dropping lock + */ for_each_node_mask(i, *nodes_allowed) { - struct page *page, *next; struct list_head *freel = &h->hugepage_freelists[i]; list_for_each_entry_safe(page, next, freel, lru) { if (count >= h->nr_huge_pages) - return; + goto out; if (PageHighMem(page)) continue; remove_hugetlb_page(h, page, false); - update_and_free_page(h, page); + list_add(&page->lru, &page_list); } } + +out: + spin_unlock(&hugetlb_lock); + list_for_each_entry_safe(page, next, &page_list, lru) { + update_and_free_page(h, page); + cond_resched(); + } + spin_lock(&hugetlb_lock); } #else static inline void try_to_free_low(struct hstate *h, unsigned long count, _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 044/143] hugetlb: change free_pool_huge_page to remove_pool_huge_page 2021-05-05 1:32 incoming Andrew Morton ` (42 preceding siblings ...) 2021-05-05 1:34 ` [patch 043/143] hugetlb: call update_and_free_page without hugetlb_lock Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:35 ` [patch 045/143] hugetlb: make free_huge_page irq safe Andrew Morton ` (96 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton, iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko, mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx, peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds, will, willy From: Mike Kravetz <mike.kravetz@oracle.com> Subject: hugetlb: change free_pool_huge_page to remove_pool_huge_page free_pool_huge_page was called with hugetlb_lock held. It would remove a hugetlb page, and then free the corresponding pages to the lower level allocators such as buddy. free_pool_huge_page was called in a loop to remove hugetlb pages and these loops could hold the hugetlb_lock for a considerable time. Create new routine remove_pool_huge_page to replace free_pool_huge_page. remove_pool_huge_page will remove the hugetlb page, and it must be called with the hugetlb_lock held. It will return the removed page and it is the responsibility of the caller to free the page to the lower level allocators. The hugetlb_lock is dropped before freeing to these allocators which results in shorter lock hold times. Add new helper routine to call update_and_free_page for a list of pages. Note: Some changes to the routine return_unused_surplus_pages are in need of explanation. Commit e5bbc8a6c992 ("mm/hugetlb.c: fix reservation race when freeing surplus pages") modified this routine to address a race which could occur when dropping the hugetlb_lock in the loop that removes pool pages. Accounting changes introduced in that commit were subtle and took some thought to understand. This commit removes the cond_resched_lock() and the potential race. Therefore, remove the subtle code and restore the more straight forward accounting effectively reverting the commit. Link: https://lkml.kernel.org/r/20210409205254.242291-7-mike.kravetz@oracle.com Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com> Reviewed-by: Muchun Song <songmuchun@bytedance.com> Acked-by: Michal Hocko <mhocko@suse.com> Reviewed-by: Oscar Salvador <osalvador@suse.de> Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com> Cc: Barry Song <song.bao.hua@hisilicon.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Hillf Danton <hdanton@sina.com> Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Miaohe Lin <linmiaohe@huawei.com> Cc: Mina Almasry <almasrymina@google.com> Cc: Peter Xu <peterx@redhat.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Roman Gushchin <guro@fb.com> Cc: Shakeel Butt <shakeelb@google.com> Cc: Waiman Long <longman@redhat.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 93 ++++++++++++++++++++++++++----------------------- 1 file changed, 51 insertions(+), 42 deletions(-) --- a/mm/hugetlb.c~hugetlb-change-free_pool_huge_page-to-remove_pool_huge_page +++ a/mm/hugetlb.c @@ -1211,7 +1211,7 @@ static int hstate_next_node_to_alloc(str } /* - * helper for free_pool_huge_page() - return the previously saved + * helper for remove_pool_huge_page() - return the previously saved * node ["this node"] from which to free a huge page. Advance the * next node id whether or not we find a free huge page to free so * that the next attempt to free addresses the next node. @@ -1391,6 +1391,16 @@ static void update_and_free_page(struct } } +static void update_and_free_pages_bulk(struct hstate *h, struct list_head *list) +{ + struct page *page, *t_page; + + list_for_each_entry_safe(page, t_page, list, lru) { + update_and_free_page(h, page); + cond_resched(); + } +} + struct hstate *size_to_hstate(unsigned long size) { struct hstate *h; @@ -1721,16 +1731,18 @@ static int alloc_pool_huge_page(struct h } /* - * Free huge page from pool from next node to free. - * Attempt to keep persistent huge pages more or less - * balanced over allowed nodes. + * Remove huge page from pool from next node to free. Attempt to keep + * persistent huge pages more or less balanced over allowed nodes. + * This routine only 'removes' the hugetlb page. The caller must make + * an additional call to free the page to low level allocators. * Called with hugetlb_lock locked. */ -static int free_pool_huge_page(struct hstate *h, nodemask_t *nodes_allowed, - bool acct_surplus) +static struct page *remove_pool_huge_page(struct hstate *h, + nodemask_t *nodes_allowed, + bool acct_surplus) { int nr_nodes, node; - int ret = 0; + struct page *page = NULL; for_each_node_mask_to_free(h, nr_nodes, node, nodes_allowed) { /* @@ -1739,23 +1751,14 @@ static int free_pool_huge_page(struct hs */ if ((!acct_surplus || h->surplus_huge_pages_node[node]) && !list_empty(&h->hugepage_freelists[node])) { - struct page *page = - list_entry(h->hugepage_freelists[node].next, + page = list_entry(h->hugepage_freelists[node].next, struct page, lru); remove_hugetlb_page(h, page, acct_surplus); - /* - * unlock/lock around update_and_free_page is temporary - * and will be removed with subsequent patch. - */ - spin_unlock(&hugetlb_lock); - update_and_free_page(h, page); - spin_lock(&hugetlb_lock); - ret = 1; break; } } - return ret; + return page; } /* @@ -2075,17 +2078,16 @@ free: * to the associated reservation map. * 2) Free any unused surplus pages that may have been allocated to satisfy * the reservation. As many as unused_resv_pages may be freed. - * - * Called with hugetlb_lock held. However, the lock could be dropped (and - * reacquired) during calls to cond_resched_lock. Whenever dropping the lock, - * we must make sure nobody else can claim pages we are in the process of - * freeing. Do this by ensuring resv_huge_page always is greater than the - * number of huge pages we plan to free when dropping the lock. */ static void return_unused_surplus_pages(struct hstate *h, unsigned long unused_resv_pages) { unsigned long nr_pages; + struct page *page; + LIST_HEAD(page_list); + + /* Uncommit the reservation */ + h->resv_huge_pages -= unused_resv_pages; /* Cannot return gigantic pages currently */ if (hstate_is_gigantic(h)) @@ -2102,24 +2104,21 @@ static void return_unused_surplus_pages( * evenly across all nodes with memory. Iterate across these nodes * until we can no longer free unreserved surplus pages. This occurs * when the nodes with surplus pages have no free pages. - * free_pool_huge_page() will balance the freed pages across the + * remove_pool_huge_page() will balance the freed pages across the * on-line nodes with memory and will handle the hstate accounting. - * - * Note that we decrement resv_huge_pages as we free the pages. If - * we drop the lock, resv_huge_pages will still be sufficiently large - * to cover subsequent pages we may free. */ while (nr_pages--) { - h->resv_huge_pages--; - unused_resv_pages--; - if (!free_pool_huge_page(h, &node_states[N_MEMORY], 1)) + page = remove_pool_huge_page(h, &node_states[N_MEMORY], 1); + if (!page) goto out; - cond_resched_lock(&hugetlb_lock); + + list_add(&page->lru, &page_list); } out: - /* Fully uncommit the reservation */ - h->resv_huge_pages -= unused_resv_pages; + spin_unlock(&hugetlb_lock); + update_and_free_pages_bulk(h, &page_list); + spin_lock(&hugetlb_lock); } @@ -2572,7 +2571,6 @@ static void try_to_free_low(struct hstat nodemask_t *nodes_allowed) { int i; - struct page *page, *next; LIST_HEAD(page_list); if (hstate_is_gigantic(h)) @@ -2582,6 +2580,7 @@ static void try_to_free_low(struct hstat * Collect pages to be freed on a list, and free after dropping lock */ for_each_node_mask(i, *nodes_allowed) { + struct page *page, *next; struct list_head *freel = &h->hugepage_freelists[i]; list_for_each_entry_safe(page, next, freel, lru) { if (count >= h->nr_huge_pages) @@ -2595,10 +2594,7 @@ static void try_to_free_low(struct hstat out: spin_unlock(&hugetlb_lock); - list_for_each_entry_safe(page, next, &page_list, lru) { - update_and_free_page(h, page); - cond_resched(); - } + update_and_free_pages_bulk(h, &page_list); spin_lock(&hugetlb_lock); } #else @@ -2645,6 +2641,8 @@ static int set_max_huge_pages(struct hst nodemask_t *nodes_allowed) { unsigned long min_count, ret; + struct page *page; + LIST_HEAD(page_list); NODEMASK_ALLOC(nodemask_t, node_alloc_noretry, GFP_KERNEL); /* @@ -2757,11 +2755,22 @@ static int set_max_huge_pages(struct hst min_count = h->resv_huge_pages + h->nr_huge_pages - h->free_huge_pages; min_count = max(count, min_count); try_to_free_low(h, min_count, nodes_allowed); + + /* + * Collect pages to be removed on list without dropping lock + */ while (min_count < persistent_huge_pages(h)) { - if (!free_pool_huge_page(h, nodes_allowed, 0)) + page = remove_pool_huge_page(h, nodes_allowed, 0); + if (!page) break; - cond_resched_lock(&hugetlb_lock); + + list_add(&page->lru, &page_list); } + /* free the pages after dropping lock */ + spin_unlock(&hugetlb_lock); + update_and_free_pages_bulk(h, &page_list); + spin_lock(&hugetlb_lock); + while (count < persistent_huge_pages(h)) { if (!adjust_pool_surplus(h, nodes_allowed, 1)) break; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 045/143] hugetlb: make free_huge_page irq safe 2021-05-05 1:32 incoming Andrew Morton ` (43 preceding siblings ...) 2021-05-05 1:35 ` [patch 044/143] hugetlb: change free_pool_huge_page to remove_pool_huge_page Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:35 ` [patch 046/143] hugetlb: add lockdep_assert_held() calls for hugetlb_lock Andrew Morton ` (95 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton, iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko, mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx, peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds, will, willy From: Mike Kravetz <mike.kravetz@oracle.com> Subject: hugetlb: make free_huge_page irq safe Commit c77c0a8ac4c5 ("mm/hugetlb: defer freeing of huge pages if in non-task context") was added to address the issue of free_huge_page being called from irq context. That commit hands off free_huge_page processing to a workqueue if !in_task. However, this doesn't cover all the cases as pointed out by 0day bot lockdep report [1]. : Possible interrupt unsafe locking scenario: : : CPU0 CPU1 : ---- ---- : lock(hugetlb_lock); : local_irq_disable(); : lock(slock-AF_INET); : lock(hugetlb_lock); : <Interrupt> : lock(slock-AF_INET); Shakeel has later explained that this is very likely TCP TX zerocopy from hugetlb pages scenario when the networking code drops a last reference to hugetlb page while having IRQ disabled. Hugetlb freeing path doesn't disable IRQ while holding hugetlb_lock so a lock dependency chain can lead to a deadlock. This commit addresses the issue by doing the following: - Make hugetlb_lock irq safe. This is mostly a simple process of changing spin_*lock calls to spin_*lock_irq* calls. - Make subpool lock irq safe in a similar manner. - Revert the !in_task check and workqueue handoff. [1] https://lore.kernel.org/linux-mm/000000000000f1c03b05bc43aadc@google.com/ Link: https://lkml.kernel.org/r/20210409205254.242291-8-mike.kravetz@oracle.com Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com> Acked-by: Michal Hocko <mhocko@suse.com> Reviewed-by: Muchun Song <songmuchun@bytedance.com> Reviewed-by: Oscar Salvador <osalvador@suse.de> Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com> Cc: Barry Song <song.bao.hua@hisilicon.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Hillf Danton <hdanton@sina.com> Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Miaohe Lin <linmiaohe@huawei.com> Cc: Mina Almasry <almasrymina@google.com> Cc: Peter Xu <peterx@redhat.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Roman Gushchin <guro@fb.com> Cc: Shakeel Butt <shakeelb@google.com> Cc: Waiman Long <longman@redhat.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 169 +++++++++++++++--------------------------- mm/hugetlb_cgroup.c | 8 - 2 files changed, 67 insertions(+), 110 deletions(-) --- a/mm/hugetlb.c~hugetlb-make-free_huge_page-irq-safe +++ a/mm/hugetlb.c @@ -94,9 +94,10 @@ static inline bool subpool_is_free(struc return true; } -static inline void unlock_or_release_subpool(struct hugepage_subpool *spool) +static inline void unlock_or_release_subpool(struct hugepage_subpool *spool, + unsigned long irq_flags) { - spin_unlock(&spool->lock); + spin_unlock_irqrestore(&spool->lock, irq_flags); /* If no pages are used, and no other handles to the subpool * remain, give up any reservations based on minimum size and @@ -135,10 +136,12 @@ struct hugepage_subpool *hugepage_new_su void hugepage_put_subpool(struct hugepage_subpool *spool) { - spin_lock(&spool->lock); + unsigned long flags; + + spin_lock_irqsave(&spool->lock, flags); BUG_ON(!spool->count); spool->count--; - unlock_or_release_subpool(spool); + unlock_or_release_subpool(spool, flags); } /* @@ -157,7 +160,7 @@ static long hugepage_subpool_get_pages(s if (!spool) return ret; - spin_lock(&spool->lock); + spin_lock_irq(&spool->lock); if (spool->max_hpages != -1) { /* maximum size accounting */ if ((spool->used_hpages + delta) <= spool->max_hpages) @@ -184,7 +187,7 @@ static long hugepage_subpool_get_pages(s } unlock_ret: - spin_unlock(&spool->lock); + spin_unlock_irq(&spool->lock); return ret; } @@ -198,11 +201,12 @@ static long hugepage_subpool_put_pages(s long delta) { long ret = delta; + unsigned long flags; if (!spool) return delta; - spin_lock(&spool->lock); + spin_lock_irqsave(&spool->lock, flags); if (spool->max_hpages != -1) /* maximum size accounting */ spool->used_hpages -= delta; @@ -223,7 +227,7 @@ static long hugepage_subpool_put_pages(s * If hugetlbfs_put_super couldn't free spool due to an outstanding * quota reference, free it now. */ - unlock_or_release_subpool(spool); + unlock_or_release_subpool(spool, flags); return ret; } @@ -1412,7 +1416,7 @@ struct hstate *size_to_hstate(unsigned l return NULL; } -static void __free_huge_page(struct page *page) +void free_huge_page(struct page *page) { /* * Can't pass hstate in here because it is called from the @@ -1422,6 +1426,7 @@ static void __free_huge_page(struct page int nid = page_to_nid(page); struct hugepage_subpool *spool = hugetlb_page_subpool(page); bool restore_reserve; + unsigned long flags; VM_BUG_ON_PAGE(page_count(page), page); VM_BUG_ON_PAGE(page_mapcount(page), page); @@ -1450,7 +1455,7 @@ static void __free_huge_page(struct page restore_reserve = true; } - spin_lock(&hugetlb_lock); + spin_lock_irqsave(&hugetlb_lock, flags); ClearHPageMigratable(page); hugetlb_cgroup_uncharge_page(hstate_index(h), pages_per_huge_page(h), page); @@ -1461,66 +1466,18 @@ static void __free_huge_page(struct page if (HPageTemporary(page)) { remove_hugetlb_page(h, page, false); - spin_unlock(&hugetlb_lock); + spin_unlock_irqrestore(&hugetlb_lock, flags); update_and_free_page(h, page); } else if (h->surplus_huge_pages_node[nid]) { /* remove the page from active list */ remove_hugetlb_page(h, page, true); - spin_unlock(&hugetlb_lock); + spin_unlock_irqrestore(&hugetlb_lock, flags); update_and_free_page(h, page); } else { arch_clear_hugepage_flags(page); enqueue_huge_page(h, page); - spin_unlock(&hugetlb_lock); - } -} - -/* - * As free_huge_page() can be called from a non-task context, we have - * to defer the actual freeing in a workqueue to prevent potential - * hugetlb_lock deadlock. - * - * free_hpage_workfn() locklessly retrieves the linked list of pages to - * be freed and frees them one-by-one. As the page->mapping pointer is - * going to be cleared in __free_huge_page() anyway, it is reused as the - * llist_node structure of a lockless linked list of huge pages to be freed. - */ -static LLIST_HEAD(hpage_freelist); - -static void free_hpage_workfn(struct work_struct *work) -{ - struct llist_node *node; - struct page *page; - - node = llist_del_all(&hpage_freelist); - - while (node) { - page = container_of((struct address_space **)node, - struct page, mapping); - node = node->next; - __free_huge_page(page); - } -} -static DECLARE_WORK(free_hpage_work, free_hpage_workfn); - -void free_huge_page(struct page *page) -{ - /* - * Defer freeing if in non-task context to avoid hugetlb_lock deadlock. - */ - if (!in_task()) { - /* - * Only call schedule_work() if hpage_freelist is previously - * empty. Otherwise, schedule_work() had been called but the - * workfn hasn't retrieved the list yet. - */ - if (llist_add((struct llist_node *)&page->mapping, - &hpage_freelist)) - schedule_work(&free_hpage_work); - return; + spin_unlock_irqrestore(&hugetlb_lock, flags); } - - __free_huge_page(page); } static void prep_new_huge_page(struct hstate *h, struct page *page, int nid) @@ -1530,11 +1487,11 @@ static void prep_new_huge_page(struct hs hugetlb_set_page_subpool(page, NULL); set_hugetlb_cgroup(page, NULL); set_hugetlb_cgroup_rsvd(page, NULL); - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); h->nr_huge_pages++; h->nr_huge_pages_node[nid]++; ClearHPageFreed(page); - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); } static void prep_compound_gigantic_page(struct page *page, unsigned int order) @@ -1780,7 +1737,7 @@ retry: if (!PageHuge(page)) return 0; - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); if (!PageHuge(page)) { rc = 0; goto out; @@ -1797,7 +1754,7 @@ retry: * when it is dissolved. */ if (unlikely(!HPageFreed(head))) { - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); cond_resched(); /* @@ -1821,12 +1778,12 @@ retry: } remove_hugetlb_page(h, page, false); h->max_huge_pages--; - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); update_and_free_page(h, head); return 0; } out: - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); return rc; } @@ -1868,16 +1825,16 @@ static struct page *alloc_surplus_huge_p if (hstate_is_gigantic(h)) return NULL; - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); if (h->surplus_huge_pages >= h->nr_overcommit_huge_pages) goto out_unlock; - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); page = alloc_fresh_huge_page(h, gfp_mask, nid, nmask, NULL); if (!page) return NULL; - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); /* * We could have raced with the pool size change. * Double check that and simply deallocate the new page @@ -1887,7 +1844,7 @@ static struct page *alloc_surplus_huge_p */ if (h->surplus_huge_pages >= h->nr_overcommit_huge_pages) { SetHPageTemporary(page); - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); put_page(page); return NULL; } else { @@ -1896,7 +1853,7 @@ static struct page *alloc_surplus_huge_p } out_unlock: - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); return page; } @@ -1946,17 +1903,17 @@ struct page *alloc_buddy_huge_page_with_ struct page *alloc_huge_page_nodemask(struct hstate *h, int preferred_nid, nodemask_t *nmask, gfp_t gfp_mask) { - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); if (h->free_huge_pages - h->resv_huge_pages > 0) { struct page *page; page = dequeue_huge_page_nodemask(h, gfp_mask, preferred_nid, nmask); if (page) { - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); return page; } } - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); return alloc_migrate_huge_page(h, gfp_mask, preferred_nid, nmask); } @@ -2004,7 +1961,7 @@ static int gather_surplus_pages(struct h ret = -ENOMEM; retry: - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); for (i = 0; i < needed; i++) { page = alloc_surplus_huge_page(h, htlb_alloc_mask(h), NUMA_NO_NODE, NULL); @@ -2021,7 +1978,7 @@ retry: * After retaking hugetlb_lock, we need to recalculate 'needed' * because either resv_huge_pages or free_huge_pages may have changed. */ - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); needed = (h->resv_huge_pages + delta) - (h->free_huge_pages + allocated); if (needed > 0) { @@ -2061,12 +2018,12 @@ retry: enqueue_huge_page(h, page); } free: - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); /* Free unnecessary surplus pages to the buddy allocator */ list_for_each_entry_safe(page, tmp, &surplus_list, lru) put_page(page); - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); return ret; } @@ -2116,9 +2073,9 @@ static void return_unused_surplus_pages( } out: - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); update_and_free_pages_bulk(h, &page_list); - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); } @@ -2352,7 +2309,7 @@ struct page *alloc_huge_page(struct vm_a if (ret) goto out_uncharge_cgroup_reservation; - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); /* * glb_chg is passed to indicate whether or not a page must be taken * from the global free pool (global change). gbl_chg == 0 indicates @@ -2360,7 +2317,7 @@ struct page *alloc_huge_page(struct vm_a */ page = dequeue_huge_page_vma(h, vma, addr, avoid_reserve, gbl_chg); if (!page) { - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); page = alloc_buddy_huge_page_with_mpol(h, vma, addr); if (!page) goto out_uncharge_cgroup; @@ -2368,7 +2325,7 @@ struct page *alloc_huge_page(struct vm_a SetHPageRestoreReserve(page); h->resv_huge_pages--; } - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); list_add(&page->lru, &h->hugepage_activelist); /* Fall through */ } @@ -2381,7 +2338,7 @@ struct page *alloc_huge_page(struct vm_a h_cg, page); } - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); hugetlb_set_page_subpool(page, spool); @@ -2593,9 +2550,9 @@ static void try_to_free_low(struct hstat } out: - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); update_and_free_pages_bulk(h, &page_list); - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); } #else static inline void try_to_free_low(struct hstate *h, unsigned long count, @@ -2660,7 +2617,7 @@ static int set_max_huge_pages(struct hst * pages in hstate via the proc/sysfs interfaces. */ mutex_lock(&h->resize_lock); - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); /* * Check for a node specific request. @@ -2691,7 +2648,7 @@ static int set_max_huge_pages(struct hst */ if (hstate_is_gigantic(h) && !IS_ENABLED(CONFIG_CONTIG_ALLOC)) { if (count > persistent_huge_pages(h)) { - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); mutex_unlock(&h->resize_lock); NODEMASK_FREE(node_alloc_noretry); return -EINVAL; @@ -2721,14 +2678,14 @@ static int set_max_huge_pages(struct hst * page, free_huge_page will handle it by freeing the page * and reducing the surplus. */ - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); /* yield cpu to avoid soft lockup */ cond_resched(); ret = alloc_pool_huge_page(h, nodes_allowed, node_alloc_noretry); - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); if (!ret) goto out; @@ -2767,9 +2724,9 @@ static int set_max_huge_pages(struct hst list_add(&page->lru, &page_list); } /* free the pages after dropping lock */ - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); update_and_free_pages_bulk(h, &page_list); - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); while (count < persistent_huge_pages(h)) { if (!adjust_pool_surplus(h, nodes_allowed, 1)) @@ -2777,7 +2734,7 @@ static int set_max_huge_pages(struct hst } out: h->max_huge_pages = persistent_huge_pages(h); - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); mutex_unlock(&h->resize_lock); NODEMASK_FREE(node_alloc_noretry); @@ -2933,9 +2890,9 @@ static ssize_t nr_overcommit_hugepages_s if (err) return err; - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); h->nr_overcommit_huge_pages = input; - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); return count; } @@ -3522,9 +3479,9 @@ int hugetlb_overcommit_handler(struct ct goto out; if (write) { - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); h->nr_overcommit_huge_pages = tmp; - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); } out: return ret; @@ -3620,7 +3577,7 @@ static int hugetlb_acct_memory(struct hs if (!delta) return 0; - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); /* * When cpuset is configured, it breaks the strict hugetlb page * reservation as the accounting is done on a global variable. Such @@ -3659,7 +3616,7 @@ static int hugetlb_acct_memory(struct hs return_unused_surplus_pages(h, (unsigned long) -delta); out: - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); return ret; } @@ -5687,7 +5644,7 @@ bool isolate_huge_page(struct page *page { bool ret = true; - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); if (!PageHeadHuge(page) || !HPageMigratable(page) || !get_page_unless_zero(page)) { @@ -5697,16 +5654,16 @@ bool isolate_huge_page(struct page *page ClearHPageMigratable(page); list_move_tail(&page->lru, list); unlock: - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); return ret; } void putback_active_hugepage(struct page *page) { - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); SetHPageMigratable(page); list_move_tail(&page->lru, &(page_hstate(page))->hugepage_activelist); - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); put_page(page); } @@ -5740,12 +5697,12 @@ void move_hugetlb_state(struct page *old */ if (new_nid == old_nid) return; - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); if (h->surplus_huge_pages_node[old_nid]) { h->surplus_huge_pages_node[old_nid]--; h->surplus_huge_pages_node[new_nid]++; } - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); } } --- a/mm/hugetlb_cgroup.c~hugetlb-make-free_huge_page-irq-safe +++ a/mm/hugetlb_cgroup.c @@ -204,11 +204,11 @@ static void hugetlb_cgroup_css_offline(s do { idx = 0; for_each_hstate(h) { - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); list_for_each_entry(page, &h->hugepage_activelist, lru) hugetlb_cgroup_move_parent(idx, h_cg, page); - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); idx++; } cond_resched(); @@ -784,7 +784,7 @@ void hugetlb_cgroup_migrate(struct page if (hugetlb_cgroup_disabled()) return; - spin_lock(&hugetlb_lock); + spin_lock_irq(&hugetlb_lock); h_cg = hugetlb_cgroup_from_page(oldhpage); h_cg_rsvd = hugetlb_cgroup_from_page_rsvd(oldhpage); set_hugetlb_cgroup(oldhpage, NULL); @@ -794,7 +794,7 @@ void hugetlb_cgroup_migrate(struct page set_hugetlb_cgroup(newhpage, h_cg); set_hugetlb_cgroup_rsvd(newhpage, h_cg_rsvd); list_move(&newhpage->lru, &h->hugepage_activelist); - spin_unlock(&hugetlb_lock); + spin_unlock_irq(&hugetlb_lock); return; } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 046/143] hugetlb: add lockdep_assert_held() calls for hugetlb_lock 2021-05-05 1:32 incoming Andrew Morton ` (44 preceding siblings ...) 2021-05-05 1:35 ` [patch 045/143] hugetlb: make free_huge_page irq safe Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:35 ` [patch 047/143] mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range Andrew Morton ` (94 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton, iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko, mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx, peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds, will, willy From: Mike Kravetz <mike.kravetz@oracle.com> Subject: hugetlb: add lockdep_assert_held() calls for hugetlb_lock After making hugetlb lock irq safe and separating some functionality done under the lock, add some lockdep_assert_held to help verify locking. Link: https://lkml.kernel.org/r/20210409205254.242291-9-mike.kravetz@oracle.com Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com> Acked-by: Michal Hocko <mhocko@suse.com> Reviewed-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Muchun Song <songmuchun@bytedance.com> Reviewed-by: Oscar Salvador <osalvador@suse.de> Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com> Cc: Barry Song <song.bao.hua@hisilicon.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Hillf Danton <hdanton@sina.com> Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mina Almasry <almasrymina@google.com> Cc: Peter Xu <peterx@redhat.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Roman Gushchin <guro@fb.com> Cc: Shakeel Butt <shakeelb@google.com> Cc: Waiman Long <longman@redhat.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 9 +++++++++ 1 file changed, 9 insertions(+) --- a/mm/hugetlb.c~hugetlb-add-lockdep_assert_held-calls-for-hugetlb_lock +++ a/mm/hugetlb.c @@ -1069,6 +1069,8 @@ static bool vma_has_reserves(struct vm_a static void enqueue_huge_page(struct hstate *h, struct page *page) { int nid = page_to_nid(page); + + lockdep_assert_held(&hugetlb_lock); list_move(&page->lru, &h->hugepage_freelists[nid]); h->free_huge_pages++; h->free_huge_pages_node[nid]++; @@ -1080,6 +1082,7 @@ static struct page *dequeue_huge_page_no struct page *page; bool nocma = !!(current->flags & PF_MEMALLOC_NOCMA); + lockdep_assert_held(&hugetlb_lock); list_for_each_entry(page, &h->hugepage_freelists[nid], lru) { if (nocma && is_migrate_cma_page(page)) continue; @@ -1351,6 +1354,7 @@ static void remove_hugetlb_page(struct h VM_BUG_ON_PAGE(hugetlb_cgroup_from_page(page), page); VM_BUG_ON_PAGE(hugetlb_cgroup_from_page_rsvd(page), page); + lockdep_assert_held(&hugetlb_lock); if (hstate_is_gigantic(h) && !gigantic_page_runtime_supported()) return; @@ -1701,6 +1705,7 @@ static struct page *remove_pool_huge_pag int nr_nodes, node; struct page *page = NULL; + lockdep_assert_held(&hugetlb_lock); for_each_node_mask_to_free(h, nr_nodes, node, nodes_allowed) { /* * If we're returning unused surplus pages, only examine @@ -1950,6 +1955,7 @@ static int gather_surplus_pages(struct h long needed, allocated; bool alloc_ok = true; + lockdep_assert_held(&hugetlb_lock); needed = (h->resv_huge_pages + delta) - h->free_huge_pages; if (needed <= 0) { h->resv_huge_pages += delta; @@ -2043,6 +2049,7 @@ static void return_unused_surplus_pages( struct page *page; LIST_HEAD(page_list); + lockdep_assert_held(&hugetlb_lock); /* Uncommit the reservation */ h->resv_huge_pages -= unused_resv_pages; @@ -2530,6 +2537,7 @@ static void try_to_free_low(struct hstat int i; LIST_HEAD(page_list); + lockdep_assert_held(&hugetlb_lock); if (hstate_is_gigantic(h)) return; @@ -2571,6 +2579,7 @@ static int adjust_pool_surplus(struct hs { int nr_nodes, node; + lockdep_assert_held(&hugetlb_lock); VM_BUG_ON(delta != -1 && delta != 1); if (delta < 0) { _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 047/143] mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range 2021-05-05 1:32 incoming Andrew Morton ` (45 preceding siblings ...) 2021-05-05 1:35 ` [patch 046/143] hugetlb: add lockdep_assert_held() calls for hugetlb_lock Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:35 ` [patch 048/143] mm,compaction: let isolate_migratepages_{range,block} return error codes Andrew Morton ` (93 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits, osalvador, songmuchun, torvalds, vbabka From: Oscar Salvador <osalvador@suse.de> Subject: mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range Patch series "Make alloc_contig_range handle Hugetlb pages", v10. alloc_contig_range lacks the ability to handle HugeTLB pages. This can be problematic for some users, e.g: CMA and virtio-mem, where those users will fail the call if alloc_contig_range ever sees a HugeTLB page, even when those pages lay in ZONE_MOVABLE and are free. That problem can be easily solved by replacing the page in the free hugepage pool. In-use HugeTLB are no exception though, as those can be isolated and migrated as any other LRU or Movable page. This patchset aims for improving alloc_contig_range->isolate_migratepages_block, so HugeTLB pages can be recognized and handled. Since we also need to start reporting errors down the chain (e.g: -ENOMEM due to not be able to allocate a new hugetlb page), isolate_migratepages_{range,block} interfaces need to change to start reporting error codes instead of the pfn == 0 vs pfn != 0 scheme it is using right now. From now on, isolate_migratepages_block will not return the next pfn to be scanned anymore, but -EINTR, -ENOMEM or 0, so we the next pfn to be scanned will be recorded in cc->migrate_pfn field (as it is already done in isolate_migratepages_range()). Below is an insight from David (thanks), where the problem can clearly be seen: "Start a VM with 4G. Hotplug 1G via virtio-mem and online it to ZONE_MOVABLE. Allocate 512 huge pages. [root@localhost ~]# cat /proc/meminfo MemTotal: 5061512 kB MemFree: 3319396 kB MemAvailable: 3457144 kB ... HugePages_Total: 512 HugePages_Free: 512 HugePages_Rsvd: 0 HugePages_Surp: 0 Hugepagesize: 2048 kB The huge pages get partially allocate from ZONE_MOVABLE. Try unplugging 1G via virtio-mem (remember, all ZONE_MOVABLE). Inside the guest: [ 180.058992] alloc_contig_range: [1b8000, 1c0000) PFNs busy [ 180.060531] alloc_contig_range: [1b8000, 1c0000) PFNs busy [ 180.061972] alloc_contig_range: [1b8000, 1c0000) PFNs busy [ 180.063413] alloc_contig_range: [1b8000, 1c0000) PFNs busy [ 180.064838] alloc_contig_range: [1b8000, 1c0000) PFNs busy [ 180.065848] alloc_contig_range: [1bfc00, 1c0000) PFNs busy [ 180.066794] alloc_contig_range: [1bfc00, 1c0000) PFNs busy [ 180.067738] alloc_contig_range: [1bfc00, 1c0000) PFNs busy [ 180.068669] alloc_contig_range: [1bfc00, 1c0000) PFNs busy [ 180.069598] alloc_contig_range: [1bfc00, 1c0000) PFNs busy" And then with this patchset running: "Same experiment with ZONE_MOVABLE: a) Free huge pages: all memory can get unplugged again. b) Allocated/populated but idle huge pages: all memory can get unplugged again. c) Allocated/populated but all 512 huge pages are read/written in a loop: all memory can get unplugged again, but I get a single [ 121.192345] alloc_contig_range: [180000, 188000) PFNs busy Most probably because it happened to try migrating a huge page while it was busy. As virtio-mem retries on ZONE_MOVABLE a couple of times, it can deal with this temporary failure. Last but not least, I did something extreme: # cat /proc/meminfo MemTotal: 5061568 kB MemFree: 186560 kB MemAvailable: 354524 kB ... HugePages_Total: 2048 HugePages_Free: 2048 HugePages_Rsvd: 0 HugePages_Surp: 0 Triggering unplug would require to dissolve+alloc - which now fails when trying to allocate an additional ~512 huge pages (1G). As expected, I can properly see memory unplug not fully succeeding. + I get a fairly continuous stream of [ 226.611584] alloc_contig_range: [19f400, 19f800) PFNs busy ... But more importantly, the hugepage count remains stable, as configured by the admin (me): HugePages_Total: 2048 HugePages_Free: 2048 HugePages_Rsvd: 0 HugePages_Surp: 0" This patch (of 7): Currently, __alloc_contig_migrate_range can generate -EINTR, -ENOMEM or -EBUSY, and report them down the chain. The problem is that when migrate_pages() reports -ENOMEM, we keep going till we exhaust all the try-attempts (5 at the moment) instead of bailing out. migrate_pages() bails out right away on -ENOMEM because it is considered a fatal error. Do the same here instead of keep going and retrying. Note that this is not fixing a real issue, just a cosmetic change. Although we can save some cycles by backing off ealier Link: https://lkml.kernel.org/r/20210419075413.1064-1-osalvador@suse.de Link: https://lkml.kernel.org/r/20210419075413.1064-2-osalvador@suse.de Signed-off-by: Oscar Salvador <osalvador@suse.de> Acked-by: Vlastimil Babka <vbabka@suse.cz> Reviewed-by: David Hildenbrand <david@redhat.com> Acked-by: Michal Hocko <mhocko@suse.com> Acked-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Muchun Song <songmuchun@bytedance.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 9 ++++++++- 1 file changed, 8 insertions(+), 1 deletion(-) --- a/mm/page_alloc.c~mmpage_alloc-bail-out-earlier-on-enomem-in-alloc_contig_migrate_range +++ a/mm/page_alloc.c @@ -8696,7 +8696,7 @@ static int __alloc_contig_migrate_range( } tries = 0; } else if (++tries == 5) { - ret = ret < 0 ? ret : -EBUSY; + ret = -EBUSY; break; } @@ -8706,6 +8706,13 @@ static int __alloc_contig_migrate_range( ret = migrate_pages(&cc->migratepages, alloc_migration_target, NULL, (unsigned long)&mtc, cc->mode, MR_CONTIG_RANGE); + + /* + * On -ENOMEM, migrate_pages() bails out right away. It is pointless + * to retry again over this error, so do the same here. + */ + if (ret == -ENOMEM) + break; } if (ret < 0) { alloc_contig_dump_pages(&cc->migratepages); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 048/143] mm,compaction: let isolate_migratepages_{range,block} return error codes 2021-05-05 1:32 incoming Andrew Morton ` (46 preceding siblings ...) 2021-05-05 1:35 ` [patch 047/143] mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:35 ` [patch 049/143] mm,hugetlb: drop clearing of flag from prep_new_huge_page Andrew Morton ` (92 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits, osalvador, songmuchun, torvalds, vbabka From: Oscar Salvador <osalvador@suse.de> Subject: mm,compaction: let isolate_migratepages_{range,block} return error codes Currently, isolate_migratepages_{range,block} and their callers use a pfn == 0 vs pfn != 0 scheme to let the caller know whether there was any error during isolation. This does not work as soon as we need to start reporting different error codes and make sure we pass them down the chain, so they are properly interpreted by functions like e.g: alloc_contig_range. Let us rework isolate_migratepages_{range,block} so we can report error codes. Since isolate_migratepages_block will stop returning the next pfn to be scanned, we reuse the cc->migrate_pfn field to keep track of that. Link: https://lkml.kernel.org/r/20210419075413.1064-3-osalvador@suse.de Signed-off-by: Oscar Salvador <osalvador@suse.de> Acked-by: Vlastimil Babka <vbabka@suse.cz> Acked-by: Mike Kravetz <mike.kravetz@oracle.com> Reviewed-by: David Hildenbrand <david@redhat.com> Cc: Michal Hocko <mhocko@suse.com> Cc: Muchun Song <songmuchun@bytedance.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/compaction.c | 52 ++++++++++++++++++++++------------------------ mm/internal.h | 10 +++++++- mm/page_alloc.c | 7 ++---- 3 files changed, 36 insertions(+), 33 deletions(-) --- a/mm/compaction.c~mmcompaction-let-isolate_migratepages_rangeblock-return-error-codes +++ a/mm/compaction.c @@ -787,15 +787,14 @@ static bool too_many_isolated(pg_data_t * * Isolate all pages that can be migrated from the range specified by * [low_pfn, end_pfn). The range is expected to be within same pageblock. - * Returns zero if there is a fatal signal pending, otherwise PFN of the - * first page that was not scanned (which may be both less, equal to or more - * than end_pfn). + * Returns errno, like -EAGAIN or -EINTR in case e.g signal pending or congestion, + * or 0. + * cc->migrate_pfn will contain the next pfn to scan. * * The pages are isolated on cc->migratepages list (not required to be empty), - * and cc->nr_migratepages is updated accordingly. The cc->migrate_pfn field - * is neither read nor updated. + * and cc->nr_migratepages is updated accordingly. */ -static unsigned long +static int isolate_migratepages_block(struct compact_control *cc, unsigned long low_pfn, unsigned long end_pfn, isolate_mode_t isolate_mode) { @@ -809,6 +808,9 @@ isolate_migratepages_block(struct compac bool skip_on_failure = false; unsigned long next_skip_pfn = 0; bool skip_updated = false; + int ret = 0; + + cc->migrate_pfn = low_pfn; /* * Ensure that there are not too many pages isolated from the LRU @@ -818,16 +820,16 @@ isolate_migratepages_block(struct compac while (unlikely(too_many_isolated(pgdat))) { /* stop isolation if there are still pages not migrated */ if (cc->nr_migratepages) - return 0; + return -EAGAIN; /* async migration should just abort */ if (cc->mode == MIGRATE_ASYNC) - return 0; + return -EAGAIN; congestion_wait(BLK_RW_ASYNC, HZ/10); if (fatal_signal_pending(current)) - return 0; + return -EINTR; } cond_resched(); @@ -875,8 +877,8 @@ isolate_migratepages_block(struct compac if (fatal_signal_pending(current)) { cc->contended = true; + ret = -EINTR; - low_pfn = 0; goto fatal_pending; } @@ -1130,7 +1132,9 @@ fatal_pending: if (nr_isolated) count_compact_events(COMPACTISOLATED, nr_isolated); - return low_pfn; + cc->migrate_pfn = low_pfn; + + return ret; } /** @@ -1139,15 +1143,14 @@ fatal_pending: * @start_pfn: The first PFN to start isolating. * @end_pfn: The one-past-last PFN. * - * Returns zero if isolation fails fatally due to e.g. pending signal. - * Otherwise, function returns one-past-the-last PFN of isolated page - * (which may be greater than end_pfn if end fell in a middle of a THP page). + * Returns -EAGAIN when contented, -EINTR in case of a signal pending or 0. */ -unsigned long +int isolate_migratepages_range(struct compact_control *cc, unsigned long start_pfn, unsigned long end_pfn) { unsigned long pfn, block_start_pfn, block_end_pfn; + int ret = 0; /* Scan block by block. First and last block may be incomplete */ pfn = start_pfn; @@ -1166,17 +1169,17 @@ isolate_migratepages_range(struct compac block_end_pfn, cc->zone)) continue; - pfn = isolate_migratepages_block(cc, pfn, block_end_pfn, - ISOLATE_UNEVICTABLE); + ret = isolate_migratepages_block(cc, pfn, block_end_pfn, + ISOLATE_UNEVICTABLE); - if (!pfn) + if (ret) break; if (cc->nr_migratepages >= COMPACT_CLUSTER_MAX) break; } - return pfn; + return ret; } #endif /* CONFIG_COMPACTION || CONFIG_CMA */ @@ -1847,7 +1850,7 @@ static isolate_migrate_t isolate_migrate */ for (; block_end_pfn <= cc->free_pfn; fast_find_block = false, - low_pfn = block_end_pfn, + cc->migrate_pfn = low_pfn = block_end_pfn, block_start_pfn = block_end_pfn, block_end_pfn += pageblock_nr_pages) { @@ -1889,10 +1892,8 @@ static isolate_migrate_t isolate_migrate } /* Perform the isolation */ - low_pfn = isolate_migratepages_block(cc, low_pfn, - block_end_pfn, isolate_mode); - - if (!low_pfn) + if (isolate_migratepages_block(cc, low_pfn, block_end_pfn, + isolate_mode)) return ISOLATE_ABORT; /* @@ -1903,9 +1904,6 @@ static isolate_migrate_t isolate_migrate break; } - /* Record where migration scanner will be restarted. */ - cc->migrate_pfn = low_pfn; - return cc->nr_migratepages ? ISOLATE_SUCCESS : ISOLATE_NONE; } --- a/mm/internal.h~mmcompaction-let-isolate_migratepages_rangeblock-return-error-codes +++ a/mm/internal.h @@ -244,7 +244,13 @@ struct compact_control { unsigned int nr_freepages; /* Number of isolated free pages */ unsigned int nr_migratepages; /* Number of pages to migrate */ unsigned long free_pfn; /* isolate_freepages search base */ - unsigned long migrate_pfn; /* isolate_migratepages search base */ + /* + * Acts as an in/out parameter to page isolation for migration. + * isolate_migratepages uses it as a search base. + * isolate_migratepages_block will update the value to the next pfn + * after the last isolated one. + */ + unsigned long migrate_pfn; unsigned long fast_start_pfn; /* a pfn to start linear scan from */ struct zone *zone; unsigned long total_migrate_scanned; @@ -280,7 +286,7 @@ struct capture_control { unsigned long isolate_freepages_range(struct compact_control *cc, unsigned long start_pfn, unsigned long end_pfn); -unsigned long +int isolate_migratepages_range(struct compact_control *cc, unsigned long low_pfn, unsigned long end_pfn); int find_suitable_fallback(struct free_area *area, unsigned int order, --- a/mm/page_alloc.c~mmcompaction-let-isolate_migratepages_rangeblock-return-error-codes +++ a/mm/page_alloc.c @@ -8689,11 +8689,10 @@ static int __alloc_contig_migrate_range( if (list_empty(&cc->migratepages)) { cc->nr_migratepages = 0; - pfn = isolate_migratepages_range(cc, pfn, end); - if (!pfn) { - ret = -EINTR; + ret = isolate_migratepages_range(cc, pfn, end); + if (ret && ret != -EAGAIN) break; - } + pfn = cc->migrate_pfn; tries = 0; } else if (++tries == 5) { ret = -EBUSY; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 049/143] mm,hugetlb: drop clearing of flag from prep_new_huge_page 2021-05-05 1:32 incoming Andrew Morton ` (47 preceding siblings ...) 2021-05-05 1:35 ` [patch 048/143] mm,compaction: let isolate_migratepages_{range,block} return error codes Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:35 ` [patch 050/143] mm,hugetlb: split prep_new_huge_page functionality Andrew Morton ` (91 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits, osalvador, songmuchun, torvalds, vbabka From: Oscar Salvador <osalvador@suse.de> Subject: mm,hugetlb: drop clearing of flag from prep_new_huge_page Pages allocated via the page allocator or CMA get its private field cleared by means of post_alloc_hook(). Pages allocated during boot, that is directly from the memblock allocator, get cleared by paging_init()->..->memmap_init_zone->..->__init_single_page() before any memblock allocation. Based on this ground, let us remove the clearing of the flag from prep_new_huge_page() as it is not needed. This was a leftover from 6c0371490140 ("hugetlb: convert PageHugeFreed to HPageFreed flag"). Previously the explicit clearing was necessary because compound allocations do not get this initialization (see prep_compound_page). Link: https://lkml.kernel.org/r/20210419075413.1064-4-osalvador@suse.de Signed-off-by: Oscar Salvador <osalvador@suse.de> Acked-by: Michal Hocko <mhocko@suse.com> Reviewed-by: David Hildenbrand <david@redhat.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Muchun Song <songmuchun@bytedance.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 1 - 1 file changed, 1 deletion(-) --- a/mm/hugetlb.c~mmhugetlb-drop-clearing-of-flag-from-prep_new_huge_page +++ a/mm/hugetlb.c @@ -1494,7 +1494,6 @@ static void prep_new_huge_page(struct hs spin_lock_irq(&hugetlb_lock); h->nr_huge_pages++; h->nr_huge_pages_node[nid]++; - ClearHPageFreed(page); spin_unlock_irq(&hugetlb_lock); } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 050/143] mm,hugetlb: split prep_new_huge_page functionality 2021-05-05 1:32 incoming Andrew Morton ` (48 preceding siblings ...) 2021-05-05 1:35 ` [patch 049/143] mm,hugetlb: drop clearing of flag from prep_new_huge_page Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:35 ` [patch 051/143] mm: make alloc_contig_range handle free hugetlb pages Andrew Morton ` (90 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits, osalvador, songmuchun, torvalds, vbabka From: Oscar Salvador <osalvador@suse.de> Subject: mm,hugetlb: split prep_new_huge_page functionality Currently, prep_new_huge_page() performs two functions. It sets the right state for a new hugetlb, and increases the hstate's counters to account for the new page. Let us split its functionality into two separate functions, decoupling the handling of the counters from initializing a hugepage. The outcome is having __prep_new_huge_page(), which only initializes the page , and __prep_account_new_huge_page(), which adds the new page to the hstate's counters. This allows us to be able to set a hugetlb without having to worry about the counter/locking. It will prove useful in the next patch. prep_new_huge_page() still calls both functions. Link: https://lkml.kernel.org/r/20210419075413.1064-5-osalvador@suse.de Signed-off-by: Oscar Salvador <osalvador@suse.de> Acked-by: Michal Hocko <mhocko@suse.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Reviewed-by: David Hildenbrand <david@redhat.com> Cc: Muchun Song <songmuchun@bytedance.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 20 +++++++++++++++++--- 1 file changed, 17 insertions(+), 3 deletions(-) --- a/mm/hugetlb.c~mmhugetlb-split-prep_new_huge_page-functionality +++ a/mm/hugetlb.c @@ -1484,16 +1484,30 @@ void free_huge_page(struct page *page) } } -static void prep_new_huge_page(struct hstate *h, struct page *page, int nid) +/* + * Must be called with the hugetlb lock held + */ +static void __prep_account_new_huge_page(struct hstate *h, int nid) +{ + lockdep_assert_held(&hugetlb_lock); + h->nr_huge_pages++; + h->nr_huge_pages_node[nid]++; +} + +static void __prep_new_huge_page(struct page *page) { INIT_LIST_HEAD(&page->lru); set_compound_page_dtor(page, HUGETLB_PAGE_DTOR); hugetlb_set_page_subpool(page, NULL); set_hugetlb_cgroup(page, NULL); set_hugetlb_cgroup_rsvd(page, NULL); +} + +static void prep_new_huge_page(struct hstate *h, struct page *page, int nid) +{ + __prep_new_huge_page(page); spin_lock_irq(&hugetlb_lock); - h->nr_huge_pages++; - h->nr_huge_pages_node[nid]++; + __prep_account_new_huge_page(h, nid); spin_unlock_irq(&hugetlb_lock); } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 051/143] mm: make alloc_contig_range handle free hugetlb pages 2021-05-05 1:32 incoming Andrew Morton ` (49 preceding siblings ...) 2021-05-05 1:35 ` [patch 050/143] mm,hugetlb: split prep_new_huge_page functionality Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:35 ` [patch 052/143] mm: make alloc_contig_range handle in-use " Andrew Morton ` (89 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits, osalvador, songmuchun, torvalds, vbabka From: Oscar Salvador <osalvador@suse.de> Subject: mm: make alloc_contig_range handle free hugetlb pages alloc_contig_range will fail if it ever sees a HugeTLB page within the range we are trying to allocate, even when that page is free and can be easily reallocated. This has proved to be problematic for some users of alloc_contic_range, e.g: CMA and virtio-mem, where those would fail the call even when those pages lay in ZONE_MOVABLE and are free. We can do better by trying to replace such page. Free hugepages are tricky to handle so as to no userspace application notices disruption, we need to replace the current free hugepage with a new one. In order to do that, a new function called alloc_and_dissolve_huge_page is introduced. This function will first try to get a new fresh hugepage, and if it succeeds, it will replace the old one in the free hugepage pool. The free page replacement is done under hugetlb_lock, so no external users of hugetlb will notice the change. To allocate the new huge page, we use alloc_buddy_huge_page(), so we do not have to deal with any counters, and prep_new_huge_page() is not called. This is valulable because in case we need to free the new page, we only need to call __free_pages(). Once we know that the page to be replaced is a genuine 0-refcounted huge page, we remove the old page from the freelist by remove_hugetlb_page(). Then, we can call __prep_new_huge_page() and __prep_account_new_huge_page() for the new huge page to properly initialize it and increment the hstate->nr_huge_pages counter (previously decremented by remove_hugetlb_page()). Once done, the page is enqueued by enqueue_huge_page() and it is ready to be used. There is one tricky case when page's refcount is 0 because it is in the process of being released. A missing PageHugeFreed bit will tell us that freeing is in flight so we retry after dropping the hugetlb_lock. The race window should be small and the next retry should make a forward progress. E.g: CPU0 CPU1 free_huge_page() isolate_or_dissolve_huge_page PageHuge() == T alloc_and_dissolve_huge_page alloc_buddy_huge_page() spin_lock_irq(hugetlb_lock) // PageHuge() && !PageHugeFreed && // !PageCount() spin_unlock_irq(hugetlb_lock) spin_lock_irq(hugetlb_lock) 1) update_and_free_page PageHuge() == F __free_pages() 2) enqueue_huge_page SetPageHugeFreed() spin_unlock_irq(&hugetlb_lock) spin_lock_irq(hugetlb_lock) 1) PageHuge() == F (freed by case#1 from CPU0) 2) PageHuge() == T PageHugeFreed() == T - proceed with replacing the page In the case above we retry as the window race is quite small and we have high chances to succeed next time. With regard to the allocation, we restrict it to the node the page belongs to with __GFP_THISNODE, meaning we do not fallback on other node's zones. Note that gigantic hugetlb pages are fenced off since there is a cyclic dependency between them and alloc_contig_range. Link: https://lkml.kernel.org/r/20210419075413.1064-6-osalvador@suse.de Signed-off-by: Oscar Salvador <osalvador@suse.de> Acked-by: Michal Hocko <mhocko@suse.com> Acked-by: David Hildenbrand <david@redhat.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Muchun Song <songmuchun@bytedance.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/hugetlb.h | 6 + mm/compaction.c | 33 +++++++++- mm/hugetlb.c | 116 ++++++++++++++++++++++++++++++++++++++ 3 files changed, 152 insertions(+), 3 deletions(-) --- a/include/linux/hugetlb.h~mm-make-alloc_contig_range-handle-free-hugetlb-pages +++ a/include/linux/hugetlb.h @@ -588,6 +588,7 @@ struct huge_bootmem_page { struct hstate *hstate; }; +int isolate_or_dissolve_huge_page(struct page *page); struct page *alloc_huge_page(struct vm_area_struct *vma, unsigned long addr, int avoid_reserve); struct page *alloc_huge_page_nodemask(struct hstate *h, int preferred_nid, @@ -870,6 +871,11 @@ static inline void huge_ptep_modify_prot #else /* CONFIG_HUGETLB_PAGE */ struct hstate {}; +static inline int isolate_or_dissolve_huge_page(struct page *page) +{ + return -ENOMEM; +} + static inline struct page *alloc_huge_page(struct vm_area_struct *vma, unsigned long addr, int avoid_reserve) --- a/mm/compaction.c~mm-make-alloc_contig_range-handle-free-hugetlb-pages +++ a/mm/compaction.c @@ -788,7 +788,7 @@ static bool too_many_isolated(pg_data_t * Isolate all pages that can be migrated from the range specified by * [low_pfn, end_pfn). The range is expected to be within same pageblock. * Returns errno, like -EAGAIN or -EINTR in case e.g signal pending or congestion, - * or 0. + * -ENOMEM in case we could not allocate a page, or 0. * cc->migrate_pfn will contain the next pfn to scan. * * The pages are isolated on cc->migratepages list (not required to be empty), @@ -906,6 +906,29 @@ isolate_migratepages_block(struct compac valid_page = page; } + if (PageHuge(page) && cc->alloc_contig) { + ret = isolate_or_dissolve_huge_page(page); + + /* + * Fail isolation in case isolate_or_dissolve_huge_page() + * reports an error. In case of -ENOMEM, abort right away. + */ + if (ret < 0) { + /* Do not report -EBUSY down the chain */ + if (ret == -EBUSY) + ret = 0; + low_pfn += (1UL << compound_order(page)) - 1; + goto isolate_fail; + } + + /* + * Ok, the hugepage was dissolved. Now these pages are + * Buddy and cannot be re-allocated because they are + * isolated. Fall-through as the check below handles + * Buddy pages. + */ + } + /* * Skip if free. We read page order here without zone lock * which is generally unsafe, but the race window is small and @@ -1065,7 +1088,7 @@ isolate_fail_put: put_page(page); isolate_fail: - if (!skip_on_failure) + if (!skip_on_failure && ret != -ENOMEM) continue; /* @@ -1091,6 +1114,9 @@ isolate_fail: */ next_skip_pfn += 1UL << cc->order; } + + if (ret == -ENOMEM) + break; } /* @@ -1143,7 +1169,8 @@ fatal_pending: * @start_pfn: The first PFN to start isolating. * @end_pfn: The one-past-last PFN. * - * Returns -EAGAIN when contented, -EINTR in case of a signal pending or 0. + * Returns -EAGAIN when contented, -EINTR in case of a signal pending, -ENOMEM + * in case we could not allocate a page, or 0. */ int isolate_migratepages_range(struct compact_control *cc, unsigned long start_pfn, --- a/mm/hugetlb.c~mm-make-alloc_contig_range-handle-free-hugetlb-pages +++ a/mm/hugetlb.c @@ -2267,6 +2267,122 @@ static void restore_reserve_on_error(str } } +/* + * alloc_and_dissolve_huge_page - Allocate a new page and dissolve the old one + * @h: struct hstate old page belongs to + * @old_page: Old page to dissolve + * Returns 0 on success, otherwise negated error. + */ +static int alloc_and_dissolve_huge_page(struct hstate *h, struct page *old_page) +{ + gfp_t gfp_mask = htlb_alloc_mask(h) | __GFP_THISNODE; + int nid = page_to_nid(old_page); + struct page *new_page; + int ret = 0; + + /* + * Before dissolving the page, we need to allocate a new one for the + * pool to remain stable. Using alloc_buddy_huge_page() allows us to + * not having to deal with prep_new_huge_page() and avoids dealing of any + * counters. This simplifies and let us do the whole thing under the + * lock. + */ + new_page = alloc_buddy_huge_page(h, gfp_mask, nid, NULL, NULL); + if (!new_page) + return -ENOMEM; + +retry: + spin_lock_irq(&hugetlb_lock); + if (!PageHuge(old_page)) { + /* + * Freed from under us. Drop new_page too. + */ + goto free_new; + } else if (page_count(old_page)) { + /* + * Someone has grabbed the page, fail for now. + */ + ret = -EBUSY; + goto free_new; + } else if (!HPageFreed(old_page)) { + /* + * Page's refcount is 0 but it has not been enqueued in the + * freelist yet. Race window is small, so we can succeed here if + * we retry. + */ + spin_unlock_irq(&hugetlb_lock); + cond_resched(); + goto retry; + } else { + /* + * Ok, old_page is still a genuine free hugepage. Remove it from + * the freelist and decrease the counters. These will be + * incremented again when calling __prep_account_new_huge_page() + * and enqueue_huge_page() for new_page. The counters will remain + * stable since this happens under the lock. + */ + remove_hugetlb_page(h, old_page, false); + + /* + * new_page needs to be initialized with the standard hugetlb + * state. This is normally done by prep_new_huge_page() but + * that takes hugetlb_lock which is already held so we need to + * open code it here. + * Reference count trick is needed because allocator gives us + * referenced page but the pool requires pages with 0 refcount. + */ + __prep_new_huge_page(new_page); + __prep_account_new_huge_page(h, nid); + page_ref_dec(new_page); + enqueue_huge_page(h, new_page); + + /* + * Pages have been replaced, we can safely free the old one. + */ + spin_unlock_irq(&hugetlb_lock); + update_and_free_page(h, old_page); + } + + return ret; + +free_new: + spin_unlock_irq(&hugetlb_lock); + __free_pages(new_page, huge_page_order(h)); + + return ret; +} + +int isolate_or_dissolve_huge_page(struct page *page) +{ + struct hstate *h; + struct page *head; + + /* + * The page might have been dissolved from under our feet, so make sure + * to carefully check the state under the lock. + * Return success when racing as if we dissolved the page ourselves. + */ + spin_lock_irq(&hugetlb_lock); + if (PageHuge(page)) { + head = compound_head(page); + h = page_hstate(head); + } else { + spin_unlock_irq(&hugetlb_lock); + return 0; + } + spin_unlock_irq(&hugetlb_lock); + + /* + * Fence off gigantic pages as there is a cyclic dependency between + * alloc_contig_range and them. Return -ENOMEM as this has the effect + * of bailing out right away without further retrying. + */ + if (hstate_is_gigantic(h)) + return -ENOMEM; + + return alloc_and_dissolve_huge_page(h, head); +} + struct page *alloc_huge_page(struct vm_area_struct *vma, unsigned long addr, int avoid_reserve) { _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 052/143] mm: make alloc_contig_range handle in-use hugetlb pages 2021-05-05 1:32 incoming Andrew Morton ` (50 preceding siblings ...) 2021-05-05 1:35 ` [patch 051/143] mm: make alloc_contig_range handle free hugetlb pages Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:35 ` [patch 053/143] mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig Andrew Morton ` (88 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits, osalvador, songmuchun, torvalds, vbabka From: Oscar Salvador <osalvador@suse.de> Subject: mm: make alloc_contig_range handle in-use hugetlb pages alloc_contig_range() will fail if it finds a HugeTLB page within the range, without a chance to handle them. Since HugeTLB pages can be migrated as any LRU or Movable page, it does not make sense to bail out without trying. Enable the interface to recognize in-use HugeTLB pages so we can migrate them, and have much better chances to succeed the call. Link: https://lkml.kernel.org/r/20210419075413.1064-7-osalvador@suse.de Signed-off-by: Oscar Salvador <osalvador@suse.de> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Acked-by: Michal Hocko <mhocko@suse.com> Acked-by: David Hildenbrand <david@redhat.com> Cc: Muchun Song <songmuchun@bytedance.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/hugetlb.h | 5 +++-- mm/compaction.c | 12 +++++++++++- mm/hugetlb.c | 22 +++++++++++++++++----- mm/vmscan.c | 5 +++-- 4 files changed, 34 insertions(+), 10 deletions(-) --- a/include/linux/hugetlb.h~mm-make-alloc_contig_range-handle-in-use-hugetlb-pages +++ a/include/linux/hugetlb.h @@ -588,7 +588,7 @@ struct huge_bootmem_page { struct hstate *hstate; }; -int isolate_or_dissolve_huge_page(struct page *page); +int isolate_or_dissolve_huge_page(struct page *page, struct list_head *list); struct page *alloc_huge_page(struct vm_area_struct *vma, unsigned long addr, int avoid_reserve); struct page *alloc_huge_page_nodemask(struct hstate *h, int preferred_nid, @@ -871,7 +871,8 @@ static inline void huge_ptep_modify_prot #else /* CONFIG_HUGETLB_PAGE */ struct hstate {}; -static inline int isolate_or_dissolve_huge_page(struct page *page) +static inline int isolate_or_dissolve_huge_page(struct page *page, + struct list_head *list) { return -ENOMEM; } --- a/mm/compaction.c~mm-make-alloc_contig_range-handle-in-use-hugetlb-pages +++ a/mm/compaction.c @@ -907,7 +907,7 @@ isolate_migratepages_block(struct compac } if (PageHuge(page) && cc->alloc_contig) { - ret = isolate_or_dissolve_huge_page(page); + ret = isolate_or_dissolve_huge_page(page, &cc->migratepages); /* * Fail isolation in case isolate_or_dissolve_huge_page() @@ -921,6 +921,15 @@ isolate_migratepages_block(struct compac goto isolate_fail; } + if (PageHuge(page)) { + /* + * Hugepage was successfully isolated and placed + * on the cc->migratepages list. + */ + low_pfn += compound_nr(page) - 1; + goto isolate_success_no_list; + } + /* * Ok, the hugepage was dissolved. Now these pages are * Buddy and cannot be re-allocated because they are @@ -1062,6 +1071,7 @@ isolate_migratepages_block(struct compac isolate_success: list_add(&page->lru, &cc->migratepages); +isolate_success_no_list: cc->nr_migratepages += compound_nr(page); nr_isolated += compound_nr(page); --- a/mm/hugetlb.c~mm-make-alloc_contig_range-handle-in-use-hugetlb-pages +++ a/mm/hugetlb.c @@ -2271,9 +2271,11 @@ static void restore_reserve_on_error(str * alloc_and_dissolve_huge_page - Allocate a new page and dissolve the old one * @h: struct hstate old page belongs to * @old_page: Old page to dissolve + * @list: List to isolate the page in case we need to * Returns 0 on success, otherwise negated error. */ -static int alloc_and_dissolve_huge_page(struct hstate *h, struct page *old_page) +static int alloc_and_dissolve_huge_page(struct hstate *h, struct page *old_page, + struct list_head *list) { gfp_t gfp_mask = htlb_alloc_mask(h) | __GFP_THISNODE; int nid = page_to_nid(old_page); @@ -2300,9 +2302,13 @@ retry: goto free_new; } else if (page_count(old_page)) { /* - * Someone has grabbed the page, fail for now. + * Someone has grabbed the page, try to isolate it here. + * Fail with -EBUSY if not possible. */ - ret = -EBUSY; + spin_unlock_irq(&hugetlb_lock); + if (!isolate_huge_page(old_page, list)) + ret = -EBUSY; + spin_lock_irq(&hugetlb_lock); goto free_new; } else if (!HPageFreed(old_page)) { /* @@ -2352,10 +2358,11 @@ free_new: return ret; } -int isolate_or_dissolve_huge_page(struct page *page) +int isolate_or_dissolve_huge_page(struct page *page, struct list_head *list) { struct hstate *h; struct page *head; + int ret = -EBUSY; /* * The page might have been dissolved from under our feet, so make sure @@ -2380,7 +2387,12 @@ int isolate_or_dissolve_huge_page(struct if (hstate_is_gigantic(h)) return -ENOMEM; - return alloc_and_dissolve_huge_page(h, head); + if (page_count(head) && isolate_huge_page(head, list)) + ret = 0; + else if (!page_count(head)) + ret = alloc_and_dissolve_huge_page(h, head, list); + + return ret; } struct page *alloc_huge_page(struct vm_area_struct *vma, --- a/mm/vmscan.c~mm-make-alloc_contig_range-handle-in-use-hugetlb-pages +++ a/mm/vmscan.c @@ -1507,8 +1507,9 @@ unsigned int reclaim_clean_pages_from_li LIST_HEAD(clean_pages); list_for_each_entry_safe(page, next, page_list, lru) { - if (page_is_file_lru(page) && !PageDirty(page) && - !__PageMovable(page) && !PageUnevictable(page)) { + if (!PageHuge(page) && page_is_file_lru(page) && + !PageDirty(page) && !__PageMovable(page) && + !PageUnevictable(page)) { ClearPageActive(page); list_move(&page->lru, &clean_pages); } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 053/143] mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig 2021-05-05 1:32 incoming Andrew Morton ` (51 preceding siblings ...) 2021-05-05 1:35 ` [patch 052/143] mm: make alloc_contig_range handle in-use " Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:35 ` [patch 054/143] userfaultfd: add minor fault registration mode Andrew Morton ` (87 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits, osalvador, songmuchun, torvalds, vbabka From: Oscar Salvador <osalvador@suse.de> Subject: mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig pfn_range_valid_contig() bails out when it finds an in-use page or a hugetlb page, among other things. We can drop the in-use page check since __alloc_contig_pages can migrate away those pages, and the hugetlb page check can go too since isolate_migratepages_range is now capable of dealing with hugetlb pages. Either way, those checks are racy so let the end function handle it when the time comes. Link: https://lkml.kernel.org/r/20210419075413.1064-8-osalvador@suse.de Signed-off-by: Oscar Salvador <osalvador@suse.de> Suggested-by: David Hildenbrand <david@redhat.com> Reviewed-by: David Hildenbrand <david@redhat.com> Acked-by: Mike Kravetz <mike.kravetz@oracle.com> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Muchun Song <songmuchun@bytedance.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 6 ------ 1 file changed, 6 deletions(-) --- a/mm/page_alloc.c~mmpage_alloc-drop-unnecessary-checks-from-pfn_range_valid_contig +++ a/mm/page_alloc.c @@ -8898,12 +8898,6 @@ static bool pfn_range_valid_contig(struc if (PageReserved(page)) return false; - - if (page_count(page) > 0) - return false; - - if (PageHuge(page)) - return false; } return true; } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 054/143] userfaultfd: add minor fault registration mode 2021-05-05 1:32 incoming Andrew Morton ` (52 preceding siblings ...) 2021-05-05 1:35 ` [patch 053/143] mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:35 ` [patch 055/143] userfaultfd: disable huge PMD sharing for MINOR registered VMAs Andrew Morton ` (86 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual, axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang, dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra, mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton, peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli, steven.price, torvalds, vbabka, viro, walken, willy, ying.huang From: Axel Rasmussen <axelrasmussen@google.com> Subject: userfaultfd: add minor fault registration mode Patch series "userfaultfd: add minor fault handling", v9. Overview ======== This series adds a new userfaultfd feature, UFFD_FEATURE_MINOR_HUGETLBFS. When enabled (via the UFFDIO_API ioctl), this feature means that any hugetlbfs VMAs registered with UFFDIO_REGISTER_MODE_MISSING will *also* get events for "minor" faults. By "minor" fault, I mean the following situation: Let there exist two mappings (i.e., VMAs) to the same page(s) (shared memory). One of the mappings is registered with userfaultfd (in minor mode), and the other is not. Via the non-UFFD mapping, the underlying pages have already been allocated & filled with some contents. The UFFD mapping has not yet been faulted in; when it is touched for the first time, this results in what I'm calling a "minor" fault. As a concrete example, when working with hugetlbfs, we have huge_pte_none(), but find_lock_page() finds an existing page. We also add a new ioctl to resolve such faults: UFFDIO_CONTINUE. The idea is, userspace resolves the fault by either a) doing nothing if the contents are already correct, or b) updating the underlying contents using the second, non-UFFD mapping (via memcpy/memset or similar, or something fancier like RDMA, or etc...). In either case, userspace issues UFFDIO_CONTINUE to tell the kernel "I have ensured the page contents are correct, carry on setting up the mapping". Use Case ======== Consider the use case of VM live migration (e.g. under QEMU/KVM): 1. While a VM is still running, we copy the contents of its memory to a target machine. The pages are populated on the target by writing to the non-UFFD mapping, using the setup described above. The VM is still running (and therefore its memory is likely changing), so this may be repeated several times, until we decide the target is "up to date enough". 2. We pause the VM on the source, and start executing on the target machine. During this gap, the VM's user(s) will *see* a pause, so it is desirable to minimize this window. 3. Between the last time any page was copied from the source to the target, and when the VM was paused, the contents of that page may have changed - and therefore the copy we have on the target machine is out of date. Although we can keep track of which pages are out of date, for VMs with large amounts of memory, it is "slow" to transfer this information to the target machine. We want to resume execution before such a transfer would complete. 4. So, the guest begins executing on the target machine. The first time it touches its memory (via the UFFD-registered mapping), userspace wants to intercept this fault. Userspace checks whether or not the page is up to date, and if not, copies the updated page from the source machine, via the non-UFFD mapping. Finally, whether a copy was performed or not, userspace issues a UFFDIO_CONTINUE ioctl to tell the kernel "I have ensured the page contents are correct, carry on setting up the mapping". We don't have to do all of the final updates on-demand. The userfaultfd manager can, in the background, also copy over updated pages once it receives the map of which pages are up-to-date or not. Interaction with Existing APIs ============================== Because this is a feature, a registered VMA could potentially receive both missing and minor faults. I spent some time thinking through how the existing API interacts with the new feature: UFFDIO_CONTINUE cannot be used to resolve non-minor faults, as it does not allocate a new page. If UFFDIO_CONTINUE is used on a non-minor fault: - For non-shared memory or shmem, -EINVAL is returned. - For hugetlb, -EFAULT is returned. UFFDIO_COPY and UFFDIO_ZEROPAGE cannot be used to resolve minor faults. Without modifications, the existing codepath assumes a new page needs to be allocated. This is okay, since userspace must have a second non-UFFD-registered mapping anyway, thus there isn't much reason to want to use these in any case (just memcpy or memset or similar). - If UFFDIO_COPY is used on a minor fault, -EEXIST is returned. - If UFFDIO_ZEROPAGE is used on a minor fault, -EEXIST is returned (or -EINVAL in the case of hugetlb, as UFFDIO_ZEROPAGE is unsupported in any case). - UFFDIO_WRITEPROTECT simply doesn't work with shared memory, and returns -ENOENT in that case (regardless of the kind of fault). Future Work =========== This series only supports hugetlbfs. I have a second series in flight to support shmem as well, extending the functionality. This series is more mature than the shmem support at this point, and the functionality works fully on hugetlbfs, so this series can be merged first and then shmem support will follow. This patch (of 6): This feature allows userspace to intercept "minor" faults. By "minor" faults, I mean the following situation: Let there exist two mappings (i.e., VMAs) to the same page(s). One of the mappings is registered with userfaultfd (in minor mode), and the other is not. Via the non-UFFD mapping, the underlying pages have already been allocated & filled with some contents. The UFFD mapping has not yet been faulted in; when it is touched for the first time, this results in what I'm calling a "minor" fault. As a concrete example, when working with hugetlbfs, we have huge_pte_none(), but find_lock_page() finds an existing page. This commit adds the new registration mode, and sets the relevant flag on the VMAs being registered. In the hugetlb fault path, if we find that we have huge_pte_none(), but find_lock_page() does indeed find an existing page, then we have a "minor" fault, and if the VMA has the userfaultfd registration flag, we call into userfaultfd to handle it. This is implemented as a new registration mode, instead of an API feature. This is because the alternative implementation has significant drawbacks [1]. However, doing it this was requires we allocate a VM_* flag for the new registration mode. On 32-bit systems, there are no unused bits, so this feature is only supported on architectures with CONFIG_ARCH_USES_HIGH_VMA_FLAGS. When attempting to register a VMA in MINOR mode on 32-bit architectures, we return -EINVAL. [1] https://lore.kernel.org/patchwork/patch/1380226/ [peterx@redhat.com: fix minor fault page leak] Link: https://lkml.kernel.org/r/20210322175132.36659-1-peterx@redhat.com Link: https://lkml.kernel.org/r/20210301222728.176417-1-axelrasmussen@google.com Link: https://lkml.kernel.org/r/20210301222728.176417-2-axelrasmussen@google.com Signed-off-by: Axel Rasmussen <axelrasmussen@google.com> Reviewed-by: Peter Xu <peterx@redhat.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Chinwen Chang <chinwen.chang@mediatek.com> Cc: Huang Ying <ying.huang@intel.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jann Horn <jannh@google.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Lokesh Gidra <lokeshgidra@google.com> Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: "Michal Koutn" <mkoutny@suse.com> Cc: Michel Lespinasse <walken@google.com> Cc: Mike Rapoport <rppt@linux.vnet.ibm.com> Cc: Nicholas Piggin <npiggin@gmail.com> Cc: Peter Xu <peterx@redhat.com> Cc: Shaohua Li <shli@fb.com> Cc: Shawn Anastasio <shawn@anastas.io> Cc: Steven Rostedt <rostedt@goodmis.org> Cc: Steven Price <steven.price@arm.com> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Adam Ruprecht <ruprecht@google.com> Cc: Axel Rasmussen <axelrasmussen@google.com> Cc: Cannon Matthews <cannonmatthews@google.com> Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Mina Almasry <almasrymina@google.com> Cc: Oliver Upton <oupton@google.com> Cc: Kirill A. Shutemov <kirill@shutemov.name> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm64/Kconfig | 1 arch/x86/Kconfig | 1 fs/proc/task_mmu.c | 3 + fs/userfaultfd.c | 78 +++++++++++++++++----------- include/linux/mm.h | 7 ++ include/linux/userfaultfd_k.h | 15 +++++ include/trace/events/mmflags.h | 7 ++ include/uapi/linux/userfaultfd.h | 15 ++++- init/Kconfig | 5 + mm/hugetlb.c | 80 ++++++++++++++++++----------- 10 files changed, 150 insertions(+), 62 deletions(-) --- a/arch/arm64/Kconfig~userfaultfd-add-minor-fault-registration-mode +++ a/arch/arm64/Kconfig @@ -213,6 +213,7 @@ config ARM64 select SWIOTLB select SYSCTL_EXCEPTION_TRACE select THREAD_INFO_IN_TASK + select HAVE_ARCH_USERFAULTFD_MINOR if USERFAULTFD help ARM 64-bit (AArch64) Linux support. --- a/arch/x86/Kconfig~userfaultfd-add-minor-fault-registration-mode +++ a/arch/x86/Kconfig @@ -165,6 +165,7 @@ config X86 select HAVE_ARCH_TRANSPARENT_HUGEPAGE select HAVE_ARCH_TRANSPARENT_HUGEPAGE_PUD if X86_64 select HAVE_ARCH_USERFAULTFD_WP if X86_64 && USERFAULTFD + select HAVE_ARCH_USERFAULTFD_MINOR if X86_64 && USERFAULTFD select HAVE_ARCH_VMAP_STACK if X86_64 select HAVE_ARCH_RANDOMIZE_KSTACK_OFFSET select HAVE_ARCH_WITHIN_STACK_FRAMES --- a/fs/proc/task_mmu.c~userfaultfd-add-minor-fault-registration-mode +++ a/fs/proc/task_mmu.c @@ -661,6 +661,9 @@ static void show_smap_vma_flags(struct s [ilog2(VM_PKEY_BIT4)] = "", #endif #endif /* CONFIG_ARCH_HAS_PKEYS */ +#ifdef CONFIG_HAVE_ARCH_USERFAULTFD_MINOR + [ilog2(VM_UFFD_MINOR)] = "ui", +#endif /* CONFIG_HAVE_ARCH_USERFAULTFD_MINOR */ }; size_t i; --- a/fs/userfaultfd.c~userfaultfd-add-minor-fault-registration-mode +++ a/fs/userfaultfd.c @@ -197,24 +197,21 @@ static inline struct uffd_msg userfault_ msg_init(&msg); msg.event = UFFD_EVENT_PAGEFAULT; msg.arg.pagefault.address = address; + /* + * These flags indicate why the userfault occurred: + * - UFFD_PAGEFAULT_FLAG_WP indicates a write protect fault. + * - UFFD_PAGEFAULT_FLAG_MINOR indicates a minor fault. + * - Neither of these flags being set indicates a MISSING fault. + * + * Separately, UFFD_PAGEFAULT_FLAG_WRITE indicates it was a write + * fault. Otherwise, it was a read fault. + */ if (flags & FAULT_FLAG_WRITE) - /* - * If UFFD_FEATURE_PAGEFAULT_FLAG_WP was set in the - * uffdio_api.features and UFFD_PAGEFAULT_FLAG_WRITE - * was not set in a UFFD_EVENT_PAGEFAULT, it means it - * was a read fault, otherwise if set it means it's - * a write fault. - */ msg.arg.pagefault.flags |= UFFD_PAGEFAULT_FLAG_WRITE; if (reason & VM_UFFD_WP) - /* - * If UFFD_FEATURE_PAGEFAULT_FLAG_WP was set in the - * uffdio_api.features and UFFD_PAGEFAULT_FLAG_WP was - * not set in a UFFD_EVENT_PAGEFAULT, it means it was - * a missing fault, otherwise if set it means it's a - * write protect fault. - */ msg.arg.pagefault.flags |= UFFD_PAGEFAULT_FLAG_WP; + if (reason & VM_UFFD_MINOR) + msg.arg.pagefault.flags |= UFFD_PAGEFAULT_FLAG_MINOR; if (features & UFFD_FEATURE_THREAD_ID) msg.arg.pagefault.feat.ptid = task_pid_vnr(current); return msg; @@ -401,8 +398,10 @@ vm_fault_t handle_userfault(struct vm_fa BUG_ON(ctx->mm != mm); - VM_BUG_ON(reason & ~(VM_UFFD_MISSING|VM_UFFD_WP)); - VM_BUG_ON(!(reason & VM_UFFD_MISSING) ^ !!(reason & VM_UFFD_WP)); + /* Any unrecognized flag is a bug. */ + VM_BUG_ON(reason & ~__VM_UFFD_FLAGS); + /* 0 or > 1 flags set is a bug; we expect exactly 1. */ + VM_BUG_ON(!reason || (reason & (reason - 1))); if (ctx->features & UFFD_FEATURE_SIGBUS) goto out; @@ -612,7 +611,7 @@ static void userfaultfd_event_wait_compl for (vma = mm->mmap; vma; vma = vma->vm_next) if (vma->vm_userfaultfd_ctx.ctx == release_new_ctx) { vma->vm_userfaultfd_ctx = NULL_VM_UFFD_CTX; - vma->vm_flags &= ~(VM_UFFD_WP | VM_UFFD_MISSING); + vma->vm_flags &= ~__VM_UFFD_FLAGS; } mmap_write_unlock(mm); @@ -644,7 +643,7 @@ int dup_userfaultfd(struct vm_area_struc octx = vma->vm_userfaultfd_ctx.ctx; if (!octx || !(octx->features & UFFD_FEATURE_EVENT_FORK)) { vma->vm_userfaultfd_ctx = NULL_VM_UFFD_CTX; - vma->vm_flags &= ~(VM_UFFD_WP | VM_UFFD_MISSING); + vma->vm_flags &= ~__VM_UFFD_FLAGS; return 0; } @@ -726,7 +725,7 @@ void mremap_userfaultfd_prep(struct vm_a } else { /* Drop uffd context if remap feature not enabled */ vma->vm_userfaultfd_ctx = NULL_VM_UFFD_CTX; - vma->vm_flags &= ~(VM_UFFD_WP | VM_UFFD_MISSING); + vma->vm_flags &= ~__VM_UFFD_FLAGS; } } @@ -867,12 +866,12 @@ static int userfaultfd_release(struct in for (vma = mm->mmap; vma; vma = vma->vm_next) { cond_resched(); BUG_ON(!!vma->vm_userfaultfd_ctx.ctx ^ - !!(vma->vm_flags & (VM_UFFD_MISSING | VM_UFFD_WP))); + !!(vma->vm_flags & __VM_UFFD_FLAGS)); if (vma->vm_userfaultfd_ctx.ctx != ctx) { prev = vma; continue; } - new_flags = vma->vm_flags & ~(VM_UFFD_MISSING | VM_UFFD_WP); + new_flags = vma->vm_flags & ~__VM_UFFD_FLAGS; prev = vma_merge(mm, prev, vma->vm_start, vma->vm_end, new_flags, vma->anon_vma, vma->vm_file, vma->vm_pgoff, @@ -1262,9 +1261,19 @@ static inline bool vma_can_userfault(str unsigned long vm_flags) { /* FIXME: add WP support to hugetlbfs and shmem */ - return vma_is_anonymous(vma) || - ((is_vm_hugetlb_page(vma) || vma_is_shmem(vma)) && - !(vm_flags & VM_UFFD_WP)); + if (vm_flags & VM_UFFD_WP) { + if (is_vm_hugetlb_page(vma) || vma_is_shmem(vma)) + return false; + } + + if (vm_flags & VM_UFFD_MINOR) { + /* FIXME: Add minor fault interception for shmem. */ + if (!is_vm_hugetlb_page(vma)) + return false; + } + + return vma_is_anonymous(vma) || is_vm_hugetlb_page(vma) || + vma_is_shmem(vma); } static int userfaultfd_register(struct userfaultfd_ctx *ctx, @@ -1290,14 +1299,19 @@ static int userfaultfd_register(struct u ret = -EINVAL; if (!uffdio_register.mode) goto out; - if (uffdio_register.mode & ~(UFFDIO_REGISTER_MODE_MISSING| - UFFDIO_REGISTER_MODE_WP)) + if (uffdio_register.mode & ~UFFD_API_REGISTER_MODES) goto out; vm_flags = 0; if (uffdio_register.mode & UFFDIO_REGISTER_MODE_MISSING) vm_flags |= VM_UFFD_MISSING; if (uffdio_register.mode & UFFDIO_REGISTER_MODE_WP) vm_flags |= VM_UFFD_WP; + if (uffdio_register.mode & UFFDIO_REGISTER_MODE_MINOR) { +#ifndef CONFIG_HAVE_ARCH_USERFAULTFD_MINOR + goto out; +#endif + vm_flags |= VM_UFFD_MINOR; + } ret = validate_range(mm, &uffdio_register.range.start, uffdio_register.range.len); @@ -1341,7 +1355,7 @@ static int userfaultfd_register(struct u cond_resched(); BUG_ON(!!cur->vm_userfaultfd_ctx.ctx ^ - !!(cur->vm_flags & (VM_UFFD_MISSING | VM_UFFD_WP))); + !!(cur->vm_flags & __VM_UFFD_FLAGS)); /* check not compatible vmas */ ret = -EINVAL; @@ -1421,8 +1435,7 @@ static int userfaultfd_register(struct u start = vma->vm_start; vma_end = min(end, vma->vm_end); - new_flags = (vma->vm_flags & - ~(VM_UFFD_MISSING|VM_UFFD_WP)) | vm_flags; + new_flags = (vma->vm_flags & ~__VM_UFFD_FLAGS) | vm_flags; prev = vma_merge(mm, prev, start, vma_end, new_flags, vma->anon_vma, vma->vm_file, vma->vm_pgoff, vma_policy(vma), @@ -1544,7 +1557,7 @@ static int userfaultfd_unregister(struct cond_resched(); BUG_ON(!!cur->vm_userfaultfd_ctx.ctx ^ - !!(cur->vm_flags & (VM_UFFD_MISSING | VM_UFFD_WP))); + !!(cur->vm_flags & __VM_UFFD_FLAGS)); /* * Check not compatible vmas, not strictly required @@ -1595,7 +1608,7 @@ static int userfaultfd_unregister(struct wake_userfault(vma->vm_userfaultfd_ctx.ctx, &range); } - new_flags = vma->vm_flags & ~(VM_UFFD_MISSING | VM_UFFD_WP); + new_flags = vma->vm_flags & ~__VM_UFFD_FLAGS; prev = vma_merge(mm, prev, start, vma_end, new_flags, vma->anon_vma, vma->vm_file, vma->vm_pgoff, vma_policy(vma), @@ -1863,6 +1876,9 @@ static int userfaultfd_api(struct userfa goto err_out; /* report all available features and ioctls to userland */ uffdio_api.features = UFFD_API_FEATURES; +#ifndef CONFIG_HAVE_ARCH_USERFAULTFD_MINOR + uffdio_api.features &= ~UFFD_FEATURE_MINOR_HUGETLBFS; +#endif uffdio_api.ioctls = UFFD_API_IOCTLS; ret = -EFAULT; if (copy_to_user(buf, &uffdio_api, sizeof(uffdio_api))) --- a/include/linux/mm.h~userfaultfd-add-minor-fault-registration-mode +++ a/include/linux/mm.h @@ -372,6 +372,13 @@ extern unsigned int kobjsize(const void # define VM_GROWSUP VM_NONE #endif +#ifdef CONFIG_HAVE_ARCH_USERFAULTFD_MINOR +# define VM_UFFD_MINOR_BIT 37 +# define VM_UFFD_MINOR BIT(VM_UFFD_MINOR_BIT) /* UFFD minor faults */ +#else /* !CONFIG_HAVE_ARCH_USERFAULTFD_MINOR */ +# define VM_UFFD_MINOR VM_NONE +#endif /* CONFIG_HAVE_ARCH_USERFAULTFD_MINOR */ + /* Bits set in the VMA until the stack is in its final location */ #define VM_STACK_INCOMPLETE_SETUP (VM_RAND_READ | VM_SEQ_READ) --- a/include/linux/userfaultfd_k.h~userfaultfd-add-minor-fault-registration-mode +++ a/include/linux/userfaultfd_k.h @@ -17,6 +17,9 @@ #include <linux/mm.h> #include <asm-generic/pgtable_uffd.h> +/* The set of all possible UFFD-related VM flags. */ +#define __VM_UFFD_FLAGS (VM_UFFD_MISSING | VM_UFFD_WP | VM_UFFD_MINOR) + /* * CAREFUL: Check include/uapi/asm-generic/fcntl.h when defining * new flags, since they might collide with O_* ones. We want @@ -71,6 +74,11 @@ static inline bool userfaultfd_wp(struct return vma->vm_flags & VM_UFFD_WP; } +static inline bool userfaultfd_minor(struct vm_area_struct *vma) +{ + return vma->vm_flags & VM_UFFD_MINOR; +} + static inline bool userfaultfd_pte_wp(struct vm_area_struct *vma, pte_t pte) { @@ -85,7 +93,7 @@ static inline bool userfaultfd_huge_pmd_ static inline bool userfaultfd_armed(struct vm_area_struct *vma) { - return vma->vm_flags & (VM_UFFD_MISSING | VM_UFFD_WP); + return vma->vm_flags & __VM_UFFD_FLAGS; } extern int dup_userfaultfd(struct vm_area_struct *, struct list_head *); @@ -131,6 +139,11 @@ static inline bool userfaultfd_wp(struct { return false; } + +static inline bool userfaultfd_minor(struct vm_area_struct *vma) +{ + return false; +} static inline bool userfaultfd_pte_wp(struct vm_area_struct *vma, pte_t pte) --- a/include/trace/events/mmflags.h~userfaultfd-add-minor-fault-registration-mode +++ a/include/trace/events/mmflags.h @@ -137,6 +137,12 @@ IF_HAVE_PG_ARCH_2(PG_arch_2, "arch_2" ) #define IF_HAVE_VM_SOFTDIRTY(flag,name) #endif +#ifdef CONFIG_HAVE_ARCH_USERFAULTFD_MINOR +# define IF_HAVE_UFFD_MINOR(flag, name) {flag, name}, +#else +# define IF_HAVE_UFFD_MINOR(flag, name) +#endif + #define __def_vmaflag_names \ {VM_READ, "read" }, \ {VM_WRITE, "write" }, \ @@ -148,6 +154,7 @@ IF_HAVE_PG_ARCH_2(PG_arch_2, "arch_2" ) {VM_MAYSHARE, "mayshare" }, \ {VM_GROWSDOWN, "growsdown" }, \ {VM_UFFD_MISSING, "uffd_missing" }, \ +IF_HAVE_UFFD_MINOR(VM_UFFD_MINOR, "uffd_minor" ) \ {VM_PFNMAP, "pfnmap" }, \ {VM_DENYWRITE, "denywrite" }, \ {VM_UFFD_WP, "uffd_wp" }, \ --- a/include/uapi/linux/userfaultfd.h~userfaultfd-add-minor-fault-registration-mode +++ a/include/uapi/linux/userfaultfd.h @@ -19,15 +19,19 @@ * means the userland is reading). */ #define UFFD_API ((__u64)0xAA) +#define UFFD_API_REGISTER_MODES (UFFDIO_REGISTER_MODE_MISSING | \ + UFFDIO_REGISTER_MODE_WP | \ + UFFDIO_REGISTER_MODE_MINOR) #define UFFD_API_FEATURES (UFFD_FEATURE_PAGEFAULT_FLAG_WP | \ UFFD_FEATURE_EVENT_FORK | \ UFFD_FEATURE_EVENT_REMAP | \ - UFFD_FEATURE_EVENT_REMOVE | \ + UFFD_FEATURE_EVENT_REMOVE | \ UFFD_FEATURE_EVENT_UNMAP | \ UFFD_FEATURE_MISSING_HUGETLBFS | \ UFFD_FEATURE_MISSING_SHMEM | \ UFFD_FEATURE_SIGBUS | \ - UFFD_FEATURE_THREAD_ID) + UFFD_FEATURE_THREAD_ID | \ + UFFD_FEATURE_MINOR_HUGETLBFS) #define UFFD_API_IOCTLS \ ((__u64)1 << _UFFDIO_REGISTER | \ (__u64)1 << _UFFDIO_UNREGISTER | \ @@ -127,6 +131,7 @@ struct uffd_msg { /* flags for UFFD_EVENT_PAGEFAULT */ #define UFFD_PAGEFAULT_FLAG_WRITE (1<<0) /* If this was a write fault */ #define UFFD_PAGEFAULT_FLAG_WP (1<<1) /* If reason is VM_UFFD_WP */ +#define UFFD_PAGEFAULT_FLAG_MINOR (1<<2) /* If reason is VM_UFFD_MINOR */ struct uffdio_api { /* userland asks for an API number and the features to enable */ @@ -171,6 +176,10 @@ struct uffdio_api { * * UFFD_FEATURE_THREAD_ID pid of the page faulted task_struct will * be returned, if feature is not requested 0 will be returned. + * + * UFFD_FEATURE_MINOR_HUGETLBFS indicates that minor faults + * can be intercepted (via REGISTER_MODE_MINOR) for + * hugetlbfs-backed pages. */ #define UFFD_FEATURE_PAGEFAULT_FLAG_WP (1<<0) #define UFFD_FEATURE_EVENT_FORK (1<<1) @@ -181,6 +190,7 @@ struct uffdio_api { #define UFFD_FEATURE_EVENT_UNMAP (1<<6) #define UFFD_FEATURE_SIGBUS (1<<7) #define UFFD_FEATURE_THREAD_ID (1<<8) +#define UFFD_FEATURE_MINOR_HUGETLBFS (1<<9) __u64 features; __u64 ioctls; @@ -195,6 +205,7 @@ struct uffdio_register { struct uffdio_range range; #define UFFDIO_REGISTER_MODE_MISSING ((__u64)1<<0) #define UFFDIO_REGISTER_MODE_WP ((__u64)1<<1) +#define UFFDIO_REGISTER_MODE_MINOR ((__u64)1<<2) __u64 mode; /* --- a/init/Kconfig~userfaultfd-add-minor-fault-registration-mode +++ a/init/Kconfig @@ -1644,6 +1644,11 @@ config HAVE_ARCH_USERFAULTFD_WP help Arch has userfaultfd write protection support +config HAVE_ARCH_USERFAULTFD_MINOR + bool + help + Arch has userfaultfd minor fault support + config MEMBARRIER bool "Enable membarrier() system call" if EXPERT default y --- a/mm/hugetlb.c~userfaultfd-add-minor-fault-registration-mode +++ a/mm/hugetlb.c @@ -4469,6 +4469,44 @@ int huge_add_to_page_cache(struct page * return 0; } +static inline vm_fault_t hugetlb_handle_userfault(struct vm_area_struct *vma, + struct address_space *mapping, + pgoff_t idx, + unsigned int flags, + unsigned long haddr, + unsigned long reason) +{ + vm_fault_t ret; + u32 hash; + struct vm_fault vmf = { + .vma = vma, + .address = haddr, + .flags = flags, + + /* + * Hard to debug if it ends up being + * used by a callee that assumes + * something about the other + * uninitialized fields... same as in + * memory.c + */ + }; + + /* + * hugetlb_fault_mutex and i_mmap_rwsem must be + * dropped before handling userfault. Reacquire + * after handling fault to make calling code simpler. + */ + hash = hugetlb_fault_mutex_hash(mapping, idx); + mutex_unlock(&hugetlb_fault_mutex_table[hash]); + i_mmap_unlock_read(mapping); + ret = handle_userfault(&vmf, reason); + i_mmap_lock_read(mapping); + mutex_lock(&hugetlb_fault_mutex_table[hash]); + + return ret; +} + static vm_fault_t hugetlb_no_page(struct mm_struct *mm, struct vm_area_struct *vma, struct address_space *mapping, pgoff_t idx, @@ -4507,35 +4545,11 @@ static vm_fault_t hugetlb_no_page(struct retry: page = find_lock_page(mapping, idx); if (!page) { - /* - * Check for page in userfault range - */ + /* Check for page in userfault range */ if (userfaultfd_missing(vma)) { - u32 hash; - struct vm_fault vmf = { - .vma = vma, - .address = haddr, - .flags = flags, - /* - * Hard to debug if it ends up being - * used by a callee that assumes - * something about the other - * uninitialized fields... same as in - * memory.c - */ - }; - - /* - * hugetlb_fault_mutex and i_mmap_rwsem must be - * dropped before handling userfault. Reacquire - * after handling fault to make calling code simpler. - */ - hash = hugetlb_fault_mutex_hash(mapping, idx); - mutex_unlock(&hugetlb_fault_mutex_table[hash]); - i_mmap_unlock_read(mapping); - ret = handle_userfault(&vmf, VM_UFFD_MISSING); - i_mmap_lock_read(mapping); - mutex_lock(&hugetlb_fault_mutex_table[hash]); + ret = hugetlb_handle_userfault(vma, mapping, idx, + flags, haddr, + VM_UFFD_MISSING); goto out; } @@ -4591,6 +4605,16 @@ retry: VM_FAULT_SET_HINDEX(hstate_index(h)); goto backout_unlocked; } + + /* Check for page in userfault range. */ + if (userfaultfd_minor(vma)) { + unlock_page(page); + put_page(page); + ret = hugetlb_handle_userfault(vma, mapping, idx, + flags, haddr, + VM_UFFD_MINOR); + goto out; + } } /* _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 055/143] userfaultfd: disable huge PMD sharing for MINOR registered VMAs 2021-05-05 1:32 incoming Andrew Morton ` (53 preceding siblings ...) 2021-05-05 1:35 ` [patch 054/143] userfaultfd: add minor fault registration mode Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:35 ` [patch 056/143] userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled Andrew Morton ` (85 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual, axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang, dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra, mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton, peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli, steven.price, torvalds, vbabka, viro, walken, willy, ying.huang From: Axel Rasmussen <axelrasmussen@google.com> Subject: userfaultfd: disable huge PMD sharing for MINOR registered VMAs As the comment says: for the MINOR fault use case, although the page might be present and populated in the other (non-UFFD-registered) half of the mapping, it may be out of date, and we explicitly want userspace to get a minor fault so it can check and potentially update the page's contents. Huge PMD sharing would prevent these faults from occurring for suitably aligned areas, so disable it upon UFFD registration. Link: https://lkml.kernel.org/r/20210301222728.176417-3-axelrasmussen@google.com Signed-off-by: Axel Rasmussen <axelrasmussen@google.com> Reviewed-by: Peter Xu <peterx@redhat.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Adam Ruprecht <ruprecht@google.com> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Cannon Matthews <cannonmatthews@google.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Chinwen Chang <chinwen.chang@mediatek.com> Cc: David Rientjes <rientjes@google.com> Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com> Cc: Huang Ying <ying.huang@intel.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jann Horn <jannh@google.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Kirill A. Shutemov <kirill@shutemov.name> Cc: Lokesh Gidra <lokeshgidra@google.com> Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: "Michal Koutn" <mkoutny@suse.com> Cc: Michel Lespinasse <walken@google.com> Cc: Mike Rapoport <rppt@linux.vnet.ibm.com> Cc: Mina Almasry <almasrymina@google.com> Cc: Nicholas Piggin <npiggin@gmail.com> Cc: Oliver Upton <oupton@google.com> Cc: Shaohua Li <shli@fb.com> Cc: Shawn Anastasio <shawn@anastas.io> Cc: Steven Price <steven.price@arm.com> Cc: Steven Rostedt <rostedt@goodmis.org> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/userfaultfd_k.h | 13 ++++++++++--- 1 file changed, 10 insertions(+), 3 deletions(-) --- a/include/linux/userfaultfd_k.h~userfaultfd-disable-huge-pmd-sharing-for-minor-registered-vmas +++ a/include/linux/userfaultfd_k.h @@ -56,12 +56,19 @@ static inline bool is_mergeable_vm_userf } /* - * Never enable huge pmd sharing on uffd-wp registered vmas, because uffd-wp - * protect information is per pgtable entry. + * Never enable huge pmd sharing on some uffd registered vmas: + * + * - VM_UFFD_WP VMAs, because write protect information is per pgtable entry. + * + * - VM_UFFD_MINOR VMAs, because otherwise we would never get minor faults for + * VMAs which share huge pmds. (If you have two mappings to the same + * underlying pages, and fault in the non-UFFD-registered one with a write, + * with huge pmd sharing this would *also* setup the second UFFD-registered + * mapping, and we'd not get minor faults.) */ static inline bool uffd_disable_huge_pmd_share(struct vm_area_struct *vma) { - return vma->vm_flags & VM_UFFD_WP; + return vma->vm_flags & (VM_UFFD_WP | VM_UFFD_MINOR); } static inline bool userfaultfd_missing(struct vm_area_struct *vma) _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 056/143] userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled 2021-05-05 1:32 incoming Andrew Morton ` (54 preceding siblings ...) 2021-05-05 1:35 ` [patch 055/143] userfaultfd: disable huge PMD sharing for MINOR registered VMAs Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:35 ` [patch 057/143] userfaultfd: add UFFDIO_CONTINUE ioctl Andrew Morton ` (84 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual, axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang, dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra, mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton, peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli, steven.price, torvalds, vbabka, viro, walken, willy, ying.huang From: Axel Rasmussen <axelrasmussen@google.com> Subject: userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled For background, mm/userfaultfd.c provides a general mcopy_atomic implementation. But some types of memory (i.e., hugetlb and shmem) need a slightly different implementation, so they provide their own helpers for this. In other words, userfaultfd is the only caller of these functions. This patch achieves two things: 1. Don't spend time compiling code which will end up never being referenced anyway (a small build time optimization). 2. In patches later in this series, we extend the signature of these helpers with UFFD-specific state (a mode enumeration). Once this happens, we *have to* either not compile the helpers, or unconditionally define the UFFD-only state (which seems messier to me). This includes the declarations in the headers, as otherwise they'd yield warnings about implicitly defining the type of those arguments. Link: https://lkml.kernel.org/r/20210301222728.176417-4-axelrasmussen@google.com Signed-off-by: Axel Rasmussen <axelrasmussen@google.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Reviewed-by: Peter Xu <peterx@redhat.com> Cc: Adam Ruprecht <ruprecht@google.com> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Cannon Matthews <cannonmatthews@google.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Chinwen Chang <chinwen.chang@mediatek.com> Cc: David Rientjes <rientjes@google.com> Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com> Cc: Huang Ying <ying.huang@intel.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jann Horn <jannh@google.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Kirill A. Shutemov <kirill@shutemov.name> Cc: Lokesh Gidra <lokeshgidra@google.com> Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: "Michal Koutn" <mkoutny@suse.com> Cc: Michel Lespinasse <walken@google.com> Cc: Mike Rapoport <rppt@linux.vnet.ibm.com> Cc: Mina Almasry <almasrymina@google.com> Cc: Nicholas Piggin <npiggin@gmail.com> Cc: Oliver Upton <oupton@google.com> Cc: Shaohua Li <shli@fb.com> Cc: Shawn Anastasio <shawn@anastas.io> Cc: Steven Price <steven.price@arm.com> Cc: Steven Rostedt <rostedt@goodmis.org> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/hugetlb.h | 4 ++++ mm/hugetlb.c | 2 ++ 2 files changed, 6 insertions(+) --- a/include/linux/hugetlb.h~userfaultfd-hugetlbfs-only-compile-uffd-helpers-if-config-enabled +++ a/include/linux/hugetlb.h @@ -134,11 +134,13 @@ void hugetlb_show_meminfo(void); unsigned long hugetlb_total_pages(void); vm_fault_t hugetlb_fault(struct mm_struct *mm, struct vm_area_struct *vma, unsigned long address, unsigned int flags); +#ifdef CONFIG_USERFAULTFD int hugetlb_mcopy_atomic_pte(struct mm_struct *dst_mm, pte_t *dst_pte, struct vm_area_struct *dst_vma, unsigned long dst_addr, unsigned long src_addr, struct page **pagep); +#endif /* CONFIG_USERFAULTFD */ bool hugetlb_reserve_pages(struct inode *inode, long from, long to, struct vm_area_struct *vma, vm_flags_t vm_flags); @@ -310,6 +312,7 @@ static inline void hugetlb_free_pgd_rang BUG(); } +#ifdef CONFIG_USERFAULTFD static inline int hugetlb_mcopy_atomic_pte(struct mm_struct *dst_mm, pte_t *dst_pte, struct vm_area_struct *dst_vma, @@ -320,6 +323,7 @@ static inline int hugetlb_mcopy_atomic_p BUG(); return 0; } +#endif /* CONFIG_USERFAULTFD */ static inline pte_t *huge_pte_offset(struct mm_struct *mm, unsigned long addr, unsigned long sz) --- a/mm/hugetlb.c~userfaultfd-hugetlbfs-only-compile-uffd-helpers-if-config-enabled +++ a/mm/hugetlb.c @@ -4855,6 +4855,7 @@ out_mutex: return ret; } +#ifdef CONFIG_USERFAULTFD /* * Used by userfaultfd UFFDIO_COPY. Based on mcopy_atomic_pte with * modifications for huge pages. @@ -4985,6 +4986,7 @@ out_release_nounlock: put_page(page); goto out; } +#endif /* CONFIG_USERFAULTFD */ static void record_subpages_vmas(struct page *page, struct vm_area_struct *vma, int refs, struct page **pages, _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 057/143] userfaultfd: add UFFDIO_CONTINUE ioctl 2021-05-05 1:32 incoming Andrew Morton ` (55 preceding siblings ...) 2021-05-05 1:35 ` [patch 056/143] userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:35 ` [patch 058/143] userfaultfd: update documentation to describe minor fault handling Andrew Morton ` (83 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual, axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang, dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra, mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton, peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli, steven.price, torvalds, vbabka, viro, walken, willy, ying.huang From: Axel Rasmussen <axelrasmussen@google.com> Subject: userfaultfd: add UFFDIO_CONTINUE ioctl This ioctl is how userspace ought to resolve "minor" userfaults. The idea is, userspace is notified that a minor fault has occurred. It might change the contents of the page using its second non-UFFD mapping, or not. Then, it calls UFFDIO_CONTINUE to tell the kernel "I have ensured the page contents are correct, carry on setting up the mapping". Note that it doesn't make much sense to use UFFDIO_{COPY,ZEROPAGE} for MINOR registered VMAs. ZEROPAGE maps the VMA to the zero page; but in the minor fault case, we already have some pre-existing underlying page. Likewise, UFFDIO_COPY isn't useful if we have a second non-UFFD mapping. We'd just use memcpy() or similar instead. It turns out hugetlb_mcopy_atomic_pte() already does very close to what we want, if an existing page is provided via `struct page **pagep`. We already special-case the behavior a bit for the UFFDIO_ZEROPAGE case, so just extend that design: add an enum for the three modes of operation, and make the small adjustments needed for the MCOPY_ATOMIC_CONTINUE case. (Basically, look up the existing page, and avoid adding the existing page to the page cache or calling set_page_huge_active() on it.) Link: https://lkml.kernel.org/r/20210301222728.176417-5-axelrasmussen@google.com Signed-off-by: Axel Rasmussen <axelrasmussen@google.com> Reviewed-by: Peter Xu <peterx@redhat.com> Cc: Adam Ruprecht <ruprecht@google.com> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Cannon Matthews <cannonmatthews@google.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Chinwen Chang <chinwen.chang@mediatek.com> Cc: David Rientjes <rientjes@google.com> Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com> Cc: Huang Ying <ying.huang@intel.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jann Horn <jannh@google.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Kirill A. Shutemov <kirill@shutemov.name> Cc: Lokesh Gidra <lokeshgidra@google.com> Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: "Michal Koutn" <mkoutny@suse.com> Cc: Michel Lespinasse <walken@google.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Mike Rapoport <rppt@linux.vnet.ibm.com> Cc: Mina Almasry <almasrymina@google.com> Cc: Nicholas Piggin <npiggin@gmail.com> Cc: Oliver Upton <oupton@google.com> Cc: Shaohua Li <shli@fb.com> Cc: Shawn Anastasio <shawn@anastas.io> Cc: Steven Price <steven.price@arm.com> Cc: Steven Rostedt <rostedt@goodmis.org> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/userfaultfd.c | 67 +++++++++++++++++++++++++++++ include/linux/hugetlb.h | 3 + include/linux/userfaultfd_k.h | 18 +++++++ include/uapi/linux/userfaultfd.h | 21 ++++++++- mm/hugetlb.c | 40 +++++++++++------ mm/userfaultfd.c | 37 +++++++++------- 6 files changed, 156 insertions(+), 30 deletions(-) --- a/fs/userfaultfd.c~userfaultfd-add-uffdio_continue-ioctl +++ a/fs/userfaultfd.c @@ -1487,6 +1487,10 @@ out_unlock: if (!(uffdio_register.mode & UFFDIO_REGISTER_MODE_WP)) ioctls_out &= ~((__u64)1 << _UFFDIO_WRITEPROTECT); + /* CONTINUE ioctl is only supported for MINOR ranges. */ + if (!(uffdio_register.mode & UFFDIO_REGISTER_MODE_MINOR)) + ioctls_out &= ~((__u64)1 << _UFFDIO_CONTINUE); + /* * Now that we scanned all vmas we can already tell * userland which ioctls methods are guaranteed to @@ -1840,6 +1844,66 @@ static int userfaultfd_writeprotect(stru return ret; } +static int userfaultfd_continue(struct userfaultfd_ctx *ctx, unsigned long arg) +{ + __s64 ret; + struct uffdio_continue uffdio_continue; + struct uffdio_continue __user *user_uffdio_continue; + struct userfaultfd_wake_range range; + + user_uffdio_continue = (struct uffdio_continue __user *)arg; + + ret = -EAGAIN; + if (READ_ONCE(ctx->mmap_changing)) + goto out; + + ret = -EFAULT; + if (copy_from_user(&uffdio_continue, user_uffdio_continue, + /* don't copy the output fields */ + sizeof(uffdio_continue) - (sizeof(__s64)))) + goto out; + + ret = validate_range(ctx->mm, &uffdio_continue.range.start, + uffdio_continue.range.len); + if (ret) + goto out; + + ret = -EINVAL; + /* double check for wraparound just in case. */ + if (uffdio_continue.range.start + uffdio_continue.range.len <= + uffdio_continue.range.start) { + goto out; + } + if (uffdio_continue.mode & ~UFFDIO_CONTINUE_MODE_DONTWAKE) + goto out; + + if (mmget_not_zero(ctx->mm)) { + ret = mcopy_continue(ctx->mm, uffdio_continue.range.start, + uffdio_continue.range.len, + &ctx->mmap_changing); + mmput(ctx->mm); + } else { + return -ESRCH; + } + + if (unlikely(put_user(ret, &user_uffdio_continue->mapped))) + return -EFAULT; + if (ret < 0) + goto out; + + /* len == 0 would wake all */ + BUG_ON(!ret); + range.len = ret; + if (!(uffdio_continue.mode & UFFDIO_CONTINUE_MODE_DONTWAKE)) { + range.start = uffdio_continue.range.start; + wake_userfault(ctx, &range); + } + ret = range.len == uffdio_continue.range.len ? 0 : -EAGAIN; + +out: + return ret; +} + static inline unsigned int uffd_ctx_features(__u64 user_features) { /* @@ -1927,6 +1991,9 @@ static long userfaultfd_ioctl(struct fil case UFFDIO_WRITEPROTECT: ret = userfaultfd_writeprotect(ctx, arg); break; + case UFFDIO_CONTINUE: + ret = userfaultfd_continue(ctx, arg); + break; } return ret; } --- a/include/linux/hugetlb.h~userfaultfd-add-uffdio_continue-ioctl +++ a/include/linux/hugetlb.h @@ -11,6 +11,7 @@ #include <linux/kref.h> #include <linux/pgtable.h> #include <linux/gfp.h> +#include <linux/userfaultfd_k.h> struct ctl_table; struct user_struct; @@ -139,6 +140,7 @@ int hugetlb_mcopy_atomic_pte(struct mm_s struct vm_area_struct *dst_vma, unsigned long dst_addr, unsigned long src_addr, + enum mcopy_atomic_mode mode, struct page **pagep); #endif /* CONFIG_USERFAULTFD */ bool hugetlb_reserve_pages(struct inode *inode, long from, long to, @@ -318,6 +320,7 @@ static inline int hugetlb_mcopy_atomic_p struct vm_area_struct *dst_vma, unsigned long dst_addr, unsigned long src_addr, + enum mcopy_atomic_mode mode, struct page **pagep) { BUG(); --- a/include/linux/userfaultfd_k.h~userfaultfd-add-uffdio_continue-ioctl +++ a/include/linux/userfaultfd_k.h @@ -37,6 +37,22 @@ extern int sysctl_unprivileged_userfault extern vm_fault_t handle_userfault(struct vm_fault *vmf, unsigned long reason); +/* + * The mode of operation for __mcopy_atomic and its helpers. + * + * This is almost an implementation detail (mcopy_atomic below doesn't take this + * as a parameter), but it's exposed here because memory-kind-specific + * implementations (e.g. hugetlbfs) need to know the mode of operation. + */ +enum mcopy_atomic_mode { + /* A normal copy_from_user into the destination range. */ + MCOPY_ATOMIC_NORMAL, + /* Don't copy; map the destination range to the zero page. */ + MCOPY_ATOMIC_ZEROPAGE, + /* Just install pte(s) with the existing page(s) in the page cache. */ + MCOPY_ATOMIC_CONTINUE, +}; + extern ssize_t mcopy_atomic(struct mm_struct *dst_mm, unsigned long dst_start, unsigned long src_start, unsigned long len, bool *mmap_changing, __u64 mode); @@ -44,6 +60,8 @@ extern ssize_t mfill_zeropage(struct mm_ unsigned long dst_start, unsigned long len, bool *mmap_changing); +extern ssize_t mcopy_continue(struct mm_struct *dst_mm, unsigned long dst_start, + unsigned long len, bool *mmap_changing); extern int mwriteprotect_range(struct mm_struct *dst_mm, unsigned long start, unsigned long len, bool enable_wp, bool *mmap_changing); --- a/include/uapi/linux/userfaultfd.h~userfaultfd-add-uffdio_continue-ioctl +++ a/include/uapi/linux/userfaultfd.h @@ -40,10 +40,12 @@ ((__u64)1 << _UFFDIO_WAKE | \ (__u64)1 << _UFFDIO_COPY | \ (__u64)1 << _UFFDIO_ZEROPAGE | \ - (__u64)1 << _UFFDIO_WRITEPROTECT) + (__u64)1 << _UFFDIO_WRITEPROTECT | \ + (__u64)1 << _UFFDIO_CONTINUE) #define UFFD_API_RANGE_IOCTLS_BASIC \ ((__u64)1 << _UFFDIO_WAKE | \ - (__u64)1 << _UFFDIO_COPY) + (__u64)1 << _UFFDIO_COPY | \ + (__u64)1 << _UFFDIO_CONTINUE) /* * Valid ioctl command number range with this API is from 0x00 to @@ -59,6 +61,7 @@ #define _UFFDIO_COPY (0x03) #define _UFFDIO_ZEROPAGE (0x04) #define _UFFDIO_WRITEPROTECT (0x06) +#define _UFFDIO_CONTINUE (0x07) #define _UFFDIO_API (0x3F) /* userfaultfd ioctl ids */ @@ -77,6 +80,8 @@ struct uffdio_zeropage) #define UFFDIO_WRITEPROTECT _IOWR(UFFDIO, _UFFDIO_WRITEPROTECT, \ struct uffdio_writeprotect) +#define UFFDIO_CONTINUE _IOR(UFFDIO, _UFFDIO_CONTINUE, \ + struct uffdio_continue) /* read() structure */ struct uffd_msg { @@ -268,6 +273,18 @@ struct uffdio_writeprotect { __u64 mode; }; +struct uffdio_continue { + struct uffdio_range range; +#define UFFDIO_CONTINUE_MODE_DONTWAKE ((__u64)1<<0) + __u64 mode; + + /* + * Fields below here are written by the ioctl and must be at the end: + * the copy_from_user will not read past here. + */ + __s64 mapped; +}; + /* * Flags for the userfaultfd(2) system call itself. */ --- a/mm/hugetlb.c~userfaultfd-add-uffdio_continue-ioctl +++ a/mm/hugetlb.c @@ -39,7 +39,6 @@ #include <linux/hugetlb.h> #include <linux/hugetlb_cgroup.h> #include <linux/node.h> -#include <linux/userfaultfd_k.h> #include <linux/page_owner.h> #include "internal.h" @@ -4865,8 +4864,10 @@ int hugetlb_mcopy_atomic_pte(struct mm_s struct vm_area_struct *dst_vma, unsigned long dst_addr, unsigned long src_addr, + enum mcopy_atomic_mode mode, struct page **pagep) { + bool is_continue = (mode == MCOPY_ATOMIC_CONTINUE); struct address_space *mapping; pgoff_t idx; unsigned long size; @@ -4876,8 +4877,17 @@ int hugetlb_mcopy_atomic_pte(struct mm_s spinlock_t *ptl; int ret; struct page *page; + int writable; - if (!*pagep) { + mapping = dst_vma->vm_file->f_mapping; + idx = vma_hugecache_offset(h, dst_vma, dst_addr); + + if (is_continue) { + ret = -EFAULT; + page = find_lock_page(mapping, idx); + if (!page) + goto out; + } else if (!*pagep) { ret = -ENOMEM; page = alloc_huge_page(dst_vma, dst_addr, 0); if (IS_ERR(page)) @@ -4906,13 +4916,8 @@ int hugetlb_mcopy_atomic_pte(struct mm_s */ __SetPageUptodate(page); - mapping = dst_vma->vm_file->f_mapping; - idx = vma_hugecache_offset(h, dst_vma, dst_addr); - - /* - * If shared, add to page cache - */ - if (vm_shared) { + /* Add shared, newly allocated pages to the page cache. */ + if (vm_shared && !is_continue) { size = i_size_read(mapping->host) >> huge_page_shift(h); ret = -EFAULT; if (idx >= size) @@ -4957,8 +4962,14 @@ int hugetlb_mcopy_atomic_pte(struct mm_s hugepage_add_new_anon_rmap(page, dst_vma, dst_addr); } - _dst_pte = make_huge_pte(dst_vma, page, dst_vma->vm_flags & VM_WRITE); - if (dst_vma->vm_flags & VM_WRITE) + /* For CONTINUE on a non-shared VMA, don't set VM_WRITE for CoW. */ + if (is_continue && !vm_shared) + writable = 0; + else + writable = dst_vma->vm_flags & VM_WRITE; + + _dst_pte = make_huge_pte(dst_vma, page, writable); + if (writable) _dst_pte = huge_pte_mkdirty(_dst_pte); _dst_pte = pte_mkyoung(_dst_pte); @@ -4972,15 +4983,16 @@ int hugetlb_mcopy_atomic_pte(struct mm_s update_mmu_cache(dst_vma, dst_addr, dst_pte); spin_unlock(ptl); - SetHPageMigratable(page); - if (vm_shared) + if (!is_continue) + SetHPageMigratable(page); + if (vm_shared || is_continue) unlock_page(page); ret = 0; out: return ret; out_release_unlock: spin_unlock(ptl); - if (vm_shared) + if (vm_shared || is_continue) unlock_page(page); out_release_nounlock: put_page(page); --- a/mm/userfaultfd.c~userfaultfd-add-uffdio_continue-ioctl +++ a/mm/userfaultfd.c @@ -207,7 +207,7 @@ static __always_inline ssize_t __mcopy_a unsigned long dst_start, unsigned long src_start, unsigned long len, - bool zeropage) + enum mcopy_atomic_mode mode) { int vm_alloc_shared = dst_vma->vm_flags & VM_SHARED; int vm_shared = dst_vma->vm_flags & VM_SHARED; @@ -227,7 +227,7 @@ static __always_inline ssize_t __mcopy_a * by THP. Since we can not reliably insert a zero page, this * feature is not supported. */ - if (zeropage) { + if (mode == MCOPY_ATOMIC_ZEROPAGE) { mmap_read_unlock(dst_mm); return -EINVAL; } @@ -273,8 +273,6 @@ retry: } while (src_addr < src_start + len) { - pte_t dst_pteval; - BUG_ON(dst_addr >= dst_start + len); /* @@ -297,16 +295,16 @@ retry: goto out_unlock; } - err = -EEXIST; - dst_pteval = huge_ptep_get(dst_pte); - if (!huge_pte_none(dst_pteval)) { + if (mode != MCOPY_ATOMIC_CONTINUE && + !huge_pte_none(huge_ptep_get(dst_pte))) { + err = -EEXIST; mutex_unlock(&hugetlb_fault_mutex_table[hash]); i_mmap_unlock_read(mapping); goto out_unlock; } err = hugetlb_mcopy_atomic_pte(dst_mm, dst_pte, dst_vma, - dst_addr, src_addr, &page); + dst_addr, src_addr, mode, &page); mutex_unlock(&hugetlb_fault_mutex_table[hash]); i_mmap_unlock_read(mapping); @@ -408,7 +406,7 @@ extern ssize_t __mcopy_atomic_hugetlb(st unsigned long dst_start, unsigned long src_start, unsigned long len, - bool zeropage); + enum mcopy_atomic_mode mode); #endif /* CONFIG_HUGETLB_PAGE */ static __always_inline ssize_t mfill_atomic_pte(struct mm_struct *dst_mm, @@ -458,7 +456,7 @@ static __always_inline ssize_t __mcopy_a unsigned long dst_start, unsigned long src_start, unsigned long len, - bool zeropage, + enum mcopy_atomic_mode mcopy_mode, bool *mmap_changing, __u64 mode) { @@ -469,6 +467,7 @@ static __always_inline ssize_t __mcopy_a long copied; struct page *page; bool wp_copy; + bool zeropage = (mcopy_mode == MCOPY_ATOMIC_ZEROPAGE); /* * Sanitize the command parameters: @@ -527,10 +526,12 @@ retry: */ if (is_vm_hugetlb_page(dst_vma)) return __mcopy_atomic_hugetlb(dst_mm, dst_vma, dst_start, - src_start, len, zeropage); + src_start, len, mcopy_mode); if (!vma_is_anonymous(dst_vma) && !vma_is_shmem(dst_vma)) goto out_unlock; + if (mcopy_mode == MCOPY_ATOMIC_CONTINUE) + goto out_unlock; /* * Ensure the dst_vma has a anon_vma or this page @@ -626,14 +627,22 @@ ssize_t mcopy_atomic(struct mm_struct *d unsigned long src_start, unsigned long len, bool *mmap_changing, __u64 mode) { - return __mcopy_atomic(dst_mm, dst_start, src_start, len, false, - mmap_changing, mode); + return __mcopy_atomic(dst_mm, dst_start, src_start, len, + MCOPY_ATOMIC_NORMAL, mmap_changing, mode); } ssize_t mfill_zeropage(struct mm_struct *dst_mm, unsigned long start, unsigned long len, bool *mmap_changing) { - return __mcopy_atomic(dst_mm, start, 0, len, true, mmap_changing, 0); + return __mcopy_atomic(dst_mm, start, 0, len, MCOPY_ATOMIC_ZEROPAGE, + mmap_changing, 0); +} + +ssize_t mcopy_continue(struct mm_struct *dst_mm, unsigned long start, + unsigned long len, bool *mmap_changing) +{ + return __mcopy_atomic(dst_mm, start, 0, len, MCOPY_ATOMIC_CONTINUE, + mmap_changing, 0); } int mwriteprotect_range(struct mm_struct *dst_mm, unsigned long start, _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 058/143] userfaultfd: update documentation to describe minor fault handling 2021-05-05 1:32 incoming Andrew Morton ` (56 preceding siblings ...) 2021-05-05 1:35 ` [patch 057/143] userfaultfd: add UFFDIO_CONTINUE ioctl Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:35 ` [patch 059/143] userfaultfd/selftests: add test exercising " Andrew Morton ` (82 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual, axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang, dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra, mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton, peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli, steven.price, torvalds, vbabka, viro, walken, willy, ying.huang From: Axel Rasmussen <axelrasmussen@google.com> Subject: userfaultfd: update documentation to describe minor fault handling Reword / reorganize things a little bit into "lists", so new features / modes / ioctls can sort of just be appended. Describe how UFFDIO_REGISTER_MODE_MINOR and UFFDIO_CONTINUE can be used to intercept and resolve minor faults. Make it clear that COPY and ZEROPAGE are used for MISSING faults, whereas CONTINUE is used for MINOR faults. Link: https://lkml.kernel.org/r/20210301222728.176417-6-axelrasmussen@google.com Signed-off-by: Axel Rasmussen <axelrasmussen@google.com> Reviewed-by: Peter Xu <peterx@redhat.com> Cc: Adam Ruprecht <ruprecht@google.com> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Cannon Matthews <cannonmatthews@google.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Chinwen Chang <chinwen.chang@mediatek.com> Cc: David Rientjes <rientjes@google.com> Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com> Cc: Huang Ying <ying.huang@intel.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jann Horn <jannh@google.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Kirill A. Shutemov <kirill@shutemov.name> Cc: Lokesh Gidra <lokeshgidra@google.com> Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: "Michal Koutn" <mkoutny@suse.com> Cc: Michel Lespinasse <walken@google.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Mike Rapoport <rppt@linux.vnet.ibm.com> Cc: Mina Almasry <almasrymina@google.com> Cc: Nicholas Piggin <npiggin@gmail.com> Cc: Oliver Upton <oupton@google.com> Cc: Shaohua Li <shli@fb.com> Cc: Shawn Anastasio <shawn@anastas.io> Cc: Steven Price <steven.price@arm.com> Cc: Steven Rostedt <rostedt@goodmis.org> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/admin-guide/mm/userfaultfd.rst | 105 ++++++++++------- 1 file changed, 65 insertions(+), 40 deletions(-) --- a/Documentation/admin-guide/mm/userfaultfd.rst~userfaultfd-update-documentation-to-describe-minor-fault-handling +++ a/Documentation/admin-guide/mm/userfaultfd.rst @@ -63,36 +63,36 @@ the generic ioctl available. The ``uffdio_api.features`` bitmask returned by the ``UFFDIO_API`` ioctl defines what memory types are supported by the ``userfaultfd`` and what -events, except page fault notifications, may be generated. +events, except page fault notifications, may be generated: -If the kernel supports registering ``userfaultfd`` ranges on hugetlbfs -virtual memory areas, ``UFFD_FEATURE_MISSING_HUGETLBFS`` will be set in -``uffdio_api.features``. Similarly, ``UFFD_FEATURE_MISSING_SHMEM`` will be -set if the kernel supports registering ``userfaultfd`` ranges on shared -memory (covering all shmem APIs, i.e. tmpfs, ``IPCSHM``, ``/dev/zero``, -``MAP_SHARED``, ``memfd_create``, etc). - -The userland application that wants to use ``userfaultfd`` with hugetlbfs -or shared memory need to set the corresponding flag in -``uffdio_api.features`` to enable those features. - -If the userland desires to receive notifications for events other than -page faults, it has to verify that ``uffdio_api.features`` has appropriate -``UFFD_FEATURE_EVENT_*`` bits set. These events are described in more -detail below in `Non-cooperative userfaultfd`_ section. - -Once the ``userfaultfd`` has been enabled the ``UFFDIO_REGISTER`` ioctl should -be invoked (if present in the returned ``uffdio_api.ioctls`` bitmask) to -register a memory range in the ``userfaultfd`` by setting the +- The ``UFFD_FEATURE_EVENT_*`` flags indicate that various other events + other than page faults are supported. These events are described in more + detail below in the `Non-cooperative userfaultfd`_ section. + +- ``UFFD_FEATURE_MISSING_HUGETLBFS`` and ``UFFD_FEATURE_MISSING_SHMEM`` + indicate that the kernel supports ``UFFDIO_REGISTER_MODE_MISSING`` + registrations for hugetlbfs and shared memory (covering all shmem APIs, + i.e. tmpfs, ``IPCSHM``, ``/dev/zero``, ``MAP_SHARED``, ``memfd_create``, + etc) virtual memory areas, respectively. + +- ``UFFD_FEATURE_MINOR_HUGETLBFS`` indicates that the kernel supports + ``UFFDIO_REGISTER_MODE_MINOR`` registration for hugetlbfs virtual memory + areas. + +The userland application should set the feature flags it intends to use +when invoking the ``UFFDIO_API`` ioctl, to request that those features be +enabled if supported. + +Once the ``userfaultfd`` API has been enabled the ``UFFDIO_REGISTER`` +ioctl should be invoked (if present in the returned ``uffdio_api.ioctls`` +bitmask) to register a memory range in the ``userfaultfd`` by setting the uffdio_register structure accordingly. The ``uffdio_register.mode`` bitmask will specify to the kernel which kind of faults to track for -the range (``UFFDIO_REGISTER_MODE_MISSING`` would track missing -pages). The ``UFFDIO_REGISTER`` ioctl will return the +the range. The ``UFFDIO_REGISTER`` ioctl will return the ``uffdio_register.ioctls`` bitmask of ioctls that are suitable to resolve userfaults on the range registered. Not all ioctls will necessarily be -supported for all memory types depending on the underlying virtual -memory backend (anonymous memory vs tmpfs vs real filebacked -mappings). +supported for all memory types (e.g. anonymous memory vs. shmem vs. +hugetlbfs), or all types of intercepted faults. Userland can use the ``uffdio_register.ioctls`` to manage the virtual address space in the background (to add or potentially also remove @@ -100,21 +100,46 @@ memory from the ``userfaultfd`` register could be triggering just before userland maps in the background the user-faulted page. -The primary ioctl to resolve userfaults is ``UFFDIO_COPY``. That -atomically copies a page into the userfault registered range and wakes -up the blocked userfaults -(unless ``uffdio_copy.mode & UFFDIO_COPY_MODE_DONTWAKE`` is set). -Other ioctl works similarly to ``UFFDIO_COPY``. They're atomic as in -guaranteeing that nothing can see an half copied page since it'll -keep userfaulting until the copy has finished. +Resolving Userfaults +-------------------- + +There are three basic ways to resolve userfaults: + +- ``UFFDIO_COPY`` atomically copies some existing page contents from + userspace. + +- ``UFFDIO_ZEROPAGE`` atomically zeros the new page. + +- ``UFFDIO_CONTINUE`` maps an existing, previously-populated page. + +These operations are atomic in the sense that they guarantee nothing can +see a half-populated page, since readers will keep userfaulting until the +operation has finished. + +By default, these wake up userfaults blocked on the range in question. +They support a ``UFFDIO_*_MODE_DONTWAKE`` ``mode`` flag, which indicates +that waking will be done separately at some later time. + +Which ioctl to choose depends on the kind of page fault, and what we'd +like to do to resolve it: + +- For ``UFFDIO_REGISTER_MODE_MISSING`` faults, the fault needs to be + resolved by either providing a new page (``UFFDIO_COPY``), or mapping + the zero page (``UFFDIO_ZEROPAGE``). By default, the kernel would map + the zero page for a missing fault. With userfaultfd, userspace can + decide what content to provide before the faulting thread continues. + +- For ``UFFDIO_REGISTER_MODE_MINOR`` faults, there is an existing page (in + the page cache). Userspace has the option of modifying the page's + contents before resolving the fault. Once the contents are correct + (modified or not), userspace asks the kernel to map the page and let the + faulting thread continue with ``UFFDIO_CONTINUE``. Notes: -- If you requested ``UFFDIO_REGISTER_MODE_MISSING`` when registering then - you must provide some kind of page in your thread after reading from - the uffd. You must provide either ``UFFDIO_COPY`` or ``UFFDIO_ZEROPAGE``. - The normal behavior of the OS automatically providing a zero page on - an anonymous mmaping is not in place. +- You can tell which kind of fault occurred by examining + ``pagefault.flags`` within the ``uffd_msg``, checking for the + ``UFFD_PAGEFAULT_FLAG_*`` flags. - None of the page-delivering ioctls default to the range that you registered with. You must fill in all fields for the appropriate @@ -122,9 +147,9 @@ Notes: - You get the address of the access that triggered the missing page event out of a struct uffd_msg that you read in the thread from the - uffd. You can supply as many pages as you want with ``UFFDIO_COPY`` or - ``UFFDIO_ZEROPAGE``. Keep in mind that unless you used DONTWAKE then - the first of any of those IOCTLs wakes up the faulting thread. + uffd. You can supply as many pages as you want with these IOCTLs. + Keep in mind that unless you used DONTWAKE then the first of any of + those IOCTLs wakes up the faulting thread. - Be sure to test for all errors including (``pollfd[0].revents & POLLERR``). This can happen, e.g. when ranges _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 059/143] userfaultfd/selftests: add test exercising minor fault handling 2021-05-05 1:32 incoming Andrew Morton ` (57 preceding siblings ...) 2021-05-05 1:35 ` [patch 058/143] userfaultfd: update documentation to describe minor fault handling Andrew Morton @ 2021-05-05 1:35 ` Andrew Morton 2021-05-05 1:36 ` [patch 060/143] mm/vmscan: move RECLAIM* bits to uapi header Andrew Morton ` (81 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw) To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual, axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang, dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra, mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton, peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli, steven.price, torvalds, vbabka, viro, walken, willy, ying.huang From: Axel Rasmussen <axelrasmussen@google.com> Subject: userfaultfd/selftests: add test exercising minor fault handling Fix a dormant bug in userfaultfd_events_test(), where we did `return faulting_process(0)` instead of `exit(faulting_process(0))`. This caused the forked process to keep running, trying to execute any further test cases after the events test in parallel with the "real" process. Add a simple test case which exercises minor faults. In short, it does the following: 1. "Sets up" an area (area_dst) and a second shared mapping to the same underlying pages (area_dst_alias). 2. Register one of these areas with userfaultfd, in minor fault mode. 3. Start a second thread to handle any minor faults. 4. Populate the underlying pages with the non-UFFD-registered side of the mapping. Basically, memset() each page with some arbitrary contents. 5. Then, using the UFFD-registered mapping, read all of the page contents, asserting that the contents match expectations (we expect the minor fault handling thread can modify the page contents before resolving the fault). The minor fault handling thread, upon receiving an event, flips all the bits (~) in that page, just to prove that it can modify it in some arbitrary way. Then it issues a UFFDIO_CONTINUE ioctl, to setup the mapping and resolve the fault. The reading thread should wake up and see this modification. Currently the minor fault test is only enabled in hugetlb_shared mode, as this is the only configuration the kernel feature supports. Link: https://lkml.kernel.org/r/20210301222728.176417-7-axelrasmussen@google.com Signed-off-by: Axel Rasmussen <axelrasmussen@google.com> Reviewed-by: Peter Xu <peterx@redhat.com> Cc: Adam Ruprecht <ruprecht@google.com> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Cannon Matthews <cannonmatthews@google.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Chinwen Chang <chinwen.chang@mediatek.com> Cc: David Rientjes <rientjes@google.com> Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com> Cc: Huang Ying <ying.huang@intel.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jann Horn <jannh@google.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Kirill A. Shutemov <kirill@shutemov.name> Cc: Lokesh Gidra <lokeshgidra@google.com> Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: "Michal Koutn" <mkoutny@suse.com> Cc: Michel Lespinasse <walken@google.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Mike Rapoport <rppt@linux.vnet.ibm.com> Cc: Mina Almasry <almasrymina@google.com> Cc: Nicholas Piggin <npiggin@gmail.com> Cc: Oliver Upton <oupton@google.com> Cc: Shaohua Li <shli@fb.com> Cc: Shawn Anastasio <shawn@anastas.io> Cc: Steven Price <steven.price@arm.com> Cc: Steven Rostedt <rostedt@goodmis.org> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/testing/selftests/vm/userfaultfd.c | 164 ++++++++++++++++++++- 1 file changed, 158 insertions(+), 6 deletions(-) --- a/tools/testing/selftests/vm/userfaultfd.c~userfaultfd-selftests-add-test-exercising-minor-fault-handling +++ a/tools/testing/selftests/vm/userfaultfd.c @@ -81,6 +81,8 @@ static volatile bool test_uffdio_copy_ee static volatile bool test_uffdio_zeropage_eexist = true; /* Whether to test uffd write-protection */ static bool test_uffdio_wp = false; +/* Whether to test uffd minor faults */ +static bool test_uffdio_minor = false; static bool map_shared; static int huge_fd; @@ -96,6 +98,7 @@ struct uffd_stats { int cpu; unsigned long missing_faults; unsigned long wp_faults; + unsigned long minor_faults; }; /* pthread_mutex_t starts at page offset 0 */ @@ -153,17 +156,19 @@ static void uffd_stats_reset(struct uffd uffd_stats[i].cpu = i; uffd_stats[i].missing_faults = 0; uffd_stats[i].wp_faults = 0; + uffd_stats[i].minor_faults = 0; } } static void uffd_stats_report(struct uffd_stats *stats, int n_cpus) { int i; - unsigned long long miss_total = 0, wp_total = 0; + unsigned long long miss_total = 0, wp_total = 0, minor_total = 0; for (i = 0; i < n_cpus; i++) { miss_total += stats[i].missing_faults; wp_total += stats[i].wp_faults; + minor_total += stats[i].minor_faults; } printf("userfaults: %llu missing (", miss_total); @@ -172,6 +177,9 @@ static void uffd_stats_report(struct uff printf("\b), %llu wp (", wp_total); for (i = 0; i < n_cpus; i++) printf("%lu+", stats[i].wp_faults); + printf("\b), %llu minor (", minor_total); + for (i = 0; i < n_cpus; i++) + printf("%lu+", stats[i].minor_faults); printf("\b)\n"); } @@ -328,7 +336,7 @@ static struct uffd_test_ops shmem_uffd_t }; static struct uffd_test_ops hugetlb_uffd_test_ops = { - .expected_ioctls = UFFD_API_RANGE_IOCTLS_BASIC, + .expected_ioctls = UFFD_API_RANGE_IOCTLS_BASIC & ~(1 << _UFFDIO_CONTINUE), .allocate_area = hugetlb_allocate_area, .release_pages = hugetlb_release_pages, .alias_mapping = hugetlb_alias_mapping, @@ -362,6 +370,22 @@ static void wp_range(int ufd, __u64 star } } +static void continue_range(int ufd, __u64 start, __u64 len) +{ + struct uffdio_continue req; + + req.range.start = start; + req.range.len = len; + req.mode = 0; + + if (ioctl(ufd, UFFDIO_CONTINUE, &req)) { + fprintf(stderr, + "UFFDIO_CONTINUE failed for address 0x%" PRIx64 "\n", + (uint64_t)start); + exit(1); + } +} + static void *locking_thread(void *arg) { unsigned long cpu = (unsigned long) arg; @@ -569,8 +593,32 @@ static void uffd_handle_page_fault(struc } if (msg->arg.pagefault.flags & UFFD_PAGEFAULT_FLAG_WP) { + /* Write protect page faults */ wp_range(uffd, msg->arg.pagefault.address, page_size, false); stats->wp_faults++; + } else if (msg->arg.pagefault.flags & UFFD_PAGEFAULT_FLAG_MINOR) { + uint8_t *area; + int b; + + /* + * Minor page faults + * + * To prove we can modify the original range for testing + * purposes, we're going to bit flip this range before + * continuing. + * + * Note that this requires all minor page fault tests operate on + * area_dst (non-UFFD-registered) and area_dst_alias + * (UFFD-registered). + */ + + area = (uint8_t *)(area_dst + + ((char *)msg->arg.pagefault.address - + area_dst_alias)); + for (b = 0; b < page_size; ++b) + area[b] = ~area[b]; + continue_range(uffd, msg->arg.pagefault.address, page_size); + stats->minor_faults++; } else { /* Missing page faults */ if (bounces & BOUNCE_VERIFY && @@ -779,7 +827,7 @@ static int stress(struct uffd_stats *uff return 0; } -static int userfaultfd_open(int features) +static int userfaultfd_open_ext(uint64_t *features) { struct uffdio_api uffdio_api; @@ -792,7 +840,7 @@ static int userfaultfd_open(int features uffd_flags = fcntl(uffd, F_GETFD, NULL); uffdio_api.api = UFFD_API; - uffdio_api.features = features; + uffdio_api.features = *features; if (ioctl(uffd, UFFDIO_API, &uffdio_api)) { fprintf(stderr, "UFFDIO_API failed.\nPlease make sure to " "run with either root or ptrace capability.\n"); @@ -804,9 +852,15 @@ static int userfaultfd_open(int features return 1; } + *features = uffdio_api.features; return 0; } +static int userfaultfd_open(uint64_t features) +{ + return userfaultfd_open_ext(&features); +} + sigjmp_buf jbuf, *sigbuf; static void sighndl(int sig, siginfo_t *siginfo, void *ptr) @@ -1112,7 +1166,7 @@ static int userfaultfd_events_test(void) } if (!pid) - return faulting_process(0); + exit(faulting_process(0)); waitpid(pid, &err, 0); if (err) { @@ -1215,6 +1269,102 @@ static int userfaultfd_sig_test(void) return userfaults != 0; } +static int userfaultfd_minor_test(void) +{ + struct uffdio_register uffdio_register; + unsigned long expected_ioctls; + unsigned long p; + pthread_t uffd_mon; + uint8_t expected_byte; + void *expected_page; + char c; + struct uffd_stats stats = { 0 }; + uint64_t features = UFFD_FEATURE_MINOR_HUGETLBFS; + + if (!test_uffdio_minor) + return 0; + + printf("testing minor faults: "); + fflush(stdout); + + if (uffd_test_ops->release_pages(area_dst)) + return 1; + + if (userfaultfd_open_ext(&features)) + return 1; + /* If kernel reports the feature isn't supported, skip the test. */ + if (!(features & UFFD_FEATURE_MINOR_HUGETLBFS)) { + printf("skipping test due to lack of feature support\n"); + fflush(stdout); + return 0; + } + + uffdio_register.range.start = (unsigned long)area_dst_alias; + uffdio_register.range.len = nr_pages * page_size; + uffdio_register.mode = UFFDIO_REGISTER_MODE_MINOR; + if (ioctl(uffd, UFFDIO_REGISTER, &uffdio_register)) { + fprintf(stderr, "register failure\n"); + exit(1); + } + + expected_ioctls = uffd_test_ops->expected_ioctls; + expected_ioctls |= 1 << _UFFDIO_CONTINUE; + if ((uffdio_register.ioctls & expected_ioctls) != expected_ioctls) { + fprintf(stderr, "unexpected missing ioctl(s)\n"); + exit(1); + } + + /* + * After registering with UFFD, populate the non-UFFD-registered side of + * the shared mapping. This should *not* trigger any UFFD minor faults. + */ + for (p = 0; p < nr_pages; ++p) { + memset(area_dst + (p * page_size), p % ((uint8_t)-1), + page_size); + } + + if (pthread_create(&uffd_mon, &attr, uffd_poll_thread, &stats)) { + perror("uffd_poll_thread create"); + exit(1); + } + + /* + * Read each of the pages back using the UFFD-registered mapping. We + * expect that the first time we touch a page, it will result in a minor + * fault. uffd_poll_thread will resolve the fault by bit-flipping the + * page's contents, and then issuing a CONTINUE ioctl. + */ + + if (posix_memalign(&expected_page, page_size, page_size)) { + fprintf(stderr, "out of memory\n"); + return 1; + } + + for (p = 0; p < nr_pages; ++p) { + expected_byte = ~((uint8_t)(p % ((uint8_t)-1))); + memset(expected_page, expected_byte, page_size); + if (my_bcmp(expected_page, area_dst_alias + (p * page_size), + page_size)) { + fprintf(stderr, + "unexpected page contents after minor fault\n"); + exit(1); + } + } + + if (write(pipefd[1], &c, sizeof(c)) != sizeof(c)) { + perror("pipe write"); + exit(1); + } + if (pthread_join(uffd_mon, NULL)) + return 1; + + close(uffd); + + uffd_stats_report(&stats, 1); + + return stats.missing_faults != 0 || stats.minor_faults != nr_pages; +} + static int userfaultfd_stress(void) { void *area; @@ -1413,7 +1563,7 @@ static int userfaultfd_stress(void) close(uffd); return userfaultfd_zeropage_test() || userfaultfd_sig_test() - || userfaultfd_events_test(); + || userfaultfd_events_test() || userfaultfd_minor_test(); } /* @@ -1454,6 +1604,8 @@ static void set_test_type(const char *ty map_shared = true; test_type = TEST_HUGETLB; uffd_test_ops = &hugetlb_uffd_test_ops; + /* Minor faults require shared hugetlb; only enable here. */ + test_uffdio_minor = true; } else if (!strcmp(type, "shmem")) { map_shared = true; test_type = TEST_SHMEM; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 060/143] mm/vmscan: move RECLAIM* bits to uapi header 2021-05-05 1:32 incoming Andrew Morton ` (58 preceding siblings ...) 2021-05-05 1:35 ` [patch 059/143] userfaultfd/selftests: add test exercising " Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 061/143] mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks Andrew Morton ` (80 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, alex.shi, ben.widawsky, cai, cl, dan.j.williams, dave.hansen, dwagner, linux-mm, mm-commits, osalvador, rientjes, tobin, torvalds, ying.huang From: Dave Hansen <dave.hansen@linux.intel.com> Subject: mm/vmscan: move RECLAIM* bits to uapi header It is currently not obvious that the RECLAIM_* bits are part of the uapi since they are defined in vmscan.c. Move them to a uapi header to make it obvious. This should have no functional impact. Link: https://lkml.kernel.org/r/20210219172557.08074910@viggo.jf.intel.com Signed-off-by: Dave Hansen <dave.hansen@linux.intel.com> Reviewed-by: Ben Widawsky <ben.widawsky@intel.com> Reviewed-by: Oscar Salvador <osalvador@suse.de> Acked-by: David Rientjes <rientjes@google.com> Acked-by: Christoph Lameter <cl@linux.com> Cc: Alex Shi <alex.shi@linux.alibaba.com> Cc: Daniel Wagner <dwagner@suse.de> Cc: "Tobin C. Harding" <tobin@kernel.org> Cc: Christoph Lameter <cl@linux.com> Cc: Huang Ying <ying.huang@intel.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: Qian Cai <cai@lca.pw> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/uapi/linux/mempolicy.h | 7 +++++++ mm/vmscan.c | 8 -------- 2 files changed, 7 insertions(+), 8 deletions(-) --- a/include/uapi/linux/mempolicy.h~mm-vmscan-move-reclaim-bits-to-uapi-header +++ a/include/uapi/linux/mempolicy.h @@ -64,5 +64,12 @@ enum { #define MPOL_F_MOF (1 << 3) /* this policy wants migrate on fault */ #define MPOL_F_MORON (1 << 4) /* Migrate On protnone Reference On Node */ +/* + * These bit locations are exposed in the vm.zone_reclaim_mode sysctl + * ABI. New bits are OK, but existing bits can never change. + */ +#define RECLAIM_ZONE (1<<0) /* Run shrink_inactive_list on the zone */ +#define RECLAIM_WRITE (1<<1) /* Writeout pages during reclaim */ +#define RECLAIM_UNMAP (1<<2) /* Unmap pages during reclaim */ #endif /* _UAPI_LINUX_MEMPOLICY_H */ --- a/mm/vmscan.c~mm-vmscan-move-reclaim-bits-to-uapi-header +++ a/mm/vmscan.c @@ -4087,14 +4087,6 @@ module_init(kswapd_init) int node_reclaim_mode __read_mostly; /* - * These bit locations are exposed in the vm.zone_reclaim_mode sysctl - * ABI. New bits are OK, but existing bits can never change. - */ -#define RECLAIM_ZONE (1<<0) /* Run shrink_inactive_list on the zone */ -#define RECLAIM_WRITE (1<<1) /* Writeout pages during reclaim */ -#define RECLAIM_UNMAP (1<<2) /* Unmap pages during reclaim */ - -/* * Priority for NODE_RECLAIM. This determines the fraction of pages * of a node considered for each zone_reclaim. 4 scans 1/16th of * a zone. _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 061/143] mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks 2021-05-05 1:32 incoming Andrew Morton ` (59 preceding siblings ...) 2021-05-05 1:36 ` [patch 060/143] mm/vmscan: move RECLAIM* bits to uapi header Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 062/143] mm: vmscan: use nid from shrink_control for tracepoint Andrew Morton ` (79 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, alex.shi, ben.widawsky, cai, cl, dan.j.williams, dave.hansen, dwagner, linux-mm, mm-commits, osalvador, rientjes, tobin, torvalds, ying.huang From: Dave Hansen <dave.hansen@linux.intel.com> Subject: mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks RECLAIM_ZONE was assumed to be unused because it was never explicitly used in the kernel. However, there were a number of places where it was checked implicitly by checking 'node_reclaim_mode' for a zero value. These zero checks are not great because it is not obvious what a zero mode *means* in the code. Replace them with a helper which makes it more obvious: node_reclaim_enabled(). This helper also provides a handy place to explicitly check the RECLAIM_ZONE bit itself. Check it explicitly there to make it more obvious where the bit can affect behavior. This should have no functional impact. Link: https://lkml.kernel.org/r/20210219172559.BF589C44@viggo.jf.intel.com Signed-off-by: Dave Hansen <dave.hansen@linux.intel.com> Reviewed-by: Ben Widawsky <ben.widawsky@intel.com> Reviewed-by: Oscar Salvador <osalvador@suse.de> Acked-by: Christoph Lameter <cl@linux.com> Acked-by: David Rientjes <rientjes@google.com> Cc: Alex Shi <alex.shi@linux.alibaba.com> Cc: "Tobin C. Harding" <tobin@kernel.org> Cc: Huang Ying <ying.huang@intel.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: Qian Cai <cai@lca.pw> Cc: Daniel Wagner <dwagner@suse.de> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/swap.h | 7 +++++++ mm/khugepaged.c | 2 +- mm/page_alloc.c | 2 +- 3 files changed, 9 insertions(+), 2 deletions(-) --- a/include/linux/swap.h~mm-vmscan-replace-implicit-reclaim_zone-checks-with-explicit-checks +++ a/include/linux/swap.h @@ -12,6 +12,7 @@ #include <linux/fs.h> #include <linux/atomic.h> #include <linux/page-flags.h> +#include <uapi/linux/mempolicy.h> #include <asm/page.h> struct notifier_block; @@ -378,6 +379,12 @@ extern int sysctl_min_slab_ratio; #define node_reclaim_mode 0 #endif +static inline bool node_reclaim_enabled(void) +{ + /* Is any node_reclaim_mode bit set? */ + return node_reclaim_mode & (RECLAIM_ZONE|RECLAIM_WRITE|RECLAIM_UNMAP); +} + extern void check_move_unevictable_pages(struct pagevec *pvec); extern int kswapd_run(int nid); --- a/mm/khugepaged.c~mm-vmscan-replace-implicit-reclaim_zone-checks-with-explicit-checks +++ a/mm/khugepaged.c @@ -809,7 +809,7 @@ static bool khugepaged_scan_abort(int ni * If node_reclaim_mode is disabled, then no extra effort is made to * allocate memory locally. */ - if (!node_reclaim_mode) + if (!node_reclaim_enabled()) return false; /* If there is a count for this node already, it must be acceptable */ --- a/mm/page_alloc.c~mm-vmscan-replace-implicit-reclaim_zone-checks-with-explicit-checks +++ a/mm/page_alloc.c @@ -3968,7 +3968,7 @@ retry: if (alloc_flags & ALLOC_NO_WATERMARKS) goto try_this_zone; - if (node_reclaim_mode == 0 || + if (!node_reclaim_enabled() || !zone_allows_reclaim(ac->preferred_zoneref->zone, zone)) continue; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 062/143] mm: vmscan: use nid from shrink_control for tracepoint 2021-05-05 1:32 incoming Andrew Morton ` (60 preceding siblings ...) 2021-05-05 1:36 ` [patch 061/143] mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 063/143] mm: vmscan: consolidate shrinker_maps handling code Andrew Morton ` (78 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits, shakeelb, shy828301, torvalds, vbabka From: Yang Shi <shy828301@gmail.com> Subject: mm: vmscan: use nid from shrink_control for tracepoint Patch series "Make shrinker's nr_deferred memcg aware", v10. Recently huge amount one-off slab drop was seen on some vfs metadata heavy workloads, it turned out there were huge amount accumulated nr_deferred objects seen by the shrinker. On our production machine, I saw absurd number of nr_deferred shown as the below tracing result: <...>-48776 [032] .... 27970562.458916: mm_shrink_slab_start: super_cache_scan+0x0/0x1a0 ffff9a83046f3458: nid: 0 objects to shrink 2531805877005 gfp_flags GFP_HIGHUSER_MOVABLE pgs_scanned 32 lru_pgs 9300 cache items 1667 delta 11 total_scan 833 There are 2.5 trillion deferred objects on one node, assuming all of them are dentry (192 bytes per object), so the total size of deferred on one node is ~480TB. It is definitely ridiculous. I managed to reproduce this problem with kernel build workload plus negative dentry generator. First step, run the below kernel build test script: NR_CPUS=`cat /proc/cpuinfo | grep -e processor | wc -l` cd /root/Buildarea/linux-stable for i in `seq 1500`; do cgcreate -g memory:kern_build echo 4G > /sys/fs/cgroup/memory/kern_build/memory.limit_in_bytes echo 3 > /proc/sys/vm/drop_caches cgexec -g memory:kern_build make clean > /dev/null 2>&1 cgexec -g memory:kern_build make -j$NR_CPUS > /dev/null 2>&1 cgdelete -g memory:kern_build done Then run the below negative dentry generator script: NR_CPUS=`cat /proc/cpuinfo | grep -e processor | wc -l` mkdir /sys/fs/cgroup/memory/test echo $$ > /sys/fs/cgroup/memory/test/tasks for i in `seq $NR_CPUS`; do while true; do FILE=`head /dev/urandom | tr -dc A-Za-z0-9 | head -c 64` cat $FILE 2>/dev/null done & done Then kswapd will shrink half of dentry cache in just one loop as the below tracing result showed: kswapd0-475 [028] .... 305968.252561: mm_shrink_slab_start: super_cache_scan+0x0/0x190 0000000024acf00c: nid: 0 objects to shrink 4994376020 gfp_flags GFP_KERNEL cache items 93689873 delta 45746 total_scan 46844936 priority 12 kswapd0-475 [021] .... 306013.099399: mm_shrink_slab_end: super_cache_scan+0x0/0x190 0000000024acf00c: nid: 0 unused scan count 4994376020 new scan count 4947576838 total_scan 8 last shrinker return val 46844928 There were huge number of deferred objects before the shrinker was called, the behavior does match the code but it might be not desirable from the user's stand of point. The excessive amount of nr_deferred might be accumulated due to various reasons, for example: * GFP_NOFS allocation * Significant times of small amount scan (< scan_batch, 1024 for vfs metadata) However the LRUs of slabs are per memcg (memcg-aware shrinkers) but the deferred objects is per shrinker, this may have some bad effects: * Poor isolation among memcgs. Some memcgs which happen to have frequent limit reclaim may get nr_deferred accumulated to a huge number, then other innocent memcgs may take the fall. In our case the main workload was hit. * Unbounded deferred objects. There is no cap for deferred objects, it can outgrow ridiculously as the tracing result showed. * Easy to get out of control. Although shrinkers take into account deferred objects, but it can go out of control easily. One misconfigured memcg could incur absurd amount of deferred objects in a period of time. * Sort of reclaim problems, i.e. over reclaim, long reclaim latency, etc. There may be hundred GB slab caches for vfe metadata heavy workload, shrink half of them may take minutes. We observed latency spike due to the prolonged reclaim. These issues also have been discussed in https://lore.kernel.org/linux-mm/20200916185823.5347-1-shy828301@gmail.com/. The patchset is the outcome of that discussion. So this patchset makes nr_deferred per-memcg to tackle the problem. It does: * Have memcg_shrinker_deferred per memcg per node, just like what shrinker_map does. Instead it is an atomic_long_t array, each element represent one shrinker even though the shrinker is not memcg aware, this simplifies the implementation. For memcg aware shrinkers, the deferred objects are just accumulated to its own memcg. The shrinkers just see nr_deferred from its own memcg. Non memcg aware shrinkers still use global nr_deferred from struct shrinker. * Once the memcg is offlined, its nr_deferred will be reparented to its parent along with LRUs. * The root memcg has memcg_shrinker_deferred array too. It simplifies the handling of reparenting to root memcg. * Cap nr_deferred to 2x of the length of lru. The idea is borrowed from Dave Chinner's series (https://lore.kernel.org/linux-xfs/20191031234618.15403-1-david@fromorbit.com/) The downside is each memcg has to allocate extra memory to store the nr_deferred array. On our production environment, there are typically around 40 shrinkers, so each memcg needs ~320 bytes. 10K memcgs would need ~3.2MB memory. It seems fine. We have been running the patched kernel on some hosts of our fleet (test and production) for months, it works very well. The monitor data shows the working set is sustained as expected. This patch (of 13): The tracepoint's nid should show what node the shrink happens on, the start tracepoint uses nid from shrinkctl, but the nid might be set to 0 before end tracepoint if the shrinker is not NUMA aware, so the tracing log may show the shrink happens on one node but end up on the other node. It seems confusing. And the following patch will remove using nid directly in do_shrink_slab(), this patch also helps cleanup the code. Link: https://lkml.kernel.org/r/20210311190845.9708-1-shy828301@gmail.com Link: https://lkml.kernel.org/r/20210311190845.9708-2-shy828301@gmail.com Signed-off-by: Yang Shi <shy828301@gmail.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Acked-by: Roman Gushchin <guro@fb.com> Cc: Dave Chinner <david@fromorbit.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@suse.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmscan.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/vmscan.c~mm-vmscan-use-nid-from-shrink_control-for-tracepoint +++ a/mm/vmscan.c @@ -536,7 +536,7 @@ static unsigned long do_shrink_slab(stru else new_nr = atomic_long_read(&shrinker->nr_deferred[nid]); - trace_mm_shrink_slab_end(shrinker, nid, freed, nr, new_nr, total_scan); + trace_mm_shrink_slab_end(shrinker, shrinkctl->nid, freed, nr, new_nr, total_scan); return freed; } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 063/143] mm: vmscan: consolidate shrinker_maps handling code 2021-05-05 1:32 incoming Andrew Morton ` (61 preceding siblings ...) 2021-05-05 1:36 ` [patch 062/143] mm: vmscan: use nid from shrink_control for tracepoint Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 064/143] mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation Andrew Morton ` (77 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits, shakeelb, shy828301, torvalds, vbabka From: Yang Shi <shy828301@gmail.com> Subject: mm: vmscan: consolidate shrinker_maps handling code The shrinker map management is not purely memcg specific, it is at the intersection between memory cgroup and shrinkers. It's allocation and assignment of a structure, and the only memcg bit is the map is being stored in a memcg structure. So move the shrinker_maps handling code into vmscan.c for tighter integration with shrinker code, and remove the "memcg_" prefix. There is no functional change. Link: https://lkml.kernel.org/r/20210311190845.9708-3-shy828301@gmail.com Signed-off-by: Yang Shi <shy828301@gmail.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com> Acked-by: Roman Gushchin <guro@fb.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Cc: Dave Chinner <david@fromorbit.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@suse.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/memcontrol.h | 11 +- mm/huge_memory.c | 4 - mm/list_lru.c | 6 - mm/memcontrol.c | 130 ---------------------------------- mm/vmscan.c | 132 ++++++++++++++++++++++++++++++++++- 5 files changed, 142 insertions(+), 141 deletions(-) --- a/include/linux/memcontrol.h~mm-vmscan-consolidate-shrinker_maps-handling-code +++ a/include/linux/memcontrol.h @@ -1610,10 +1610,9 @@ static inline bool mem_cgroup_under_sock return false; } -extern int memcg_expand_shrinker_maps(int new_id); - -extern void memcg_set_shrinker_bit(struct mem_cgroup *memcg, - int nid, int shrinker_id); +int alloc_shrinker_maps(struct mem_cgroup *memcg); +void free_shrinker_maps(struct mem_cgroup *memcg); +void set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id); #else #define mem_cgroup_sockets_enabled 0 static inline void mem_cgroup_sk_alloc(struct sock *sk) { }; @@ -1623,8 +1622,8 @@ static inline bool mem_cgroup_under_sock return false; } -static inline void memcg_set_shrinker_bit(struct mem_cgroup *memcg, - int nid, int shrinker_id) +static inline void set_shrinker_bit(struct mem_cgroup *memcg, + int nid, int shrinker_id) { } #endif --- a/mm/huge_memory.c~mm-vmscan-consolidate-shrinker_maps-handling-code +++ a/mm/huge_memory.c @@ -2830,8 +2830,8 @@ void deferred_split_huge_page(struct pag ds_queue->split_queue_len++; #ifdef CONFIG_MEMCG if (memcg) - memcg_set_shrinker_bit(memcg, page_to_nid(page), - deferred_split_shrinker.id); + set_shrinker_bit(memcg, page_to_nid(page), + deferred_split_shrinker.id); #endif } spin_unlock_irqrestore(&ds_queue->split_queue_lock, flags); --- a/mm/list_lru.c~mm-vmscan-consolidate-shrinker_maps-handling-code +++ a/mm/list_lru.c @@ -125,8 +125,8 @@ bool list_lru_add(struct list_lru *lru, list_add_tail(item, &l->list); /* Set shrinker bit if the first element was added */ if (!l->nr_items++) - memcg_set_shrinker_bit(memcg, nid, - lru_shrinker_id(lru)); + set_shrinker_bit(memcg, nid, + lru_shrinker_id(lru)); nlru->nr_items++; spin_unlock(&nlru->lock); return true; @@ -540,7 +540,7 @@ static void memcg_drain_list_lru_node(st if (src->nr_items) { dst->nr_items += src->nr_items; - memcg_set_shrinker_bit(dst_memcg, nid, lru_shrinker_id(lru)); + set_shrinker_bit(dst_memcg, nid, lru_shrinker_id(lru)); src->nr_items = 0; } --- a/mm/memcontrol.c~mm-vmscan-consolidate-shrinker_maps-handling-code +++ a/mm/memcontrol.c @@ -400,130 +400,6 @@ DEFINE_STATIC_KEY_FALSE(memcg_kmem_enabl EXPORT_SYMBOL(memcg_kmem_enabled_key); #endif -static int memcg_shrinker_map_size; -static DEFINE_MUTEX(memcg_shrinker_map_mutex); - -static void memcg_free_shrinker_map_rcu(struct rcu_head *head) -{ - kvfree(container_of(head, struct memcg_shrinker_map, rcu)); -} - -static int memcg_expand_one_shrinker_map(struct mem_cgroup *memcg, - int size, int old_size) -{ - struct memcg_shrinker_map *new, *old; - struct mem_cgroup_per_node *pn; - int nid; - - lockdep_assert_held(&memcg_shrinker_map_mutex); - - for_each_node(nid) { - pn = memcg->nodeinfo[nid]; - old = rcu_dereference_protected(pn->shrinker_map, true); - /* Not yet online memcg */ - if (!old) - return 0; - - new = kvmalloc_node(sizeof(*new) + size, GFP_KERNEL, nid); - if (!new) - return -ENOMEM; - - /* Set all old bits, clear all new bits */ - memset(new->map, (int)0xff, old_size); - memset((void *)new->map + old_size, 0, size - old_size); - - rcu_assign_pointer(pn->shrinker_map, new); - call_rcu(&old->rcu, memcg_free_shrinker_map_rcu); - } - - return 0; -} - -static void memcg_free_shrinker_maps(struct mem_cgroup *memcg) -{ - struct mem_cgroup_per_node *pn; - struct memcg_shrinker_map *map; - int nid; - - if (mem_cgroup_is_root(memcg)) - return; - - for_each_node(nid) { - pn = memcg->nodeinfo[nid]; - map = rcu_dereference_protected(pn->shrinker_map, true); - kvfree(map); - rcu_assign_pointer(pn->shrinker_map, NULL); - } -} - -static int memcg_alloc_shrinker_maps(struct mem_cgroup *memcg) -{ - struct memcg_shrinker_map *map; - int nid, size, ret = 0; - - if (mem_cgroup_is_root(memcg)) - return 0; - - mutex_lock(&memcg_shrinker_map_mutex); - size = memcg_shrinker_map_size; - for_each_node(nid) { - map = kvzalloc_node(sizeof(*map) + size, GFP_KERNEL, nid); - if (!map) { - memcg_free_shrinker_maps(memcg); - ret = -ENOMEM; - break; - } - rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_map, map); - } - mutex_unlock(&memcg_shrinker_map_mutex); - - return ret; -} - -int memcg_expand_shrinker_maps(int new_id) -{ - int size, old_size, ret = 0; - struct mem_cgroup *memcg; - - size = DIV_ROUND_UP(new_id + 1, BITS_PER_LONG) * sizeof(unsigned long); - old_size = memcg_shrinker_map_size; - if (size <= old_size) - return 0; - - mutex_lock(&memcg_shrinker_map_mutex); - if (!root_mem_cgroup) - goto unlock; - - for_each_mem_cgroup(memcg) { - if (mem_cgroup_is_root(memcg)) - continue; - ret = memcg_expand_one_shrinker_map(memcg, size, old_size); - if (ret) { - mem_cgroup_iter_break(NULL, memcg); - goto unlock; - } - } -unlock: - if (!ret) - memcg_shrinker_map_size = size; - mutex_unlock(&memcg_shrinker_map_mutex); - return ret; -} - -void memcg_set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id) -{ - if (shrinker_id >= 0 && memcg && !mem_cgroup_is_root(memcg)) { - struct memcg_shrinker_map *map; - - rcu_read_lock(); - map = rcu_dereference(memcg->nodeinfo[nid]->shrinker_map); - /* Pairs with smp mb in shrink_slab() */ - smp_mb__before_atomic(); - set_bit(shrinker_id, map->map); - rcu_read_unlock(); - } -} - /** * mem_cgroup_css_from_page - css of the memcg associated with a page * @page: page of interest @@ -5242,11 +5118,11 @@ static int mem_cgroup_css_online(struct struct mem_cgroup *memcg = mem_cgroup_from_css(css); /* - * A memcg must be visible for memcg_expand_shrinker_maps() + * A memcg must be visible for expand_shrinker_maps() * by the time the maps are allocated. So, we allocate maps * here, when for_each_mem_cgroup() can't skip it. */ - if (memcg_alloc_shrinker_maps(memcg)) { + if (alloc_shrinker_maps(memcg)) { mem_cgroup_id_remove(memcg); return -ENOMEM; } @@ -5310,7 +5186,7 @@ static void mem_cgroup_css_free(struct c vmpressure_cleanup(&memcg->vmpressure); cancel_work_sync(&memcg->high_work); mem_cgroup_remove_from_trees(memcg); - memcg_free_shrinker_maps(memcg); + free_shrinker_maps(memcg); memcg_free_kmem(memcg); mem_cgroup_free(memcg); } --- a/mm/vmscan.c~mm-vmscan-consolidate-shrinker_maps-handling-code +++ a/mm/vmscan.c @@ -185,6 +185,132 @@ static LIST_HEAD(shrinker_list); static DECLARE_RWSEM(shrinker_rwsem); #ifdef CONFIG_MEMCG + +static int memcg_shrinker_map_size; +static DEFINE_MUTEX(memcg_shrinker_map_mutex); + +static void free_shrinker_map_rcu(struct rcu_head *head) +{ + kvfree(container_of(head, struct memcg_shrinker_map, rcu)); +} + +static int expand_one_shrinker_map(struct mem_cgroup *memcg, + int size, int old_size) +{ + struct memcg_shrinker_map *new, *old; + struct mem_cgroup_per_node *pn; + int nid; + + lockdep_assert_held(&memcg_shrinker_map_mutex); + + for_each_node(nid) { + pn = memcg->nodeinfo[nid]; + old = rcu_dereference_protected(pn->shrinker_map, true); + /* Not yet online memcg */ + if (!old) + return 0; + + new = kvmalloc_node(sizeof(*new) + size, GFP_KERNEL, nid); + if (!new) + return -ENOMEM; + + /* Set all old bits, clear all new bits */ + memset(new->map, (int)0xff, old_size); + memset((void *)new->map + old_size, 0, size - old_size); + + rcu_assign_pointer(pn->shrinker_map, new); + call_rcu(&old->rcu, free_shrinker_map_rcu); + } + + return 0; +} + +void free_shrinker_maps(struct mem_cgroup *memcg) +{ + struct mem_cgroup_per_node *pn; + struct memcg_shrinker_map *map; + int nid; + + if (mem_cgroup_is_root(memcg)) + return; + + for_each_node(nid) { + pn = memcg->nodeinfo[nid]; + map = rcu_dereference_protected(pn->shrinker_map, true); + kvfree(map); + rcu_assign_pointer(pn->shrinker_map, NULL); + } +} + +int alloc_shrinker_maps(struct mem_cgroup *memcg) +{ + struct memcg_shrinker_map *map; + int nid, size, ret = 0; + + if (mem_cgroup_is_root(memcg)) + return 0; + + mutex_lock(&memcg_shrinker_map_mutex); + size = memcg_shrinker_map_size; + for_each_node(nid) { + map = kvzalloc_node(sizeof(*map) + size, GFP_KERNEL, nid); + if (!map) { + free_shrinker_maps(memcg); + ret = -ENOMEM; + break; + } + rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_map, map); + } + mutex_unlock(&memcg_shrinker_map_mutex); + + return ret; +} + +static int expand_shrinker_maps(int new_id) +{ + int size, old_size, ret = 0; + struct mem_cgroup *memcg; + + size = DIV_ROUND_UP(new_id + 1, BITS_PER_LONG) * sizeof(unsigned long); + old_size = memcg_shrinker_map_size; + if (size <= old_size) + return 0; + + mutex_lock(&memcg_shrinker_map_mutex); + if (!root_mem_cgroup) + goto unlock; + + memcg = mem_cgroup_iter(NULL, NULL, NULL); + do { + if (mem_cgroup_is_root(memcg)) + continue; + ret = expand_one_shrinker_map(memcg, size, old_size); + if (ret) { + mem_cgroup_iter_break(NULL, memcg); + goto unlock; + } + } while ((memcg = mem_cgroup_iter(NULL, memcg, NULL)) != NULL); +unlock: + if (!ret) + memcg_shrinker_map_size = size; + mutex_unlock(&memcg_shrinker_map_mutex); + return ret; +} + +void set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id) +{ + if (shrinker_id >= 0 && memcg && !mem_cgroup_is_root(memcg)) { + struct memcg_shrinker_map *map; + + rcu_read_lock(); + map = rcu_dereference(memcg->nodeinfo[nid]->shrinker_map); + /* Pairs with smp mb in shrink_slab() */ + smp_mb__before_atomic(); + set_bit(shrinker_id, map->map); + rcu_read_unlock(); + } +} + /* * We allow subsystems to populate their shrinker-related * LRU lists before register_shrinker_prepared() is called @@ -212,7 +338,7 @@ static int prealloc_memcg_shrinker(struc goto unlock; if (id >= shrinker_nr_max) { - if (memcg_expand_shrinker_maps(id)) { + if (expand_shrinker_maps(id)) { idr_remove(&shrinker_idr, id); goto unlock; } @@ -590,7 +716,7 @@ static unsigned long shrink_slab_memcg(g * case, we invoke the shrinker one more time and reset * the bit if it reports that it is not empty anymore. * The memory barrier here pairs with the barrier in - * memcg_set_shrinker_bit(): + * set_shrinker_bit(): * * list_lru_add() shrink_slab_memcg() * list_add_tail() clear_bit() @@ -602,7 +728,7 @@ static unsigned long shrink_slab_memcg(g if (ret == SHRINK_EMPTY) ret = 0; else - memcg_set_shrinker_bit(memcg, nid, i); + set_shrinker_bit(memcg, nid, i); } freed += ret; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 064/143] mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation 2021-05-05 1:32 incoming Andrew Morton ` (62 preceding siblings ...) 2021-05-05 1:36 ` [patch 063/143] mm: vmscan: consolidate shrinker_maps handling code Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 065/143] mm: vmscan: remove memcg_shrinker_map_size Andrew Morton ` (76 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits, shakeelb, shy828301, torvalds, vbabka From: Yang Shi <shy828301@gmail.com> Subject: mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation Since memcg_shrinker_map_size just can be changed under holding shrinker_rwsem exclusively, the read side can be protected by holding read lock, so it sounds superfluous to have a dedicated mutex. Kirill Tkhai suggested use write lock since: * We want the assignment to shrinker_maps is visible for shrink_slab_memcg(). * The rcu_dereference_protected() dereferrencing in shrink_slab_memcg(), but in case of we use READ lock in alloc_shrinker_maps(), the dereferrencing is not actually protected. * READ lock makes alloc_shrinker_info() racy against memory allocation fail. alloc_shrinker_info()->free_shrinker_info() may free memory right after shrink_slab_memcg() dereferenced it. You may say shrink_slab_memcg()->mem_cgroup_online() protects us from it? Yes, sure, but this is not the thing we want to remember in the future, since this spreads modularity. And a test with heavy paging workload didn't show write lock makes things worse. Link: https://lkml.kernel.org/r/20210311190845.9708-4-shy828301@gmail.com Signed-off-by: Yang Shi <shy828301@gmail.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com> Acked-by: Roman Gushchin <guro@fb.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Cc: Dave Chinner <david@fromorbit.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@suse.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmscan.c | 18 ++++++++---------- 1 file changed, 8 insertions(+), 10 deletions(-) --- a/mm/vmscan.c~mm-vmscan-use-shrinker_rwsem-to-protect-shrinker_maps-allocation +++ a/mm/vmscan.c @@ -187,7 +187,6 @@ static DECLARE_RWSEM(shrinker_rwsem); #ifdef CONFIG_MEMCG static int memcg_shrinker_map_size; -static DEFINE_MUTEX(memcg_shrinker_map_mutex); static void free_shrinker_map_rcu(struct rcu_head *head) { @@ -201,8 +200,6 @@ static int expand_one_shrinker_map(struc struct mem_cgroup_per_node *pn; int nid; - lockdep_assert_held(&memcg_shrinker_map_mutex); - for_each_node(nid) { pn = memcg->nodeinfo[nid]; old = rcu_dereference_protected(pn->shrinker_map, true); @@ -250,7 +247,7 @@ int alloc_shrinker_maps(struct mem_cgrou if (mem_cgroup_is_root(memcg)) return 0; - mutex_lock(&memcg_shrinker_map_mutex); + down_write(&shrinker_rwsem); size = memcg_shrinker_map_size; for_each_node(nid) { map = kvzalloc_node(sizeof(*map) + size, GFP_KERNEL, nid); @@ -261,7 +258,7 @@ int alloc_shrinker_maps(struct mem_cgrou } rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_map, map); } - mutex_unlock(&memcg_shrinker_map_mutex); + up_write(&shrinker_rwsem); return ret; } @@ -276,9 +273,10 @@ static int expand_shrinker_maps(int new_ if (size <= old_size) return 0; - mutex_lock(&memcg_shrinker_map_mutex); if (!root_mem_cgroup) - goto unlock; + goto out; + + lockdep_assert_held(&shrinker_rwsem); memcg = mem_cgroup_iter(NULL, NULL, NULL); do { @@ -287,13 +285,13 @@ static int expand_shrinker_maps(int new_ ret = expand_one_shrinker_map(memcg, size, old_size); if (ret) { mem_cgroup_iter_break(NULL, memcg); - goto unlock; + goto out; } } while ((memcg = mem_cgroup_iter(NULL, memcg, NULL)) != NULL); -unlock: +out: if (!ret) memcg_shrinker_map_size = size; - mutex_unlock(&memcg_shrinker_map_mutex); + return ret; } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 065/143] mm: vmscan: remove memcg_shrinker_map_size 2021-05-05 1:32 incoming Andrew Morton ` (63 preceding siblings ...) 2021-05-05 1:36 ` [patch 064/143] mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 066/143] mm: vmscan: use kvfree_rcu instead of call_rcu Andrew Morton ` (75 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits, shakeelb, shy828301, torvalds, vbabka From: Yang Shi <shy828301@gmail.com> Subject: mm: vmscan: remove memcg_shrinker_map_size Both memcg_shrinker_map_size and shrinker_nr_max is maintained, but actually the map size can be calculated via shrinker_nr_max, so it seems unnecessary to keep both. Remove memcg_shrinker_map_size since shrinker_nr_max is also used by iterating the bit map. Link: https://lkml.kernel.org/r/20210311190845.9708-5-shy828301@gmail.com Signed-off-by: Yang Shi <shy828301@gmail.com> Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com> Acked-by: Roman Gushchin <guro@fb.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Reviewed-by: Shakeel Butt <shakeelb@google.com> Cc: Dave Chinner <david@fromorbit.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@suse.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmscan.c | 20 +++++++++++--------- 1 file changed, 11 insertions(+), 9 deletions(-) --- a/mm/vmscan.c~mm-vmscan-remove-memcg_shrinker_map_size +++ a/mm/vmscan.c @@ -185,8 +185,12 @@ static LIST_HEAD(shrinker_list); static DECLARE_RWSEM(shrinker_rwsem); #ifdef CONFIG_MEMCG +static int shrinker_nr_max; -static int memcg_shrinker_map_size; +static inline int shrinker_map_size(int nr_items) +{ + return (DIV_ROUND_UP(nr_items, BITS_PER_LONG) * sizeof(unsigned long)); +} static void free_shrinker_map_rcu(struct rcu_head *head) { @@ -248,7 +252,7 @@ int alloc_shrinker_maps(struct mem_cgrou return 0; down_write(&shrinker_rwsem); - size = memcg_shrinker_map_size; + size = shrinker_map_size(shrinker_nr_max); for_each_node(nid) { map = kvzalloc_node(sizeof(*map) + size, GFP_KERNEL, nid); if (!map) { @@ -266,12 +270,13 @@ int alloc_shrinker_maps(struct mem_cgrou static int expand_shrinker_maps(int new_id) { int size, old_size, ret = 0; + int new_nr_max = new_id + 1; struct mem_cgroup *memcg; - size = DIV_ROUND_UP(new_id + 1, BITS_PER_LONG) * sizeof(unsigned long); - old_size = memcg_shrinker_map_size; + size = shrinker_map_size(new_nr_max); + old_size = shrinker_map_size(shrinker_nr_max); if (size <= old_size) - return 0; + goto out; if (!root_mem_cgroup) goto out; @@ -290,7 +295,7 @@ static int expand_shrinker_maps(int new_ } while ((memcg = mem_cgroup_iter(NULL, memcg, NULL)) != NULL); out: if (!ret) - memcg_shrinker_map_size = size; + shrinker_nr_max = new_nr_max; return ret; } @@ -323,7 +328,6 @@ void set_shrinker_bit(struct mem_cgroup #define SHRINKER_REGISTERING ((struct shrinker *)~0UL) static DEFINE_IDR(shrinker_idr); -static int shrinker_nr_max; static int prealloc_memcg_shrinker(struct shrinker *shrinker) { @@ -340,8 +344,6 @@ static int prealloc_memcg_shrinker(struc idr_remove(&shrinker_idr, id); goto unlock; } - - shrinker_nr_max = id + 1; } shrinker->id = id; ret = 0; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 066/143] mm: vmscan: use kvfree_rcu instead of call_rcu 2021-05-05 1:32 incoming Andrew Morton ` (64 preceding siblings ...) 2021-05-05 1:36 ` [patch 065/143] mm: vmscan: remove memcg_shrinker_map_size Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 067/143] mm: memcontrol: rename shrinker_map to shrinker_info Andrew Morton ` (74 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits, shakeelb, shy828301, torvalds, vbabka From: Yang Shi <shy828301@gmail.com> Subject: mm: vmscan: use kvfree_rcu instead of call_rcu Using kvfree_rcu() to free the old shrinker_maps instead of call_rcu(). We don't have to define a dedicated callback for call_rcu() anymore. Link: https://lkml.kernel.org/r/20210311190845.9708-6-shy828301@gmail.com Signed-off-by: Yang Shi <shy828301@gmail.com> Acked-by: Roman Gushchin <guro@fb.com> Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Cc: Dave Chinner <david@fromorbit.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@suse.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmscan.c | 7 +------ 1 file changed, 1 insertion(+), 6 deletions(-) --- a/mm/vmscan.c~mm-vmscan-use-kvfree_rcu-instead-of-call_rcu +++ a/mm/vmscan.c @@ -192,11 +192,6 @@ static inline int shrinker_map_size(int return (DIV_ROUND_UP(nr_items, BITS_PER_LONG) * sizeof(unsigned long)); } -static void free_shrinker_map_rcu(struct rcu_head *head) -{ - kvfree(container_of(head, struct memcg_shrinker_map, rcu)); -} - static int expand_one_shrinker_map(struct mem_cgroup *memcg, int size, int old_size) { @@ -220,7 +215,7 @@ static int expand_one_shrinker_map(struc memset((void *)new->map + old_size, 0, size - old_size); rcu_assign_pointer(pn->shrinker_map, new); - call_rcu(&old->rcu, free_shrinker_map_rcu); + kvfree_rcu(old, rcu); } return 0; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 067/143] mm: memcontrol: rename shrinker_map to shrinker_info 2021-05-05 1:32 incoming Andrew Morton ` (65 preceding siblings ...) 2021-05-05 1:36 ` [patch 066/143] mm: vmscan: use kvfree_rcu instead of call_rcu Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 068/143] mm: vmscan: add shrinker_info_protected() helper Andrew Morton ` (73 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits, shakeelb, shy828301, torvalds, vbabka From: Yang Shi <shy828301@gmail.com> Subject: mm: memcontrol: rename shrinker_map to shrinker_info The following patch is going to add nr_deferred into shrinker_map, the change will make shrinker_map not only include map anymore, so rename it to "memcg_shrinker_info". And this should make the patch adding nr_deferred cleaner and readable and make review easier. Also remove the "memcg_" prefix. Link: https://lkml.kernel.org/r/20210311190845.9708-7-shy828301@gmail.com Signed-off-by: Yang Shi <shy828301@gmail.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com> Acked-by: Roman Gushchin <guro@fb.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Cc: Dave Chinner <david@fromorbit.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@suse.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/memcontrol.h | 8 ++-- mm/memcontrol.c | 6 +-- mm/vmscan.c | 58 +++++++++++++++++------------------ 3 files changed, 36 insertions(+), 36 deletions(-) --- a/include/linux/memcontrol.h~mm-memcontrol-rename-shrinker_map-to-shrinker_info +++ a/include/linux/memcontrol.h @@ -117,7 +117,7 @@ struct batched_lruvec_stat { * Bitmap of shrinker::id corresponding to memcg-aware shrinkers, * which have elements charged to this memcg. */ -struct memcg_shrinker_map { +struct shrinker_info { struct rcu_head rcu; unsigned long map[]; }; @@ -145,7 +145,7 @@ struct mem_cgroup_per_node { struct mem_cgroup_reclaim_iter iter; - struct memcg_shrinker_map __rcu *shrinker_map; + struct shrinker_info __rcu *shrinker_info; struct rb_node tree_node; /* RB tree node */ unsigned long usage_in_excess;/* Set to the value by which */ @@ -1610,8 +1610,8 @@ static inline bool mem_cgroup_under_sock return false; } -int alloc_shrinker_maps(struct mem_cgroup *memcg); -void free_shrinker_maps(struct mem_cgroup *memcg); +int alloc_shrinker_info(struct mem_cgroup *memcg); +void free_shrinker_info(struct mem_cgroup *memcg); void set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id); #else #define mem_cgroup_sockets_enabled 0 --- a/mm/memcontrol.c~mm-memcontrol-rename-shrinker_map-to-shrinker_info +++ a/mm/memcontrol.c @@ -5118,11 +5118,11 @@ static int mem_cgroup_css_online(struct struct mem_cgroup *memcg = mem_cgroup_from_css(css); /* - * A memcg must be visible for expand_shrinker_maps() + * A memcg must be visible for expand_shrinker_info() * by the time the maps are allocated. So, we allocate maps * here, when for_each_mem_cgroup() can't skip it. */ - if (alloc_shrinker_maps(memcg)) { + if (alloc_shrinker_info(memcg)) { mem_cgroup_id_remove(memcg); return -ENOMEM; } @@ -5186,7 +5186,7 @@ static void mem_cgroup_css_free(struct c vmpressure_cleanup(&memcg->vmpressure); cancel_work_sync(&memcg->high_work); mem_cgroup_remove_from_trees(memcg); - free_shrinker_maps(memcg); + free_shrinker_info(memcg); memcg_free_kmem(memcg); mem_cgroup_free(memcg); } --- a/mm/vmscan.c~mm-memcontrol-rename-shrinker_map-to-shrinker_info +++ a/mm/vmscan.c @@ -192,16 +192,16 @@ static inline int shrinker_map_size(int return (DIV_ROUND_UP(nr_items, BITS_PER_LONG) * sizeof(unsigned long)); } -static int expand_one_shrinker_map(struct mem_cgroup *memcg, - int size, int old_size) +static int expand_one_shrinker_info(struct mem_cgroup *memcg, + int size, int old_size) { - struct memcg_shrinker_map *new, *old; + struct shrinker_info *new, *old; struct mem_cgroup_per_node *pn; int nid; for_each_node(nid) { pn = memcg->nodeinfo[nid]; - old = rcu_dereference_protected(pn->shrinker_map, true); + old = rcu_dereference_protected(pn->shrinker_info, true); /* Not yet online memcg */ if (!old) return 0; @@ -214,17 +214,17 @@ static int expand_one_shrinker_map(struc memset(new->map, (int)0xff, old_size); memset((void *)new->map + old_size, 0, size - old_size); - rcu_assign_pointer(pn->shrinker_map, new); + rcu_assign_pointer(pn->shrinker_info, new); kvfree_rcu(old, rcu); } return 0; } -void free_shrinker_maps(struct mem_cgroup *memcg) +void free_shrinker_info(struct mem_cgroup *memcg) { struct mem_cgroup_per_node *pn; - struct memcg_shrinker_map *map; + struct shrinker_info *info; int nid; if (mem_cgroup_is_root(memcg)) @@ -232,15 +232,15 @@ void free_shrinker_maps(struct mem_cgrou for_each_node(nid) { pn = memcg->nodeinfo[nid]; - map = rcu_dereference_protected(pn->shrinker_map, true); - kvfree(map); - rcu_assign_pointer(pn->shrinker_map, NULL); + info = rcu_dereference_protected(pn->shrinker_info, true); + kvfree(info); + rcu_assign_pointer(pn->shrinker_info, NULL); } } -int alloc_shrinker_maps(struct mem_cgroup *memcg) +int alloc_shrinker_info(struct mem_cgroup *memcg) { - struct memcg_shrinker_map *map; + struct shrinker_info *info; int nid, size, ret = 0; if (mem_cgroup_is_root(memcg)) @@ -249,20 +249,20 @@ int alloc_shrinker_maps(struct mem_cgrou down_write(&shrinker_rwsem); size = shrinker_map_size(shrinker_nr_max); for_each_node(nid) { - map = kvzalloc_node(sizeof(*map) + size, GFP_KERNEL, nid); - if (!map) { - free_shrinker_maps(memcg); + info = kvzalloc_node(sizeof(*info) + size, GFP_KERNEL, nid); + if (!info) { + free_shrinker_info(memcg); ret = -ENOMEM; break; } - rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_map, map); + rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_info, info); } up_write(&shrinker_rwsem); return ret; } -static int expand_shrinker_maps(int new_id) +static int expand_shrinker_info(int new_id) { int size, old_size, ret = 0; int new_nr_max = new_id + 1; @@ -282,7 +282,7 @@ static int expand_shrinker_maps(int new_ do { if (mem_cgroup_is_root(memcg)) continue; - ret = expand_one_shrinker_map(memcg, size, old_size); + ret = expand_one_shrinker_info(memcg, size, old_size); if (ret) { mem_cgroup_iter_break(NULL, memcg); goto out; @@ -298,13 +298,13 @@ out: void set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id) { if (shrinker_id >= 0 && memcg && !mem_cgroup_is_root(memcg)) { - struct memcg_shrinker_map *map; + struct shrinker_info *info; rcu_read_lock(); - map = rcu_dereference(memcg->nodeinfo[nid]->shrinker_map); + info = rcu_dereference(memcg->nodeinfo[nid]->shrinker_info); /* Pairs with smp mb in shrink_slab() */ smp_mb__before_atomic(); - set_bit(shrinker_id, map->map); + set_bit(shrinker_id, info->map); rcu_read_unlock(); } } @@ -335,7 +335,7 @@ static int prealloc_memcg_shrinker(struc goto unlock; if (id >= shrinker_nr_max) { - if (expand_shrinker_maps(id)) { + if (expand_shrinker_info(id)) { idr_remove(&shrinker_idr, id); goto unlock; } @@ -665,7 +665,7 @@ static unsigned long do_shrink_slab(stru static unsigned long shrink_slab_memcg(gfp_t gfp_mask, int nid, struct mem_cgroup *memcg, int priority) { - struct memcg_shrinker_map *map; + struct shrinker_info *info; unsigned long ret, freed = 0; int i; @@ -675,12 +675,12 @@ static unsigned long shrink_slab_memcg(g if (!down_read_trylock(&shrinker_rwsem)) return 0; - map = rcu_dereference_protected(memcg->nodeinfo[nid]->shrinker_map, - true); - if (unlikely(!map)) + info = rcu_dereference_protected(memcg->nodeinfo[nid]->shrinker_info, + true); + if (unlikely(!info)) goto unlock; - for_each_set_bit(i, map->map, shrinker_nr_max) { + for_each_set_bit(i, info->map, shrinker_nr_max) { struct shrink_control sc = { .gfp_mask = gfp_mask, .nid = nid, @@ -691,7 +691,7 @@ static unsigned long shrink_slab_memcg(g shrinker = idr_find(&shrinker_idr, i); if (unlikely(!shrinker || shrinker == SHRINKER_REGISTERING)) { if (!shrinker) - clear_bit(i, map->map); + clear_bit(i, info->map); continue; } @@ -702,7 +702,7 @@ static unsigned long shrink_slab_memcg(g ret = do_shrink_slab(&sc, shrinker, priority); if (ret == SHRINK_EMPTY) { - clear_bit(i, map->map); + clear_bit(i, info->map); /* * After the shrinker reported that it had no objects to * free, but before we cleared the corresponding bit in _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 068/143] mm: vmscan: add shrinker_info_protected() helper 2021-05-05 1:32 incoming Andrew Morton ` (66 preceding siblings ...) 2021-05-05 1:36 ` [patch 067/143] mm: memcontrol: rename shrinker_map to shrinker_info Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 069/143] mm: vmscan: use a new flag to indicate shrinker is registered Andrew Morton ` (72 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits, shakeelb, shy828301, torvalds, vbabka From: Yang Shi <shy828301@gmail.com> Subject: mm: vmscan: add shrinker_info_protected() helper The shrinker_info is dereferenced in a couple of places via rcu_dereference_protected with different calling conventions, for example, using mem_cgroup_nodeinfo helper or dereferencing memcg->nodeinfo[nid]->shrinker_info. And the later patch will add more dereference places. So extract the dereference into a helper to make the code more readable. No functional change. [akpm@linux-foundation.org: retain rcu_dereference_protected() in free_shrinker_info(), per Hugh] Link: https://lkml.kernel.org/r/20210311190845.9708-8-shy828301@gmail.com Signed-off-by: Yang Shi <shy828301@gmail.com> Acked-by: Roman Gushchin <guro@fb.com> Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Reviewed-by: Shakeel Butt <shakeelb@google.com> Cc: Dave Chinner <david@fromorbit.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@suse.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmscan.c | 12 +++++++++--- 1 file changed, 9 insertions(+), 3 deletions(-) --- a/mm/vmscan.c~mm-vmscan-add-shrinker_info_protected-helper +++ a/mm/vmscan.c @@ -192,6 +192,13 @@ static inline int shrinker_map_size(int return (DIV_ROUND_UP(nr_items, BITS_PER_LONG) * sizeof(unsigned long)); } +static struct shrinker_info *shrinker_info_protected(struct mem_cgroup *memcg, + int nid) +{ + return rcu_dereference_protected(memcg->nodeinfo[nid]->shrinker_info, + lockdep_is_held(&shrinker_rwsem)); +} + static int expand_one_shrinker_info(struct mem_cgroup *memcg, int size, int old_size) { @@ -201,7 +208,7 @@ static int expand_one_shrinker_info(stru for_each_node(nid) { pn = memcg->nodeinfo[nid]; - old = rcu_dereference_protected(pn->shrinker_info, true); + old = shrinker_info_protected(memcg, nid); /* Not yet online memcg */ if (!old) return 0; @@ -675,8 +682,7 @@ static unsigned long shrink_slab_memcg(g if (!down_read_trylock(&shrinker_rwsem)) return 0; - info = rcu_dereference_protected(memcg->nodeinfo[nid]->shrinker_info, - true); + info = shrinker_info_protected(memcg, nid); if (unlikely(!info)) goto unlock; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 069/143] mm: vmscan: use a new flag to indicate shrinker is registered 2021-05-05 1:32 incoming Andrew Morton ` (67 preceding siblings ...) 2021-05-05 1:36 ` [patch 068/143] mm: vmscan: add shrinker_info_protected() helper Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 070/143] mm: vmscan: add per memcg shrinker nr_deferred Andrew Morton ` (71 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits, shakeelb, shy828301, torvalds, vbabka From: Yang Shi <shy828301@gmail.com> Subject: mm: vmscan: use a new flag to indicate shrinker is registered Currently registered shrinker is indicated by non-NULL shrinker->nr_deferred. This approach is fine with nr_deferred at the shrinker level, but the following patches will move MEMCG_AWARE shrinkers' nr_deferred to memcg level, so their shrinker->nr_deferred would always be NULL. This would prevent the shrinkers from unregistering correctly. Remove SHRINKER_REGISTERING since we could check if shrinker is registered successfully by the new flag. Link: https://lkml.kernel.org/r/20210311190845.9708-9-shy828301@gmail.com Signed-off-by: Yang Shi <shy828301@gmail.com> Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Acked-by: Roman Gushchin <guro@fb.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Cc: Dave Chinner <david@fromorbit.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@suse.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/shrinker.h | 7 +++--- mm/vmscan.c | 40 +++++++++++++------------------------ 2 files changed, 19 insertions(+), 28 deletions(-) --- a/include/linux/shrinker.h~mm-vmscan-use-a-new-flag-to-indicate-shrinker-is-registered +++ a/include/linux/shrinker.h @@ -79,13 +79,14 @@ struct shrinker { #define DEFAULT_SEEKS 2 /* A good number if you don't know better. */ /* Flags */ -#define SHRINKER_NUMA_AWARE (1 << 0) -#define SHRINKER_MEMCG_AWARE (1 << 1) +#define SHRINKER_REGISTERED (1 << 0) +#define SHRINKER_NUMA_AWARE (1 << 1) +#define SHRINKER_MEMCG_AWARE (1 << 2) /* * It just makes sense when the shrinker is also MEMCG_AWARE for now, * non-MEMCG_AWARE shrinker should not have this flag set. */ -#define SHRINKER_NONSLAB (1 << 2) +#define SHRINKER_NONSLAB (1 << 3) extern int prealloc_shrinker(struct shrinker *shrinker); extern void register_shrinker_prepared(struct shrinker *shrinker); --- a/mm/vmscan.c~mm-vmscan-use-a-new-flag-to-indicate-shrinker-is-registered +++ a/mm/vmscan.c @@ -316,19 +316,6 @@ void set_shrinker_bit(struct mem_cgroup } } -/* - * We allow subsystems to populate their shrinker-related - * LRU lists before register_shrinker_prepared() is called - * for the shrinker, since we don't want to impose - * restrictions on their internal registration order. - * In this case shrink_slab_memcg() may find corresponding - * bit is set in the shrinkers map. - * - * This value is used by the function to detect registering - * shrinkers and to skip do_shrink_slab() calls for them. - */ -#define SHRINKER_REGISTERING ((struct shrinker *)~0UL) - static DEFINE_IDR(shrinker_idr); static int prealloc_memcg_shrinker(struct shrinker *shrinker) @@ -337,7 +324,7 @@ static int prealloc_memcg_shrinker(struc down_write(&shrinker_rwsem); /* This may call shrinker, so it must use down_read_trylock() */ - id = idr_alloc(&shrinker_idr, SHRINKER_REGISTERING, 0, 0, GFP_KERNEL); + id = idr_alloc(&shrinker_idr, shrinker, 0, 0, GFP_KERNEL); if (id < 0) goto unlock; @@ -360,9 +347,9 @@ static void unregister_memcg_shrinker(st BUG_ON(id < 0); - down_write(&shrinker_rwsem); + lockdep_assert_held(&shrinker_rwsem); + idr_remove(&shrinker_idr, id); - up_write(&shrinker_rwsem); } static bool cgroup_reclaim(struct scan_control *sc) @@ -490,8 +477,11 @@ void free_prealloced_shrinker(struct shr if (!shrinker->nr_deferred) return; - if (shrinker->flags & SHRINKER_MEMCG_AWARE) + if (shrinker->flags & SHRINKER_MEMCG_AWARE) { + down_write(&shrinker_rwsem); unregister_memcg_shrinker(shrinker); + up_write(&shrinker_rwsem); + } kfree(shrinker->nr_deferred); shrinker->nr_deferred = NULL; @@ -501,10 +491,7 @@ void register_shrinker_prepared(struct s { down_write(&shrinker_rwsem); list_add_tail(&shrinker->list, &shrinker_list); -#ifdef CONFIG_MEMCG - if (shrinker->flags & SHRINKER_MEMCG_AWARE) - idr_replace(&shrinker_idr, shrinker, shrinker->id); -#endif + shrinker->flags |= SHRINKER_REGISTERED; up_write(&shrinker_rwsem); } @@ -524,13 +511,16 @@ EXPORT_SYMBOL(register_shrinker); */ void unregister_shrinker(struct shrinker *shrinker) { - if (!shrinker->nr_deferred) + if (!(shrinker->flags & SHRINKER_REGISTERED)) return; - if (shrinker->flags & SHRINKER_MEMCG_AWARE) - unregister_memcg_shrinker(shrinker); + down_write(&shrinker_rwsem); list_del(&shrinker->list); + shrinker->flags &= ~SHRINKER_REGISTERED; + if (shrinker->flags & SHRINKER_MEMCG_AWARE) + unregister_memcg_shrinker(shrinker); up_write(&shrinker_rwsem); + kfree(shrinker->nr_deferred); shrinker->nr_deferred = NULL; } @@ -695,7 +685,7 @@ static unsigned long shrink_slab_memcg(g struct shrinker *shrinker; shrinker = idr_find(&shrinker_idr, i); - if (unlikely(!shrinker || shrinker == SHRINKER_REGISTERING)) { + if (unlikely(!shrinker || !(shrinker->flags & SHRINKER_REGISTERED))) { if (!shrinker) clear_bit(i, info->map); continue; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 070/143] mm: vmscan: add per memcg shrinker nr_deferred 2021-05-05 1:32 incoming Andrew Morton ` (68 preceding siblings ...) 2021-05-05 1:36 ` [patch 069/143] mm: vmscan: use a new flag to indicate shrinker is registered Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 071/143] mm: vmscan: use per memcg nr_deferred of shrinker Andrew Morton ` (70 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits, shakeelb, shy828301, torvalds, vbabka From: Yang Shi <shy828301@gmail.com> Subject: mm: vmscan: add per memcg shrinker nr_deferred Currently the number of deferred objects are per shrinker, but some slabs, for example, vfs inode/dentry cache are per memcg, this would result in poor isolation among memcgs. The deferred objects typically are generated by __GFP_NOFS allocations, one memcg with excessive __GFP_NOFS allocations may blow up deferred objects, then other innocent memcgs may suffer from over shrink, excessive reclaim latency, etc. For example, two workloads run in memcgA and memcgB respectively, workload in B is vfs heavy workload. Workload in A generates excessive deferred objects, then B's vfs cache might be hit heavily (drop half of caches) by B's limit reclaim or global reclaim. We observed this hit in our production environment which was running vfs heavy workload shown as the below tracing log: <...>-409454 [016] .... 28286961.747146: mm_shrink_slab_start: super_cache_scan+0x0/0x1a0 ffff9a83046f3458: nid: 1 objects to shrink 3641681686040 gfp_flags GFP_HIGHUSER_MOVABLE|__GFP_ZERO pgs_scanned 1 lru_pgs 15721 cache items 246404277 delta 31345 total_scan 123202138 <...>-409454 [022] .... 28287105.928018: mm_shrink_slab_end: super_cache_scan+0x0/0x1a0 ffff9a83046f3458: nid: 1 unused scan count 3641681686040 new scan count 3641798379189 total_scan 602 last shrinker return val 123186855 The vfs cache and page cache ratio was 10:1 on this machine, and half of caches were dropped. This also resulted in significant amount of page caches were dropped due to inodes eviction. Make nr_deferred per memcg for memcg aware shrinkers would solve the unfairness and bring better isolation. The following patch will add nr_deferred to parent memcg when memcg offline. To preserve nr_deferred when reparenting memcgs to root, root memcg needs shrinker_info allocated too. When memcg is not enabled (!CONFIG_MEMCG or memcg disabled), the shrinker's nr_deferred would be used. And non memcg aware shrinkers use shrinker's nr_deferred all the time. Link: https://lkml.kernel.org/r/20210311190845.9708-10-shy828301@gmail.com Signed-off-by: Yang Shi <shy828301@gmail.com> Acked-by: Roman Gushchin <guro@fb.com> Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Cc: Dave Chinner <david@fromorbit.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@suse.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/memcontrol.h | 7 ++-- mm/vmscan.c | 60 ++++++++++++++++++++++++----------- 2 files changed, 46 insertions(+), 21 deletions(-) --- a/include/linux/memcontrol.h~mm-vmscan-add-per-memcg-shrinker-nr_deferred +++ a/include/linux/memcontrol.h @@ -114,12 +114,13 @@ struct batched_lruvec_stat { }; /* - * Bitmap of shrinker::id corresponding to memcg-aware shrinkers, - * which have elements charged to this memcg. + * Bitmap and deferred work of shrinker::id corresponding to memcg-aware + * shrinkers, which have elements charged to this memcg. */ struct shrinker_info { struct rcu_head rcu; - unsigned long map[]; + atomic_long_t *nr_deferred; + unsigned long *map; }; /* --- a/mm/vmscan.c~mm-vmscan-add-per-memcg-shrinker-nr_deferred +++ a/mm/vmscan.c @@ -187,11 +187,17 @@ static DECLARE_RWSEM(shrinker_rwsem); #ifdef CONFIG_MEMCG static int shrinker_nr_max; +/* The shrinker_info is expanded in a batch of BITS_PER_LONG */ static inline int shrinker_map_size(int nr_items) { return (DIV_ROUND_UP(nr_items, BITS_PER_LONG) * sizeof(unsigned long)); } +static inline int shrinker_defer_size(int nr_items) +{ + return (round_up(nr_items, BITS_PER_LONG) * sizeof(atomic_long_t)); +} + static struct shrinker_info *shrinker_info_protected(struct mem_cgroup *memcg, int nid) { @@ -200,11 +206,13 @@ static struct shrinker_info *shrinker_in } static int expand_one_shrinker_info(struct mem_cgroup *memcg, - int size, int old_size) + int map_size, int defer_size, + int old_map_size, int old_defer_size) { struct shrinker_info *new, *old; struct mem_cgroup_per_node *pn; int nid; + int size = map_size + defer_size; for_each_node(nid) { pn = memcg->nodeinfo[nid]; @@ -217,9 +225,16 @@ static int expand_one_shrinker_info(stru if (!new) return -ENOMEM; - /* Set all old bits, clear all new bits */ - memset(new->map, (int)0xff, old_size); - memset((void *)new->map + old_size, 0, size - old_size); + new->nr_deferred = (atomic_long_t *)(new + 1); + new->map = (void *)new->nr_deferred + defer_size; + + /* map: set all old bits, clear all new bits */ + memset(new->map, (int)0xff, old_map_size); + memset((void *)new->map + old_map_size, 0, map_size - old_map_size); + /* nr_deferred: copy old values, clear all new values */ + memcpy(new->nr_deferred, old->nr_deferred, old_defer_size); + memset((void *)new->nr_deferred + old_defer_size, 0, + defer_size - old_defer_size); rcu_assign_pointer(pn->shrinker_info, new); kvfree_rcu(old, rcu); @@ -234,9 +249,6 @@ void free_shrinker_info(struct mem_cgrou struct shrinker_info *info; int nid; - if (mem_cgroup_is_root(memcg)) - return; - for_each_node(nid) { pn = memcg->nodeinfo[nid]; info = rcu_dereference_protected(pn->shrinker_info, true); @@ -249,12 +261,12 @@ int alloc_shrinker_info(struct mem_cgrou { struct shrinker_info *info; int nid, size, ret = 0; - - if (mem_cgroup_is_root(memcg)) - return 0; + int map_size, defer_size = 0; down_write(&shrinker_rwsem); - size = shrinker_map_size(shrinker_nr_max); + map_size = shrinker_map_size(shrinker_nr_max); + defer_size = shrinker_defer_size(shrinker_nr_max); + size = map_size + defer_size; for_each_node(nid) { info = kvzalloc_node(sizeof(*info) + size, GFP_KERNEL, nid); if (!info) { @@ -262,6 +274,8 @@ int alloc_shrinker_info(struct mem_cgrou ret = -ENOMEM; break; } + info->nr_deferred = (atomic_long_t *)(info + 1); + info->map = (void *)info->nr_deferred + defer_size; rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_info, info); } up_write(&shrinker_rwsem); @@ -269,15 +283,21 @@ int alloc_shrinker_info(struct mem_cgrou return ret; } +static inline bool need_expand(int nr_max) +{ + return round_up(nr_max, BITS_PER_LONG) > + round_up(shrinker_nr_max, BITS_PER_LONG); +} + static int expand_shrinker_info(int new_id) { - int size, old_size, ret = 0; + int ret = 0; int new_nr_max = new_id + 1; + int map_size, defer_size = 0; + int old_map_size, old_defer_size = 0; struct mem_cgroup *memcg; - size = shrinker_map_size(new_nr_max); - old_size = shrinker_map_size(shrinker_nr_max); - if (size <= old_size) + if (!need_expand(new_nr_max)) goto out; if (!root_mem_cgroup) @@ -285,11 +305,15 @@ static int expand_shrinker_info(int new_ lockdep_assert_held(&shrinker_rwsem); + map_size = shrinker_map_size(new_nr_max); + defer_size = shrinker_defer_size(new_nr_max); + old_map_size = shrinker_map_size(shrinker_nr_max); + old_defer_size = shrinker_defer_size(shrinker_nr_max); + memcg = mem_cgroup_iter(NULL, NULL, NULL); do { - if (mem_cgroup_is_root(memcg)) - continue; - ret = expand_one_shrinker_info(memcg, size, old_size); + ret = expand_one_shrinker_info(memcg, map_size, defer_size, + old_map_size, old_defer_size); if (ret) { mem_cgroup_iter_break(NULL, memcg); goto out; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 071/143] mm: vmscan: use per memcg nr_deferred of shrinker 2021-05-05 1:32 incoming Andrew Morton ` (69 preceding siblings ...) 2021-05-05 1:36 ` [patch 070/143] mm: vmscan: add per memcg shrinker nr_deferred Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 072/143] mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers Andrew Morton ` (69 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits, shakeelb, shy828301, torvalds, vbabka From: Yang Shi <shy828301@gmail.com> Subject: mm: vmscan: use per memcg nr_deferred of shrinker Use per memcg's nr_deferred for memcg aware shrinkers. The shrinker's nr_deferred will be used in the following cases: 1. Non memcg aware shrinkers 2. !CONFIG_MEMCG 3. memcg is disabled by boot parameter Link: https://lkml.kernel.org/r/20210311190845.9708-11-shy828301@gmail.com Signed-off-by: Yang Shi <shy828301@gmail.com> Acked-by: Roman Gushchin <guro@fb.com> Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Cc: Dave Chinner <david@fromorbit.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@suse.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmscan.c | 78 ++++++++++++++++++++++++++++++++++++++++++-------- 1 file changed, 66 insertions(+), 12 deletions(-) --- a/mm/vmscan.c~mm-vmscan-use-per-memcg-nr_deferred-of-shrinker +++ a/mm/vmscan.c @@ -376,6 +376,24 @@ static void unregister_memcg_shrinker(st idr_remove(&shrinker_idr, id); } +static long xchg_nr_deferred_memcg(int nid, struct shrinker *shrinker, + struct mem_cgroup *memcg) +{ + struct shrinker_info *info; + + info = shrinker_info_protected(memcg, nid); + return atomic_long_xchg(&info->nr_deferred[shrinker->id], 0); +} + +static long add_nr_deferred_memcg(long nr, int nid, struct shrinker *shrinker, + struct mem_cgroup *memcg) +{ + struct shrinker_info *info; + + info = shrinker_info_protected(memcg, nid); + return atomic_long_add_return(nr, &info->nr_deferred[shrinker->id]); +} + static bool cgroup_reclaim(struct scan_control *sc) { return sc->target_mem_cgroup; @@ -414,6 +432,18 @@ static void unregister_memcg_shrinker(st { } +static long xchg_nr_deferred_memcg(int nid, struct shrinker *shrinker, + struct mem_cgroup *memcg) +{ + return 0; +} + +static long add_nr_deferred_memcg(long nr, int nid, struct shrinker *shrinker, + struct mem_cgroup *memcg) +{ + return 0; +} + static bool cgroup_reclaim(struct scan_control *sc) { return false; @@ -425,6 +455,39 @@ static bool writeback_throttling_sane(st } #endif +static long xchg_nr_deferred(struct shrinker *shrinker, + struct shrink_control *sc) +{ + int nid = sc->nid; + + if (!(shrinker->flags & SHRINKER_NUMA_AWARE)) + nid = 0; + + if (sc->memcg && + (shrinker->flags & SHRINKER_MEMCG_AWARE)) + return xchg_nr_deferred_memcg(nid, shrinker, + sc->memcg); + + return atomic_long_xchg(&shrinker->nr_deferred[nid], 0); +} + + +static long add_nr_deferred(long nr, struct shrinker *shrinker, + struct shrink_control *sc) +{ + int nid = sc->nid; + + if (!(shrinker->flags & SHRINKER_NUMA_AWARE)) + nid = 0; + + if (sc->memcg && + (shrinker->flags & SHRINKER_MEMCG_AWARE)) + return add_nr_deferred_memcg(nr, nid, shrinker, + sc->memcg); + + return atomic_long_add_return(nr, &shrinker->nr_deferred[nid]); +} + /* * This misses isolated pages which are not accounted for to save counters. * As the data only determines if reclaim or compaction continues, it is @@ -561,14 +624,10 @@ static unsigned long do_shrink_slab(stru long freeable; long nr; long new_nr; - int nid = shrinkctl->nid; long batch_size = shrinker->batch ? shrinker->batch : SHRINK_BATCH; long scanned = 0, next_deferred; - if (!(shrinker->flags & SHRINKER_NUMA_AWARE)) - nid = 0; - freeable = shrinker->count_objects(shrinker, shrinkctl); if (freeable == 0 || freeable == SHRINK_EMPTY) return freeable; @@ -578,7 +637,7 @@ static unsigned long do_shrink_slab(stru * and zero it so that other concurrent shrinker invocations * don't also do this scanning work. */ - nr = atomic_long_xchg(&shrinker->nr_deferred[nid], 0); + nr = xchg_nr_deferred(shrinker, shrinkctl); total_scan = nr; if (shrinker->seeks) { @@ -669,14 +728,9 @@ static unsigned long do_shrink_slab(stru next_deferred = 0; /* * move the unused scan count back into the shrinker in a - * manner that handles concurrent updates. If we exhausted the - * scan, there is no need to do an update. + * manner that handles concurrent updates. */ - if (next_deferred > 0) - new_nr = atomic_long_add_return(next_deferred, - &shrinker->nr_deferred[nid]); - else - new_nr = atomic_long_read(&shrinker->nr_deferred[nid]); + new_nr = add_nr_deferred(next_deferred, shrinker, shrinkctl); trace_mm_shrink_slab_end(shrinker, shrinkctl->nid, freed, nr, new_nr, total_scan); return freed; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 072/143] mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers 2021-05-05 1:32 incoming Andrew Morton ` (70 preceding siblings ...) 2021-05-05 1:36 ` [patch 071/143] mm: vmscan: use per memcg nr_deferred of shrinker Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 073/143] mm: memcontrol: reparent nr_deferred when memcg offline Andrew Morton ` (68 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits, shakeelb, shy828301, torvalds, vbabka From: Yang Shi <shy828301@gmail.com> Subject: mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers Now nr_deferred is available on per memcg level for memcg aware shrinkers, so don't need allocate shrinker->nr_deferred for such shrinkers anymore. The prealloc_memcg_shrinker() would return -ENOSYS if !CONFIG_MEMCG or memcg is disabled by kernel command line, then shrinker's SHRINKER_MEMCG_AWARE flag would be cleared. This makes the implementation of this patch simpler. Link: https://lkml.kernel.org/r/20210311190845.9708-12-shy828301@gmail.com Signed-off-by: Yang Shi <shy828301@gmail.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Reviewed-by: Kirill Tkhai <ktkhai@virtuozzo.com> Acked-by: Roman Gushchin <guro@fb.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Cc: Dave Chinner <david@fromorbit.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@suse.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmscan.c | 31 ++++++++++++++++--------------- 1 file changed, 16 insertions(+), 15 deletions(-) --- a/mm/vmscan.c~mm-vmscan-dont-need-allocate-shrinker-nr_deferred-for-memcg-aware-shrinkers +++ a/mm/vmscan.c @@ -346,6 +346,9 @@ static int prealloc_memcg_shrinker(struc { int id, ret = -ENOMEM; + if (mem_cgroup_disabled()) + return -ENOSYS; + down_write(&shrinker_rwsem); /* This may call shrinker, so it must use down_read_trylock() */ id = idr_alloc(&shrinker_idr, shrinker, 0, 0, GFP_KERNEL); @@ -425,7 +428,7 @@ static bool writeback_throttling_sane(st #else static int prealloc_memcg_shrinker(struct shrinker *shrinker) { - return 0; + return -ENOSYS; } static void unregister_memcg_shrinker(struct shrinker *shrinker) @@ -537,8 +540,18 @@ static unsigned long lruvec_lru_size(str */ int prealloc_shrinker(struct shrinker *shrinker) { - unsigned int size = sizeof(*shrinker->nr_deferred); + unsigned int size; + int err; + + if (shrinker->flags & SHRINKER_MEMCG_AWARE) { + err = prealloc_memcg_shrinker(shrinker); + if (err != -ENOSYS) + return err; + shrinker->flags &= ~SHRINKER_MEMCG_AWARE; + } + + size = sizeof(*shrinker->nr_deferred); if (shrinker->flags & SHRINKER_NUMA_AWARE) size *= nr_node_ids; @@ -546,28 +559,16 @@ int prealloc_shrinker(struct shrinker *s if (!shrinker->nr_deferred) return -ENOMEM; - if (shrinker->flags & SHRINKER_MEMCG_AWARE) { - if (prealloc_memcg_shrinker(shrinker)) - goto free_deferred; - } - return 0; - -free_deferred: - kfree(shrinker->nr_deferred); - shrinker->nr_deferred = NULL; - return -ENOMEM; } void free_prealloced_shrinker(struct shrinker *shrinker) { - if (!shrinker->nr_deferred) - return; - if (shrinker->flags & SHRINKER_MEMCG_AWARE) { down_write(&shrinker_rwsem); unregister_memcg_shrinker(shrinker); up_write(&shrinker_rwsem); + return; } kfree(shrinker->nr_deferred); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 073/143] mm: memcontrol: reparent nr_deferred when memcg offline 2021-05-05 1:32 incoming Andrew Morton ` (71 preceding siblings ...) 2021-05-05 1:36 ` [patch 072/143] mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 074/143] mm: vmscan: shrink deferred objects proportional to priority Andrew Morton ` (67 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits, shakeelb, shy828301, torvalds, vbabka From: Yang Shi <shy828301@gmail.com> Subject: mm: memcontrol: reparent nr_deferred when memcg offline Now shrinker's nr_deferred is per memcg for memcg aware shrinkers, add to parent's corresponding nr_deferred when memcg offline. Link: https://lkml.kernel.org/r/20210311190845.9708-13-shy828301@gmail.com Signed-off-by: Yang Shi <shy828301@gmail.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com> Acked-by: Roman Gushchin <guro@fb.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Cc: Dave Chinner <david@fromorbit.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@suse.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/memcontrol.h | 1 + mm/memcontrol.c | 1 + mm/vmscan.c | 24 ++++++++++++++++++++++++ 3 files changed, 26 insertions(+) --- a/include/linux/memcontrol.h~mm-memcontrol-reparent-nr_deferred-when-memcg-offline +++ a/include/linux/memcontrol.h @@ -1614,6 +1614,7 @@ static inline bool mem_cgroup_under_sock int alloc_shrinker_info(struct mem_cgroup *memcg); void free_shrinker_info(struct mem_cgroup *memcg); void set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id); +void reparent_shrinker_deferred(struct mem_cgroup *memcg); #else #define mem_cgroup_sockets_enabled 0 static inline void mem_cgroup_sk_alloc(struct sock *sk) { }; --- a/mm/memcontrol.c~mm-memcontrol-reparent-nr_deferred-when-memcg-offline +++ a/mm/memcontrol.c @@ -5154,6 +5154,7 @@ static void mem_cgroup_css_offline(struc page_counter_set_low(&memcg->memory, 0); memcg_offline_kmem(memcg); + reparent_shrinker_deferred(memcg); wb_memcg_offline(memcg); drain_all_stock(memcg); --- a/mm/vmscan.c~mm-memcontrol-reparent-nr_deferred-when-memcg-offline +++ a/mm/vmscan.c @@ -397,6 +397,30 @@ static long add_nr_deferred_memcg(long n return atomic_long_add_return(nr, &info->nr_deferred[shrinker->id]); } +void reparent_shrinker_deferred(struct mem_cgroup *memcg) +{ + int i, nid; + long nr; + struct mem_cgroup *parent; + struct shrinker_info *child_info, *parent_info; + + parent = parent_mem_cgroup(memcg); + if (!parent) + parent = root_mem_cgroup; + + /* Prevent from concurrent shrinker_info expand */ + down_read(&shrinker_rwsem); + for_each_node(nid) { + child_info = shrinker_info_protected(memcg, nid); + parent_info = shrinker_info_protected(parent, nid); + for (i = 0; i < shrinker_nr_max; i++) { + nr = atomic_long_read(&child_info->nr_deferred[i]); + atomic_long_add(nr, &parent_info->nr_deferred[i]); + } + } + up_read(&shrinker_rwsem); +} + static bool cgroup_reclaim(struct scan_control *sc) { return sc->target_mem_cgroup; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 074/143] mm: vmscan: shrink deferred objects proportional to priority 2021-05-05 1:32 incoming Andrew Morton ` (72 preceding siblings ...) 2021-05-05 1:36 ` [patch 073/143] mm: memcontrol: reparent nr_deferred when memcg offline Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 075/143] mm/compaction: remove unused variable sysctl_compact_memory Andrew Morton ` (66 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits, shakeelb, shy828301, torvalds, vbabka From: Yang Shi <shy828301@gmail.com> Subject: mm: vmscan: shrink deferred objects proportional to priority The number of deferred objects might get windup to an absurd number, and it results in clamp of slab objects. It is undesirable for sustaining workingset. So shrink deferred objects proportional to priority and cap nr_deferred to twice of cache items. The idea is borrowed from Dave Chinner's patch: https://lore.kernel.org/linux-xfs/20191031234618.15403-13-david@fromorbit.com/ Tested with kernel build and vfs metadata heavy workload in our production environment, no regression is spotted so far. Link: https://lkml.kernel.org/r/20210311190845.9708-14-shy828301@gmail.com Signed-off-by: Yang Shi <shy828301@gmail.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Kirill Tkhai <ktkhai@virtuozzo.com> Cc: Michal Hocko <mhocko@suse.com> Cc: Roman Gushchin <guro@fb.com> Cc: Shakeel Butt <shakeelb@google.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmscan.c | 46 +++++++++++----------------------------------- 1 file changed, 11 insertions(+), 35 deletions(-) --- a/mm/vmscan.c~mm-vmscan-shrink-deferred-objects-proportional-to-priority +++ a/mm/vmscan.c @@ -664,7 +664,6 @@ static unsigned long do_shrink_slab(stru */ nr = xchg_nr_deferred(shrinker, shrinkctl); - total_scan = nr; if (shrinker->seeks) { delta = freeable >> priority; delta *= 4; @@ -678,37 +677,9 @@ static unsigned long do_shrink_slab(stru delta = freeable / 2; } + total_scan = nr >> priority; total_scan += delta; - if (total_scan < 0) { - pr_err("shrink_slab: %pS negative objects to delete nr=%ld\n", - shrinker->scan_objects, total_scan); - total_scan = freeable; - next_deferred = nr; - } else - next_deferred = total_scan; - - /* - * We need to avoid excessive windup on filesystem shrinkers - * due to large numbers of GFP_NOFS allocations causing the - * shrinkers to return -1 all the time. This results in a large - * nr being built up so when a shrink that can do some work - * comes along it empties the entire cache due to nr >>> - * freeable. This is bad for sustaining a working set in - * memory. - * - * Hence only allow the shrinker to scan the entire cache when - * a large delta change is calculated directly. - */ - if (delta < freeable / 4) - total_scan = min(total_scan, freeable / 2); - - /* - * Avoid risking looping forever due to too large nr value: - * never try to free more than twice the estimate number of - * freeable entries. - */ - if (total_scan > freeable * 2) - total_scan = freeable * 2; + total_scan = min(total_scan, (2 * freeable)); trace_mm_shrink_slab_start(shrinker, shrinkctl, nr, freeable, delta, total_scan, priority); @@ -747,10 +718,15 @@ static unsigned long do_shrink_slab(stru cond_resched(); } - if (next_deferred >= scanned) - next_deferred -= scanned; - else - next_deferred = 0; + /* + * The deferred work is increased by any new work (delta) that wasn't + * done, decreased by old deferred work that was done now. + * + * And it is capped to two times of the freeable items. + */ + next_deferred = max_t(long, (nr + delta - scanned), 0); + next_deferred = min(next_deferred, (2 * freeable)); + /* * move the unused scan count back into the shrinker in a * manner that handles concurrent updates. _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 075/143] mm/compaction: remove unused variable sysctl_compact_memory 2021-05-05 1:32 incoming Andrew Morton ` (73 preceding siblings ...) 2021-05-05 1:36 ` [patch 074/143] mm: vmscan: shrink deferred objects proportional to priority Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 076/143] mm: compaction: update the COMPACT[STALL|FAIL] events properly Andrew Morton ` (65 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, pintu.ping, pintu, torvalds, vbabka From: Pintu Kumar <pintu@codeaurora.org> Subject: mm/compaction: remove unused variable sysctl_compact_memory The sysctl_compact_memory is mostly unused in mm/compaction.c It just acts as a place holder for sysctl to store .data. But the .data itself is not needed here. So we can get ride of this variable completely and make .data as NULL. This will also eliminate the extern declaration from header file. No functionality is broken or changed this way. Link: https://lkml.kernel.org/r/1614852224-14671-1-git-send-email-pintu@codeaurora.org Signed-off-by: Pintu Kumar <pintu@codeaurora.org> Signed-off-by: Pintu Agarwal <pintu.ping@gmail.com> Reviewed-by: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/compaction.h | 1 - kernel/sysctl.c | 2 +- mm/compaction.c | 3 --- 3 files changed, 1 insertion(+), 5 deletions(-) --- a/include/linux/compaction.h~mm-compaction-remove-unused-variable-sysctl_compact_memory +++ a/include/linux/compaction.h @@ -81,7 +81,6 @@ static inline unsigned long compact_gap( } #ifdef CONFIG_COMPACTION -extern int sysctl_compact_memory; extern unsigned int sysctl_compaction_proactiveness; extern int sysctl_compaction_handler(struct ctl_table *table, int write, void *buffer, size_t *length, loff_t *ppos); --- a/kernel/sysctl.c~mm-compaction-remove-unused-variable-sysctl_compact_memory +++ a/kernel/sysctl.c @@ -2830,7 +2830,7 @@ static struct ctl_table vm_table[] = { #ifdef CONFIG_COMPACTION { .procname = "compact_memory", - .data = &sysctl_compact_memory, + .data = NULL, .maxlen = sizeof(int), .mode = 0200, .proc_handler = sysctl_compaction_handler, --- a/mm/compaction.c~mm-compaction-remove-unused-variable-sysctl_compact_memory +++ a/mm/compaction.c @@ -2692,9 +2692,6 @@ static void compact_nodes(void) compact_node(nid); } -/* The written value is actually unused, all memory is compacted */ -int sysctl_compact_memory; - /* * Tunable for proactive compaction. It determines how * aggressively the kernel should compact memory in the _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 076/143] mm: compaction: update the COMPACT[STALL|FAIL] events properly 2021-05-05 1:32 incoming Andrew Morton ` (74 preceding siblings ...) 2021-05-05 1:36 ` [patch 075/143] mm/compaction: remove unused variable sysctl_compact_memory Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 077/143] mm: disable LRU pagevec during the migration temporarily Andrew Morton ` (64 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, charante, linux-mm, mm-commits, rientjes, torvalds, vbabka From: Charan Teja Reddy <charante@codeaurora.org> Subject: mm: compaction: update the COMPACT[STALL|FAIL] events properly By definition, COMPACT[STALL|FAIL] events needs to be counted when there is 'At least in one zone compaction wasn't deferred or skipped from the direct compaction'. And when compaction is skipped or deferred, COMPACT_SKIPPED will be returned but it will still go and update these compaction events which is wrong in the sense that COMPACT[STALL|FAIL] is counted without even trying the compaction. Correct this by skipping the counting of these events when COMPACT_SKIPPED is returned for compaction. This indirectly also avoid the unnecessary try into the get_page_from_freelist() when compaction is not even tried. There is a corner case where compaction is skipped but still count COMPACTSTALL event, which is that IRQ came and freed the page and the same is captured in capture_control. Link: https://lkml.kernel.org/r/1613151184-21213-1-git-send-email-charante@codeaurora.org Signed-off-by: Charan Teja Reddy <charante@codeaurora.org> Acked-by: Vlastimil Babka <vbabka@suse.cz> Acked-by: David Rientjes <rientjes@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/compaction.c | 8 ++++++++ mm/page_alloc.c | 2 ++ 2 files changed, 10 insertions(+) --- a/mm/compaction.c~mm-compaction-update-the-compact-events-properly +++ a/mm/compaction.c @@ -2529,6 +2529,14 @@ static enum compact_result compact_zone_ */ WRITE_ONCE(current->capture_control, NULL); *capture = READ_ONCE(capc.page); + /* + * Technically, it is also possible that compaction is skipped but + * the page is still captured out of luck(IRQ came and freed the page). + * Returning COMPACT_SUCCESS in such cases helps in properly accounting + * the COMPACT[STALL|FAIL] when compaction is skipped. + */ + if (*capture) + ret = COMPACT_SUCCESS; return ret; } --- a/mm/page_alloc.c~mm-compaction-update-the-compact-events-properly +++ a/mm/page_alloc.c @@ -4204,6 +4204,8 @@ __alloc_pages_direct_compact(gfp_t gfp_m memalloc_noreclaim_restore(noreclaim_flag); psi_memstall_leave(&pflags); + if (*compact_result == COMPACT_SKIPPED) + return NULL; /* * At least in one zone compaction wasn't deferred or skipped, so let's * count a compaction stall _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 077/143] mm: disable LRU pagevec during the migration temporarily 2021-05-05 1:32 incoming Andrew Morton ` (75 preceding siblings ...) 2021-05-05 1:36 ` [patch 076/143] mm: compaction: update the COMPACT[STALL|FAIL] events properly Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:36 ` [patch 078/143] mm: replace migrate_[prep|finish] with lru_cache_[disable|enable] Andrew Morton ` (63 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, cgoldswo, david, joaodias, linux-mm, mhocko, minchan, mm-commits, oliver.sang, surenb, torvalds, vbabka, willy From: Minchan Kim <minchan@kernel.org> Subject: mm: disable LRU pagevec during the migration temporarily LRU pagevec holds refcount of pages until the pagevec are drained. It could prevent migration since the refcount of the page is greater than the expection in migration logic. To mitigate the issue, callers of migrate_pages drains LRU pagevec via migrate_prep or lru_add_drain_all before migrate_pages call. However, it's not enough because pages coming into pagevec after the draining call still could stay at the pagevec so it could keep preventing page migration. Since some callers of migrate_pages have retrial logic with LRU draining, the page would migrate at next trail but it is still fragile in that it doesn't close the fundamental race between upcoming LRU pages into pagvec and migration so the migration failure could cause contiguous memory allocation failure in the end. To close the race, this patch disables lru caches(i.e, pagevec) during ongoing migration until migrate is done. Since it's really hard to reproduce, I measured how many times migrate_pages retried with force mode(it is about a fallback to a sync migration) with below debug code. int migrate_pages(struct list_head *from, new_page_t get_new_page, .. .. if (rc && reason == MR_CONTIG_RANGE && pass > 2) { printk(KERN_ERR, "pfn 0x%lx reason %d ", page_to_pfn(page), rc); dump_page(page, "fail to migrate"); } The test was repeating android apps launching with cma allocation in background every five seconds. Total cma allocation count was about 500 during the testing. With this patch, the dump_page count was reduced from 400 to 30. The new interface is also useful for memory hotplug which currently drains lru pcp caches after each migration failure. This is rather suboptimal as it has to disrupt others running during the operation. With the new interface the operation happens only once. This is also in line with pcp allocator cache which are disabled for the offlining as well. Link: https://lkml.kernel.org/r/20210319175127.886124-1-minchan@kernel.org Signed-off-by: Minchan Kim <minchan@kernel.org> Reviewed-by: Chris Goldsworthy <cgoldswo@codeaurora.org> Acked-by: Michal Hocko <mhocko@suse.com> Cc: John Dias <joaodias@google.com> Cc: Suren Baghdasaryan <surenb@google.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: David Hildenbrand <david@redhat.com> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Oliver Sang <oliver.sang@intel.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/migrate.h | 2 + include/linux/swap.h | 14 ++++++++ mm/memory_hotplug.c | 3 + mm/mempolicy.c | 4 ++ mm/migrate.c | 11 ++++-- mm/page_alloc.c | 2 + mm/swap.c | 64 ++++++++++++++++++++++++++++++++------ 7 files changed, 86 insertions(+), 14 deletions(-) --- a/include/linux/migrate.h~mm-disable-lru-pagevec-during-the-migration-temporarily +++ a/include/linux/migrate.h @@ -46,6 +46,7 @@ extern int isolate_movable_page(struct p extern void putback_movable_page(struct page *page); extern void migrate_prep(void); +extern void migrate_finish(void); extern void migrate_prep_local(void); extern void migrate_page_states(struct page *newpage, struct page *page); extern void migrate_page_copy(struct page *newpage, struct page *page); @@ -67,6 +68,7 @@ static inline int isolate_movable_page(s { return -EBUSY; } static inline int migrate_prep(void) { return -ENOSYS; } +static inline int migrate_finish(void) { return -ENOSYS; } static inline int migrate_prep_local(void) { return -ENOSYS; } static inline void migrate_page_states(struct page *newpage, struct page *page) --- a/include/linux/swap.h~mm-disable-lru-pagevec-during-the-migration-temporarily +++ a/include/linux/swap.h @@ -340,6 +340,20 @@ extern void lru_note_cost(struct lruvec extern void lru_note_cost_page(struct page *); extern void lru_cache_add(struct page *); extern void mark_page_accessed(struct page *); + +extern atomic_t lru_disable_count; + +static inline bool lru_cache_disabled(void) +{ + return atomic_read(&lru_disable_count); +} + +static inline void lru_cache_enable(void) +{ + atomic_dec(&lru_disable_count); +} + +extern void lru_cache_disable(void); extern void lru_add_drain(void); extern void lru_add_drain_cpu(int cpu); extern void lru_add_drain_cpu_zone(struct zone *zone); --- a/mm/memory_hotplug.c~mm-disable-lru-pagevec-during-the-migration-temporarily +++ a/mm/memory_hotplug.c @@ -1611,6 +1611,7 @@ int __ref offline_pages(unsigned long st * in a way that pages from isolated pageblock are left on pcplists. */ zone_pcp_disable(zone); + lru_cache_disable(); /* set above range as isolated */ ret = start_isolate_page_range(start_pfn, end_pfn, @@ -1642,7 +1643,6 @@ int __ref offline_pages(unsigned long st } cond_resched(); - lru_add_drain_all(); ret = scan_movable_pages(pfn, end_pfn, &pfn); if (!ret) { @@ -1687,6 +1687,7 @@ int __ref offline_pages(unsigned long st zone->nr_isolate_pageblock -= nr_pages / pageblock_nr_pages; spin_unlock_irqrestore(&zone->lock, flags); + lru_cache_enable(); zone_pcp_enable(zone); /* removal success */ --- a/mm/mempolicy.c~mm-disable-lru-pagevec-during-the-migration-temporarily +++ a/mm/mempolicy.c @@ -1208,6 +1208,8 @@ int do_migrate_pages(struct mm_struct *m break; } mmap_read_unlock(mm); + + migrate_finish(); if (err < 0) return err; return busy; @@ -1371,6 +1373,8 @@ up_out: mmap_write_unlock(mm); mpol_out: mpol_put(new); + if (flags & (MPOL_MF_MOVE | MPOL_MF_MOVE_ALL)) + migrate_finish(); return err; } --- a/mm/migrate.c~mm-disable-lru-pagevec-during-the-migration-temporarily +++ a/mm/migrate.c @@ -66,11 +66,13 @@ void migrate_prep(void) { /* * Clear the LRU lists so pages can be isolated. - * Note that pages may be moved off the LRU after we have - * drained them. Those pages will fail to migrate like other - * pages that may be busy. */ - lru_add_drain_all(); + lru_cache_disable(); +} + +void migrate_finish(void) +{ + lru_cache_enable(); } /* Do the necessary work of migrate_prep but not if it involves other CPUs */ @@ -1838,6 +1840,7 @@ out_flush: if (err >= 0) err = err1; out: + migrate_finish(); return err; } --- a/mm/page_alloc.c~mm-disable-lru-pagevec-during-the-migration-temporarily +++ a/mm/page_alloc.c @@ -8715,6 +8715,8 @@ static int __alloc_contig_migrate_range( if (ret == -ENOMEM) break; } + + migrate_finish(); if (ret < 0) { alloc_contig_dump_pages(&cc->migratepages); putback_movable_pages(&cc->migratepages); --- a/mm/swap.c~mm-disable-lru-pagevec-during-the-migration-temporarily +++ a/mm/swap.c @@ -235,6 +235,18 @@ static void pagevec_move_tail_fn(struct } } +/* return true if pagevec needs to drain */ +static bool pagevec_add_and_need_flush(struct pagevec *pvec, struct page *page) +{ + bool ret = false; + + if (!pagevec_add(pvec, page) || PageCompound(page) || + lru_cache_disabled()) + ret = true; + + return ret; +} + /* * Writeback is about to end against a page which has been marked for immediate * reclaim. If it still appears to be reclaimable, move it to the tail of the @@ -252,7 +264,7 @@ void rotate_reclaimable_page(struct page get_page(page); local_lock_irqsave(&lru_rotate.lock, flags); pvec = this_cpu_ptr(&lru_rotate.pvec); - if (!pagevec_add(pvec, page) || PageCompound(page)) + if (pagevec_add_and_need_flush(pvec, page)) pagevec_lru_move_fn(pvec, pagevec_move_tail_fn); local_unlock_irqrestore(&lru_rotate.lock, flags); } @@ -343,7 +355,7 @@ static void activate_page(struct page *p local_lock(&lru_pvecs.lock); pvec = this_cpu_ptr(&lru_pvecs.activate_page); get_page(page); - if (!pagevec_add(pvec, page) || PageCompound(page)) + if (pagevec_add_and_need_flush(pvec, page)) pagevec_lru_move_fn(pvec, __activate_page); local_unlock(&lru_pvecs.lock); } @@ -458,7 +470,7 @@ void lru_cache_add(struct page *page) get_page(page); local_lock(&lru_pvecs.lock); pvec = this_cpu_ptr(&lru_pvecs.lru_add); - if (!pagevec_add(pvec, page) || PageCompound(page)) + if (pagevec_add_and_need_flush(pvec, page)) __pagevec_lru_add(pvec); local_unlock(&lru_pvecs.lock); } @@ -654,7 +666,7 @@ void deactivate_file_page(struct page *p local_lock(&lru_pvecs.lock); pvec = this_cpu_ptr(&lru_pvecs.lru_deactivate_file); - if (!pagevec_add(pvec, page) || PageCompound(page)) + if (pagevec_add_and_need_flush(pvec, page)) pagevec_lru_move_fn(pvec, lru_deactivate_file_fn); local_unlock(&lru_pvecs.lock); } @@ -676,7 +688,7 @@ void deactivate_page(struct page *page) local_lock(&lru_pvecs.lock); pvec = this_cpu_ptr(&lru_pvecs.lru_deactivate); get_page(page); - if (!pagevec_add(pvec, page) || PageCompound(page)) + if (pagevec_add_and_need_flush(pvec, page)) pagevec_lru_move_fn(pvec, lru_deactivate_fn); local_unlock(&lru_pvecs.lock); } @@ -698,7 +710,7 @@ void mark_page_lazyfree(struct page *pag local_lock(&lru_pvecs.lock); pvec = this_cpu_ptr(&lru_pvecs.lru_lazyfree); get_page(page); - if (!pagevec_add(pvec, page) || PageCompound(page)) + if (pagevec_add_and_need_flush(pvec, page)) pagevec_lru_move_fn(pvec, lru_lazyfree_fn); local_unlock(&lru_pvecs.lock); } @@ -735,7 +747,7 @@ static void lru_add_drain_per_cpu(struct * Calling this function with cpu hotplug locks held can actually lead * to obscure indirect dependencies via WQ context. */ -void lru_add_drain_all(void) +inline void __lru_add_drain_all(bool force_all_cpus) { /* * lru_drain_gen - Global pages generation number @@ -780,7 +792,7 @@ void lru_add_drain_all(void) * (C) Exit the draining operation if a newer generation, from another * lru_add_drain_all(), was already scheduled for draining. Check (A). */ - if (unlikely(this_gen != lru_drain_gen)) + if (unlikely(this_gen != lru_drain_gen && !force_all_cpus)) goto done; /* @@ -810,7 +822,8 @@ void lru_add_drain_all(void) for_each_online_cpu(cpu) { struct work_struct *work = &per_cpu(lru_add_drain_work, cpu); - if (pagevec_count(&per_cpu(lru_pvecs.lru_add, cpu)) || + if (force_all_cpus || + pagevec_count(&per_cpu(lru_pvecs.lru_add, cpu)) || data_race(pagevec_count(&per_cpu(lru_rotate.pvec, cpu))) || pagevec_count(&per_cpu(lru_pvecs.lru_deactivate_file, cpu)) || pagevec_count(&per_cpu(lru_pvecs.lru_deactivate, cpu)) || @@ -828,6 +841,11 @@ void lru_add_drain_all(void) done: mutex_unlock(&lock); } + +void lru_add_drain_all(void) +{ + __lru_add_drain_all(false); +} #else void lru_add_drain_all(void) { @@ -835,6 +853,34 @@ void lru_add_drain_all(void) } #endif /* CONFIG_SMP */ +atomic_t lru_disable_count = ATOMIC_INIT(0); + +/* + * lru_cache_disable() needs to be called before we start compiling + * a list of pages to be migrated using isolate_lru_page(). + * It drains pages on LRU cache and then disable on all cpus until + * lru_cache_enable is called. + * + * Must be paired with a call to lru_cache_enable(). + */ +void lru_cache_disable(void) +{ + atomic_inc(&lru_disable_count); +#ifdef CONFIG_SMP + /* + * lru_add_drain_all in the force mode will schedule draining on + * all online CPUs so any calls of lru_cache_disabled wrapped by + * local_lock or preemption disabled would be ordered by that. + * The atomic operation doesn't need to have stronger ordering + * requirements because that is enforeced by the scheduling + * guarantees. + */ + __lru_add_drain_all(true); +#else + lru_add_drain(); +#endif +} + /** * release_pages - batched put_page() * @pages: array of pages to release _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 078/143] mm: replace migrate_[prep|finish] with lru_cache_[disable|enable] 2021-05-05 1:32 incoming Andrew Morton ` (76 preceding siblings ...) 2021-05-05 1:36 ` [patch 077/143] mm: disable LRU pagevec during the migration temporarily Andrew Morton @ 2021-05-05 1:36 ` Andrew Morton 2021-05-05 1:37 ` [patch 079/143] mm: fs: invalidate BH LRU during page migration Andrew Morton ` (62 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw) To: akpm, cgoldswo, david, joaodias, linux-mm, mhocko, minchan, mm-commits, oliver.sang, surenb, torvalds, vbabka, willy From: Minchan Kim <minchan@kernel.org> Subject: mm: replace migrate_[prep|finish] with lru_cache_[disable|enable] Currently, migrate_[prep|finish] is merely a wrapper of lru_cache_[disable|enable]. There is not much to gain from having additional abstraction. Use lru_cache_[disable|enable] instead of migrate_[prep|finish], which would be more descriptive. note: migrate_prep_local in compaction.c changed into lru_add_drain to avoid CPU schedule cost with involving many other CPUs to keep old behavior. Link: https://lkml.kernel.org/r/20210319175127.886124-2-minchan@kernel.org Signed-off-by: Minchan Kim <minchan@kernel.org> Acked-by: Michal Hocko <mhocko@suse.com> Reviewed-by: David Hildenbrand <david@redhat.com> Cc: Chris Goldsworthy <cgoldswo@codeaurora.org> Cc: John Dias <joaodias@google.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Oliver Sang <oliver.sang@intel.com> Cc: Suren Baghdasaryan <surenb@google.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/migrate.h | 7 ------- mm/compaction.c | 3 ++- mm/mempolicy.c | 8 ++++---- mm/migrate.c | 28 ++-------------------------- mm/page_alloc.c | 4 ++-- 5 files changed, 10 insertions(+), 40 deletions(-) --- a/include/linux/migrate.h~mm-replace-migrate_-with-lru_cache_ +++ a/include/linux/migrate.h @@ -45,9 +45,6 @@ extern struct page *alloc_migration_targ extern int isolate_movable_page(struct page *page, isolate_mode_t mode); extern void putback_movable_page(struct page *page); -extern void migrate_prep(void); -extern void migrate_finish(void); -extern void migrate_prep_local(void); extern void migrate_page_states(struct page *newpage, struct page *page); extern void migrate_page_copy(struct page *newpage, struct page *page); extern int migrate_huge_page_move_mapping(struct address_space *mapping, @@ -67,10 +64,6 @@ static inline struct page *alloc_migrati static inline int isolate_movable_page(struct page *page, isolate_mode_t mode) { return -EBUSY; } -static inline int migrate_prep(void) { return -ENOSYS; } -static inline int migrate_finish(void) { return -ENOSYS; } -static inline int migrate_prep_local(void) { return -ENOSYS; } - static inline void migrate_page_states(struct page *newpage, struct page *page) { } --- a/mm/compaction.c~mm-replace-migrate_-with-lru_cache_ +++ a/mm/compaction.c @@ -2354,7 +2354,8 @@ compact_zone(struct compact_control *cc, trace_mm_compaction_begin(start_pfn, cc->migrate_pfn, cc->free_pfn, end_pfn, sync); - migrate_prep_local(); + /* lru_add_drain_all could be expensive with involving other CPUs */ + lru_add_drain(); while ((ret = compact_finished(cc)) == COMPACT_CONTINUE) { int err; --- a/mm/mempolicy.c~mm-replace-migrate_-with-lru_cache_ +++ a/mm/mempolicy.c @@ -1124,7 +1124,7 @@ int do_migrate_pages(struct mm_struct *m int err = 0; nodemask_t tmp; - migrate_prep(); + lru_cache_disable(); mmap_read_lock(mm); @@ -1209,7 +1209,7 @@ int do_migrate_pages(struct mm_struct *m } mmap_read_unlock(mm); - migrate_finish(); + lru_cache_enable(); if (err < 0) return err; return busy; @@ -1325,7 +1325,7 @@ static long do_mbind(unsigned long start if (flags & (MPOL_MF_MOVE | MPOL_MF_MOVE_ALL)) { - migrate_prep(); + lru_cache_disable(); } { NODEMASK_SCRATCH(scratch); @@ -1374,7 +1374,7 @@ up_out: mpol_out: mpol_put(new); if (flags & (MPOL_MF_MOVE | MPOL_MF_MOVE_ALL)) - migrate_finish(); + lru_cache_enable(); return err; } --- a/mm/migrate.c~mm-replace-migrate_-with-lru_cache_ +++ a/mm/migrate.c @@ -57,30 +57,6 @@ #include "internal.h" -/* - * migrate_prep() needs to be called before we start compiling a list of pages - * to be migrated using isolate_lru_page(). If scheduling work on other CPUs is - * undesirable, use migrate_prep_local() - */ -void migrate_prep(void) -{ - /* - * Clear the LRU lists so pages can be isolated. - */ - lru_cache_disable(); -} - -void migrate_finish(void) -{ - lru_cache_enable(); -} - -/* Do the necessary work of migrate_prep but not if it involves other CPUs */ -void migrate_prep_local(void) -{ - lru_add_drain(); -} - int isolate_movable_page(struct page *page, isolate_mode_t mode) { struct address_space *mapping; @@ -1771,7 +1747,7 @@ static int do_pages_move(struct mm_struc int start, i; int err = 0, err1; - migrate_prep(); + lru_cache_disable(); for (i = start = 0; i < nr_pages; i++) { const void __user *p; @@ -1840,7 +1816,7 @@ out_flush: if (err >= 0) err = err1; out: - migrate_finish(); + lru_cache_enable(); return err; } --- a/mm/page_alloc.c~mm-replace-migrate_-with-lru_cache_ +++ a/mm/page_alloc.c @@ -8681,7 +8681,7 @@ static int __alloc_contig_migrate_range( .gfp_mask = GFP_USER | __GFP_MOVABLE | __GFP_RETRY_MAYFAIL, }; - migrate_prep(); + lru_cache_disable(); while (pfn < end || !list_empty(&cc->migratepages)) { if (fatal_signal_pending(current)) { @@ -8716,7 +8716,7 @@ static int __alloc_contig_migrate_range( break; } - migrate_finish(); + lru_cache_enable(); if (ret < 0) { alloc_contig_dump_pages(&cc->migratepages); putback_movable_pages(&cc->migratepages); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 079/143] mm: fs: invalidate BH LRU during page migration 2021-05-05 1:32 incoming Andrew Morton ` (77 preceding siblings ...) 2021-05-05 1:36 ` [patch 078/143] mm: replace migrate_[prep|finish] with lru_cache_[disable|enable] Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 080/143] mm/migrate.c: make putback_movable_page() static Andrew Morton ` (61 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, cgoldswo, david, joaodias, labbott, linux-mm, mhocko, minchan, mm-commits, oliver.sang, surenb, torvalds, vbabka, willy From: Minchan Kim <minchan@kernel.org> Subject: mm: fs: invalidate BH LRU during page migration Pages containing buffer_heads that are in one of the per-CPU buffer_head LRU caches will be pinned and thus cannot be migrated. This can prevent CMA allocations from succeeding, which are often used on platforms with co-processors (such as a DSP) that can only use physically contiguous memory. It can also prevent memory hot-unplugging from succeeding, which involves migrating at least MIN_MEMORY_BLOCK_SIZE bytes of memory, which ranges from 8 MiB to 1 GiB based on the architecture in use. Correspondingly, invalidate the BH LRU caches before a migration starts and stop any buffer_head from being cached in the LRU caches, until migration has finished. Link: https://lkml.kernel.org/r/20210319175127.886124-3-minchan@kernel.org Signed-off-by: Minchan Kim <minchan@kernel.org> Reported-by: Chris Goldsworthy <cgoldswo@codeaurora.org> Reported-by: Laura Abbott <labbott@kernel.org> Tested-by: Oliver Sang <oliver.sang@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: John Dias <joaodias@google.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Michal Hocko <mhocko@suse.com> Cc: Suren Baghdasaryan <surenb@google.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/buffer.c | 36 ++++++++++++++++++++++++++++------ include/linux/buffer_head.h | 4 +++ mm/swap.c | 5 +++- 3 files changed, 38 insertions(+), 7 deletions(-) --- a/fs/buffer.c~mm-fs-invalidate-bh-lru-during-page-migration +++ a/fs/buffer.c @@ -1264,6 +1264,15 @@ static void bh_lru_install(struct buffer int i; check_irqs_on(); + /* + * the refcount of buffer_head in bh_lru prevents dropping the + * attached page(i.e., try_to_free_buffers) so it could cause + * failing page migration. + * Skip putting upcoming bh into bh_lru until migration is done. + */ + if (lru_cache_disabled()) + return; + bh_lru_lock(); b = this_cpu_ptr(&bh_lrus); @@ -1404,6 +1413,15 @@ __bread_gfp(struct block_device *bdev, s } EXPORT_SYMBOL(__bread_gfp); +static void __invalidate_bh_lrus(struct bh_lru *b) +{ + int i; + + for (i = 0; i < BH_LRU_SIZE; i++) { + brelse(b->bhs[i]); + b->bhs[i] = NULL; + } +} /* * invalidate_bh_lrus() is called rarely - but not only at unmount. * This doesn't race because it runs in each cpu either in irq @@ -1412,16 +1430,12 @@ EXPORT_SYMBOL(__bread_gfp); static void invalidate_bh_lru(void *arg) { struct bh_lru *b = &get_cpu_var(bh_lrus); - int i; - for (i = 0; i < BH_LRU_SIZE; i++) { - brelse(b->bhs[i]); - b->bhs[i] = NULL; - } + __invalidate_bh_lrus(b); put_cpu_var(bh_lrus); } -static bool has_bh_in_lru(int cpu, void *dummy) +bool has_bh_in_lru(int cpu, void *dummy) { struct bh_lru *b = per_cpu_ptr(&bh_lrus, cpu); int i; @@ -1440,6 +1454,16 @@ void invalidate_bh_lrus(void) } EXPORT_SYMBOL_GPL(invalidate_bh_lrus); +void invalidate_bh_lrus_cpu(int cpu) +{ + struct bh_lru *b; + + bh_lru_lock(); + b = per_cpu_ptr(&bh_lrus, cpu); + __invalidate_bh_lrus(b); + bh_lru_unlock(); +} + void set_bh_page(struct buffer_head *bh, struct page *page, unsigned long offset) { --- a/include/linux/buffer_head.h~mm-fs-invalidate-bh-lru-during-page-migration +++ a/include/linux/buffer_head.h @@ -194,6 +194,8 @@ void __breadahead_gfp(struct block_devic struct buffer_head *__bread_gfp(struct block_device *, sector_t block, unsigned size, gfp_t gfp); void invalidate_bh_lrus(void); +void invalidate_bh_lrus_cpu(int cpu); +bool has_bh_in_lru(int cpu, void *dummy); struct buffer_head *alloc_buffer_head(gfp_t gfp_flags); void free_buffer_head(struct buffer_head * bh); void unlock_buffer(struct buffer_head *bh); @@ -406,6 +408,8 @@ static inline int inode_has_buffers(stru static inline void invalidate_inode_buffers(struct inode *inode) {} static inline int remove_inode_buffers(struct inode *inode) { return 1; } static inline int sync_mapping_buffers(struct address_space *mapping) { return 0; } +static inline void invalidate_bh_lrus_cpu(int cpu) {} +static inline bool has_bh_in_lru(int cpu, void *dummy) { return 0; } #define buffer_heads_over_limit 0 #endif /* CONFIG_BLOCK */ --- a/mm/swap.c~mm-fs-invalidate-bh-lru-during-page-migration +++ a/mm/swap.c @@ -36,6 +36,7 @@ #include <linux/hugetlb.h> #include <linux/page_idle.h> #include <linux/local_lock.h> +#include <linux/buffer_head.h> #include "internal.h" @@ -641,6 +642,7 @@ void lru_add_drain_cpu(int cpu) pagevec_lru_move_fn(pvec, lru_lazyfree_fn); activate_page_drain(cpu); + invalidate_bh_lrus_cpu(cpu); } /** @@ -828,7 +830,8 @@ inline void __lru_add_drain_all(bool for pagevec_count(&per_cpu(lru_pvecs.lru_deactivate_file, cpu)) || pagevec_count(&per_cpu(lru_pvecs.lru_deactivate, cpu)) || pagevec_count(&per_cpu(lru_pvecs.lru_lazyfree, cpu)) || - need_activate_page_drain(cpu)) { + need_activate_page_drain(cpu) || + has_bh_in_lru(cpu, NULL)) { INIT_WORK(work, lru_add_drain_per_cpu); queue_work_on(cpu, mm_percpu_wq, work); __cpumask_set_cpu(cpu, &has_work); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 080/143] mm/migrate.c: make putback_movable_page() static 2021-05-05 1:32 incoming Andrew Morton ` (78 preceding siblings ...) 2021-05-05 1:37 ` [patch 079/143] mm: fs: invalidate BH LRU during page migration Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 081/143] mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case Andrew Morton ` (60 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, apopple, aquini, david, jglisse, linmiaohe, linux-mm, mm-commits, shy828301, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/migrate.c: make putback_movable_page() static Patch series "Cleanup and fixup for mm/migrate.c", v3. This series contains cleanups to remove unnecessary VM_BUG_ON_PAGE and rc != MIGRATEPAGE_SUCCESS check. Also use helper function to remove some duplicated codes. What's more, this fixes potential deadlock in NUMA balancing shared exec THP case and so on. More details can be found in the respective changelogs. This patch (of 5): The putback_movable_page() is just called by putback_movable_pages() and we know the page is locked and both PageMovable() and PageIsolated() is checked right before calling putback_movable_page(). So we make it static and remove all the 3 VM_BUG_ON_PAGE(). Link: https://lkml.kernel.org/r/20210325131524.48181-1-linmiaohe@huawei.com Link: https://lkml.kernel.org/r/20210325131524.48181-2-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: David Hildenbrand <david@redhat.com> Reviewed-by: Yang Shi <shy828301@gmail.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Rafael Aquini <aquini@redhat.com> Cc: Alistair Popple <apopple@nvidia.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/migrate.h | 1 - mm/migrate.c | 7 +------ 2 files changed, 1 insertion(+), 7 deletions(-) --- a/include/linux/migrate.h~mm-migratec-make-putback_movable_page-static +++ a/include/linux/migrate.h @@ -43,7 +43,6 @@ extern int migrate_pages(struct list_hea unsigned long private, enum migrate_mode mode, int reason); extern struct page *alloc_migration_target(struct page *page, unsigned long private); extern int isolate_movable_page(struct page *page, isolate_mode_t mode); -extern void putback_movable_page(struct page *page); extern void migrate_page_states(struct page *newpage, struct page *page); extern void migrate_page_copy(struct page *newpage, struct page *page); --- a/mm/migrate.c~mm-migratec-make-putback_movable_page-static +++ a/mm/migrate.c @@ -118,15 +118,10 @@ out: return -EBUSY; } -/* It should be called on page which is PG_movable */ -void putback_movable_page(struct page *page) +static void putback_movable_page(struct page *page) { struct address_space *mapping; - VM_BUG_ON_PAGE(!PageLocked(page), page); - VM_BUG_ON_PAGE(!PageMovable(page), page); - VM_BUG_ON_PAGE(!PageIsolated(page), page); - mapping = page_mapping(page); mapping->a_ops->putback_page(page); __ClearPageIsolated(page); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 081/143] mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case 2021-05-05 1:32 incoming Andrew Morton ` (79 preceding siblings ...) 2021-05-05 1:37 ` [patch 080/143] mm/migrate.c: make putback_movable_page() static Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 082/143] mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page() Andrew Morton ` (59 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, apopple, aquini, david, jglisse, linmiaohe, linux-mm, mm-commits, shy828301, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case It's guaranteed that in the 'else' case of the rc == MIGRATEPAGE_SUCCESS check, rc does not equal to MIGRATEPAGE_SUCCESS. Remove this unnecessary check. Link: https://lkml.kernel.org/r/20210325131524.48181-3-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: David Hildenbrand <david@redhat.com> Reviewed-by: Yang Shi <shy828301@gmail.com> Cc: Alistair Popple <apopple@nvidia.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Rafael Aquini <aquini@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/migrate.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/migrate.c~mm-migratec-remove-unnecessary-rc-=-migratepage_success-check-in-else-case +++ a/mm/migrate.c @@ -1348,7 +1348,7 @@ out_unlock: out: if (rc == MIGRATEPAGE_SUCCESS) putback_active_hugepage(hpage); - else if (rc != -EAGAIN && rc != MIGRATEPAGE_SUCCESS) + else if (rc != -EAGAIN) list_move_tail(&hpage->lru, ret); /* _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 082/143] mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page() 2021-05-05 1:32 incoming Andrew Morton ` (80 preceding siblings ...) 2021-05-05 1:37 ` [patch 081/143] mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 083/143] mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole() Andrew Morton ` (58 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, apopple, aquini, david, jglisse, linmiaohe, linux-mm, mm-commits, shy828301, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page() If the zone device page does not belong to un-addressable device memory, the variable entry will be uninitialized and lead to indeterminate pte entry ultimately. Fix this unexpected case and warn about it. Link: https://lkml.kernel.org/r/20210325131524.48181-4-linmiaohe@huawei.com Fixes: df6ad69838fc ("mm/device-public-memory: device memory cache coherent with CPU") Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: David Hildenbrand <david@redhat.com> Cc: Alistair Popple <apopple@nvidia.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Rafael Aquini <aquini@redhat.com> Cc: Yang Shi <shy828301@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/migrate.c | 7 +++++++ 1 file changed, 7 insertions(+) --- a/mm/migrate.c~mm-migratec-fix-potential-indeterminate-pte-entry-in-migrate_vma_insert_page +++ a/mm/migrate.c @@ -2947,6 +2947,13 @@ static void migrate_vma_insert_page(stru swp_entry = make_device_private_entry(page, vma->vm_flags & VM_WRITE); entry = swp_entry_to_pte(swp_entry); + } else { + /* + * For now we only support migrating to un-addressable + * device memory. + */ + pr_warn_once("Unsupported ZONE_DEVICE page type.\n"); + goto abort; } } else { entry = mk_pte(page, vma->vm_page_prot); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 083/143] mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole() 2021-05-05 1:32 incoming Andrew Morton ` (81 preceding siblings ...) 2021-05-05 1:37 ` [patch 082/143] mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page() Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 084/143] Revert "mm: migrate: skip shared exec THP for NUMA balancing" Andrew Morton ` (57 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, apopple, aquini, david, jglisse, linmiaohe, linux-mm, mm-commits, shy828301, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole() It's more recommended to use helper function migrate_vma_collect_skip() to skip the unexpected case and it also helps remove some duplicated codes. Move migrate_vma_collect_skip() above migrate_vma_collect_hole() to avoid compiler warning. Link: https://lkml.kernel.org/r/20210325131524.48181-5-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: David Hildenbrand <david@redhat.com> Cc: Alistair Popple <apopple@nvidia.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Rafael Aquini <aquini@redhat.com> Cc: Yang Shi <shy828301@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/migrate.c | 28 +++++++++++----------------- 1 file changed, 11 insertions(+), 17 deletions(-) --- a/mm/migrate.c~mm-migratec-use-helper-migrate_vma_collect_skip-in-migrate_vma_collect_hole +++ a/mm/migrate.c @@ -2290,44 +2290,38 @@ out: #endif /* CONFIG_NUMA */ #ifdef CONFIG_DEVICE_PRIVATE -static int migrate_vma_collect_hole(unsigned long start, +static int migrate_vma_collect_skip(unsigned long start, unsigned long end, - __always_unused int depth, struct mm_walk *walk) { struct migrate_vma *migrate = walk->private; unsigned long addr; - /* Only allow populating anonymous memory. */ - if (!vma_is_anonymous(walk->vma)) { - for (addr = start; addr < end; addr += PAGE_SIZE) { - migrate->src[migrate->npages] = 0; - migrate->dst[migrate->npages] = 0; - migrate->npages++; - } - return 0; - } - for (addr = start; addr < end; addr += PAGE_SIZE) { - migrate->src[migrate->npages] = MIGRATE_PFN_MIGRATE; migrate->dst[migrate->npages] = 0; - migrate->npages++; - migrate->cpages++; + migrate->src[migrate->npages++] = 0; } return 0; } -static int migrate_vma_collect_skip(unsigned long start, +static int migrate_vma_collect_hole(unsigned long start, unsigned long end, + __always_unused int depth, struct mm_walk *walk) { struct migrate_vma *migrate = walk->private; unsigned long addr; + /* Only allow populating anonymous memory. */ + if (!vma_is_anonymous(walk->vma)) + return migrate_vma_collect_skip(start, end, walk); + for (addr = start; addr < end; addr += PAGE_SIZE) { + migrate->src[migrate->npages] = MIGRATE_PFN_MIGRATE; migrate->dst[migrate->npages] = 0; - migrate->src[migrate->npages++] = 0; + migrate->npages++; + migrate->cpages++; } return 0; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 084/143] Revert "mm: migrate: skip shared exec THP for NUMA balancing" 2021-05-05 1:32 incoming Andrew Morton ` (82 preceding siblings ...) 2021-05-05 1:37 ` [patch 083/143] mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole() Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 085/143] mm: vmstat: add cma statistics Andrew Morton ` (56 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, apopple, aquini, david, jglisse, linmiaohe, linux-mm, mm-commits, shy828301, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: Revert "mm: migrate: skip shared exec THP for NUMA balancing" This reverts commit c77c5cbafe549eb330e8909861a3e16cbda2c848. Since commit c77c5cbafe54 ("mm: migrate: skip shared exec THP for NUMA balancing"), the NUMA balancing would skip shared exec transhuge page. But this enhancement is not suitable for transhuge page. Because it's required that page_mapcount() must be 1 due to no migration pte dance is done here. On the other hand, the shared exec transhuge page will leave the migrate_misplaced_page() with pte entry untouched and page locked. Thus pagefault for NUMA will be triggered again and deadlock occurs when we start waiting for the page lock held by ourselves. Yang Shi said: "Thanks for catching this. By relooking the code I think the other important reason for removing this is migrate_misplaced_transhuge_page() actually can't see shared exec file THP at all since page_lock_anon_vma_read() is called before and if page is not anonymous page it will just restore the PMD without migrating anything. The pages for private mapped file vma may be anonymous pages due to COW but they can't be THP so it won't trigger THP numa fault at all. I think this is why no bug was reported. I overlooked this in the first place." Link: https://lkml.kernel.org/r/20210325131524.48181-6-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Yang Shi <shy828301@gmail.com> Cc: Alistair Popple <apopple@nvidia.com> Cc: David Hildenbrand <david@redhat.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Rafael Aquini <aquini@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/migrate.c | 18 ++---------------- 1 file changed, 2 insertions(+), 16 deletions(-) --- a/mm/migrate.c~revert-mm-migrate-skip-shared-exec-thp-for-numa-balancing +++ a/mm/migrate.c @@ -2084,17 +2084,6 @@ bool pmd_trans_migrating(pmd_t pmd) return PageLocked(page); } -static inline bool is_shared_exec_page(struct vm_area_struct *vma, - struct page *page) -{ - if (page_mapcount(page) != 1 && - (page_is_file_lru(page) || vma_is_shmem(vma)) && - (vma->vm_flags & VM_EXEC)) - return true; - - return false; -} - /* * Attempt to migrate a misplaced page to the specified destination * node. Caller is expected to have an elevated reference count on @@ -2112,7 +2101,8 @@ int migrate_misplaced_page(struct page * * Don't migrate file pages that are mapped in multiple processes * with execute permissions as they are probably shared libraries. */ - if (is_shared_exec_page(vma, page)) + if (page_mapcount(page) != 1 && page_is_file_lru(page) && + (vma->vm_flags & VM_EXEC)) goto out; /* @@ -2167,9 +2157,6 @@ int migrate_misplaced_transhuge_page(str int page_lru = page_is_file_lru(page); unsigned long start = address & HPAGE_PMD_MASK; - if (is_shared_exec_page(vma, page)) - goto out; - new_page = alloc_pages_node(node, (GFP_TRANSHUGE_LIGHT | __GFP_THISNODE), HPAGE_PMD_ORDER); @@ -2281,7 +2268,6 @@ out_fail: out_unlock: unlock_page(page); -out: put_page(page); return 0; } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 085/143] mm: vmstat: add cma statistics 2021-05-05 1:32 incoming Andrew Morton ` (83 preceding siblings ...) 2021-05-05 1:37 ` [patch 084/143] Revert "mm: migrate: skip shared exec THP for NUMA balancing" Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 086/143] mm: cma: use pr_err_ratelimited for CMA warning Andrew Morton ` (55 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, jhubbard, joaodias, linux-mm, minchan, mm-commits, surenb, torvalds From: Minchan Kim <minchan@kernel.org> Subject: mm: vmstat: add cma statistics Since CMA is used more widely, it's worth to have CMA allocation statistics into vmstat. With it, we could know how agressively system uses cma allocation and how often it fails. Link: https://lkml.kernel.org/r/20210302183346.3707237-1-minchan@kernel.org Signed-off-by: Minchan Kim <minchan@kernel.org> Reviewed-by: John Hubbard <jhubbard@nvidia.com> Cc: John Dias <joaodias@google.com> Cc: Suren Baghdasaryan <surenb@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/vm_event_item.h | 4 ++++ mm/cma.c | 12 +++++++++--- mm/vmstat.c | 4 ++++ 3 files changed, 17 insertions(+), 3 deletions(-) --- a/include/linux/vm_event_item.h~mm-vmstat-add-cma-statistics +++ a/include/linux/vm_event_item.h @@ -71,6 +71,10 @@ enum vm_event_item { PGPGIN, PGPGOUT, PS #ifdef CONFIG_HUGETLB_PAGE HTLB_BUDDY_PGALLOC, HTLB_BUDDY_PGALLOC_FAIL, #endif +#ifdef CONFIG_CMA + CMA_ALLOC_SUCCESS, + CMA_ALLOC_FAIL, +#endif UNEVICTABLE_PGCULLED, /* culled to noreclaim list */ UNEVICTABLE_PGSCANNED, /* scanned for reclaimability */ UNEVICTABLE_PGRESCUED, /* rescued from noreclaim list */ --- a/mm/cma.c~mm-vmstat-add-cma-statistics +++ a/mm/cma.c @@ -435,13 +435,13 @@ struct page *cma_alloc(struct cma *cma, int ret = -ENOMEM; if (!cma || !cma->count || !cma->bitmap) - return NULL; + goto out; pr_debug("%s(cma %p, count %zu, align %d)\n", __func__, (void *)cma, count, align); if (!count) - return NULL; + goto out; mask = cma_bitmap_aligned_mask(cma, align); offset = cma_bitmap_aligned_offset(cma, align); @@ -449,7 +449,7 @@ struct page *cma_alloc(struct cma *cma, bitmap_count = cma_bitmap_pages_to_bits(cma, count); if (bitmap_count > bitmap_maxno) - return NULL; + goto out; for (;;) { spin_lock_irq(&cma->lock); @@ -506,6 +506,12 @@ struct page *cma_alloc(struct cma *cma, } pr_debug("%s(): returned %p\n", __func__, page); +out: + if (page) + count_vm_event(CMA_ALLOC_SUCCESS); + else + count_vm_event(CMA_ALLOC_FAIL); + return page; } --- a/mm/vmstat.c~mm-vmstat-add-cma-statistics +++ a/mm/vmstat.c @@ -1313,6 +1313,10 @@ const char * const vmstat_text[] = { "htlb_buddy_alloc_success", "htlb_buddy_alloc_fail", #endif +#ifdef CONFIG_CMA + "cma_alloc_success", + "cma_alloc_fail", +#endif "unevictable_pgs_culled", "unevictable_pgs_scanned", "unevictable_pgs_rescued", _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 086/143] mm: cma: use pr_err_ratelimited for CMA warning 2021-05-05 1:32 incoming Andrew Morton ` (84 preceding siblings ...) 2021-05-05 1:37 ` [patch 085/143] mm: vmstat: add cma statistics Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 087/143] mm: cma: add trace events for CMA alloc perf testing Andrew Morton ` (54 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, baolin.wang, david, linux-mm, minchan, mm-commits, torvalds From: Baolin Wang <baolin.wang@linux.alibaba.com> Subject: mm: cma: use pr_err_ratelimited for CMA warning If we did not reserve extra CMA memory, the log buffer can be easily filled up by CMA failure warning when the devices calling dmam_alloc_coherent() to alloc DMA memory. Thus we can use pr_err_ratelimited() instead to reduce the duplicate CMA warning. Link: https://lkml.kernel.org/r/ce2251ef49e1727a9a40531d1996660b05462bd2.1615279825.git.baolin.wang@linux.alibaba.com Signed-off-by: Baolin Wang <baolin.wang@linux.alibaba.com> Reviewed-by: David Hildenbrand <david@redhat.com> Acked-by: Minchan Kim <minchan@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/cma.c | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) --- a/mm/cma.c~mm-cma-use-pr_err_ratelimited-for-cma-warning +++ a/mm/cma.c @@ -500,8 +500,8 @@ struct page *cma_alloc(struct cma *cma, } if (ret && !no_warn) { - pr_err("%s: %s: alloc failed, req-size: %zu pages, ret: %d\n", - __func__, cma->name, count, ret); + pr_err_ratelimited("%s: %s: alloc failed, req-size: %zu pages, ret: %d\n", + __func__, cma->name, count, ret); cma_debug_show_areas(cma); } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 087/143] mm: cma: add trace events for CMA alloc perf testing 2021-05-05 1:32 incoming Andrew Morton ` (85 preceding siblings ...) 2021-05-05 1:37 ` [patch 086/143] mm: cma: use pr_err_ratelimited for CMA warning Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 088/143] mm: cma: support sysfs Andrew Morton ` (53 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, georgi.djakov, linux-mm, lmark, minchan, mm-commits, torvalds From: Liam Mark <lmark@codeaurora.org> Subject: mm: cma: add trace events for CMA alloc perf testing Add cma and migrate trace events to enable CMA allocation performance to be measured via ftrace. [georgi.djakov@linaro.org: add the CMA instance name to the cma_alloc_start trace event] Link: https://lkml.kernel.org/r/20210326155414.25006-1-georgi.djakov@linaro.org Link: https://lkml.kernel.org/r/20210324160740.15901-1-georgi.djakov@linaro.org Signed-off-by: Liam Mark <lmark@codeaurora.org> Signed-off-by: Georgi Djakov <georgi.djakov@linaro.org> Acked-by: Minchan Kim <minchan@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/trace/events/cma.h | 42 ++++++++++++++++++++++++++++++- include/trace/events/migrate.h | 22 ++++++++++++++++ mm/cma.c | 4 ++ mm/migrate.c | 2 + 4 files changed, 69 insertions(+), 1 deletion(-) --- a/include/trace/events/cma.h~mm-cma-add-trace-events-for-cma-alloc-perf-testing +++ a/include/trace/events/cma.h @@ -8,7 +8,7 @@ #include <linux/types.h> #include <linux/tracepoint.h> -TRACE_EVENT(cma_alloc, +DECLARE_EVENT_CLASS(cma_alloc_class, TP_PROTO(unsigned long pfn, const struct page *page, unsigned int count, unsigned int align), @@ -61,6 +61,46 @@ TRACE_EVENT(cma_release, __entry->count) ); +TRACE_EVENT(cma_alloc_start, + + TP_PROTO(const char *name, unsigned int count, unsigned int align), + + TP_ARGS(name, count, align), + + TP_STRUCT__entry( + __string(name, name) + __field(unsigned int, count) + __field(unsigned int, align) + ), + + TP_fast_assign( + __assign_str(name, name); + __entry->count = count; + __entry->align = align; + ), + + TP_printk("name=%s count=%u align=%u", + __get_str(name), + __entry->count, + __entry->align) +); + +DEFINE_EVENT(cma_alloc_class, cma_alloc, + + TP_PROTO(unsigned long pfn, const struct page *page, + unsigned int count, unsigned int align), + + TP_ARGS(pfn, page, count, align) +); + +DEFINE_EVENT(cma_alloc_class, cma_alloc_busy_retry, + + TP_PROTO(unsigned long pfn, const struct page *page, + unsigned int count, unsigned int align), + + TP_ARGS(pfn, page, count, align) +); + #endif /* _TRACE_CMA_H */ /* This part must be outside protection */ --- a/include/trace/events/migrate.h~mm-cma-add-trace-events-for-cma-alloc-perf-testing +++ a/include/trace/events/migrate.h @@ -81,6 +81,28 @@ TRACE_EVENT(mm_migrate_pages, __print_symbolic(__entry->mode, MIGRATE_MODE), __print_symbolic(__entry->reason, MIGRATE_REASON)) ); + +TRACE_EVENT(mm_migrate_pages_start, + + TP_PROTO(enum migrate_mode mode, int reason), + + TP_ARGS(mode, reason), + + TP_STRUCT__entry( + __field(enum migrate_mode, mode) + __field(int, reason) + ), + + TP_fast_assign( + __entry->mode = mode; + __entry->reason = reason; + ), + + TP_printk("mode=%s reason=%s", + __print_symbolic(__entry->mode, MIGRATE_MODE), + __print_symbolic(__entry->reason, MIGRATE_REASON)) +); + #endif /* _TRACE_MIGRATE_H */ /* This part must be outside protection */ --- a/mm/cma.c~mm-cma-add-trace-events-for-cma-alloc-perf-testing +++ a/mm/cma.c @@ -443,6 +443,8 @@ struct page *cma_alloc(struct cma *cma, if (!count) goto out; + trace_cma_alloc_start(cma->name, count, align); + mask = cma_bitmap_aligned_mask(cma, align); offset = cma_bitmap_aligned_offset(cma, align); bitmap_maxno = cma_bitmap_maxno(cma); @@ -483,6 +485,8 @@ struct page *cma_alloc(struct cma *cma, pr_debug("%s(): memory range at %p is busy, retrying\n", __func__, pfn_to_page(pfn)); + + trace_cma_alloc_busy_retry(pfn, pfn_to_page(pfn), count, align); /* try again with a bit different memory target */ start = bitmap_no + mask + 1; } --- a/mm/migrate.c~mm-cma-add-trace-events-for-cma-alloc-perf-testing +++ a/mm/migrate.c @@ -1418,6 +1418,8 @@ int migrate_pages(struct list_head *from int rc, nr_subpages; LIST_HEAD(ret_pages); + trace_mm_migrate_pages_start(mode, reason); + if (!swapwrite) current->flags |= PF_SWAPWRITE; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 088/143] mm: cma: support sysfs 2021-05-05 1:32 incoming Andrew Morton ` (86 preceding siblings ...) 2021-05-05 1:37 ` [patch 087/143] mm: cma: add trace events for CMA alloc perf testing Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 089/143] mm: cma: add the CMA instance name to cma trace events Andrew Morton ` (52 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, anders.roxell, colin.king, digetx, gregkh, jhubbard, joaodias, linux-mm, minchan, mm-commits, surenb, torvalds, willy From: Minchan Kim <minchan@kernel.org> Subject: mm: cma: support sysfs Since CMA is getting used more widely, it's more important to keep monitoring CMA statistics for system health since it's directly related to user experience. This patch introduces sysfs statistics for CMA, in order to provide some basic monitoring of the CMA allocator. * the number of CMA page successful allocations * the number of CMA page allocation failures These two values allow the user to calcuate the allocation failure rate for each CMA area. e.g.) /sys/kernel/mm/cma/WIFI/alloc_pages_[success|fail] /sys/kernel/mm/cma/SENSOR/alloc_pages_[success|fail] /sys/kernel/mm/cma/BLUETOOTH/alloc_pages_[success|fail] The cma_stat was intentionally allocated by dynamic allocation to harmonize with kobject lifetime management. https://lore.kernel.org/linux-mm/YCOAmXqt6dZkCQYs@kroah.com/ Link: https://lkml.kernel.org/r/20210324230759.2213957-1-minchan@kernel.org Link: https://lore.kernel.org/linux-mm/20210316100433.17665-1-colin.king@canonical.com/ Signed-off-by: Minchan Kim <minchan@kernel.org> Signed-off-by: Colin Ian King <colin.king@canonical.com> Tested-by: Dmitry Osipenko <digetx@gmail.com> Reviewed-by: Dmitry Osipenko <digetx@gmail.com> Reviewed-by: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Reviewed-by: John Hubbard <jhubbard@nvidia.com> Tested-by: Anders Roxell <anders.roxell@linaro.org> Cc: Suren Baghdasaryan <surenb@google.com> Cc: John Dias <joaodias@google.com> Cc: Matthew Wilcox (Oracle) <willy@infradead.org> Cc: Colin Ian King <colin.king@canonical.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/ABI/testing/sysfs-kernel-mm-cma | 25 +++ mm/Kconfig | 7 + mm/Makefile | 1 mm/cma.c | 8 - mm/cma.h | 23 +++ mm/cma_sysfs.c | 112 ++++++++++++++++ 6 files changed, 174 insertions(+), 2 deletions(-) --- /dev/null +++ a/Documentation/ABI/testing/sysfs-kernel-mm-cma @@ -0,0 +1,25 @@ +What: /sys/kernel/mm/cma/ +Date: Feb 2021 +Contact: Minchan Kim <minchan@kernel.org> +Description: + /sys/kernel/mm/cma/ contains a subdirectory for each CMA + heap name (also sometimes called CMA areas). + + Each CMA heap subdirectory (that is, each + /sys/kernel/mm/cma/<cma-heap-name> directory) contains the + following items: + + alloc_pages_success + alloc_pages_fail + +What: /sys/kernel/mm/cma/<cma-heap-name>/alloc_pages_success +Date: Feb 2021 +Contact: Minchan Kim <minchan@kernel.org> +Description: + the number of pages CMA API succeeded to allocate + +What: /sys/kernel/mm/cma/<cma-heap-name>/alloc_pages_fail +Date: Feb 2021 +Contact: Minchan Kim <minchan@kernel.org> +Description: + the number of pages CMA API failed to allocate --- a/mm/cma.c~mm-cma-support-sysfs +++ a/mm/cma.c @@ -511,10 +511,14 @@ struct page *cma_alloc(struct cma *cma, pr_debug("%s(): returned %p\n", __func__, page); out: - if (page) + if (page) { count_vm_event(CMA_ALLOC_SUCCESS); - else + cma_sysfs_account_success_pages(cma, count); + } else { count_vm_event(CMA_ALLOC_FAIL); + if (cma) + cma_sysfs_account_fail_pages(cma, count); + } return page; } --- a/mm/cma.h~mm-cma-support-sysfs +++ a/mm/cma.h @@ -3,6 +3,12 @@ #define __MM_CMA_H__ #include <linux/debugfs.h> +#include <linux/kobject.h> + +struct cma_kobject { + struct kobject kobj; + struct cma *cma; +}; struct cma { unsigned long base_pfn; @@ -16,6 +22,14 @@ struct cma { struct debugfs_u32_array dfs_bitmap; #endif char name[CMA_MAX_NAME]; +#ifdef CONFIG_CMA_SYSFS + /* the number of CMA page successful allocations */ + atomic64_t nr_pages_succeeded; + /* the number of CMA page allocation failures */ + atomic64_t nr_pages_failed; + /* kobject requires dynamic object */ + struct cma_kobject *cma_kobj; +#endif }; extern struct cma cma_areas[MAX_CMA_AREAS]; @@ -26,4 +40,13 @@ static inline unsigned long cma_bitmap_m return cma->count >> cma->order_per_bit; } +#ifdef CONFIG_CMA_SYSFS +void cma_sysfs_account_success_pages(struct cma *cma, unsigned long nr_pages); +void cma_sysfs_account_fail_pages(struct cma *cma, unsigned long nr_pages); +#else +static inline void cma_sysfs_account_success_pages(struct cma *cma, + unsigned long nr_pages) {}; +static inline void cma_sysfs_account_fail_pages(struct cma *cma, + unsigned long nr_pages) {}; +#endif #endif --- /dev/null +++ a/mm/cma_sysfs.c @@ -0,0 +1,112 @@ +// SPDX-License-Identifier: GPL-2.0 +/* + * CMA SysFS Interface + * + * Copyright (c) 2021 Minchan Kim <minchan@kernel.org> + */ + +#include <linux/cma.h> +#include <linux/kernel.h> +#include <linux/slab.h> + +#include "cma.h" + +#define CMA_ATTR_RO(_name) \ + static struct kobj_attribute _name##_attr = __ATTR_RO(_name) + +void cma_sysfs_account_success_pages(struct cma *cma, unsigned long nr_pages) +{ + atomic64_add(nr_pages, &cma->nr_pages_succeeded); +} + +void cma_sysfs_account_fail_pages(struct cma *cma, unsigned long nr_pages) +{ + atomic64_add(nr_pages, &cma->nr_pages_failed); +} + +static inline struct cma *cma_from_kobj(struct kobject *kobj) +{ + return container_of(kobj, struct cma_kobject, kobj)->cma; +} + +static ssize_t alloc_pages_success_show(struct kobject *kobj, + struct kobj_attribute *attr, char *buf) +{ + struct cma *cma = cma_from_kobj(kobj); + + return sysfs_emit(buf, "%llu\n", + atomic64_read(&cma->nr_pages_succeeded)); +} +CMA_ATTR_RO(alloc_pages_success); + +static ssize_t alloc_pages_fail_show(struct kobject *kobj, + struct kobj_attribute *attr, char *buf) +{ + struct cma *cma = cma_from_kobj(kobj); + + return sysfs_emit(buf, "%llu\n", atomic64_read(&cma->nr_pages_failed)); +} +CMA_ATTR_RO(alloc_pages_fail); + +static void cma_kobj_release(struct kobject *kobj) +{ + struct cma *cma = cma_from_kobj(kobj); + struct cma_kobject *cma_kobj = cma->cma_kobj; + + kfree(cma_kobj); + cma->cma_kobj = NULL; +} + +static struct attribute *cma_attrs[] = { + &alloc_pages_success_attr.attr, + &alloc_pages_fail_attr.attr, + NULL, +}; +ATTRIBUTE_GROUPS(cma); + +static struct kobj_type cma_ktype = { + .release = cma_kobj_release, + .sysfs_ops = &kobj_sysfs_ops, + .default_groups = cma_groups, +}; + +static int __init cma_sysfs_init(void) +{ + struct kobject *cma_kobj_root; + struct cma_kobject *cma_kobj; + struct cma *cma; + int i, err; + + cma_kobj_root = kobject_create_and_add("cma", mm_kobj); + if (!cma_kobj_root) + return -ENOMEM; + + for (i = 0; i < cma_area_count; i++) { + cma_kobj = kzalloc(sizeof(*cma_kobj), GFP_KERNEL); + if (!cma_kobj) { + err = -ENOMEM; + goto out; + } + + cma = &cma_areas[i]; + cma->cma_kobj = cma_kobj; + cma_kobj->cma = cma; + err = kobject_init_and_add(&cma_kobj->kobj, &cma_ktype, + cma_kobj_root, "%s", cma->name); + if (err) { + kobject_put(&cma_kobj->kobj); + goto out; + } + } + + return 0; +out: + while (--i >= 0) { + cma = &cma_areas[i]; + kobject_put(&cma->cma_kobj->kobj); + } + kobject_put(cma_kobj_root); + + return err; +} +subsys_initcall(cma_sysfs_init); --- a/mm/Kconfig~mm-cma-support-sysfs +++ a/mm/Kconfig @@ -518,6 +518,13 @@ config CMA_DEBUGFS help Turns on the DebugFS interface for CMA. +config CMA_SYSFS + bool "CMA information through sysfs interface" + depends on CMA && SYSFS + help + This option exposes some sysfs attributes to get information + from CMA. + config CMA_AREAS int "Maximum count of the CMA areas" depends on CMA --- a/mm/Makefile~mm-cma-support-sysfs +++ a/mm/Makefile @@ -109,6 +109,7 @@ obj-$(CONFIG_CMA) += cma.o obj-$(CONFIG_MEMORY_BALLOON) += balloon_compaction.o obj-$(CONFIG_PAGE_EXTENSION) += page_ext.o obj-$(CONFIG_CMA_DEBUGFS) += cma_debug.o +obj-$(CONFIG_CMA_SYSFS) += cma_sysfs.o obj-$(CONFIG_USERFAULTFD) += userfaultfd.o obj-$(CONFIG_IDLE_PAGE_TRACKING) += page_idle.o obj-$(CONFIG_DEBUG_PAGE_REF) += debug_page_ref.o _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 089/143] mm: cma: add the CMA instance name to cma trace events 2021-05-05 1:32 incoming Andrew Morton ` (87 preceding siblings ...) 2021-05-05 1:37 ` [patch 088/143] mm: cma: support sysfs Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 090/143] mm: use proper type for cma_[alloc|release] Andrew Morton ` (51 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, georgi.djakov, linux-mm, lmark, minchan, mm-commits, torvalds From: Minchan Kim <minchan@kernel.org> Subject: mm: cma: add the CMA instance name to cma trace events There were missing places to add cma instance name. To identify each CMA instance, let's add the name for every cma trace. This patch also changes the existing cma_trace_alloc to cma_trace_finish since we have cma_alloc_start[1]. [1] https://lore.kernel.org/linux-mm/20210324160740.15901-1-georgi.djakov@linaro.org Link: https://lkml.kernel.org/r/20210330220237.748899-1-minchan@kernel.org Signed-off-by: Minchan Kim <minchan@kernel.org> Cc: Liam Mark <lmark@codeaurora.org> Cc: Georgi Djakov <georgi.djakov@linaro.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/trace/events/cma.h | 28 +++++++++++++++++----------- mm/cma.c | 7 ++++--- 2 files changed, 21 insertions(+), 14 deletions(-) --- a/include/trace/events/cma.h~mm-cma-add-the-cma-instance-name-to-cma-trace-events +++ a/include/trace/events/cma.h @@ -10,12 +10,13 @@ DECLARE_EVENT_CLASS(cma_alloc_class, - TP_PROTO(unsigned long pfn, const struct page *page, + TP_PROTO(const char *name, unsigned long pfn, const struct page *page, unsigned int count, unsigned int align), - TP_ARGS(pfn, page, count, align), + TP_ARGS(name, pfn, page, count, align), TP_STRUCT__entry( + __string(name, name) __field(unsigned long, pfn) __field(const struct page *, page) __field(unsigned int, count) @@ -23,13 +24,15 @@ DECLARE_EVENT_CLASS(cma_alloc_class, ), TP_fast_assign( + __assign_str(name, name); __entry->pfn = pfn; __entry->page = page; __entry->count = count; __entry->align = align; ), - TP_printk("pfn=%lx page=%p count=%u align=%u", + TP_printk("name=%s pfn=%lx page=%p count=%u align=%u", + __get_str(name), __entry->pfn, __entry->page, __entry->count, @@ -38,24 +41,27 @@ DECLARE_EVENT_CLASS(cma_alloc_class, TRACE_EVENT(cma_release, - TP_PROTO(unsigned long pfn, const struct page *page, + TP_PROTO(const char *name, unsigned long pfn, const struct page *page, unsigned int count), - TP_ARGS(pfn, page, count), + TP_ARGS(name, pfn, page, count), TP_STRUCT__entry( + __string(name, name) __field(unsigned long, pfn) __field(const struct page *, page) __field(unsigned int, count) ), TP_fast_assign( + __assign_str(name, name); __entry->pfn = pfn; __entry->page = page; __entry->count = count; ), - TP_printk("pfn=%lx page=%p count=%u", + TP_printk("name=%s pfn=%lx page=%p count=%u", + __get_str(name), __entry->pfn, __entry->page, __entry->count) @@ -85,20 +91,20 @@ TRACE_EVENT(cma_alloc_start, __entry->align) ); -DEFINE_EVENT(cma_alloc_class, cma_alloc, +DEFINE_EVENT(cma_alloc_class, cma_alloc_finish, - TP_PROTO(unsigned long pfn, const struct page *page, + TP_PROTO(const char *name, unsigned long pfn, const struct page *page, unsigned int count, unsigned int align), - TP_ARGS(pfn, page, count, align) + TP_ARGS(name, pfn, page, count, align) ); DEFINE_EVENT(cma_alloc_class, cma_alloc_busy_retry, - TP_PROTO(unsigned long pfn, const struct page *page, + TP_PROTO(const char *name, unsigned long pfn, const struct page *page, unsigned int count, unsigned int align), - TP_ARGS(pfn, page, count, align) + TP_ARGS(name, pfn, page, count, align) ); #endif /* _TRACE_CMA_H */ --- a/mm/cma.c~mm-cma-add-the-cma-instance-name-to-cma-trace-events +++ a/mm/cma.c @@ -486,12 +486,13 @@ struct page *cma_alloc(struct cma *cma, pr_debug("%s(): memory range at %p is busy, retrying\n", __func__, pfn_to_page(pfn)); - trace_cma_alloc_busy_retry(pfn, pfn_to_page(pfn), count, align); + trace_cma_alloc_busy_retry(cma->name, pfn, pfn_to_page(pfn), + count, align); /* try again with a bit different memory target */ start = bitmap_no + mask + 1; } - trace_cma_alloc(pfn, page, count, align); + trace_cma_alloc_finish(cma->name, pfn, page, count, align); /* * CMA can allocate multiple page blocks, which results in different @@ -551,7 +552,7 @@ bool cma_release(struct cma *cma, const free_contig_range(pfn, count); cma_clear_bitmap(cma, pfn, count); - trace_cma_release(pfn, pages, count); + trace_cma_release(cma->name, pfn, pages, count); return true; } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 090/143] mm: use proper type for cma_[alloc|release] 2021-05-05 1:32 incoming Andrew Morton ` (88 preceding siblings ...) 2021-05-05 1:37 ` [patch 089/143] mm: cma: add the CMA instance name to cma trace events Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 091/143] ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search() Andrew Morton ` (50 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, david, linux-mm, minchan, mm-commits, torvalds, willy From: Minchan Kim <minchan@kernel.org> Subject: mm: use proper type for cma_[alloc|release] size_t in cma_alloc is confusing since it makes people think it's byte count, not pages. Change it to unsigned long[1]. The unsigned int in cma_release is also not right so change it. Since we have unsigned long in cma_release, free_contig_range should also respect it. [1] 67a2e213e7e9, mm: cma: fix incorrect type conversion for size during dma allocation Link: https://lore.kernel.org/linux-mm/20210324043434.GP1719932@casper.infradead.org/ Link: https://lkml.kernel.org/r/20210331164018.710560-1-minchan@kernel.org Signed-off-by: Minchan Kim <minchan@kernel.org> Reviewed-by: David Hildenbrand <david@redhat.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: David Hildenbrand <david@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/cma.h | 4 ++-- include/linux/gfp.h | 2 +- include/trace/events/cma.h | 22 +++++++++++----------- mm/cma.c | 17 +++++++++-------- mm/page_alloc.c | 6 +++--- 5 files changed, 26 insertions(+), 25 deletions(-) --- a/include/linux/cma.h~mm-use-proper-type-for-cma_ +++ a/include/linux/cma.h @@ -44,9 +44,9 @@ extern int cma_init_reserved_mem(phys_ad unsigned int order_per_bit, const char *name, struct cma **res_cma); -extern struct page *cma_alloc(struct cma *cma, size_t count, unsigned int align, +extern struct page *cma_alloc(struct cma *cma, unsigned long count, unsigned int align, bool no_warn); -extern bool cma_release(struct cma *cma, const struct page *pages, unsigned int count); +extern bool cma_release(struct cma *cma, const struct page *pages, unsigned long count); extern int cma_for_each_area(int (*it)(struct cma *cma, void *data), void *data); #endif --- a/include/linux/gfp.h~mm-use-proper-type-for-cma_ +++ a/include/linux/gfp.h @@ -657,7 +657,7 @@ extern int alloc_contig_range(unsigned l extern struct page *alloc_contig_pages(unsigned long nr_pages, gfp_t gfp_mask, int nid, nodemask_t *nodemask); #endif -void free_contig_range(unsigned long pfn, unsigned int nr_pages); +void free_contig_range(unsigned long pfn, unsigned long nr_pages); #ifdef CONFIG_CMA /* CMA stuff */ --- a/include/trace/events/cma.h~mm-use-proper-type-for-cma_ +++ a/include/trace/events/cma.h @@ -11,7 +11,7 @@ DECLARE_EVENT_CLASS(cma_alloc_class, TP_PROTO(const char *name, unsigned long pfn, const struct page *page, - unsigned int count, unsigned int align), + unsigned long count, unsigned int align), TP_ARGS(name, pfn, page, count, align), @@ -19,7 +19,7 @@ DECLARE_EVENT_CLASS(cma_alloc_class, __string(name, name) __field(unsigned long, pfn) __field(const struct page *, page) - __field(unsigned int, count) + __field(unsigned long, count) __field(unsigned int, align) ), @@ -31,7 +31,7 @@ DECLARE_EVENT_CLASS(cma_alloc_class, __entry->align = align; ), - TP_printk("name=%s pfn=%lx page=%p count=%u align=%u", + TP_printk("name=%s pfn=%lx page=%p count=%lu align=%u", __get_str(name), __entry->pfn, __entry->page, @@ -42,7 +42,7 @@ DECLARE_EVENT_CLASS(cma_alloc_class, TRACE_EVENT(cma_release, TP_PROTO(const char *name, unsigned long pfn, const struct page *page, - unsigned int count), + unsigned long count), TP_ARGS(name, pfn, page, count), @@ -50,7 +50,7 @@ TRACE_EVENT(cma_release, __string(name, name) __field(unsigned long, pfn) __field(const struct page *, page) - __field(unsigned int, count) + __field(unsigned long, count) ), TP_fast_assign( @@ -60,7 +60,7 @@ TRACE_EVENT(cma_release, __entry->count = count; ), - TP_printk("name=%s pfn=%lx page=%p count=%u", + TP_printk("name=%s pfn=%lx page=%p count=%lu", __get_str(name), __entry->pfn, __entry->page, @@ -69,13 +69,13 @@ TRACE_EVENT(cma_release, TRACE_EVENT(cma_alloc_start, - TP_PROTO(const char *name, unsigned int count, unsigned int align), + TP_PROTO(const char *name, unsigned long count, unsigned int align), TP_ARGS(name, count, align), TP_STRUCT__entry( __string(name, name) - __field(unsigned int, count) + __field(unsigned long, count) __field(unsigned int, align) ), @@ -85,7 +85,7 @@ TRACE_EVENT(cma_alloc_start, __entry->align = align; ), - TP_printk("name=%s count=%u align=%u", + TP_printk("name=%s count=%lu align=%u", __get_str(name), __entry->count, __entry->align) @@ -94,7 +94,7 @@ TRACE_EVENT(cma_alloc_start, DEFINE_EVENT(cma_alloc_class, cma_alloc_finish, TP_PROTO(const char *name, unsigned long pfn, const struct page *page, - unsigned int count, unsigned int align), + unsigned long count, unsigned int align), TP_ARGS(name, pfn, page, count, align) ); @@ -102,7 +102,7 @@ DEFINE_EVENT(cma_alloc_class, cma_alloc_ DEFINE_EVENT(cma_alloc_class, cma_alloc_busy_retry, TP_PROTO(const char *name, unsigned long pfn, const struct page *page, - unsigned int count, unsigned int align), + unsigned long count, unsigned int align), TP_ARGS(name, pfn, page, count, align) ); --- a/mm/cma.c~mm-use-proper-type-for-cma_ +++ a/mm/cma.c @@ -79,7 +79,7 @@ static unsigned long cma_bitmap_pages_to } static void cma_clear_bitmap(struct cma *cma, unsigned long pfn, - unsigned int count) + unsigned long count) { unsigned long bitmap_no, bitmap_count; unsigned long flags; @@ -423,21 +423,21 @@ static inline void cma_debug_show_areas( * This function allocates part of contiguous memory on specific * contiguous memory area. */ -struct page *cma_alloc(struct cma *cma, size_t count, unsigned int align, - bool no_warn) +struct page *cma_alloc(struct cma *cma, unsigned long count, + unsigned int align, bool no_warn) { unsigned long mask, offset; unsigned long pfn = -1; unsigned long start = 0; unsigned long bitmap_maxno, bitmap_no, bitmap_count; - size_t i; + unsigned long i; struct page *page = NULL; int ret = -ENOMEM; if (!cma || !cma->count || !cma->bitmap) goto out; - pr_debug("%s(cma %p, count %zu, align %d)\n", __func__, (void *)cma, + pr_debug("%s(cma %p, count %lu, align %d)\n", __func__, (void *)cma, count, align); if (!count) @@ -505,7 +505,7 @@ struct page *cma_alloc(struct cma *cma, } if (ret && !no_warn) { - pr_err_ratelimited("%s: %s: alloc failed, req-size: %zu pages, ret: %d\n", + pr_err_ratelimited("%s: %s: alloc failed, req-size: %lu pages, ret: %d\n", __func__, cma->name, count, ret); cma_debug_show_areas(cma); } @@ -534,14 +534,15 @@ out: * It returns false when provided pages do not belong to contiguous area and * true otherwise. */ -bool cma_release(struct cma *cma, const struct page *pages, unsigned int count) +bool cma_release(struct cma *cma, const struct page *pages, + unsigned long count) { unsigned long pfn; if (!cma || !pages) return false; - pr_debug("%s(page %p, count %u)\n", __func__, (void *)pages, count); + pr_debug("%s(page %p, count %lu)\n", __func__, (void *)pages, count); pfn = page_to_pfn(pages); --- a/mm/page_alloc.c~mm-use-proper-type-for-cma_ +++ a/mm/page_alloc.c @@ -8973,9 +8973,9 @@ struct page *alloc_contig_pages(unsigned } #endif /* CONFIG_CONTIG_ALLOC */ -void free_contig_range(unsigned long pfn, unsigned int nr_pages) +void free_contig_range(unsigned long pfn, unsigned long nr_pages) { - unsigned int count = 0; + unsigned long count = 0; for (; nr_pages--; pfn++) { struct page *page = pfn_to_page(pfn); @@ -8983,7 +8983,7 @@ void free_contig_range(unsigned long pfn count += page_count(page) != 1; __free_page(page); } - WARN(count != 0, "%d pages are still in use!\n", count); + WARN(count != 0, "%lu pages are still in use!\n", count); } EXPORT_SYMBOL(free_contig_range); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 091/143] ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search() 2021-05-05 1:32 incoming Andrew Morton ` (89 preceding siblings ...) 2021-05-05 1:37 ` [patch 090/143] mm: use proper type for cma_[alloc|release] Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 092/143] ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree() Andrew Morton ` (49 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, hughd, linmiaohe, linux-mm, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search() Patch series "Cleanup and fixup for ksm". This series contains cleanups to remove unnecessary VM_BUG_ON_PAGE and dedicated macro KSM_FLAG_MASK. Also this fixes potential missing rmap_item for stable_node which would result in failed rmap_walk_ksm(). More details can be found in the respective changelogs. This patch (of 4): The same VM_BUG_ON_PAGE() check is already done in the callee. Remove these extra caller one to simplify code slightly. Link: https://lkml.kernel.org/r/20210330140228.45635-1-linmiaohe@huawei.com Link: https://lkml.kernel.org/r/20210330140228.45635-2-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Cc: Hugh Dickins <hughd@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/ksm.c | 2 -- 1 file changed, 2 deletions(-) --- a/mm/ksm.c~ksm-remove-redundant-vm_bug_on_page-on-stable_tree_search +++ a/mm/ksm.c @@ -1771,7 +1771,6 @@ chain_append: * stable_node_dup is the dup to replace. */ if (stable_node_dup == stable_node) { - VM_BUG_ON(is_stable_node_chain(stable_node_dup)); VM_BUG_ON(is_stable_node_dup(stable_node_dup)); /* chain is missing so create it */ stable_node = alloc_stable_node_chain(stable_node_dup, @@ -1785,7 +1784,6 @@ chain_append: * of the current nid for this page * content. */ - VM_BUG_ON(!is_stable_node_chain(stable_node)); VM_BUG_ON(!is_stable_node_dup(stable_node_dup)); VM_BUG_ON(page_node->head != &migrate_nodes); list_del(&page_node->list); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 092/143] ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree() 2021-05-05 1:32 incoming Andrew Morton ` (90 preceding siblings ...) 2021-05-05 1:37 ` [patch 091/143] ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search() Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 093/143] ksm: remove dedicated macro KSM_FLAG_MASK Andrew Morton ` (48 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, hughd, linmiaohe, linux-mm, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree() It's unnecessary to lock the page when get ksm page if we're going to remove the rmap item as page migration is irrelevant in this case. Use GET_KSM_PAGE_NOLOCK instead to save some page lock cycles. Link: https://lkml.kernel.org/r/20210330140228.45635-3-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Cc: Hugh Dickins <hughd@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/ksm.c | 3 +-- 1 file changed, 1 insertion(+), 2 deletions(-) --- a/mm/ksm.c~ksm-use-get_ksm_page_nolock-to-get-ksm-page-in-remove_rmap_item_from_tree +++ a/mm/ksm.c @@ -778,12 +778,11 @@ static void remove_rmap_item_from_tree(s struct page *page; stable_node = rmap_item->head; - page = get_ksm_page(stable_node, GET_KSM_PAGE_LOCK); + page = get_ksm_page(stable_node, GET_KSM_PAGE_NOLOCK); if (!page) goto out; hlist_del(&rmap_item->hlist); - unlock_page(page); put_page(page); if (!hlist_empty(&stable_node->hlist)) _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 093/143] ksm: remove dedicated macro KSM_FLAG_MASK 2021-05-05 1:32 incoming Andrew Morton ` (91 preceding siblings ...) 2021-05-05 1:37 ` [patch 092/143] ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree() Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 094/143] ksm: fix potential missing rmap_item for stable_node Andrew Morton ` (47 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, hughd, linmiaohe, linux-mm, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: ksm: remove dedicated macro KSM_FLAG_MASK The macro KSM_FLAG_MASK is used in rmap_walk_ksm() only. So we can replace ~KSM_FLAG_MASK with PAGE_MASK to remove this dedicated macro and make code more consistent because PAGE_MASK is used elsewhere in this file. Link: https://lkml.kernel.org/r/20210330140228.45635-4-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Cc: Hugh Dickins <hughd@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/ksm.c | 4 +--- 1 file changed, 1 insertion(+), 3 deletions(-) --- a/mm/ksm.c~ksm-remove-dedicated-macro-ksm_flag_mask +++ a/mm/ksm.c @@ -215,8 +215,6 @@ struct rmap_item { #define SEQNR_MASK 0x0ff /* low bits of unstable tree seqnr */ #define UNSTABLE_FLAG 0x100 /* is a node of the unstable tree */ #define STABLE_FLAG 0x200 /* is listed from the stable tree */ -#define KSM_FLAG_MASK (SEQNR_MASK|UNSTABLE_FLAG|STABLE_FLAG) - /* to mask all the flags */ /* The stable and unstable tree heads */ static struct rb_root one_stable_tree[1] = { RB_ROOT }; @@ -2631,7 +2629,7 @@ again: vma = vmac->vma; /* Ignore the stable/unstable/sqnr flags */ - addr = rmap_item->address & ~KSM_FLAG_MASK; + addr = rmap_item->address & PAGE_MASK; if (addr < vma->vm_start || addr >= vma->vm_end) continue; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 094/143] ksm: fix potential missing rmap_item for stable_node 2021-05-05 1:32 incoming Andrew Morton ` (92 preceding siblings ...) 2021-05-05 1:37 ` [patch 093/143] ksm: remove dedicated macro KSM_FLAG_MASK Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 095/143] mm/ksm: remove unused parameter from remove_trailing_rmap_items() Andrew Morton ` (46 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, hughd, linmiaohe, linux-mm, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: ksm: fix potential missing rmap_item for stable_node When removing rmap_item from stable tree, STABLE_FLAG of rmap_item is cleared with head reserved. So the following scenario might happen: For ksm page with rmap_item1: cmp_and_merge_page stable_node->head = &migrate_nodes; remove_rmap_item_from_tree, but head still equal to stable_node; try_to_merge_with_ksm_page failed; return; For the same ksm page with rmap_item2, stable node migration succeed this time. The stable_node->head does not equal to migrate_nodes now. For ksm page with rmap_item1 again: cmp_and_merge_page stable_node->head != &migrate_nodes && rmap_item->head == stable_node return; We would miss the rmap_item for stable_node and might result in failed rmap_walk_ksm(). Fix this by set rmap_item->head to NULL when rmap_item is removed from stable tree. Link: https://lkml.kernel.org/r/20210330140228.45635-5-linmiaohe@huawei.com Fixes: 4146d2d673e8 ("ksm: make !merge_across_nodes migration safe") Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Cc: Hugh Dickins <hughd@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/ksm.c | 1 + 1 file changed, 1 insertion(+) --- a/mm/ksm.c~ksm-fix-potential-missing-rmap_item-for-stable_node +++ a/mm/ksm.c @@ -791,6 +791,7 @@ static void remove_rmap_item_from_tree(s stable_node->rmap_hlist_len--; put_anon_vma(rmap_item->anon_vma); + rmap_item->head = NULL; rmap_item->address &= PAGE_MASK; } else if (rmap_item->address & UNSTABLE_FLAG) { _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 095/143] mm/ksm: remove unused parameter from remove_trailing_rmap_items() 2021-05-05 1:32 incoming Andrew Morton ` (93 preceding siblings ...) 2021-05-05 1:37 ` [patch 094/143] ksm: fix potential missing rmap_item for stable_node Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 096/143] mm: restore node stat checking in /proc/sys/vm/stat_refresh Andrew Morton ` (45 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, cy.fan, david, hughd, linux-mm, mm-commits, torvalds From: Chengyang Fan <cy.fan@huawei.com> Subject: mm/ksm: remove unused parameter from remove_trailing_rmap_items() Since commit 6514d511dbe5 ("ksm: singly-linked rmap_list") was merged, remove_trailing_rmap_items() doesn't use the 'mm_slot' parameter. So remove it, and update caller accordingly. Link: https://lkml.kernel.org/r/20210330121320.1693474-1-cy.fan@huawei.com Signed-off-by: Chengyang Fan <cy.fan@huawei.com> Reviewed-by: David Hildenbrand <david@redhat.com> Cc: Hugh Dickins <hughd@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/ksm.c | 7 +++---- 1 file changed, 3 insertions(+), 4 deletions(-) --- a/mm/ksm.c~mm-ksm-remove-unused-parameter-from-remove_trailing_rmap_items +++ a/mm/ksm.c @@ -815,8 +815,7 @@ out: cond_resched(); /* we're called from many long loops */ } -static void remove_trailing_rmap_items(struct mm_slot *mm_slot, - struct rmap_item **rmap_list) +static void remove_trailing_rmap_items(struct rmap_item **rmap_list) { while (*rmap_list) { struct rmap_item *rmap_item = *rmap_list; @@ -987,7 +986,7 @@ static int unmerge_and_remove_all_rmap_i goto error; } - remove_trailing_rmap_items(mm_slot, &mm_slot->rmap_list); + remove_trailing_rmap_items(&mm_slot->rmap_list); mmap_read_unlock(mm); spin_lock(&ksm_mmlist_lock); @@ -2333,7 +2332,7 @@ next_mm: * Nuke all the rmap_items that are above this current rmap: * because there were no VM_MERGEABLE vmas with such addresses. */ - remove_trailing_rmap_items(slot, ksm_scan.rmap_list); + remove_trailing_rmap_items(ksm_scan.rmap_list); spin_lock(&ksm_mmlist_lock); ksm_scan.mm_slot = list_entry(slot->mm_list.next, _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 096/143] mm: restore node stat checking in /proc/sys/vm/stat_refresh 2021-05-05 1:32 incoming Andrew Morton ` (94 preceding siblings ...) 2021-05-05 1:37 ` [patch 095/143] mm/ksm: remove unused parameter from remove_trailing_rmap_items() Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 097/143] mm: no more EINVAL from /proc/sys/vm/stat_refresh Andrew Morton ` (44 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, guro, hannes, hughd, linux-mm, mhocko, mm-commits, torvalds, vbabka From: Hugh Dickins <hughd@google.com> Subject: mm: restore node stat checking in /proc/sys/vm/stat_refresh v4.7 52b6f46bc163 ("mm: /proc/sys/vm/stat_refresh to force vmstat update") introduced vmstat_refresh(), with its vmstat underflow checking; then v4.8 75ef71840539 ("mm, vmstat: add infrastructure for per-node vmstats") split NR_VM_NODE_STAT_ITEMS out of NR_VM_ZONE_STAT_ITEMS without updating vmstat_refresh(): so it has been missing out much of the vmstat underflow checking ever since. Reinstate it. Thanks to Roman Gushchin <guro@fb.com> for tangentially pointing this out. Link: https://lkml.kernel.org/r/alpine.LSU.2.11.2102251502240.13363@eggly.anvils Signed-off-by: Hugh Dickins <hughd@google.com> Cc: Roman Gushchin <guro@fb.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmstat.c | 8 ++++++++ 1 file changed, 8 insertions(+) --- a/mm/vmstat.c~mm-restore-node-stat-checking-in-proc-sys-vm-stat_refresh +++ a/mm/vmstat.c @@ -1875,6 +1875,14 @@ int vmstat_refresh(struct ctl_table *tab } } #endif + for (i = 0; i < NR_VM_NODE_STAT_ITEMS; i++) { + val = atomic_long_read(&vm_node_stat[i]); + if (val < 0) { + pr_warn("%s: %s %ld\n", + __func__, node_stat_name(i), val); + err = -EINVAL; + } + } if (err) return err; if (write) _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 097/143] mm: no more EINVAL from /proc/sys/vm/stat_refresh 2021-05-05 1:32 incoming Andrew Morton ` (95 preceding siblings ...) 2021-05-05 1:37 ` [patch 096/143] mm: restore node stat checking in /proc/sys/vm/stat_refresh Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:37 ` [patch 098/143] mm: /proc/sys/vm/stat_refresh skip checking known negative stats Andrew Morton ` (43 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, guro, hannes, hughd, linux-mm, mhocko, mm-commits, torvalds, vbabka From: Hugh Dickins <hughd@google.com> Subject: mm: no more EINVAL from /proc/sys/vm/stat_refresh EINVAL was good for drawing the refresher's attention to a warning in dmesg, but became very tiresome when running test suites scripted with "set -e": an underflow from a bug in one feature would cause unrelated tests much later to fail, just because their /proc/sys/vm/stat_refresh touch failed with that error. Stop doing that. Link: https://lkml.kernel.org/r/alpine.LSU.2.11.2102251510410.13363@eggly.anvils Signed-off-by: Hugh Dickins <hughd@google.com> Acked-by: Roman Gushchin <guro@fb.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmstat.c | 5 ----- 1 file changed, 5 deletions(-) --- a/mm/vmstat.c~mm-no-more-einval-from-proc-sys-vm-stat_refresh +++ a/mm/vmstat.c @@ -1862,7 +1862,6 @@ int vmstat_refresh(struct ctl_table *tab if (val < 0) { pr_warn("%s: %s %ld\n", __func__, zone_stat_name(i), val); - err = -EINVAL; } } #ifdef CONFIG_NUMA @@ -1871,7 +1870,6 @@ int vmstat_refresh(struct ctl_table *tab if (val < 0) { pr_warn("%s: %s %ld\n", __func__, numa_stat_name(i), val); - err = -EINVAL; } } #endif @@ -1880,11 +1878,8 @@ int vmstat_refresh(struct ctl_table *tab if (val < 0) { pr_warn("%s: %s %ld\n", __func__, node_stat_name(i), val); - err = -EINVAL; } } - if (err) - return err; if (write) *ppos += *lenp; else _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 098/143] mm: /proc/sys/vm/stat_refresh skip checking known negative stats 2021-05-05 1:32 incoming Andrew Morton ` (96 preceding siblings ...) 2021-05-05 1:37 ` [patch 097/143] mm: no more EINVAL from /proc/sys/vm/stat_refresh Andrew Morton @ 2021-05-05 1:37 ` Andrew Morton 2021-05-05 1:38 ` [patch 099/143] mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats Andrew Morton ` (42 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw) To: akpm, guro, hannes, hughd, linux-mm, mhocko, mm-commits, torvalds, vbabka From: Hugh Dickins <hughd@google.com> Subject: mm: /proc/sys/vm/stat_refresh skip checking known negative stats vmstat_refresh() can occasionally catch nr_zone_write_pending and nr_writeback when they are transiently negative. The reason is partly that the interrupt which decrements them in test_clear_page_writeback() can come in before __test_set_page_writeback() got to increment them; but transient negatives are still seen even when that is prevented, and I am not yet certain why (but see Roman's note below). Those stats are not buggy, they have never been seen to drift away from 0 permanently: so just avoid the annoyance of showing a warning on them. Similarly avoid showing a warning on nr_free_cma: CMA users have seen that one reported negative from /proc/sys/vm/stat_refresh too, but it does drift away permanently: I believe that's because its incrementation and decrementation are decided by page migratetype, but the migratetype of a pageblock is not guaranteed to be constant. Roman Gushchin points out: For performance reasons, vmstat counters are incremented and decremented using per-cpu batches. vmstat_refresh() flushes the per-cpu batches on all CPUs, to get values as accurate as possible; but this method is not atomic, so the resulting value is not always precise. As a consequence, for those counters whose actual value is close to 0, a small negative value may occasionally be reported. If the value is small and the state is transient, it is not an indication of an error. Link: https://lore.kernel.org/linux-mm/20200714173747.3315771-1-guro@fb.com/ Link: https://lkml.kernel.org/r/alpine.LSU.2.11.2103012158540.7549@eggly.anvils Signed-off-by: Hugh Dickins <hughd@google.com> Reported-by: Roman Gushchin <guro@fb.com> Acked-by: Roman Gushchin <guro@fb.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmstat.c | 15 +++++++++++++++ 1 file changed, 15 insertions(+) --- a/mm/vmstat.c~mm-proc-sys-vm-stat_refresh-skip-checking-known-negative-stats +++ a/mm/vmstat.c @@ -1858,6 +1858,14 @@ int vmstat_refresh(struct ctl_table *tab if (err) return err; for (i = 0; i < NR_VM_ZONE_STAT_ITEMS; i++) { + /* + * Skip checking stats known to go negative occasionally. + */ + switch (i) { + case NR_ZONE_WRITE_PENDING: + case NR_FREE_CMA_PAGES: + continue; + } val = atomic_long_read(&vm_zone_stat[i]); if (val < 0) { pr_warn("%s: %s %ld\n", @@ -1874,6 +1882,13 @@ int vmstat_refresh(struct ctl_table *tab } #endif for (i = 0; i < NR_VM_NODE_STAT_ITEMS; i++) { + /* + * Skip checking stats known to go negative occasionally. + */ + switch (i) { + case NR_WRITEBACK: + continue; + } val = atomic_long_read(&vm_node_stat[i]); if (val < 0) { pr_warn("%s: %s %ld\n", _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 099/143] mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats 2021-05-05 1:32 incoming Andrew Morton ` (97 preceding siblings ...) 2021-05-05 1:37 ` [patch 098/143] mm: /proc/sys/vm/stat_refresh skip checking known negative stats Andrew Morton @ 2021-05-05 1:38 ` Andrew Morton 2021-05-05 1:38 ` [patch 100/143] x86/mm: track linear mapping split events Andrew Morton ` (41 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw) To: akpm, guro, hannes, hughd, linux-mm, mhocko, mm-commits, torvalds, vbabka From: Hugh Dickins <hughd@google.com> Subject: mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats All of the VM NUMA stats are event counts, incremented never decremented: it is not very useful for vmstat_refresh() to check them throughout their first aeon, then warn on them throughout their next. Link: https://lkml.kernel.org/r/alpine.LSU.2.11.2102251514110.13363@eggly.anvils Signed-off-by: Hugh Dickins <hughd@google.com> Acked-by: Roman Gushchin <guro@fb.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmstat.c | 9 --------- 1 file changed, 9 deletions(-) --- a/mm/vmstat.c~mm-proc-sys-vm-stat_refresh-stop-checking-monotonic-numa-stats +++ a/mm/vmstat.c @@ -1872,15 +1872,6 @@ int vmstat_refresh(struct ctl_table *tab __func__, zone_stat_name(i), val); } } -#ifdef CONFIG_NUMA - for (i = 0; i < NR_VM_NUMA_STAT_ITEMS; i++) { - val = atomic_long_read(&vm_numa_stat[i]); - if (val < 0) { - pr_warn("%s: %s %ld\n", - __func__, numa_stat_name(i), val); - } - } -#endif for (i = 0; i < NR_VM_NODE_STAT_ITEMS; i++) { /* * Skip checking stats known to go negative occasionally. _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 100/143] x86/mm: track linear mapping split events 2021-05-05 1:32 incoming Andrew Morton ` (98 preceding siblings ...) 2021-05-05 1:38 ` [patch 099/143] mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats Andrew Morton @ 2021-05-05 1:38 ` Andrew Morton 2021-05-05 1:38 ` [patch 101/143] mm/mmap.c: don't unlock VMAs in remap_file_pages() Andrew Morton ` (40 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw) To: akpm, dave.hansen, hannes, linux-mm, mingo, mm-commits, saravanand, tj, torvalds From: Saravanan D <saravanand@fb.com> Subject: x86/mm: track linear mapping split events To help with debugging the sluggishness caused by TLB miss/reload, we introduce monotonic hugepage [direct mapped] split event counts since system state: SYSTEM_RUNNING to be displayed as part of /proc/vmstat in x86 servers The lifetime split event information will be displayed at the bottom of /proc/vmstat .... swap_ra 0 swap_ra_hit 0 direct_map_level2_splits 94 direct_map_level3_splits 4 nr_unstable 0 .... One of the many lasting sources of direct hugepage splits is kernel tracing (kprobes, tracepoints). Note that the kernel's code segment [512 MB] points to the same physical addresses that have been already mapped in the kernel's direct mapping range. Source : Documentation/x86/x86_64/mm.rst When we enable kernel tracing, the kernel has to modify attributes/permissions of the text segment hugepages that are direct mapped causing them to split. Kernel's direct mapped hugepages do not coalesce back after split and remain in place for the remainder of the lifetime. An instance of direct page splits when we turn on dynamic kernel tracing .... cat /proc/vmstat | grep -i direct_map_level direct_map_level2_splits 784 direct_map_level3_splits 12 bpftrace -e 'tracepoint:raw_syscalls:sys_enter { @ [pid, comm] = count(); }' cat /proc/vmstat | grep -i direct_map_level direct_map_level2_splits 789 direct_map_level3_splits 12 .... Link: https://lkml.kernel.org/r/20210218235744.1040634-1-saravanand@fb.com Signed-off-by: Saravanan D <saravanand@fb.com> Acked-by: Tejun Heo <tj@kernel.org> Acked-by: Johannes Weiner <hannes@cmpxchg.org> Acked-by: Dave Hansen <dave.hansen@linux.intel.com> Cc: Ingo Molnar <mingo@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/x86/mm/pat/set_memory.c | 8 ++++++++ include/linux/vm_event_item.h | 4 ++++ mm/vmstat.c | 4 ++++ 3 files changed, 16 insertions(+) --- a/arch/x86/mm/pat/set_memory.c~x86-mm-tracking-linear-mapping-split-events +++ a/arch/x86/mm/pat/set_memory.c @@ -16,6 +16,8 @@ #include <linux/pci.h> #include <linux/vmalloc.h> #include <linux/libnvdimm.h> +#include <linux/vmstat.h> +#include <linux/kernel.h> #include <asm/e820/api.h> #include <asm/processor.h> @@ -91,6 +93,12 @@ static void split_page_count(int level) return; direct_pages_count[level]--; + if (system_state == SYSTEM_RUNNING) { + if (level == PG_LEVEL_2M) + count_vm_event(DIRECT_MAP_LEVEL2_SPLIT); + else if (level == PG_LEVEL_1G) + count_vm_event(DIRECT_MAP_LEVEL3_SPLIT); + } direct_pages_count[level - 1] += PTRS_PER_PTE; } --- a/include/linux/vm_event_item.h~x86-mm-tracking-linear-mapping-split-events +++ a/include/linux/vm_event_item.h @@ -125,6 +125,10 @@ enum vm_event_item { PGPGIN, PGPGOUT, PS SWAP_RA, SWAP_RA_HIT, #endif +#ifdef CONFIG_X86 + DIRECT_MAP_LEVEL2_SPLIT, + DIRECT_MAP_LEVEL3_SPLIT, +#endif NR_VM_EVENT_ITEMS }; --- a/mm/vmstat.c~x86-mm-tracking-linear-mapping-split-events +++ a/mm/vmstat.c @@ -1369,6 +1369,10 @@ const char * const vmstat_text[] = { "swap_ra", "swap_ra_hit", #endif +#ifdef CONFIG_X86 + "direct_map_level2_splits", + "direct_map_level3_splits", +#endif #endif /* CONFIG_VM_EVENT_COUNTERS || CONFIG_MEMCG */ }; #endif /* CONFIG_PROC_FS || CONFIG_SYSFS || CONFIG_NUMA || CONFIG_MEMCG */ _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 101/143] mm/mmap.c: don't unlock VMAs in remap_file_pages() 2021-05-05 1:32 incoming Andrew Morton ` (99 preceding siblings ...) 2021-05-05 1:38 ` [patch 100/143] x86/mm: track linear mapping split events Andrew Morton @ 2021-05-05 1:38 ` Andrew Morton 2021-05-05 1:38 ` [patch 102/143] mm: generalize ARCH_HAS_CACHE_LINE_SIZE Andrew Morton ` (39 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw) To: akpm, david, hughd, Liam.Howlett, linux-mm, mm-commits, torvalds, willy From: Liam Howlett <liam.howlett@oracle.com> Subject: mm/mmap.c: don't unlock VMAs in remap_file_pages() Since this call uses MAP_FIXED, do_mmap() will munlock the necessary range. There is also an error in the loop test expression which will evaluate as false and the loop body has never execute. Link: https://lkml.kernel.org/r/20210223235010.2296915-1-Liam.Howlett@Oracle.com Signed-off-by: Liam R. Howlett <Liam.Howlett@Oracle.com> Acked-by: Hugh Dickins <hughd@google.com> Reviewed-by: Matthew Wilcox (Oracle) <willy@infradead.org> Reviewed-by: David Hildenbrand <david@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/mmap.c | 18 +----------------- 1 file changed, 1 insertion(+), 17 deletions(-) --- a/mm/mmap.c~mm-mmap-dont-unlock-vmas-in-remap_file_pages +++ a/mm/mmap.c @@ -3029,25 +3029,9 @@ SYSCALL_DEFINE5(remap_file_pages, unsign flags &= MAP_NONBLOCK; flags |= MAP_SHARED | MAP_FIXED | MAP_POPULATE; - if (vma->vm_flags & VM_LOCKED) { - struct vm_area_struct *tmp; + if (vma->vm_flags & VM_LOCKED) flags |= MAP_LOCKED; - /* drop PG_Mlocked flag for over-mapped range */ - for (tmp = vma; tmp->vm_start >= start + size; - tmp = tmp->vm_next) { - /* - * Split pmd and munlock page on the border - * of the range. - */ - vma_adjust_trans_huge(tmp, start, start + size, 0); - - munlock_vma_pages_range(tmp, - max(tmp->vm_start, start), - min(tmp->vm_end, start + size)); - } - } - file = get_file(vma->vm_file); ret = do_mmap(vma->vm_file, start, size, prot, flags, pgoff, &populate, NULL); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 102/143] mm: generalize ARCH_HAS_CACHE_LINE_SIZE 2021-05-05 1:32 incoming Andrew Morton ` (100 preceding siblings ...) 2021-05-05 1:38 ` [patch 101/143] mm/mmap.c: don't unlock VMAs in remap_file_pages() Andrew Morton @ 2021-05-05 1:38 ` Andrew Morton 2021-05-05 1:38 ` [patch 104/143] mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] Andrew Morton ` (38 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw) To: akpm, anshuman.khandual, aou, arnd, benh, borntraeger, bp, catalin.marinas, dalias, deller, gor, hca, hpa, James.Bottomley, linux-mm, linux, mingo, mm-commits, mpe, palmerdabbelt, paul.walmsley, paulus, tglx, torvalds, tsbogend, vgupta, viro, will, ysato From: Anshuman Khandual <anshuman.khandual@arm.com> Subject: mm: generalize ARCH_HAS_CACHE_LINE_SIZE Patch series "mm: some config cleanups", v2. This series contains config cleanup patches which reduces code duplication across platforms and also improves maintainability. There is no functional change intended with this series. This patch (of 6): ARCH_HAS_CACHE_LINE_SIZE config has duplicate definitions on platforms that subscribe it. Instead, just make it a generic option which can be selected on applicable platforms. This change reduces code duplication and makes it cleaner. Link: https://lkml.kernel.org/r/1617259448-22529-1-git-send-email-anshuman.khandual@arm.com Link: https://lkml.kernel.org/r/1617259448-22529-2-git-send-email-anshuman.khandual@arm.com Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com> Acked-by: Catalin Marinas <catalin.marinas@arm.com> [arm64] Acked-by: Vineet Gupta <vgupta@synopsys.com> [arc] Cc: Will Deacon <will@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Ingo Molnar <mingo@redhat.com> Cc: Borislav Petkov <bp@alien8.de> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Albert Ou <aou@eecs.berkeley.edu> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Arnd Bergmann <arnd@arndb.de> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Christian Borntraeger <borntraeger@de.ibm.com> Cc: Heiko Carstens <hca@linux.ibm.com> Cc: Helge Deller <deller@gmx.de> Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Palmer Dabbelt <palmerdabbelt@google.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Rich Felker <dalias@libc.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Vasily Gorbik <gor@linux.ibm.com> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arc/Kconfig | 4 +--- arch/arm64/Kconfig | 4 +--- arch/x86/Kconfig | 4 +--- mm/Kconfig | 3 +++ 4 files changed, 6 insertions(+), 9 deletions(-) --- a/arch/arc/Kconfig~mm-generalize-arch_has_cache_line_size +++ a/arch/arc/Kconfig @@ -6,6 +6,7 @@ config ARC def_bool y select ARC_TIMERS + select ARCH_HAS_CACHE_LINE_SIZE select ARCH_HAS_DEBUG_VM_PGTABLE select ARCH_HAS_DMA_PREP_COHERENT select ARCH_HAS_PTE_SPECIAL @@ -48,9 +49,6 @@ config ARC select HAVE_ARCH_JUMP_LABEL if ISA_ARCV2 && !CPU_ENDIAN_BE32 select SET_FS -config ARCH_HAS_CACHE_LINE_SIZE - def_bool y - config TRACE_IRQFLAGS_SUPPORT def_bool y --- a/arch/arm64/Kconfig~mm-generalize-arch_has_cache_line_size +++ a/arch/arm64/Kconfig @@ -11,6 +11,7 @@ config ARM64 select ACPI_PPTT if ACPI select ARCH_HAS_DEBUG_WX select ARCH_BINFMT_ELF_STATE + select ARCH_HAS_CACHE_LINE_SIZE select ARCH_HAS_DEBUG_VIRTUAL select ARCH_HAS_DEBUG_VM_PGTABLE select ARCH_HAS_DMA_PREP_COHERENT @@ -1074,9 +1075,6 @@ config HW_PERF_EVENTS config SYS_SUPPORTS_HUGETLBFS def_bool y -config ARCH_HAS_CACHE_LINE_SIZE - def_bool y - config ARCH_HAS_FILTER_PGPROT def_bool y --- a/arch/x86/Kconfig~mm-generalize-arch_has_cache_line_size +++ a/arch/x86/Kconfig @@ -61,6 +61,7 @@ config X86 select ARCH_32BIT_OFF_T if X86_32 select ARCH_CLOCKSOURCE_INIT select ARCH_HAS_ACPI_TABLE_UPGRADE if ACPI + select ARCH_HAS_CACHE_LINE_SIZE select ARCH_HAS_DEBUG_VIRTUAL select ARCH_HAS_DEBUG_VM_PGTABLE if !X86_PAE select ARCH_HAS_DEVMEM_IS_ALLOWED @@ -316,9 +317,6 @@ config GENERIC_CALIBRATE_DELAY config ARCH_HAS_CPU_RELAX def_bool y -config ARCH_HAS_CACHE_LINE_SIZE - def_bool y - config ARCH_HAS_FILTER_PGPROT def_bool y --- a/mm/Kconfig~mm-generalize-arch_has_cache_line_size +++ a/mm/Kconfig @@ -772,6 +772,9 @@ config IDLE_PAGE_TRACKING See Documentation/admin-guide/mm/idle_page_tracking.rst for more details. +config ARCH_HAS_CACHE_LINE_SIZE + bool + config ARCH_HAS_PTE_DEVMAP bool _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 104/143] mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] 2021-05-05 1:32 incoming Andrew Morton ` (101 preceding siblings ...) 2021-05-05 1:38 ` [patch 102/143] mm: generalize ARCH_HAS_CACHE_LINE_SIZE Andrew Morton @ 2021-05-05 1:38 ` Andrew Morton 2021-05-05 1:38 ` [patch 105/143] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION Andrew Morton ` (37 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw) To: akpm, anshuman.khandual, aou, arnd, benh, borntraeger, bp, catalin.marinas, dalias, deller, gor, hca, hpa, James.Bottomley, linux-mm, linux, mingo, mm-commits, mpe, palmerdabbelt, paul.walmsley, paulus, tglx, torvalds, tsbogend, vgupta, viro, will, ysato From: Anshuman Khandual <anshuman.khandual@arm.com> Subject: mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] configs have duplicate definitions on platforms that subscribe them. Instead, just make them generic options which can be selected on applicable platforms. Link: https://lkml.kernel.org/r/1617259448-22529-4-git-send-email-anshuman.khandual@arm.com Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com> Acked-by: Catalin Marinas <catalin.marinas@arm.com> [arm64] Acked-by: Heiko Carstens <hca@linux.ibm.com> [s390] Cc: Will Deacon <will@kernel.org> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Paul Mackerras <paulus@samba.org> Cc: Vasily Gorbik <gor@linux.ibm.com> Cc: Christian Borntraeger <borntraeger@de.ibm.com> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Cc: Rich Felker <dalias@libc.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Ingo Molnar <mingo@redhat.com> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Albert Ou <aou@eecs.berkeley.edu> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Arnd Bergmann <arnd@arndb.de> Cc: Borislav Petkov <bp@alien8.de> Cc: Helge Deller <deller@gmx.de> Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com> Cc: Palmer Dabbelt <palmerdabbelt@google.com> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Russell King <linux@armlinux.org.uk> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Vineet Gupta <vgupta@synopsys.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm64/Kconfig | 8 ++------ arch/ia64/Kconfig | 8 ++------ arch/powerpc/Kconfig | 8 ++------ arch/s390/Kconfig | 8 ++------ arch/sh/Kconfig | 2 ++ arch/sh/mm/Kconfig | 8 -------- arch/x86/Kconfig | 10 ++-------- mm/Kconfig | 6 ++++++ 8 files changed, 18 insertions(+), 40 deletions(-) --- a/arch/arm64/Kconfig~mm-generalize-arch_enable_memory_ +++ a/arch/arm64/Kconfig @@ -11,6 +11,8 @@ config ARM64 select ACPI_PPTT if ACPI select ARCH_HAS_DEBUG_WX select ARCH_BINFMT_ELF_STATE + select ARCH_ENABLE_MEMORY_HOTPLUG + select ARCH_ENABLE_MEMORY_HOTREMOVE select ARCH_HAS_CACHE_LINE_SIZE select ARCH_HAS_DEBUG_VIRTUAL select ARCH_HAS_DEBUG_VM_PGTABLE @@ -311,12 +313,6 @@ config ZONE_DMA32 bool "Support DMA32 zone" if EXPERT default y -config ARCH_ENABLE_MEMORY_HOTPLUG - def_bool y - -config ARCH_ENABLE_MEMORY_HOTREMOVE - def_bool y - config SMP def_bool y --- a/arch/ia64/Kconfig~mm-generalize-arch_enable_memory_ +++ a/arch/ia64/Kconfig @@ -13,6 +13,8 @@ config IA64 select ARCH_MIGHT_HAVE_PC_SERIO select ACPI select ACPI_NUMA if NUMA + select ARCH_ENABLE_MEMORY_HOTPLUG + select ARCH_ENABLE_MEMORY_HOTREMOVE select ARCH_SUPPORTS_ACPI select ACPI_SYSTEM_POWER_STATES_SUPPORT if ACPI select ARCH_MIGHT_HAVE_ACPI_PDC if ACPI @@ -246,12 +248,6 @@ config HOTPLUG_CPU can be controlled through /sys/devices/system/cpu/cpu#. Say N if you want to disable CPU hotplug. -config ARCH_ENABLE_MEMORY_HOTPLUG - def_bool y - -config ARCH_ENABLE_MEMORY_HOTREMOVE - def_bool y - config SCHED_SMT bool "SMT scheduler support" depends on SMP --- a/arch/powerpc/Kconfig~mm-generalize-arch_enable_memory_ +++ a/arch/powerpc/Kconfig @@ -118,6 +118,8 @@ config PPC # Please keep this list sorted alphabetically. # select ARCH_32BIT_OFF_T if PPC32 + select ARCH_ENABLE_MEMORY_HOTPLUG + select ARCH_ENABLE_MEMORY_HOTREMOVE select ARCH_HAS_DEBUG_VIRTUAL select ARCH_HAS_DEVMEM_IS_ALLOWED select ARCH_HAS_ELF_RANDOMIZE @@ -512,12 +514,6 @@ config ARCH_CPU_PROBE_RELEASE def_bool y depends on HOTPLUG_CPU -config ARCH_ENABLE_MEMORY_HOTPLUG - def_bool y - -config ARCH_ENABLE_MEMORY_HOTREMOVE - def_bool y - config PPC64_SUPPORTS_MEMORY_FAILURE bool "Add support for memory hwpoison" depends on PPC_BOOK3S_64 --- a/arch/s390/Kconfig~mm-generalize-arch_enable_memory_ +++ a/arch/s390/Kconfig @@ -60,6 +60,8 @@ config S390 imply IMA_SECURE_AND_OR_TRUSTED_BOOT select ARCH_32BIT_USTAT_F_TINODE select ARCH_BINFMT_ELF_STATE + select ARCH_ENABLE_MEMORY_HOTPLUG if SPARSEMEM + select ARCH_ENABLE_MEMORY_HOTREMOVE select ARCH_HAS_DEBUG_VM_PGTABLE select ARCH_HAS_DEBUG_WX select ARCH_HAS_DEVMEM_IS_ALLOWED @@ -626,12 +628,6 @@ config ARCH_SPARSEMEM_ENABLE config ARCH_SPARSEMEM_DEFAULT def_bool y -config ARCH_ENABLE_MEMORY_HOTPLUG - def_bool y if SPARSEMEM - -config ARCH_ENABLE_MEMORY_HOTREMOVE - def_bool y - config ARCH_ENABLE_SPLIT_PMD_PTLOCK def_bool y --- a/arch/sh/Kconfig~mm-generalize-arch_enable_memory_ +++ a/arch/sh/Kconfig @@ -2,6 +2,8 @@ config SUPERH def_bool y select ARCH_32BIT_OFF_T + select ARCH_ENABLE_MEMORY_HOTPLUG if SPARSEMEM && MMU + select ARCH_ENABLE_MEMORY_HOTREMOVE if SPARSEMEM && MMU select ARCH_HAVE_CUSTOM_GPIO_H select ARCH_HAVE_NMI_SAFE_CMPXCHG if (GUSA_RB || CPU_SH4A) select ARCH_HAS_BINFMT_FLAT if !MMU --- a/arch/sh/mm/Kconfig~mm-generalize-arch_enable_memory_ +++ a/arch/sh/mm/Kconfig @@ -136,14 +136,6 @@ config ARCH_SPARSEMEM_DEFAULT config ARCH_SELECT_MEMORY_MODEL def_bool y -config ARCH_ENABLE_MEMORY_HOTPLUG - def_bool y - depends on SPARSEMEM && MMU - -config ARCH_ENABLE_MEMORY_HOTREMOVE - def_bool y - depends on SPARSEMEM && MMU - config ARCH_MEMORY_PROBE def_bool y depends on MEMORY_HOTPLUG --- a/arch/x86/Kconfig~mm-generalize-arch_enable_memory_ +++ a/arch/x86/Kconfig @@ -60,6 +60,8 @@ config X86 select ACPI_SYSTEM_POWER_STATES_SUPPORT if ACPI select ARCH_32BIT_OFF_T if X86_32 select ARCH_CLOCKSOURCE_INIT + select ARCH_ENABLE_MEMORY_HOTPLUG if X86_64 || (X86_32 && HIGHMEM) + select ARCH_ENABLE_MEMORY_HOTREMOVE if MEMORY_HOTPLUG select ARCH_HAS_ACPI_TABLE_UPGRADE if ACPI select ARCH_HAS_CACHE_LINE_SIZE select ARCH_HAS_DEBUG_VIRTUAL @@ -2427,14 +2429,6 @@ config ARCH_HAS_ADD_PAGES def_bool y depends on X86_64 && ARCH_ENABLE_MEMORY_HOTPLUG -config ARCH_ENABLE_MEMORY_HOTPLUG - def_bool y - depends on X86_64 || (X86_32 && HIGHMEM) - -config ARCH_ENABLE_MEMORY_HOTREMOVE - def_bool y - depends on MEMORY_HOTPLUG - config USE_PERCPU_NUMA_NODE_ID def_bool y depends on NUMA --- a/mm/Kconfig~mm-generalize-arch_enable_memory_ +++ a/mm/Kconfig @@ -148,6 +148,9 @@ config MEMORY_ISOLATION config HAVE_BOOTMEM_INFO_NODE def_bool n +config ARCH_ENABLE_MEMORY_HOTPLUG + bool + # eventually, we can have this option just 'select SPARSEMEM' config MEMORY_HOTPLUG bool "Allow for memory hot-add" @@ -176,6 +179,9 @@ config MEMORY_HOTPLUG_DEFAULT_ONLINE Say N here if you want the default policy to keep all hot-plugged memory blocks in 'offline' state. +config ARCH_ENABLE_MEMORY_HOTREMOVE + bool + config MEMORY_HOTREMOVE bool "Allow for memory hot remove" select HAVE_BOOTMEM_INFO_NODE if (X86_64 || PPC64) _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 105/143] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION 2021-05-05 1:32 incoming Andrew Morton ` (102 preceding siblings ...) 2021-05-05 1:38 ` [patch 104/143] mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] Andrew Morton @ 2021-05-05 1:38 ` Andrew Morton 2021-05-05 1:38 ` [patch 108/143] mm/util.c: reduce mem_dump_obj() object size Andrew Morton ` (36 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw) To: akpm, anshuman.khandual, aou, arnd, benh, borntraeger, bp, catalin.marinas, dalias, deller, gor, hca, hpa, James.Bottomley, linux-mm, linux, mingo, mm-commits, mpe, palmerdabbelt, paul.walmsley, paulus, tglx, torvalds, tsbogend, vgupta, viro, will, ysato From: Anshuman Khandual <anshuman.khandual@arm.com> Subject: mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION configs have duplicate definitions on platforms that subscribe them. Drop these reduntant definitions and instead just select them appropriately. [akpm@linux-foundation.org: s/x86_64/X86_64/, per Oscar] Link: https://lkml.kernel.org/r/1617259448-22529-5-git-send-email-anshuman.khandual@arm.com Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com> Acked-by: Catalin Marinas <catalin.marinas@arm.com> [arm64] Cc: Will Deacon <will@kernel.org> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Paul Mackerras <paulus@samba.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Ingo Molnar <mingo@redhat.com> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Albert Ou <aou@eecs.berkeley.edu> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Arnd Bergmann <arnd@arndb.de> Cc: Borislav Petkov <bp@alien8.de> Cc: Christian Borntraeger <borntraeger@de.ibm.com> Cc: Heiko Carstens <hca@linux.ibm.com> Cc: Helge Deller <deller@gmx.de> Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com> Cc: Palmer Dabbelt <palmerdabbelt@google.com> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Rich Felker <dalias@libc.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Vasily Gorbik <gor@linux.ibm.com> Cc: Vineet Gupta <vgupta@synopsys.com> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm64/Kconfig | 10 ++-------- arch/powerpc/platforms/Kconfig.cputype | 5 +---- arch/x86/Kconfig | 10 ++-------- 3 files changed, 5 insertions(+), 20 deletions(-) --- a/arch/arm64/Kconfig~mm-drop-redundant-arch_enable__migration +++ a/arch/arm64/Kconfig @@ -11,8 +11,10 @@ config ARM64 select ACPI_PPTT if ACPI select ARCH_HAS_DEBUG_WX select ARCH_BINFMT_ELF_STATE + select ARCH_ENABLE_HUGEPAGE_MIGRATION if HUGETLB_PAGE && MIGRATION select ARCH_ENABLE_MEMORY_HOTPLUG select ARCH_ENABLE_MEMORY_HOTREMOVE + select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE select ARCH_HAS_CACHE_LINE_SIZE select ARCH_HAS_DEBUG_VIRTUAL select ARCH_HAS_DEBUG_VM_PGTABLE @@ -1916,14 +1918,6 @@ config SYSVIPC_COMPAT def_bool y depends on COMPAT && SYSVIPC -config ARCH_ENABLE_HUGEPAGE_MIGRATION - def_bool y - depends on HUGETLB_PAGE && MIGRATION - -config ARCH_ENABLE_THP_MIGRATION - def_bool y - depends on TRANSPARENT_HUGEPAGE - menu "Power management options" source "kernel/power/Kconfig" --- a/arch/powerpc/platforms/Kconfig.cputype~mm-drop-redundant-arch_enable__migration +++ a/arch/powerpc/platforms/Kconfig.cputype @@ -96,6 +96,7 @@ config PPC_BOOK3S_64 select PPC_FPU select PPC_HAVE_PMU_SUPPORT select HAVE_ARCH_TRANSPARENT_HUGEPAGE + select ARCH_ENABLE_HUGEPAGE_MIGRATION if HUGETLB_PAGE && MIGRATION select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE select ARCH_SUPPORTS_HUGETLBFS select ARCH_SUPPORTS_NUMA_BALANCING @@ -420,10 +421,6 @@ config PPC_PKEY depends on PPC_BOOK3S_64 depends on PPC_MEM_KEYS || PPC_KUAP || PPC_KUEP -config ARCH_ENABLE_HUGEPAGE_MIGRATION - def_bool y - depends on PPC_BOOK3S_64 && HUGETLB_PAGE && MIGRATION - config PPC_MMU_NOHASH def_bool y --- a/arch/x86/Kconfig~mm-drop-redundant-arch_enable__migration +++ a/arch/x86/Kconfig @@ -60,8 +60,10 @@ config X86 select ACPI_SYSTEM_POWER_STATES_SUPPORT if ACPI select ARCH_32BIT_OFF_T if X86_32 select ARCH_CLOCKSOURCE_INIT + select ARCH_ENABLE_HUGEPAGE_MIGRATION if X86_64 && HUGETLB_PAGE && MIGRATION select ARCH_ENABLE_MEMORY_HOTPLUG if X86_64 || (X86_32 && HIGHMEM) select ARCH_ENABLE_MEMORY_HOTREMOVE if MEMORY_HOTPLUG + select ARCH_ENABLE_THP_MIGRATION if X86_64 && TRANSPARENT_HUGEPAGE select ARCH_HAS_ACPI_TABLE_UPGRADE if ACPI select ARCH_HAS_CACHE_LINE_SIZE select ARCH_HAS_DEBUG_VIRTUAL @@ -2437,14 +2439,6 @@ config ARCH_ENABLE_SPLIT_PMD_PTLOCK def_bool y depends on X86_64 || X86_PAE -config ARCH_ENABLE_HUGEPAGE_MIGRATION - def_bool y - depends on X86_64 && HUGETLB_PAGE && MIGRATION - -config ARCH_ENABLE_THP_MIGRATION - def_bool y - depends on X86_64 && TRANSPARENT_HUGEPAGE - menu "Power management and ACPI options" config ARCH_HIBERNATION_HEADER _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 108/143] mm/util.c: reduce mem_dump_obj() object size 2021-05-05 1:32 incoming Andrew Morton ` (103 preceding siblings ...) 2021-05-05 1:38 ` [patch 105/143] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION Andrew Morton @ 2021-05-05 1:38 ` Andrew Morton 2021-05-05 1:38 ` [patch 109/143] mm/util.c: fix typo Andrew Morton ` (35 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw) To: akpm, joe, linux-mm, mm-commits, torvalds From: Joe Perches <joe@perches.com> Subject: mm/util.c: reduce mem_dump_obj() object size Simplify the code by using a temporary and reduce the object size by using a single call to pr_cont(). Reverse a test and unindent a block too. $ size mm/util.o* (defconfig x86-64) text data bss dec hex filename 7419 372 40 7831 1e97 mm/util.o.new 7477 372 40 7889 1ed1 mm/util.o.old Link: https://lkml.kernel.org/r/a6e105886338f68afd35f7a13d73bcf06b0cc732.camel@perches.com Signed-off-by: Joe Perches <joe@perches.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/util.c | 24 ++++++++++++++---------- 1 file changed, 14 insertions(+), 10 deletions(-) --- a/mm/util.c~mm-reduce-mem_dump_obj-object-size +++ a/mm/util.c @@ -987,22 +987,26 @@ int __weak memcmp_pages(struct page *pag */ void mem_dump_obj(void *object) { + const char *type; + if (kmem_valid_obj(object)) { kmem_dump_obj(object); return; } + if (vmalloc_dump_obj(object)) return; - if (!virt_addr_valid(object)) { - if (object == NULL) - pr_cont(" NULL pointer.\n"); - else if (object == ZERO_SIZE_PTR) - pr_cont(" zero-size pointer.\n"); - else - pr_cont(" non-paged memory.\n"); - return; - } - pr_cont(" non-slab/vmalloc memory.\n"); + + if (virt_addr_valid(object)) + type = "non-slab/vmalloc memory"; + else if (object == NULL) + type = "NULL pointer"; + else if (object == ZERO_SIZE_PTR) + type = "zero-size pointer"; + else + type = "non-paged memory"; + + pr_cont(" %s\n", type); } EXPORT_SYMBOL_GPL(mem_dump_obj); #endif _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 109/143] mm/util.c: fix typo 2021-05-05 1:32 incoming Andrew Morton ` (104 preceding siblings ...) 2021-05-05 1:38 ` [patch 108/143] mm/util.c: reduce mem_dump_obj() object size Andrew Morton @ 2021-05-05 1:38 ` Andrew Morton 2021-05-05 1:38 ` [patch 110/143] mm/gup: don't pin migrated cma pages in movable zone Andrew Morton ` (34 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, rdunlap, torvalds, unixbhaskar, willy From: Bhaskar Chowdhury <unixbhaskar@gmail.com> Subject: mm/util.c: fix typo s/condtion/condition/ Link: https://lkml.kernel.org/r/20210317033439.3429411-1-unixbhaskar@gmail.com Signed-off-by: Bhaskar Chowdhury <unixbhaskar@gmail.com> Acked-by: Randy Dunlap <rdunlap@infradead.org> Cc: Matthew Wilcox <willy@infradead.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/util.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/util.c~mm-typo-fix-in-the-file-utilc +++ a/mm/util.c @@ -765,7 +765,7 @@ int overcommit_policy_handler(struct ctl * The deviation of sync_overcommit_as could be big with loose policy * like OVERCOMMIT_ALWAYS/OVERCOMMIT_GUESS. When changing policy to * strict OVERCOMMIT_NEVER, we need to reduce the deviation to comply - * with the strict "NEVER", and to avoid possible race condtion (even + * with the strict "NEVER", and to avoid possible race condition (even * though user usually won't too frequently do the switching to policy * OVERCOMMIT_NEVER), the switch is done in the following order: * 1. changing the batch _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 110/143] mm/gup: don't pin migrated cma pages in movable zone 2021-05-05 1:32 incoming Andrew Morton ` (105 preceding siblings ...) 2021-05-05 1:38 ` [patch 109/143] mm/util.c: fix typo Andrew Morton @ 2021-05-05 1:38 ` Andrew Morton 2021-05-05 1:38 ` [patch 111/143] mm/gup: check every subpage of a compound page during isolation Andrew Morton ` (33 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw) To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg, jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko, mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin, peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka, willy From: Pavel Tatashin <pasha.tatashin@soleen.com> Subject: mm/gup: don't pin migrated cma pages in movable zone Patch series "prohibit pinning pages in ZONE_MOVABLE", v11. When page is pinned it cannot be moved and its physical address stays the same until pages is unpinned. This is useful functionality to allows userland to implementation DMA access. For example, it is used by vfio in vfio_pin_pages(). However, this functionality breaks memory hotplug/hotremove assumptions that pages in ZONE_MOVABLE can always be migrated. This patch series fixes this issue by forcing new allocations during page pinning to omit ZONE_MOVABLE, and also to migrate any existing pages from ZONE_MOVABLE during pinning. It uses the same scheme logic that is currently used by CMA, and extends the functionality for all allocations. For more information read the discussion [1] about this problem. [1] https://lore.kernel.org/lkml/CA+CK2bBffHBxjmb9jmSKacm0fJMinyt3Nhk8Nx6iudcQSj80_w@mail.gmail.com This patch (of 14): In order not to fragment CMA the pinned pages are migrated. However, they are migrated to ZONE_MOVABLE, which also should not have pinned pages. Remove __GFP_MOVABLE, so pages can be migrated to zones where pinning is allowed. Link: https://lkml.kernel.org/r/20210215161349.246722-1-pasha.tatashin@soleen.com Link: https://lkml.kernel.org/r/20210215161349.246722-2-pasha.tatashin@soleen.com Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com> Reviewed-by: David Hildenbrand <david@redhat.com> Reviewed-by: John Hubbard <jhubbard@nvidia.com> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Michal Hocko <mhocko@suse.com> Cc: David Hildenbrand <david@redhat.com> Cc: Oscar Salvador <osalvador@suse.de> Cc: Dan Williams <dan.j.williams@intel.com> Cc: Sasha Levin <sashal@kernel.org> Cc: Tyler Hicks <tyhicks@linux.microsoft.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Steven Rostedt (VMware) <rostedt@goodmis.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Mel Gorman <mgorman@suse.de> Cc: Matthew Wilcox <willy@infradead.org> Cc: David Rientjes <rientjes@google.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: James Morris <jmorris@namei.org> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: Michal Hocko <mhocko@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/gup.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/gup.c~mm-gup-dont-pin-migrated-cma-pages-in-movable-zone +++ a/mm/gup.c @@ -1616,7 +1616,7 @@ static long check_and_migrate_cma_pages( long ret = nr_pages; struct migration_target_control mtc = { .nid = NUMA_NO_NODE, - .gfp_mask = GFP_USER | __GFP_MOVABLE | __GFP_NOWARN, + .gfp_mask = GFP_USER | __GFP_NOWARN, }; check_again: _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 111/143] mm/gup: check every subpage of a compound page during isolation 2021-05-05 1:32 incoming Andrew Morton ` (106 preceding siblings ...) 2021-05-05 1:38 ` [patch 110/143] mm/gup: don't pin migrated cma pages in movable zone Andrew Morton @ 2021-05-05 1:38 ` Andrew Morton 2021-05-05 1:38 ` [patch 112/143] mm/gup: return an error on migration failure Andrew Morton ` (32 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw) To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg, jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko, mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin, peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka, willy From: Pavel Tatashin <pasha.tatashin@soleen.com> Subject: mm/gup: check every subpage of a compound page during isolation When pages are isolated in check_and_migrate_movable_pages() we skip compound number of pages at a time. However, as Jason noted, it is not necessary correct that pages[i] corresponds to the pages that we skipped. This is because it is possible that the addresses in this range had split_huge_pmd()/split_huge_pud(), and these functions do not update the compound page metadata. The problem can be reproduced if something like this occurs: 1. User faulted huge pages. 2. split_huge_pmd() was called for some reason 3. User has unmapped some sub-pages in the range 4. User tries to longterm pin the addresses. The resulting pages[i] might end-up having pages which are not compound size page aligned. Link: https://lkml.kernel.org/r/20210215161349.246722-3-pasha.tatashin@soleen.com Fixes: aa712399c1e8 ("mm/gup: speed up check_and_migrate_cma_pages() on huge page") Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com> Reported-by: Jason Gunthorpe <jgg@nvidia.com> Reviewed-by: Jason Gunthorpe <jgg@nvidia.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: James Morris <jmorris@namei.org> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mel Gorman <mgorman@suse.de> Cc: Michal Hocko <mhocko@kernel.org> Cc: Michal Hocko <mhocko@suse.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Oscar Salvador <osalvador@suse.de> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Sasha Levin <sashal@kernel.org> Cc: Steven Rostedt (VMware) <rostedt@goodmis.org> Cc: Tyler Hicks <tyhicks@linux.microsoft.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/gup.c | 19 +++++++------------ 1 file changed, 7 insertions(+), 12 deletions(-) --- a/mm/gup.c~mm-gup-check-every-subpage-of-a-compound-page-during-isolation +++ a/mm/gup.c @@ -1609,26 +1609,23 @@ static long check_and_migrate_cma_pages( unsigned int gup_flags) { unsigned long i; - unsigned long step; bool drain_allow = true; bool migrate_allow = true; LIST_HEAD(cma_page_list); long ret = nr_pages; + struct page *prev_head, *head; struct migration_target_control mtc = { .nid = NUMA_NO_NODE, .gfp_mask = GFP_USER | __GFP_NOWARN, }; check_again: - for (i = 0; i < nr_pages;) { - - struct page *head = compound_head(pages[i]); - - /* - * gup may start from a tail page. Advance step by the left - * part. - */ - step = compound_nr(head) - (pages[i] - head); + prev_head = NULL; + for (i = 0; i < nr_pages; i++) { + head = compound_head(pages[i]); + if (head == prev_head) + continue; + prev_head = head; /* * If we get a page from the CMA zone, since we are going to * be pinning these entries, we might as well move them out @@ -1652,8 +1649,6 @@ check_again: } } } - - i += step; } if (!list_empty(&cma_page_list)) { _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 112/143] mm/gup: return an error on migration failure 2021-05-05 1:32 incoming Andrew Morton ` (107 preceding siblings ...) 2021-05-05 1:38 ` [patch 111/143] mm/gup: check every subpage of a compound page during isolation Andrew Morton @ 2021-05-05 1:38 ` Andrew Morton 2021-05-05 1:38 ` [patch 113/143] mm/gup: check for isolation errors Andrew Morton ` (31 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw) To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg, jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko, mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin, peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka, willy From: Pavel Tatashin <pasha.tatashin@soleen.com> Subject: mm/gup: return an error on migration failure When migration failure occurs, we still pin pages, which means that we may pin CMA movable pages which should never be the case. Instead return an error without pinning pages when migration failure happens. No need to retry migrating, because migrate_pages() already retries 10 times. Link: https://lkml.kernel.org/r/20210215161349.246722-4-pasha.tatashin@soleen.com Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com> Reviewed-by: Jason Gunthorpe <jgg@nvidia.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: James Morris <jmorris@namei.org> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mel Gorman <mgorman@suse.de> Cc: Michal Hocko <mhocko@kernel.org> Cc: Michal Hocko <mhocko@suse.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Oscar Salvador <osalvador@suse.de> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Sasha Levin <sashal@kernel.org> Cc: Steven Rostedt (VMware) <rostedt@goodmis.org> Cc: Tyler Hicks <tyhicks@linux.microsoft.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/gup.c | 17 +++++++---------- 1 file changed, 7 insertions(+), 10 deletions(-) --- a/mm/gup.c~mm-gup-return-an-error-on-migration-failure +++ a/mm/gup.c @@ -1610,7 +1610,6 @@ static long check_and_migrate_cma_pages( { unsigned long i; bool drain_allow = true; - bool migrate_allow = true; LIST_HEAD(cma_page_list); long ret = nr_pages; struct page *prev_head, *head; @@ -1661,17 +1660,15 @@ check_again: for (i = 0; i < nr_pages; i++) put_page(pages[i]); - if (migrate_pages(&cma_page_list, alloc_migration_target, NULL, - (unsigned long)&mtc, MIGRATE_SYNC, MR_CONTIG_RANGE)) { - /* - * some of the pages failed migration. Do get_user_pages - * without migration. - */ - migrate_allow = false; - + ret = migrate_pages(&cma_page_list, alloc_migration_target, + NULL, (unsigned long)&mtc, MIGRATE_SYNC, + MR_CONTIG_RANGE); + if (ret) { if (!list_empty(&cma_page_list)) putback_movable_pages(&cma_page_list); + return ret > 0 ? -ENOMEM : ret; } + /* * We did migrate all the pages, Try to get the page references * again migrating any new CMA pages which we failed to isolate @@ -1681,7 +1678,7 @@ check_again: pages, vmas, NULL, gup_flags); - if ((ret > 0) && migrate_allow) { + if (ret > 0) { nr_pages = ret; drain_allow = true; goto check_again; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 113/143] mm/gup: check for isolation errors 2021-05-05 1:32 incoming Andrew Morton ` (108 preceding siblings ...) 2021-05-05 1:38 ` [patch 112/143] mm/gup: return an error on migration failure Andrew Morton @ 2021-05-05 1:38 ` Andrew Morton 2021-05-05 1:38 ` [patch 114/143] mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN Andrew Morton ` (30 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw) To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg, jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko, mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin, peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka, willy From: Pavel Tatashin <pasha.tatashin@soleen.com> Subject: mm/gup: check for isolation errors It is still possible that we pin movable CMA pages if there are isolation errors and cma_page_list stays empty when we check again. Check for isolation errors, and return success only when there are no isolation errors, and cma_page_list is empty after checking. Because isolation errors are transient, we retry indefinitely. Link: https://lkml.kernel.org/r/20210215161349.246722-5-pasha.tatashin@soleen.com Fixes: 9a4e9f3b2d73 ("mm: update get_user_pages_longterm to migrate pages allocated from CMA region") Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com> Reviewed-by: Jason Gunthorpe <jgg@nvidia.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: James Morris <jmorris@namei.org> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mel Gorman <mgorman@suse.de> Cc: Michal Hocko <mhocko@kernel.org> Cc: Michal Hocko <mhocko@suse.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Oscar Salvador <osalvador@suse.de> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Sasha Levin <sashal@kernel.org> Cc: Steven Rostedt (VMware) <rostedt@goodmis.org> Cc: Tyler Hicks <tyhicks@linux.microsoft.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/gup.c | 60 ++++++++++++++++++++++++++++++----------------------- 1 file changed, 34 insertions(+), 26 deletions(-) --- a/mm/gup.c~mm-gup-check-for-isolation-errors +++ a/mm/gup.c @@ -1608,8 +1608,8 @@ static long check_and_migrate_cma_pages( struct vm_area_struct **vmas, unsigned int gup_flags) { - unsigned long i; - bool drain_allow = true; + unsigned long i, isolation_error_count; + bool drain_allow; LIST_HEAD(cma_page_list); long ret = nr_pages; struct page *prev_head, *head; @@ -1620,6 +1620,8 @@ static long check_and_migrate_cma_pages( check_again: prev_head = NULL; + isolation_error_count = 0; + drain_allow = true; for (i = 0; i < nr_pages; i++) { head = compound_head(pages[i]); if (head == prev_head) @@ -1631,25 +1633,35 @@ check_again: * of the CMA zone if possible. */ if (is_migrate_cma_page(head)) { - if (PageHuge(head)) - isolate_huge_page(head, &cma_page_list); - else { + if (PageHuge(head)) { + if (!isolate_huge_page(head, &cma_page_list)) + isolation_error_count++; + } else { if (!PageLRU(head) && drain_allow) { lru_add_drain_all(); drain_allow = false; } - if (!isolate_lru_page(head)) { - list_add_tail(&head->lru, &cma_page_list); - mod_node_page_state(page_pgdat(head), - NR_ISOLATED_ANON + - page_is_file_lru(head), - thp_nr_pages(head)); + if (isolate_lru_page(head)) { + isolation_error_count++; + continue; } + list_add_tail(&head->lru, &cma_page_list); + mod_node_page_state(page_pgdat(head), + NR_ISOLATED_ANON + + page_is_file_lru(head), + thp_nr_pages(head)); } } } + /* + * If list is empty, and no isolation errors, means that all pages are + * in the correct zone. + */ + if (list_empty(&cma_page_list) && !isolation_error_count) + return ret; + if (!list_empty(&cma_page_list)) { /* * drop the above get_user_pages reference. @@ -1669,23 +1681,19 @@ check_again: return ret > 0 ? -ENOMEM : ret; } - /* - * We did migrate all the pages, Try to get the page references - * again migrating any new CMA pages which we failed to isolate - * earlier. - */ - ret = __get_user_pages_locked(mm, start, nr_pages, - pages, vmas, NULL, - gup_flags); - - if (ret > 0) { - nr_pages = ret; - drain_allow = true; - goto check_again; - } + /* We unpinned pages before migration, pin them again */ + ret = __get_user_pages_locked(mm, start, nr_pages, pages, vmas, + NULL, gup_flags); + if (ret <= 0) + return ret; + nr_pages = ret; } - return ret; + /* + * check again because pages were unpinned, and we also might have + * had isolation errors and need more pages to migrate. + */ + goto check_again; } #else static long check_and_migrate_cma_pages(struct mm_struct *mm, _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 114/143] mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN 2021-05-05 1:32 incoming Andrew Morton ` (109 preceding siblings ...) 2021-05-05 1:38 ` [patch 113/143] mm/gup: check for isolation errors Andrew Morton @ 2021-05-05 1:38 ` Andrew Morton 2021-05-05 1:38 ` [patch 115/143] mm: apply per-task gfp constraints in fast path Andrew Morton ` (29 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw) To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg, jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko, mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin, peterz, rientjes, rostedt, rppt, sashal, torvalds, tyhicks, vbabka, willy From: Pavel Tatashin <pasha.tatashin@soleen.com> Subject: mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN PF_MEMALLOC_NOCMA is used ot guarantee that the allocator will not return pages that might belong to CMA region. This is currently used for long term gup to make sure that such pins are not going to be done on any CMA pages. When PF_MEMALLOC_NOCMA has been introduced we haven't realized that it is focusing on CMA pages too much and that there is larger class of pages that need the same treatment. MOVABLE zone cannot contain any long term pins as well so it makes sense to reuse and redefine this flag for that usecase as well. Rename the flag to PF_MEMALLOC_PIN which defines an allocation context which can only get pages suitable for long-term pins. Also rename: memalloc_nocma_save()/memalloc_nocma_restore to memalloc_pin_save()/memalloc_pin_restore() and make the new functions common. [rppt@linux.ibm.com: fix renaming of PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN] Link: https://lkml.kernel.org/r/20210331163816.11517-1-rppt@kernel.org Link: https://lkml.kernel.org/r/20210215161349.246722-6-pasha.tatashin@soleen.com Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com> Reviewed-by: John Hubbard <jhubbard@nvidia.com> Acked-by: Michal Hocko <mhocko@suse.com> Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: James Morris <jmorris@namei.org> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mel Gorman <mgorman@suse.de> Cc: Michal Hocko <mhocko@kernel.org> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Oscar Salvador <osalvador@suse.de> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Sasha Levin <sashal@kernel.org> Cc: Steven Rostedt (VMware) <rostedt@goodmis.org> Cc: Tyler Hicks <tyhicks@linux.microsoft.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/sched.h | 2 +- include/linux/sched/mm.h | 21 +++++---------------- mm/gup.c | 4 ++-- mm/hugetlb.c | 4 ++-- mm/page_alloc.c | 4 ++-- 5 files changed, 12 insertions(+), 23 deletions(-) --- a/include/linux/sched.h~mm-cma-rename-pf_memalloc_nocma-to-pf_memalloc_pin +++ a/include/linux/sched.h @@ -1583,7 +1583,7 @@ extern struct pid *cad_pid; #define PF_SWAPWRITE 0x00800000 /* Allowed to write to swap */ #define PF_NO_SETAFFINITY 0x04000000 /* Userland is not allowed to meddle with cpus_mask */ #define PF_MCE_EARLY 0x08000000 /* Early kill for mce process policy */ -#define PF_MEMALLOC_NOCMA 0x10000000 /* All allocation request will have _GFP_MOVABLE cleared */ +#define PF_MEMALLOC_PIN 0x10000000 /* Allocation context constrained to zones which allow long term pinning. */ #define PF_FREEZER_SKIP 0x40000000 /* Freezer should not count it as freezable */ #define PF_SUSPEND_TASK 0x80000000 /* This thread called freeze_processes() and should not be frozen */ --- a/include/linux/sched/mm.h~mm-cma-rename-pf_memalloc_nocma-to-pf_memalloc_pin +++ a/include/linux/sched/mm.h @@ -271,29 +271,18 @@ static inline void memalloc_noreclaim_re current->flags = (current->flags & ~PF_MEMALLOC) | flags; } -#ifdef CONFIG_CMA -static inline unsigned int memalloc_nocma_save(void) +static inline unsigned int memalloc_pin_save(void) { - unsigned int flags = current->flags & PF_MEMALLOC_NOCMA; + unsigned int flags = current->flags & PF_MEMALLOC_PIN; - current->flags |= PF_MEMALLOC_NOCMA; + current->flags |= PF_MEMALLOC_PIN; return flags; } -static inline void memalloc_nocma_restore(unsigned int flags) +static inline void memalloc_pin_restore(unsigned int flags) { - current->flags = (current->flags & ~PF_MEMALLOC_NOCMA) | flags; + current->flags = (current->flags & ~PF_MEMALLOC_PIN) | flags; } -#else -static inline unsigned int memalloc_nocma_save(void) -{ - return 0; -} - -static inline void memalloc_nocma_restore(unsigned int flags) -{ -} -#endif #ifdef CONFIG_MEMCG DECLARE_PER_CPU(struct mem_cgroup *, int_active_memcg); --- a/mm/gup.c~mm-cma-rename-pf_memalloc_nocma-to-pf_memalloc_pin +++ a/mm/gup.c @@ -1722,7 +1722,7 @@ static long __gup_longterm_locked(struct long rc; if (gup_flags & FOLL_LONGTERM) - flags = memalloc_nocma_save(); + flags = memalloc_pin_save(); rc = __get_user_pages_locked(mm, start, nr_pages, pages, vmas, NULL, gup_flags); @@ -1731,7 +1731,7 @@ static long __gup_longterm_locked(struct if (rc > 0) rc = check_and_migrate_cma_pages(mm, start, rc, pages, vmas, gup_flags); - memalloc_nocma_restore(flags); + memalloc_pin_restore(flags); } return rc; } --- a/mm/hugetlb.c~mm-cma-rename-pf_memalloc_nocma-to-pf_memalloc_pin +++ a/mm/hugetlb.c @@ -1079,11 +1079,11 @@ static void enqueue_huge_page(struct hst static struct page *dequeue_huge_page_node_exact(struct hstate *h, int nid) { struct page *page; - bool nocma = !!(current->flags & PF_MEMALLOC_NOCMA); + bool pin = !!(current->flags & PF_MEMALLOC_PIN); lockdep_assert_held(&hugetlb_lock); list_for_each_entry(page, &h->hugepage_freelists[nid], lru) { - if (nocma && is_migrate_cma_page(page)) + if (pin && is_migrate_cma_page(page)) continue; if (PageHWPoison(page)) --- a/mm/page_alloc.c~mm-cma-rename-pf_memalloc_nocma-to-pf_memalloc_pin +++ a/mm/page_alloc.c @@ -3865,8 +3865,8 @@ static inline unsigned int current_alloc #ifdef CONFIG_CMA unsigned int pflags = current->flags; - if (!(pflags & PF_MEMALLOC_NOCMA) && - gfp_migratetype(gfp_mask) == MIGRATE_MOVABLE) + if (!(pflags & PF_MEMALLOC_PIN) && + gfp_migratetype(gfp_mask) == MIGRATE_MOVABLE) alloc_flags |= ALLOC_CMA; #endif _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 115/143] mm: apply per-task gfp constraints in fast path 2021-05-05 1:32 incoming Andrew Morton ` (110 preceding siblings ...) 2021-05-05 1:38 ` [patch 114/143] mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN Andrew Morton @ 2021-05-05 1:38 ` Andrew Morton 2021-05-05 1:39 ` [patch 116/143] mm: honor PF_MEMALLOC_PIN for all movable pages Andrew Morton ` (28 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw) To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg, jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko, mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin, peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka, willy From: Pavel Tatashin <pasha.tatashin@soleen.com> Subject: mm: apply per-task gfp constraints in fast path Function current_gfp_context() is called after fast path. However, soon we will add more constraints which will also limit zones based on context. Move this call into fast path, and apply the correct constraints for all allocations. Also update .reclaim_idx based on value returned by current_gfp_context() because it soon will modify the allowed zones. Note: With this patch we will do one extra current->flags load during fast path, but we already load current->flags in fast-path: __alloc_pages() prepare_alloc_pages() current_alloc_flags(gfp_mask, *alloc_flags); Later, when we add the zone constrain logic to current_gfp_context() we will be able to remove current->flags load from current_alloc_flags, and therefore return fast-path to the current performance level. Link: https://lkml.kernel.org/r/20210215161349.246722-7-pasha.tatashin@soleen.com Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com> Suggested-by: Michal Hocko <mhocko@kernel.org> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: James Morris <jmorris@namei.org> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mel Gorman <mgorman@suse.de> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Oscar Salvador <osalvador@suse.de> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Sasha Levin <sashal@kernel.org> Cc: Steven Rostedt (VMware) <rostedt@goodmis.org> Cc: Tyler Hicks <tyhicks@linux.microsoft.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 15 ++++++++------- 1 file changed, 8 insertions(+), 7 deletions(-) --- a/mm/page_alloc.c~mm-apply-per-task-gfp-constraints-in-fast-path +++ a/mm/page_alloc.c @@ -5180,6 +5180,13 @@ struct page *__alloc_pages(gfp_t gfp, un } gfp &= gfp_allowed_mask; + /* + * Apply scoped allocation constraints. This is mainly about GFP_NOFS + * resp. GFP_NOIO which has to be inherited for all allocation requests + * from a particular context which has been marked by + * memalloc_no{fs,io}_{save,restore}. + */ + gfp = current_gfp_context(gfp); alloc_gfp = gfp; if (!prepare_alloc_pages(gfp, order, preferred_nid, nodemask, &ac, &alloc_gfp, &alloc_flags)) @@ -5196,13 +5203,7 @@ struct page *__alloc_pages(gfp_t gfp, un if (likely(page)) goto out; - /* - * Apply scoped allocation constraints. This is mainly about GFP_NOFS - * resp. GFP_NOIO which has to be inherited for all allocation requests - * from a particular context which has been marked by - * memalloc_no{fs,io}_{save,restore}. - */ - alloc_gfp = current_gfp_context(gfp); + alloc_gfp = gfp; ac.spread_dirty_pages = false; /* _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 116/143] mm: honor PF_MEMALLOC_PIN for all movable pages 2021-05-05 1:32 incoming Andrew Morton ` (111 preceding siblings ...) 2021-05-05 1:38 ` [patch 115/143] mm: apply per-task gfp constraints in fast path Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 117/143] mm/gup: do not migrate zero page Andrew Morton ` (27 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg, jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko, mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin, peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka, willy From: Pavel Tatashin <pasha.tatashin@soleen.com> Subject: mm: honor PF_MEMALLOC_PIN for all movable pages PF_MEMALLOC_PIN is only honored for CMA pages, extend this flag to work for any allocations from ZONE_MOVABLE by removing __GFP_MOVABLE from gfp_mask when this flag is passed in the current context. Add is_pinnable_page() to return true if page is in a pinnable page. A pinnable page is not in ZONE_MOVABLE and not of MIGRATE_CMA type. Link: https://lkml.kernel.org/r/20210215161349.246722-8-pasha.tatashin@soleen.com Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: James Morris <jmorris@namei.org> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mel Gorman <mgorman@suse.de> Cc: Michal Hocko <mhocko@kernel.org> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Oscar Salvador <osalvador@suse.de> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Sasha Levin <sashal@kernel.org> Cc: Steven Rostedt (VMware) <rostedt@goodmis.org> Cc: Tyler Hicks <tyhicks@linux.microsoft.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/mm.h | 18 ++++++++++++++++++ include/linux/sched/mm.h | 6 +++++- mm/hugetlb.c | 2 +- mm/page_alloc.c | 20 +++++++++----------- 4 files changed, 33 insertions(+), 13 deletions(-) --- a/include/linux/mm.h~mm-honor-pf_memalloc_pin-for-all-movable-pages +++ a/include/linux/mm.h @@ -1141,6 +1141,11 @@ static inline bool is_zone_device_page(c } #endif +static inline bool is_zone_movable_page(const struct page *page) +{ + return page_zonenum(page) == ZONE_MOVABLE; +} + #ifdef CONFIG_DEV_PAGEMAP_OPS void free_devmap_managed_page(struct page *page); DECLARE_STATIC_KEY_FALSE(devmap_managed_key); @@ -1550,6 +1555,19 @@ static inline unsigned long page_to_sect } #endif +/* MIGRATE_CMA and ZONE_MOVABLE do not allow pin pages */ +#ifdef CONFIG_MIGRATION +static inline bool is_pinnable_page(struct page *page) +{ + return !is_zone_movable_page(page) && !is_migrate_cma_page(page); +} +#else +static inline bool is_pinnable_page(struct page *page) +{ + return true; +} +#endif + static inline void set_page_zone(struct page *page, enum zone_type zone) { page->flags &= ~(ZONES_MASK << ZONES_PGSHIFT); --- a/include/linux/sched/mm.h~mm-honor-pf_memalloc_pin-for-all-movable-pages +++ a/include/linux/sched/mm.h @@ -151,12 +151,13 @@ static inline bool in_vfork(struct task_ * Applies per-task gfp context to the given allocation flags. * PF_MEMALLOC_NOIO implies GFP_NOIO * PF_MEMALLOC_NOFS implies GFP_NOFS + * PF_MEMALLOC_PIN implies !GFP_MOVABLE */ static inline gfp_t current_gfp_context(gfp_t flags) { unsigned int pflags = READ_ONCE(current->flags); - if (unlikely(pflags & (PF_MEMALLOC_NOIO | PF_MEMALLOC_NOFS))) { + if (unlikely(pflags & (PF_MEMALLOC_NOIO | PF_MEMALLOC_NOFS | PF_MEMALLOC_PIN))) { /* * NOIO implies both NOIO and NOFS and it is a weaker context * so always make sure it makes precedence @@ -165,6 +166,9 @@ static inline gfp_t current_gfp_context( flags &= ~(__GFP_IO | __GFP_FS); else if (pflags & PF_MEMALLOC_NOFS) flags &= ~__GFP_FS; + + if (pflags & PF_MEMALLOC_PIN) + flags &= ~__GFP_MOVABLE; } return flags; } --- a/mm/hugetlb.c~mm-honor-pf_memalloc_pin-for-all-movable-pages +++ a/mm/hugetlb.c @@ -1083,7 +1083,7 @@ static struct page *dequeue_huge_page_no lockdep_assert_held(&hugetlb_lock); list_for_each_entry(page, &h->hugepage_freelists[nid], lru) { - if (pin && is_migrate_cma_page(page)) + if (pin && !is_pinnable_page(page)) continue; if (PageHWPoison(page)) --- a/mm/page_alloc.c~mm-honor-pf_memalloc_pin-for-all-movable-pages +++ a/mm/page_alloc.c @@ -3859,16 +3859,13 @@ alloc_flags_nofragment(struct zone *zone return alloc_flags; } -static inline unsigned int current_alloc_flags(gfp_t gfp_mask, - unsigned int alloc_flags) +/* Must be called after current_gfp_context() which can change gfp_mask */ +static inline unsigned int gfp_to_alloc_flags_cma(gfp_t gfp_mask, + unsigned int alloc_flags) { #ifdef CONFIG_CMA - unsigned int pflags = current->flags; - - if (!(pflags & PF_MEMALLOC_PIN) && - gfp_migratetype(gfp_mask) == MIGRATE_MOVABLE) + if (gfp_migratetype(gfp_mask) == MIGRATE_MOVABLE) alloc_flags |= ALLOC_CMA; - #endif return alloc_flags; } @@ -4526,7 +4523,7 @@ gfp_to_alloc_flags(gfp_t gfp_mask) } else if (unlikely(rt_task(current)) && !in_interrupt()) alloc_flags |= ALLOC_HARDER; - alloc_flags = current_alloc_flags(gfp_mask, alloc_flags); + alloc_flags = gfp_to_alloc_flags_cma(gfp_mask, alloc_flags); return alloc_flags; } @@ -4828,7 +4825,7 @@ retry: reserve_flags = __gfp_pfmemalloc_flags(gfp_mask); if (reserve_flags) - alloc_flags = current_alloc_flags(gfp_mask, reserve_flags); + alloc_flags = gfp_to_alloc_flags_cma(gfp_mask, reserve_flags); /* * Reset the nodemask and zonelist iterators if memory policies can be @@ -4997,7 +4994,7 @@ static inline bool prepare_alloc_pages(g if (should_fail_alloc_page(gfp_mask, order)) return false; - *alloc_flags = current_alloc_flags(gfp_mask, *alloc_flags); + *alloc_flags = gfp_to_alloc_flags_cma(gfp_mask, *alloc_flags); /* Dirty zone balancing only done in the fast path */ ac->spread_dirty_pages = (gfp_mask & __GFP_WRITE); @@ -5184,7 +5181,8 @@ struct page *__alloc_pages(gfp_t gfp, un * Apply scoped allocation constraints. This is mainly about GFP_NOFS * resp. GFP_NOIO which has to be inherited for all allocation requests * from a particular context which has been marked by - * memalloc_no{fs,io}_{save,restore}. + * memalloc_no{fs,io}_{save,restore}. And PF_MEMALLOC_PIN which ensures + * movable zones are not used during allocation. */ gfp = current_gfp_context(gfp); alloc_gfp = gfp; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 117/143] mm/gup: do not migrate zero page 2021-05-05 1:32 incoming Andrew Morton ` (112 preceding siblings ...) 2021-05-05 1:39 ` [patch 116/143] mm: honor PF_MEMALLOC_PIN for all movable pages Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 118/143] mm/gup: migrate pinned pages out of movable zone Andrew Morton ` (26 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg, jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko, mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin, peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka, willy From: Pavel Tatashin <pasha.tatashin@soleen.com> Subject: mm/gup: do not migrate zero page On some platforms ZERO_PAGE(0) might end-up in a movable zone. Do not migrate zero page in gup during longterm pinning as migration of zero page is not allowed. For example, in x86 QEMU with 16G of memory and kernelcore=5G parameter, I see the following: Boot#1: zero_pfn 0x48a8d zero_pfn zone: ZONE_DMA32 Boot#2: zero_pfn 0x20168d zero_pfn zone: ZONE_MOVABLE On x86, empty_zero_page is declared in .bss and depending on the loader may end up in different physical locations during boots. Also, move is_zero_pfn() my_zero_pfn() functions under CONFIG_MMU, because zero_pfn that they are using is declared in memory.c which is compiled with CONFIG_MMU. Link: https://lkml.kernel.org/r/20210215161349.246722-9-pasha.tatashin@soleen.com Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: James Morris <jmorris@namei.org> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mel Gorman <mgorman@suse.de> Cc: Michal Hocko <mhocko@kernel.org> Cc: Michal Hocko <mhocko@suse.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Oscar Salvador <osalvador@suse.de> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Sasha Levin <sashal@kernel.org> Cc: Steven Rostedt (VMware) <rostedt@goodmis.org> Cc: Tyler Hicks <tyhicks@linux.microsoft.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/mm.h | 3 ++- include/linux/mmzone.h | 4 ++++ include/linux/pgtable.h | 12 ++++++++++++ 3 files changed, 18 insertions(+), 1 deletion(-) --- a/include/linux/mm.h~mm-gup-do-not-migrate-zero-page +++ a/include/linux/mm.h @@ -1559,7 +1559,8 @@ static inline unsigned long page_to_sect #ifdef CONFIG_MIGRATION static inline bool is_pinnable_page(struct page *page) { - return !is_zone_movable_page(page) && !is_migrate_cma_page(page); + return !(is_zone_movable_page(page) || is_migrate_cma_page(page)) || + is_zero_pfn(page_to_pfn(page)); } #else static inline bool is_pinnable_page(struct page *page) --- a/include/linux/mmzone.h~mm-gup-do-not-migrate-zero-page +++ a/include/linux/mmzone.h @@ -427,6 +427,10 @@ enum zone_type { * techniques might use alloc_contig_range() to hide previously * exposed pages from the buddy again (e.g., to implement some sort * of memory unplug in virtio-mem). + * 6. ZERO_PAGE(0), kernelcore/movablecore setups might create + * situations where ZERO_PAGE(0) which is allocated differently + * on different platforms may end up in a movable zone. ZERO_PAGE(0) + * cannot be migrated. * * In general, no unmovable allocations that degrade memory offlining * should end up in ZONE_MOVABLE. Allocators (like alloc_contig_range()) --- a/include/linux/pgtable.h~mm-gup-do-not-migrate-zero-page +++ a/include/linux/pgtable.h @@ -1111,6 +1111,7 @@ extern void untrack_pfn(struct vm_area_s extern void untrack_pfn_moved(struct vm_area_struct *vma); #endif +#ifdef CONFIG_MMU #ifdef __HAVE_COLOR_ZERO_PAGE static inline int is_zero_pfn(unsigned long pfn) { @@ -1134,6 +1135,17 @@ static inline unsigned long my_zero_pfn( return zero_pfn; } #endif +#else +static inline int is_zero_pfn(unsigned long pfn) +{ + return 0; +} + +static inline unsigned long my_zero_pfn(unsigned long addr) +{ + return 0; +} +#endif /* CONFIG_MMU */ #ifdef CONFIG_MMU _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 118/143] mm/gup: migrate pinned pages out of movable zone 2021-05-05 1:32 incoming Andrew Morton ` (113 preceding siblings ...) 2021-05-05 1:39 ` [patch 117/143] mm/gup: do not migrate zero page Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 119/143] memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning Andrew Morton ` (25 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg, jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko, mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin, peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka, willy From: Pavel Tatashin <pasha.tatashin@soleen.com> Subject: mm/gup: migrate pinned pages out of movable zone We should not pin pages in ZONE_MOVABLE. Currently, we do not pin only movable CMA pages. Generalize the function that migrates CMA pages to migrate all movable pages. Use is_pinnable_page() to check which pages need to be migrated Link: https://lkml.kernel.org/r/20210215161349.246722-10-pasha.tatashin@soleen.com Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com> Reviewed-by: John Hubbard <jhubbard@nvidia.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: James Morris <jmorris@namei.org> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mel Gorman <mgorman@suse.de> Cc: Michal Hocko <mhocko@kernel.org> Cc: Michal Hocko <mhocko@suse.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Oscar Salvador <osalvador@suse.de> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Sasha Levin <sashal@kernel.org> Cc: Steven Rostedt (VMware) <rostedt@goodmis.org> Cc: Tyler Hicks <tyhicks@linux.microsoft.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/migrate.h | 1 include/linux/mmzone.h | 9 +++- include/trace/events/migrate.h | 3 - mm/gup.c | 67 +++++++++++++++---------------- 4 files changed, 44 insertions(+), 36 deletions(-) --- a/include/linux/migrate.h~mm-gup-migrate-pinned-pages-out-of-movable-zone +++ a/include/linux/migrate.h @@ -27,6 +27,7 @@ enum migrate_reason { MR_MEMPOLICY_MBIND, MR_NUMA_MISPLACED, MR_CONTIG_RANGE, + MR_LONGTERM_PIN, MR_TYPES }; --- a/include/linux/mmzone.h~mm-gup-migrate-pinned-pages-out-of-movable-zone +++ a/include/linux/mmzone.h @@ -407,8 +407,13 @@ enum zone_type { * to increase the number of THP/huge pages. Notable special cases are: * * 1. Pinned pages: (long-term) pinning of movable pages might - * essentially turn such pages unmovable. Memory offlining might - * retry a long time. + * essentially turn such pages unmovable. Therefore, we do not allow + * pinning long-term pages in ZONE_MOVABLE. When pages are pinned and + * faulted, they come from the right zone right away. However, it is + * still possible that address space already has pages in + * ZONE_MOVABLE at the time when pages are pinned (i.e. user has + * touches that memory before pinning). In such case we migrate them + * to a different zone. When migration fails - pinning fails. * 2. memblock allocations: kernelcore/movablecore setups might create * situations where ZONE_MOVABLE contains unmovable allocations * after boot. Memory offlining and allocations fail early. --- a/include/trace/events/migrate.h~mm-gup-migrate-pinned-pages-out-of-movable-zone +++ a/include/trace/events/migrate.h @@ -20,7 +20,8 @@ EM( MR_SYSCALL, "syscall_or_cpuset") \ EM( MR_MEMPOLICY_MBIND, "mempolicy_mbind") \ EM( MR_NUMA_MISPLACED, "numa_misplaced") \ - EMe(MR_CONTIG_RANGE, "contig_range") + EM( MR_CONTIG_RANGE, "contig_range") \ + EMe(MR_LONGTERM_PIN, "longterm_pin") /* * First define the enums in the above macros to be exported to userspace --- a/mm/gup.c~mm-gup-migrate-pinned-pages-out-of-movable-zone +++ a/mm/gup.c @@ -87,11 +87,12 @@ __maybe_unused struct page *try_grab_com int orig_refs = refs; /* - * Can't do FOLL_LONGTERM + FOLL_PIN with CMA in the gup fast - * path, so fail and let the caller fall back to the slow path. + * Can't do FOLL_LONGTERM + FOLL_PIN gup fast path if not in a + * right zone, so fail and let the caller fall back to the slow + * path. */ - if (unlikely(flags & FOLL_LONGTERM) && - is_migrate_cma_page(page)) + if (unlikely((flags & FOLL_LONGTERM) && + !is_pinnable_page(page))) return NULL; /* @@ -1600,17 +1601,17 @@ struct page *get_dump_page(unsigned long } #endif /* CONFIG_ELF_CORE */ -#ifdef CONFIG_CMA -static long check_and_migrate_cma_pages(struct mm_struct *mm, - unsigned long start, - unsigned long nr_pages, - struct page **pages, - struct vm_area_struct **vmas, - unsigned int gup_flags) +#ifdef CONFIG_MIGRATION +static long check_and_migrate_movable_pages(struct mm_struct *mm, + unsigned long start, + unsigned long nr_pages, + struct page **pages, + struct vm_area_struct **vmas, + unsigned int gup_flags) { unsigned long i, isolation_error_count; bool drain_allow; - LIST_HEAD(cma_page_list); + LIST_HEAD(movable_page_list); long ret = nr_pages; struct page *prev_head, *head; struct migration_target_control mtc = { @@ -1628,13 +1629,12 @@ check_again: continue; prev_head = head; /* - * If we get a page from the CMA zone, since we are going to - * be pinning these entries, we might as well move them out - * of the CMA zone if possible. + * If we get a movable page, since we are going to be pinning + * these entries, try to move them out if possible. */ - if (is_migrate_cma_page(head)) { + if (!is_pinnable_page(head)) { if (PageHuge(head)) { - if (!isolate_huge_page(head, &cma_page_list)) + if (!isolate_huge_page(head, &movable_page_list)) isolation_error_count++; } else { if (!PageLRU(head) && drain_allow) { @@ -1646,7 +1646,7 @@ check_again: isolation_error_count++; continue; } - list_add_tail(&head->lru, &cma_page_list); + list_add_tail(&head->lru, &movable_page_list); mod_node_page_state(page_pgdat(head), NR_ISOLATED_ANON + page_is_file_lru(head), @@ -1659,10 +1659,10 @@ check_again: * If list is empty, and no isolation errors, means that all pages are * in the correct zone. */ - if (list_empty(&cma_page_list) && !isolation_error_count) + if (list_empty(&movable_page_list) && !isolation_error_count) return ret; - if (!list_empty(&cma_page_list)) { + if (!list_empty(&movable_page_list)) { /* * drop the above get_user_pages reference. */ @@ -1672,12 +1672,12 @@ check_again: for (i = 0; i < nr_pages; i++) put_page(pages[i]); - ret = migrate_pages(&cma_page_list, alloc_migration_target, + ret = migrate_pages(&movable_page_list, alloc_migration_target, NULL, (unsigned long)&mtc, MIGRATE_SYNC, - MR_CONTIG_RANGE); + MR_LONGTERM_PIN); if (ret) { - if (!list_empty(&cma_page_list)) - putback_movable_pages(&cma_page_list); + if (!list_empty(&movable_page_list)) + putback_movable_pages(&movable_page_list); return ret > 0 ? -ENOMEM : ret; } @@ -1696,16 +1696,16 @@ check_again: goto check_again; } #else -static long check_and_migrate_cma_pages(struct mm_struct *mm, - unsigned long start, - unsigned long nr_pages, - struct page **pages, - struct vm_area_struct **vmas, - unsigned int gup_flags) +static long check_and_migrate_movable_pages(struct mm_struct *mm, + unsigned long start, + unsigned long nr_pages, + struct page **pages, + struct vm_area_struct **vmas, + unsigned int gup_flags) { return nr_pages; } -#endif /* CONFIG_CMA */ +#endif /* CONFIG_MIGRATION */ /* * __gup_longterm_locked() is a wrapper for __get_user_pages_locked which @@ -1729,8 +1729,9 @@ static long __gup_longterm_locked(struct if (gup_flags & FOLL_LONGTERM) { if (rc > 0) - rc = check_and_migrate_cma_pages(mm, start, rc, pages, - vmas, gup_flags); + rc = check_and_migrate_movable_pages(mm, start, rc, + pages, vmas, + gup_flags); memalloc_pin_restore(flags); } return rc; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 119/143] memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning 2021-05-05 1:32 incoming Andrew Morton ` (114 preceding siblings ...) 2021-05-05 1:39 ` [patch 118/143] mm/gup: migrate pinned pages out of movable zone Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 120/143] mm/gup: change index type to long as it counts pages Andrew Morton ` (24 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg, jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko, mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin, peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka, willy From: Pavel Tatashin <pasha.tatashin@soleen.com> Subject: memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning Document the special handling of page pinning when ZONE_MOVABLE present. Link: https://lkml.kernel.org/r/20210215161349.246722-11-pasha.tatashin@soleen.com Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com> Suggested-by: David Hildenbrand <david@redhat.com> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: David Rientjes <rientjes@google.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: James Morris <jmorris@namei.org> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mel Gorman <mgorman@suse.de> Cc: Michal Hocko <mhocko@kernel.org> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Oscar Salvador <osalvador@suse.de> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Sasha Levin <sashal@kernel.org> Cc: Steven Rostedt (VMware) <rostedt@goodmis.org> Cc: Tyler Hicks <tyhicks@linux.microsoft.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/admin-guide/mm/memory-hotplug.rst | 9 +++++++++ 1 file changed, 9 insertions(+) --- a/Documentation/admin-guide/mm/memory-hotplug.rst~memory-hotplugrst-add-a-note-about-zone_movable-and-page-pinning +++ a/Documentation/admin-guide/mm/memory-hotplug.rst @@ -357,6 +357,15 @@ creates ZONE_MOVABLE as following. Unfortunately, there is no information to show which memory block belongs to ZONE_MOVABLE. This is TBD. +.. note:: + Techniques that rely on long-term pinnings of memory (especially, RDMA and + vfio) are fundamentally problematic with ZONE_MOVABLE and, therefore, memory + hot remove. Pinned pages cannot reside on ZONE_MOVABLE, to guarantee that + memory can still get hot removed - be aware that pinning can fail even if + there is plenty of free memory in ZONE_MOVABLE. In addition, using + ZONE_MOVABLE might make page pinning more expensive, because pages have to be + migrated off that zone first. + .. _memory_hotplug_how_to_offline_memory: How to offline memory _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 120/143] mm/gup: change index type to long as it counts pages 2021-05-05 1:32 incoming Andrew Morton ` (115 preceding siblings ...) 2021-05-05 1:39 ` [patch 119/143] memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 121/143] mm/gup: longterm pin migration cleanup Andrew Morton ` (23 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg, jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko, mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin, peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka, willy From: Pavel Tatashin <pasha.tatashin@soleen.com> Subject: mm/gup: change index type to long as it counts pages In __get_user_pages_locked() i counts number of pages which should be long, as long is used in all other places to contain number of pages, and 32-bit becomes increasingly small for handling page count proportional values. Link: https://lkml.kernel.org/r/20210215161349.246722-12-pasha.tatashin@soleen.com Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: James Morris <jmorris@namei.org> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mel Gorman <mgorman@suse.de> Cc: Michal Hocko <mhocko@kernel.org> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Oscar Salvador <osalvador@suse.de> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Sasha Levin <sashal@kernel.org> Cc: Steven Rostedt (VMware) <rostedt@goodmis.org> Cc: Tyler Hicks <tyhicks@linux.microsoft.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/gup.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/gup.c~mm-gup-change-index-type-to-long-as-it-counts-pages +++ a/mm/gup.c @@ -1528,7 +1528,7 @@ static long __get_user_pages_locked(stru { struct vm_area_struct *vma; unsigned long vm_flags; - int i; + long i; /* calculate required read or write permissions. * If FOLL_FORCE is set, we only require the "MAY" flags. _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 121/143] mm/gup: longterm pin migration cleanup 2021-05-05 1:32 incoming Andrew Morton ` (116 preceding siblings ...) 2021-05-05 1:39 ` [patch 120/143] mm/gup: change index type to long as it counts pages Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 122/143] selftests/vm: gup_test: fix test flag Andrew Morton ` (22 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg, jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko, mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin, peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka, willy From: Pavel Tatashin <pasha.tatashin@soleen.com> Subject: mm/gup: longterm pin migration cleanup When pages are longterm pinned, we must migrated them out of movable zone. The function that migrates them has a hidden loop with goto. The loop is to retry on isolation failures, and after successful migration. Make this code better by moving this loop to the caller. Link: https://lkml.kernel.org/r/20210215161349.246722-13-pasha.tatashin@soleen.com Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com> Reviewed-by: Jason Gunthorpe <jgg@nvidia.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: James Morris <jmorris@namei.org> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mel Gorman <mgorman@suse.de> Cc: Michal Hocko <mhocko@kernel.org> Cc: Michal Hocko <mhocko@suse.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Oscar Salvador <osalvador@suse.de> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Sasha Levin <sashal@kernel.org> Cc: Steven Rostedt (VMware) <rostedt@goodmis.org> Cc: Tyler Hicks <tyhicks@linux.microsoft.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/gup.c | 93 +++++++++++++++++++++-------------------------------- 1 file changed, 37 insertions(+), 56 deletions(-) --- a/mm/gup.c~mm-gup-longterm-pin-migration-cleanup +++ a/mm/gup.c @@ -1602,27 +1602,28 @@ struct page *get_dump_page(unsigned long #endif /* CONFIG_ELF_CORE */ #ifdef CONFIG_MIGRATION -static long check_and_migrate_movable_pages(struct mm_struct *mm, - unsigned long start, - unsigned long nr_pages, +/* + * Check whether all pages are pinnable, if so return number of pages. If some + * pages are not pinnable, migrate them, and unpin all pages. Return zero if + * pages were migrated, or if some pages were not successfully isolated. + * Return negative error if migration fails. + */ +static long check_and_migrate_movable_pages(unsigned long nr_pages, struct page **pages, - struct vm_area_struct **vmas, unsigned int gup_flags) { - unsigned long i, isolation_error_count; - bool drain_allow; + unsigned long i; + unsigned long isolation_error_count = 0; + bool drain_allow = true; LIST_HEAD(movable_page_list); - long ret = nr_pages; - struct page *prev_head, *head; + long ret = 0; + struct page *prev_head = NULL; + struct page *head; struct migration_target_control mtc = { .nid = NUMA_NO_NODE, .gfp_mask = GFP_USER | __GFP_NOWARN, }; -check_again: - prev_head = NULL; - isolation_error_count = 0; - drain_allow = true; for (i = 0; i < nr_pages; i++) { head = compound_head(pages[i]); if (head == prev_head) @@ -1660,47 +1661,27 @@ check_again: * in the correct zone. */ if (list_empty(&movable_page_list) && !isolation_error_count) - return ret; + return nr_pages; + if (gup_flags & FOLL_PIN) { + unpin_user_pages(pages, nr_pages); + } else { + for (i = 0; i < nr_pages; i++) + put_page(pages[i]); + } if (!list_empty(&movable_page_list)) { - /* - * drop the above get_user_pages reference. - */ - if (gup_flags & FOLL_PIN) - unpin_user_pages(pages, nr_pages); - else - for (i = 0; i < nr_pages; i++) - put_page(pages[i]); - ret = migrate_pages(&movable_page_list, alloc_migration_target, NULL, (unsigned long)&mtc, MIGRATE_SYNC, MR_LONGTERM_PIN); - if (ret) { - if (!list_empty(&movable_page_list)) - putback_movable_pages(&movable_page_list); - return ret > 0 ? -ENOMEM : ret; - } - - /* We unpinned pages before migration, pin them again */ - ret = __get_user_pages_locked(mm, start, nr_pages, pages, vmas, - NULL, gup_flags); - if (ret <= 0) - return ret; - nr_pages = ret; + if (ret && !list_empty(&movable_page_list)) + putback_movable_pages(&movable_page_list); } - /* - * check again because pages were unpinned, and we also might have - * had isolation errors and need more pages to migrate. - */ - goto check_again; + return ret > 0 ? -ENOMEM : ret; } #else -static long check_and_migrate_movable_pages(struct mm_struct *mm, - unsigned long start, - unsigned long nr_pages, +static long check_and_migrate_movable_pages(unsigned long nr_pages, struct page **pages, - struct vm_area_struct **vmas, unsigned int gup_flags) { return nr_pages; @@ -1718,22 +1699,22 @@ static long __gup_longterm_locked(struct struct vm_area_struct **vmas, unsigned int gup_flags) { - unsigned long flags = 0; + unsigned int flags; long rc; - if (gup_flags & FOLL_LONGTERM) - flags = memalloc_pin_save(); - - rc = __get_user_pages_locked(mm, start, nr_pages, pages, vmas, NULL, - gup_flags); + if (!(gup_flags & FOLL_LONGTERM)) + return __get_user_pages_locked(mm, start, nr_pages, pages, vmas, + NULL, gup_flags); + flags = memalloc_pin_save(); + do { + rc = __get_user_pages_locked(mm, start, nr_pages, pages, vmas, + NULL, gup_flags); + if (rc <= 0) + break; + rc = check_and_migrate_movable_pages(rc, pages, gup_flags); + } while (!rc); + memalloc_pin_restore(flags); - if (gup_flags & FOLL_LONGTERM) { - if (rc > 0) - rc = check_and_migrate_movable_pages(mm, start, rc, - pages, vmas, - gup_flags); - memalloc_pin_restore(flags); - } return rc; } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 122/143] selftests/vm: gup_test: fix test flag 2021-05-05 1:32 incoming Andrew Morton ` (117 preceding siblings ...) 2021-05-05 1:39 ` [patch 121/143] mm/gup: longterm pin migration cleanup Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 123/143] selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages Andrew Morton ` (21 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg, jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko, mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin, peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka, willy From: Pavel Tatashin <pasha.tatashin@soleen.com> Subject: selftests/vm: gup_test: fix test flag In gup_test both gup_flags and test_flags use the same flags field. This is broken. Farther, in the actual gup_test.c all the passed gup_flags are erased and unconditionally replaced with FOLL_WRITE. Which means that test_flags are ignored, and code like this always performs pin dump test: 155 if (gup->flags & GUP_TEST_FLAG_DUMP_PAGES_USE_PIN) 156 nr = pin_user_pages(addr, nr, gup->flags, 157 pages + i, NULL); 158 else 159 nr = get_user_pages(addr, nr, gup->flags, 160 pages + i, NULL); 161 break; Add a new test_flags field, to allow raw gup_flags to work. Add a new subcommand for DUMP_USER_PAGES_TEST to specify that pin test should be performed. Remove unconditional overwriting of gup_flags via FOLL_WRITE. But, preserve the previous behaviour where FOLL_WRITE was the default flag, and add a new option "-W" to unset FOLL_WRITE. Rename flags with gup_flags. With the fix, dump works like this: root@virtme:/# gup_test -c ---- page #0, starting from user virt addr: 0x7f8acb9e4000 page:00000000d3d2ee27 refcount:2 mapcount:1 mapping:0000000000000000 index:0x0 pfn:0x100bcf anon flags: 0x300000000080016(referenced|uptodate|lru|swapbacked) raw: 0300000000080016 ffffd0e204021608 ffffd0e208df2e88 ffff8ea04243ec61 raw: 0000000000000000 0000000000000000 0000000200000000 0000000000000000 page dumped because: gup_test: dump_pages() test DUMP_USER_PAGES_TEST: done root@virtme:/# gup_test -c -p ---- page #0, starting from user virt addr: 0x7fd19701b000 page:00000000baed3c7d refcount:1025 mapcount:1 mapping:0000000000000000 index:0x0 pfn:0x108008 anon flags: 0x300000000080014(uptodate|lru|swapbacked) raw: 0300000000080014 ffffd0e204200188 ffffd0e205e09088 ffff8ea04243ee71 raw: 0000000000000000 0000000000000000 0000040100000000 0000000000000000 page dumped because: gup_test: dump_pages() test DUMP_USER_PAGES_TEST: done Refcount shows the difference between pin vs no-pin case. Also change type of nr from int to long, as it counts number of pages. Link: https://lkml.kernel.org/r/20210215161349.246722-14-pasha.tatashin@soleen.com Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com> Reviewed-by: John Hubbard <jhubbard@nvidia.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: James Morris <jmorris@namei.org> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mel Gorman <mgorman@suse.de> Cc: Michal Hocko <mhocko@kernel.org> Cc: Michal Hocko <mhocko@suse.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Oscar Salvador <osalvador@suse.de> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Sasha Levin <sashal@kernel.org> Cc: Steven Rostedt (VMware) <rostedt@goodmis.org> Cc: Tyler Hicks <tyhicks@linux.microsoft.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/gup_test.c | 23 ++++++++++------------- mm/gup_test.h | 3 ++- tools/testing/selftests/vm/gup_test.c | 15 +++++++++++---- 3 files changed, 23 insertions(+), 18 deletions(-) --- a/mm/gup_test.c~selftests-vm-gup_test-fix-test-flag +++ a/mm/gup_test.c @@ -94,7 +94,7 @@ static int __gup_test_ioctl(unsigned int { ktime_t start_time, end_time; unsigned long i, nr_pages, addr, next; - int nr; + long nr; struct page **pages; int ret = 0; bool needs_mmap_lock = @@ -126,37 +126,34 @@ static int __gup_test_ioctl(unsigned int nr = (next - addr) / PAGE_SIZE; } - /* Filter out most gup flags: only allow a tiny subset here: */ - gup->flags &= FOLL_WRITE; - switch (cmd) { case GUP_FAST_BENCHMARK: - nr = get_user_pages_fast(addr, nr, gup->flags, + nr = get_user_pages_fast(addr, nr, gup->gup_flags, pages + i); break; case GUP_BASIC_TEST: - nr = get_user_pages(addr, nr, gup->flags, pages + i, + nr = get_user_pages(addr, nr, gup->gup_flags, pages + i, NULL); break; case PIN_FAST_BENCHMARK: - nr = pin_user_pages_fast(addr, nr, gup->flags, + nr = pin_user_pages_fast(addr, nr, gup->gup_flags, pages + i); break; case PIN_BASIC_TEST: - nr = pin_user_pages(addr, nr, gup->flags, pages + i, + nr = pin_user_pages(addr, nr, gup->gup_flags, pages + i, NULL); break; case PIN_LONGTERM_BENCHMARK: nr = pin_user_pages(addr, nr, - gup->flags | FOLL_LONGTERM, + gup->gup_flags | FOLL_LONGTERM, pages + i, NULL); break; case DUMP_USER_PAGES_TEST: - if (gup->flags & GUP_TEST_FLAG_DUMP_PAGES_USE_PIN) - nr = pin_user_pages(addr, nr, gup->flags, + if (gup->test_flags & GUP_TEST_FLAG_DUMP_PAGES_USE_PIN) + nr = pin_user_pages(addr, nr, gup->gup_flags, pages + i, NULL); else - nr = get_user_pages(addr, nr, gup->flags, + nr = get_user_pages(addr, nr, gup->gup_flags, pages + i, NULL); break; default: @@ -187,7 +184,7 @@ static int __gup_test_ioctl(unsigned int start_time = ktime_get(); - put_back_pages(cmd, pages, nr_pages, gup->flags); + put_back_pages(cmd, pages, nr_pages, gup->test_flags); end_time = ktime_get(); gup->put_delta_usec = ktime_us_delta(end_time, start_time); --- a/mm/gup_test.h~selftests-vm-gup_test-fix-test-flag +++ a/mm/gup_test.h @@ -21,7 +21,8 @@ struct gup_test { __u64 addr; __u64 size; __u32 nr_pages_per_call; - __u32 flags; + __u32 gup_flags; + __u32 test_flags; /* * Each non-zero entry is the number of the page (1-based: first page is * page 1, so that zero entries mean "do nothing") from the .addr base. --- a/tools/testing/selftests/vm/gup_test.c~selftests-vm-gup_test-fix-test-flag +++ a/tools/testing/selftests/vm/gup_test.c @@ -37,13 +37,13 @@ int main(int argc, char **argv) { struct gup_test gup = { 0 }; unsigned long size = 128 * MB; - int i, fd, filed, opt, nr_pages = 1, thp = -1, repeats = 1, write = 0; + int i, fd, filed, opt, nr_pages = 1, thp = -1, repeats = 1, write = 1; unsigned long cmd = GUP_FAST_BENCHMARK; int flags = MAP_PRIVATE; char *file = "/dev/zero"; char *p; - while ((opt = getopt(argc, argv, "m:r:n:F:f:abctTLUuwSH")) != -1) { + while ((opt = getopt(argc, argv, "m:r:n:F:f:abctTLUuwWSHp")) != -1) { switch (opt) { case 'a': cmd = PIN_FAST_BENCHMARK; @@ -65,9 +65,13 @@ int main(int argc, char **argv) */ gup.which_pages[0] = 1; break; + case 'p': + /* works only with DUMP_USER_PAGES_TEST */ + gup.test_flags |= GUP_TEST_FLAG_DUMP_PAGES_USE_PIN; + break; case 'F': /* strtol, so you can pass flags in hex form */ - gup.flags = strtol(optarg, 0, 0); + gup.gup_flags = strtol(optarg, 0, 0); break; case 'm': size = atoi(optarg) * MB; @@ -93,6 +97,9 @@ int main(int argc, char **argv) case 'w': write = 1; break; + case 'W': + write = 0; + break; case 'f': file = optarg; break; @@ -140,7 +147,7 @@ int main(int argc, char **argv) gup.nr_pages_per_call = nr_pages; if (write) - gup.flags |= FOLL_WRITE; + gup.gup_flags |= FOLL_WRITE; fd = open("/sys/kernel/debug/gup_test", O_RDWR); if (fd == -1) { _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 123/143] selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages 2021-05-05 1:32 incoming Andrew Morton ` (118 preceding siblings ...) 2021-05-05 1:39 ` [patch 122/143] selftests/vm: gup_test: fix test flag Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 124/143] mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove Andrew Morton ` (20 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg, jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko, mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin, peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka, willy From: Pavel Tatashin <pasha.tatashin@soleen.com> Subject: selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages When pages are pinned they can be faulted in userland and migrated, and they can be faulted right in kernel without migration. In either case, the pinned pages must end-up being pinnable (not movable). Add a new test to gup_test, to help verify that the gup/pup (get_user_pages() / pin_user_pages()) behavior with respect to pinnable and movable pages is reasonable and correct. Specifically, provide a way to: 1) Verify that only "pinnable" pages are pinned. This is checked automatically for you. 2) Verify that gup/pup performance is reasonable. This requires comparing benchmarks between doing gup/pup on pages that have been pre-faulted in from user space, vs. doing gup/pup on pages that are not faulted in until gup/pup time (via FOLL_TOUCH). This decision is controlled with the new -z command line option. Link: https://lkml.kernel.org/r/20210215161349.246722-15-pasha.tatashin@soleen.com Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com> Reviewed-by: John Hubbard <jhubbard@nvidia.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: David Rientjes <rientjes@google.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: James Morris <jmorris@namei.org> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Mel Gorman <mgorman@suse.de> Cc: Michal Hocko <mhocko@kernel.org> Cc: Michal Hocko <mhocko@suse.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Oscar Salvador <osalvador@suse.de> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Sasha Levin <sashal@kernel.org> Cc: Steven Rostedt (VMware) <rostedt@goodmis.org> Cc: Tyler Hicks <tyhicks@linux.microsoft.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/gup_test.c | 6 ++++++ tools/testing/selftests/vm/gup_test.c | 23 +++++++++++++++++++---- 2 files changed, 25 insertions(+), 4 deletions(-) --- a/mm/gup_test.c~selftests-vm-gup_test-test-faulting-in-kernel-and-verify-pinnable-pages +++ a/mm/gup_test.c @@ -52,6 +52,12 @@ static void verify_dma_pinned(unsigned i dump_page(page, "gup_test failure"); break; + } else if (cmd == PIN_LONGTERM_BENCHMARK && + WARN(!is_pinnable_page(page), + "pages[%lu] is NOT pinnable but pinned\n", + i)) { + dump_page(page, "gup_test failure"); + break; } } break; --- a/tools/testing/selftests/vm/gup_test.c~selftests-vm-gup_test-test-faulting-in-kernel-and-verify-pinnable-pages +++ a/tools/testing/selftests/vm/gup_test.c @@ -13,6 +13,7 @@ /* Just the flags we need, copied from mm.h: */ #define FOLL_WRITE 0x01 /* check pte is writable */ +#define FOLL_TOUCH 0x02 /* mark page accessed */ static char *cmd_to_str(unsigned long cmd) { @@ -39,11 +40,11 @@ int main(int argc, char **argv) unsigned long size = 128 * MB; int i, fd, filed, opt, nr_pages = 1, thp = -1, repeats = 1, write = 1; unsigned long cmd = GUP_FAST_BENCHMARK; - int flags = MAP_PRIVATE; + int flags = MAP_PRIVATE, touch = 0; char *file = "/dev/zero"; char *p; - while ((opt = getopt(argc, argv, "m:r:n:F:f:abctTLUuwWSHp")) != -1) { + while ((opt = getopt(argc, argv, "m:r:n:F:f:abctTLUuwWSHpz")) != -1) { switch (opt) { case 'a': cmd = PIN_FAST_BENCHMARK; @@ -110,6 +111,10 @@ int main(int argc, char **argv) case 'H': flags |= (MAP_HUGETLB | MAP_ANONYMOUS); break; + case 'z': + /* fault pages in gup, do not fault in userland */ + touch = 1; + break; default: return -1; } @@ -167,8 +172,18 @@ int main(int argc, char **argv) else if (thp == 0) madvise(p, size, MADV_NOHUGEPAGE); - for (; (unsigned long)p < gup.addr + size; p += PAGE_SIZE) - p[0] = 0; + /* + * FOLL_TOUCH, in gup_test, is used as an either/or case: either + * fault pages in from the kernel via FOLL_TOUCH, or fault them + * in here, from user space. This allows comparison of performance + * between those two cases. + */ + if (touch) { + gup.gup_flags |= FOLL_TOUCH; + } else { + for (; (unsigned long)p < gup.addr + size; p += PAGE_SIZE) + p[0] = 0; + } /* Only report timing information on the *_BENCHMARK commands: */ if ((cmd == PIN_FAST_BENCHMARK) || (cmd == GUP_FAST_BENCHMARK) || _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 124/143] mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove 2021-05-05 1:32 incoming Andrew Morton ` (119 preceding siblings ...) 2021-05-05 1:39 ` [patch 123/143] selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 125/143] drivers/base/memory: introduce memory_block_{online,offline} Andrew Morton ` (19 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, alexander.h.duyck, david, linux-mm, mgorman, mhocko, minchan, mm-commits, mst, osalvador, torvalds, vbabka From: Mel Gorman <mgorman@techsingularity.net> Subject: mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove zone_pcp_reset allegedly protects against a race with drain_pages using local_irq_save but this is bogus. local_irq_save only operates on the local CPU. If memory hotplug is running on CPU A and drain_pages is running on CPU B, disabling IRQs on CPU A does not affect CPU B and offers no protection. This patch deletes IRQ disable/enable on the grounds that IRQs protect nothing and assumes the existing hotplug paths guarantees the PCP cannot be used after zone_pcp_enable(). That should be the case already because all the pages have been freed and there is no page to put on the PCP lists. Link: https://lkml.kernel.org/r/20210412090346.GQ3697@techsingularity.net Signed-off-by: Mel Gorman <mgorman@techsingularity.net> Acked-by: Michal Hocko <mhocko@suse.com> Reviewed-by: Oscar Salvador <osalvador@suse.de> Cc: "Michael S. Tsirkin" <mst@redhat.com> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Alexander Duyck <alexander.h.duyck@linux.intel.com> Cc: Minchan Kim <minchan@kernel.org> Cc: David Hildenbrand <david@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 4 ---- 1 file changed, 4 deletions(-) --- a/mm/page_alloc.c~mm-memory_hotplug-make-unpopulated-zones-pcp-structures-unreachable-during-hot-remove +++ a/mm/page_alloc.c @@ -9020,12 +9020,9 @@ void zone_pcp_enable(struct zone *zone) void zone_pcp_reset(struct zone *zone) { - unsigned long flags; int cpu; struct per_cpu_pageset *pset; - /* avoid races with drain_pages() */ - local_irq_save(flags); if (zone->pageset != &boot_pageset) { for_each_online_cpu(cpu) { pset = per_cpu_ptr(zone->pageset, cpu); @@ -9034,7 +9031,6 @@ void zone_pcp_reset(struct zone *zone) free_percpu(zone->pageset); zone->pageset = &boot_pageset; } - local_irq_restore(flags); } #ifdef CONFIG_MEMORY_HOTREMOVE _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 125/143] drivers/base/memory: introduce memory_block_{online,offline} 2021-05-05 1:32 incoming Andrew Morton ` (120 preceding siblings ...) 2021-05-05 1:39 ` [patch 124/143] mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 126/143] mm,memory_hotplug: relax fully spanned sections check Andrew Morton ` (18 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits, osalvador, pasha.tatashin, torvalds, vbabka From: Oscar Salvador <osalvador@suse.de> Subject: drivers/base/memory: introduce memory_block_{online,offline} Patch series "Allocate memmap from hotadded memory (per device)", v10. The primary goal of this patchset is to reduce memory overhead of the hot-added memory (at least for SPARSEMEM_VMEMMAP memory model). The current way we use to populate memmap (struct page array) has two main drawbacks: a) it consumes an additional memory until the hotadded memory itself is onlined and b) memmap might end up on a different numa node which is especially true for movable_node configuration. c) due to fragmentation we might end up populating memmap with base pages One way to mitigate all these issues is to simply allocate memmap array (which is the largest memory footprint of the physical memory hotplug) from the hot-added memory itself. SPARSEMEM_VMEMMAP memory model allows us to map any pfn range so the memory doesn't need to be online to be usable for the array. See patch 4 for more details. This feature is only usable when CONFIG_SPARSEMEM_VMEMMAP is set. [Overall design]: Implementation wise we reuse vmem_altmap infrastructure to override the default allocator used by vmemap_populate. memory_block structure gains a new field called nr_vmemmap_pages, which accounts for the number of vmemmap pages used by that memory_block. E.g: On x86_64, that is 512 vmemmap pages on small memory bloks and 4096 on large memory blocks (1GB) We also introduce new two functions: memory_block_{online,offline}. These functions take care of initializing/unitializing vmemmap pages prior to calling {online,offline}_pages, so the latter functions can remain totally untouched. More details can be found in the respective changelogs. This patch (of 8): This is a preparatory patch that introduces two new functions: memory_block_online() and memory_block_offline(). For now, these functions will only call online_pages() and offline_pages() respectively, but they will be later in charge of preparing the vmemmap pages, carrying out the initialization and proper accounting of such pages. Since memory_block struct contains all the information, pass this struct down the chain till the end functions. Link: https://lkml.kernel.org/r/20210421102701.25051-1-osalvador@suse.de Link: https://lkml.kernel.org/r/20210421102701.25051-2-osalvador@suse.de Signed-off-by: Oscar Salvador <osalvador@suse.de> Reviewed-by: David Hildenbrand <david@redhat.com> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/base/memory.c | 33 +++++++++++++++++++++------------ 1 file changed, 21 insertions(+), 12 deletions(-) --- a/drivers/base/memory.c~drivers-base-memory-introduce-memory_block_onlineoffline +++ a/drivers/base/memory.c @@ -169,30 +169,41 @@ int memory_notify(unsigned long val, voi return blocking_notifier_call_chain(&memory_chain, val, v); } +static int memory_block_online(struct memory_block *mem) +{ + unsigned long start_pfn = section_nr_to_pfn(mem->start_section_nr); + unsigned long nr_pages = PAGES_PER_SECTION * sections_per_block; + + return online_pages(start_pfn, nr_pages, mem->online_type, mem->nid); +} + +static int memory_block_offline(struct memory_block *mem) +{ + unsigned long start_pfn = section_nr_to_pfn(mem->start_section_nr); + unsigned long nr_pages = PAGES_PER_SECTION * sections_per_block; + + return offline_pages(start_pfn, nr_pages); +} + /* * MEMORY_HOTPLUG depends on SPARSEMEM in mm/Kconfig, so it is * OK to have direct references to sparsemem variables in here. */ static int -memory_block_action(unsigned long start_section_nr, unsigned long action, - int online_type, int nid) +memory_block_action(struct memory_block *mem, unsigned long action) { - unsigned long start_pfn; - unsigned long nr_pages = PAGES_PER_SECTION * sections_per_block; int ret; - start_pfn = section_nr_to_pfn(start_section_nr); - switch (action) { case MEM_ONLINE: - ret = online_pages(start_pfn, nr_pages, online_type, nid); + ret = memory_block_online(mem); break; case MEM_OFFLINE: - ret = offline_pages(start_pfn, nr_pages); + ret = memory_block_offline(mem); break; default: WARN(1, KERN_WARNING "%s(%ld, %ld) unknown action: " - "%ld\n", __func__, start_section_nr, action, action); + "%ld\n", __func__, mem->start_section_nr, action, action); ret = -EINVAL; } @@ -210,9 +221,7 @@ static int memory_block_change_state(str if (to_state == MEM_OFFLINE) mem->state = MEM_GOING_OFFLINE; - ret = memory_block_action(mem->start_section_nr, to_state, - mem->online_type, mem->nid); - + ret = memory_block_action(mem, to_state); mem->state = ret ? from_state_req : to_state; return ret; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 126/143] mm,memory_hotplug: relax fully spanned sections check 2021-05-05 1:32 incoming Andrew Morton ` (121 preceding siblings ...) 2021-05-05 1:39 ` [patch 125/143] drivers/base/memory: introduce memory_block_{online,offline} Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 127/143] mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count() Andrew Morton ` (17 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits, osalvador, pasha.tatashin, torvalds, vbabka From: Oscar Salvador <osalvador@suse.de> Subject: mm,memory_hotplug: relax fully spanned sections check We want {online,offline}_pages to operate on whole memblocks, but memmap_on_memory will poke pageblock_nr_pages aligned holes in the beginning, which is a special case we want to allow. Relax the check to account for that case. Link: https://lkml.kernel.org/r/20210421102701.25051-3-osalvador@suse.de Signed-off-by: Oscar Salvador <osalvador@suse.de> Reviewed-by: David Hildenbrand <david@redhat.com> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memory_hotplug.c | 22 ++++++++++++++++++---- 1 file changed, 18 insertions(+), 4 deletions(-) --- a/mm/memory_hotplug.c~mmmemory_hotplug-relax-fully-spanned-sections-check +++ a/mm/memory_hotplug.c @@ -838,9 +838,16 @@ int __ref online_pages(unsigned long pfn int ret; struct memory_notify arg; - /* We can only online full sections (e.g., SECTION_IS_ONLINE) */ + /* + * {on,off}lining is constrained to full memory sections (or more + * precisly to memory blocks from the user space POV). + * memmap_on_memory is an exception because it reserves initial part + * of the physical memory space for vmemmaps. That space is pageblock + * aligned. + */ if (WARN_ON_ONCE(!nr_pages || - !IS_ALIGNED(pfn | nr_pages, PAGES_PER_SECTION))) + !IS_ALIGNED(pfn, pageblock_nr_pages) || + !IS_ALIGNED(pfn + nr_pages, PAGES_PER_SECTION))) return -EINVAL; mem_hotplug_begin(); @@ -1573,9 +1580,16 @@ int __ref offline_pages(unsigned long st int ret, node; char *reason; - /* We can only offline full sections (e.g., SECTION_IS_ONLINE) */ + /* + * {on,off}lining is constrained to full memory sections (or more + * precisly to memory blocks from the user space POV). + * memmap_on_memory is an exception because it reserves initial part + * of the physical memory space for vmemmaps. That space is pageblock + * aligned. + */ if (WARN_ON_ONCE(!nr_pages || - !IS_ALIGNED(start_pfn | nr_pages, PAGES_PER_SECTION))) + !IS_ALIGNED(start_pfn, pageblock_nr_pages) || + !IS_ALIGNED(start_pfn + nr_pages, PAGES_PER_SECTION))) return -EINVAL; mem_hotplug_begin(); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 127/143] mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count() 2021-05-05 1:32 incoming Andrew Morton ` (122 preceding siblings ...) 2021-05-05 1:39 ` [patch 126/143] mm,memory_hotplug: relax fully spanned sections check Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 128/143] mm,memory_hotplug: allocate memmap from the added memory range Andrew Morton ` (16 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits, osalvador, pasha.tatashin, torvalds, vbabka From: David Hildenbrand <david@redhat.com> Subject: mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count() Let's have a single place (inspired by adjust_managed_page_count()) where we adjust present pages. In contrast to adjust_managed_page_count(), only memory onlining/offlining is allowed to modify the number of present pages. Link: https://lkml.kernel.org/r/20210421102701.25051-4-osalvador@suse.de Signed-off-by: David Hildenbrand <david@redhat.com> Signed-off-by: Oscar Salvador <osalvador@suse.de> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memory_hotplug.c | 22 ++++++++++++---------- 1 file changed, 12 insertions(+), 10 deletions(-) --- a/mm/memory_hotplug.c~mmmemory_hotplug-factor-out-adjusting-present-pages-into-adjust_present_page_count +++ a/mm/memory_hotplug.c @@ -829,6 +829,16 @@ struct zone * zone_for_pfn_range(int onl return default_zone_for_pfn(nid, start_pfn, nr_pages); } +static void adjust_present_page_count(struct zone *zone, long nr_pages) +{ + unsigned long flags; + + zone->present_pages += nr_pages; + pgdat_resize_lock(zone->zone_pgdat, &flags); + zone->zone_pgdat->node_present_pages += nr_pages; + pgdat_resize_unlock(zone->zone_pgdat, &flags); +} + int __ref online_pages(unsigned long pfn, unsigned long nr_pages, int online_type, int nid) { @@ -884,11 +894,7 @@ int __ref online_pages(unsigned long pfn } online_pages_range(pfn, nr_pages); - zone->present_pages += nr_pages; - - pgdat_resize_lock(zone->zone_pgdat, &flags); - zone->zone_pgdat->node_present_pages += nr_pages; - pgdat_resize_unlock(zone->zone_pgdat, &flags); + adjust_present_page_count(zone, nr_pages); node_states_set_node(nid, &arg); if (need_zonelists_rebuild) @@ -1706,11 +1712,7 @@ int __ref offline_pages(unsigned long st /* removal success */ adjust_managed_page_count(pfn_to_page(start_pfn), -nr_pages); - zone->present_pages -= nr_pages; - - pgdat_resize_lock(zone->zone_pgdat, &flags); - zone->zone_pgdat->node_present_pages -= nr_pages; - pgdat_resize_unlock(zone->zone_pgdat, &flags); + adjust_present_page_count(zone, -nr_pages); init_per_zone_wmark_min(); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 128/143] mm,memory_hotplug: allocate memmap from the added memory range 2021-05-05 1:32 incoming Andrew Morton ` (123 preceding siblings ...) 2021-05-05 1:39 ` [patch 127/143] mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count() Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 129/143] acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported Andrew Morton ` (15 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits, osalvador, pasha.tatashin, torvalds, vbabka From: Oscar Salvador <osalvador@suse.de> Subject: mm,memory_hotplug: allocate memmap from the added memory range Physical memory hotadd has to allocate a memmap (struct page array) for the newly added memory section. Currently, alloc_pages_node() is used for those allocations. This has some disadvantages: a) an existing memory is consumed for that purpose (eg: ~2MB per 128MB memory section on x86_64) This can even lead to extreme cases where system goes OOM because the physically hotplugged memory depletes the available memory before it is onlined. b) if the whole node is movable then we have off-node struct pages which has performance drawbacks. c) It might be there are no PMD_ALIGNED chunks so memmap array gets populated with base pages. This can be improved when CONFIG_SPARSEMEM_VMEMMAP is enabled. Vmemap page tables can map arbitrary memory. That means that we can reserve a part of the physically hotadded memory to back vmemmap page tables. This implementation uses the beginning of the hotplugged memory for that purpose. There are some non-obviously things to consider though. Vmemmap pages are allocated/freed during the memory hotplug events (add_memory_resource(), try_remove_memory()) when the memory is added/removed. This means that the reserved physical range is not online although it is used. The most obvious side effect is that pfn_to_online_page() returns NULL for those pfns. The current design expects that this should be OK as the hotplugged memory is considered a garbage until it is onlined. For example hibernation wouldn't save the content of those vmmemmaps into the image so it wouldn't be restored on resume but this should be OK as there no real content to recover anyway while metadata is reachable from other data structures (e.g. vmemmap page tables). The reserved space is therefore (de)initialized during the {on,off}line events (mhp_{de}init_memmap_on_memory). That is done by extracting page allocator independent initialization from the regular onlining path. The primary reason to handle the reserved space outside of {on,off}line_pages is to make each initialization specific to the purpose rather than special case them in a single function. As per above, the functions that are introduced are: - mhp_init_memmap_on_memory: Initializes vmemmap pages by calling move_pfn_range_to_zone(), calls kasan_add_zero_shadow(), and onlines as many sections as vmemmap pages fully span. - mhp_deinit_memmap_on_memory: Offlines as many sections as vmemmap pages fully span, removes the range from zhe zone by remove_pfn_range_from_zone(), and calls kasan_remove_zero_shadow() for the range. The new function memory_block_online() calls mhp_init_memmap_on_memory() before doing the actual online_pages(). Should online_pages() fail, we clean up by calling mhp_deinit_memmap_on_memory(). Adjusting of present_pages is done at the end once we know that online_pages() succedeed. On offline, memory_block_offline() needs to unaccount vmemmap pages from present_pages() before calling offline_pages(). This is necessary because offline_pages() tears down some structures based on the fact whether the node or the zone become empty. If offline_pages() fails, we account back vmemmap pages. If it succeeds, we call mhp_deinit_memmap_on_memory(). Hot-remove: We need to be careful when removing memory, as adding and removing memory needs to be done with the same granularity. To check that this assumption is not violated, we check the memory range we want to remove and if a) any memory block has vmemmap pages and b) the range spans more than a single memory block, we scream out loud and refuse to proceed. If all is good and the range was using memmap on memory (aka vmemmap pages), we construct an altmap structure so free_hugepage_table does the right thing and calls vmem_altmap_free instead of free_pagetable. Link: https://lkml.kernel.org/r/20210421102701.25051-5-osalvador@suse.de Signed-off-by: Oscar Salvador <osalvador@suse.de> Reviewed-by: David Hildenbrand <david@redhat.com> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/base/memory.c | 72 ++++++++++++- include/linux/memory.h | 8 + include/linux/memory_hotplug.h | 15 ++ include/linux/memremap.h | 2 include/linux/mmzone.h | 7 - mm/Kconfig | 5 mm/memory_hotplug.c | 161 +++++++++++++++++++++++++++++-- mm/sparse.c | 2 8 files changed, 250 insertions(+), 22 deletions(-) --- a/drivers/base/memory.c~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range +++ a/drivers/base/memory.c @@ -173,16 +173,73 @@ static int memory_block_online(struct me { unsigned long start_pfn = section_nr_to_pfn(mem->start_section_nr); unsigned long nr_pages = PAGES_PER_SECTION * sections_per_block; + unsigned long nr_vmemmap_pages = mem->nr_vmemmap_pages; + struct zone *zone; + int ret; + + zone = zone_for_pfn_range(mem->online_type, mem->nid, start_pfn, nr_pages); + + /* + * Although vmemmap pages have a different lifecycle than the pages + * they describe (they remain until the memory is unplugged), doing + * their initialization and accounting at memory onlining/offlining + * stage helps to keep accounting easier to follow - e.g vmemmaps + * belong to the same zone as the memory they backed. + */ + if (nr_vmemmap_pages) { + ret = mhp_init_memmap_on_memory(start_pfn, nr_vmemmap_pages, zone); + if (ret) + return ret; + } + + ret = online_pages(start_pfn + nr_vmemmap_pages, + nr_pages - nr_vmemmap_pages, zone); + if (ret) { + if (nr_vmemmap_pages) + mhp_deinit_memmap_on_memory(start_pfn, nr_vmemmap_pages); + return ret; + } + + /* + * Account once onlining succeeded. If the zone was unpopulated, it is + * now already properly populated. + */ + if (nr_vmemmap_pages) + adjust_present_page_count(zone, nr_vmemmap_pages); - return online_pages(start_pfn, nr_pages, mem->online_type, mem->nid); + return ret; } static int memory_block_offline(struct memory_block *mem) { unsigned long start_pfn = section_nr_to_pfn(mem->start_section_nr); unsigned long nr_pages = PAGES_PER_SECTION * sections_per_block; + unsigned long nr_vmemmap_pages = mem->nr_vmemmap_pages; + struct zone *zone; + int ret; + + zone = page_zone(pfn_to_page(start_pfn)); + + /* + * Unaccount before offlining, such that unpopulated zone and kthreads + * can properly be torn down in offline_pages(). + */ + if (nr_vmemmap_pages) + adjust_present_page_count(zone, -nr_vmemmap_pages); - return offline_pages(start_pfn, nr_pages); + ret = offline_pages(start_pfn + nr_vmemmap_pages, + nr_pages - nr_vmemmap_pages); + if (ret) { + /* offline_pages() failed. Account back. */ + if (nr_vmemmap_pages) + adjust_present_page_count(zone, nr_vmemmap_pages); + return ret; + } + + if (nr_vmemmap_pages) + mhp_deinit_memmap_on_memory(start_pfn, nr_vmemmap_pages); + + return ret; } /* @@ -576,7 +633,8 @@ int register_memory(struct memory_block return ret; } -static int init_memory_block(unsigned long block_id, unsigned long state) +static int init_memory_block(unsigned long block_id, unsigned long state, + unsigned long nr_vmemmap_pages) { struct memory_block *mem; int ret = 0; @@ -593,6 +651,7 @@ static int init_memory_block(unsigned lo mem->start_section_nr = block_id * sections_per_block; mem->state = state; mem->nid = NUMA_NO_NODE; + mem->nr_vmemmap_pages = nr_vmemmap_pages; ret = register_memory(mem); @@ -612,7 +671,7 @@ static int add_memory_block(unsigned lon if (section_count == 0) return 0; return init_memory_block(memory_block_id(base_section_nr), - MEM_ONLINE); + MEM_ONLINE, 0); } static void unregister_memory(struct memory_block *memory) @@ -634,7 +693,8 @@ static void unregister_memory(struct mem * * Called under device_hotplug_lock. */ -int create_memory_block_devices(unsigned long start, unsigned long size) +int create_memory_block_devices(unsigned long start, unsigned long size, + unsigned long vmemmap_pages) { const unsigned long start_block_id = pfn_to_block_id(PFN_DOWN(start)); unsigned long end_block_id = pfn_to_block_id(PFN_DOWN(start + size)); @@ -647,7 +707,7 @@ int create_memory_block_devices(unsigned return -EINVAL; for (block_id = start_block_id; block_id != end_block_id; block_id++) { - ret = init_memory_block(block_id, MEM_OFFLINE); + ret = init_memory_block(block_id, MEM_OFFLINE, vmemmap_pages); if (ret) break; } --- a/include/linux/memory.h~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range +++ a/include/linux/memory.h @@ -29,6 +29,11 @@ struct memory_block { int online_type; /* for passing data to online routine */ int nid; /* NID for this memory block */ struct device dev; + /* + * Number of vmemmap pages. These pages + * lay at the beginning of the memory block. + */ + unsigned long nr_vmemmap_pages; }; int arch_get_memory_phys_device(unsigned long start_pfn); @@ -80,7 +85,8 @@ static inline int memory_notify(unsigned #else extern int register_memory_notifier(struct notifier_block *nb); extern void unregister_memory_notifier(struct notifier_block *nb); -int create_memory_block_devices(unsigned long start, unsigned long size); +int create_memory_block_devices(unsigned long start, unsigned long size, + unsigned long vmemmap_pages); void remove_memory_block_devices(unsigned long start, unsigned long size); extern void memory_dev_init(void); extern int memory_notify(unsigned long val, void *v); --- a/include/linux/memory_hotplug.h~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range +++ a/include/linux/memory_hotplug.h @@ -56,6 +56,14 @@ typedef int __bitwise mhp_t; #define MHP_MERGE_RESOURCE ((__force mhp_t)BIT(0)) /* + * We want memmap (struct page array) to be self contained. + * To do so, we will use the beginning of the hot-added range to build + * the page tables for the memmap array that describes the entire range. + * Only selected architectures support it with SPARSE_VMEMMAP. + */ +#define MHP_MEMMAP_ON_MEMORY ((__force mhp_t)BIT(1)) + +/* * Extended parameters for memory hotplug: * altmap: alternative allocator for memmap array (optional) * pgprot: page protection flags to apply to newly created page tables @@ -99,9 +107,13 @@ static inline void zone_seqlock_init(str extern int zone_grow_free_lists(struct zone *zone, unsigned long new_nr_pages); extern int zone_grow_waitqueues(struct zone *zone, unsigned long nr_pages); extern int add_one_highpage(struct page *page, int pfn, int bad_ppro); +extern void adjust_present_page_count(struct zone *zone, long nr_pages); /* VM interface that may be used by firmware interface */ +extern int mhp_init_memmap_on_memory(unsigned long pfn, unsigned long nr_pages, + struct zone *zone); +extern void mhp_deinit_memmap_on_memory(unsigned long pfn, unsigned long nr_pages); extern int online_pages(unsigned long pfn, unsigned long nr_pages, - int online_type, int nid); + struct zone *zone); extern struct zone *test_pages_in_a_zone(unsigned long start_pfn, unsigned long end_pfn); extern void __offline_isolated_pages(unsigned long start_pfn, @@ -359,6 +371,7 @@ extern struct zone *zone_for_pfn_range(i extern int arch_create_linear_mapping(int nid, u64 start, u64 size, struct mhp_params *params); void arch_remove_linear_mapping(u64 start, u64 size); +extern bool mhp_supports_memmap_on_memory(unsigned long size); #endif /* CONFIG_MEMORY_HOTPLUG */ #endif /* __LINUX_MEMORY_HOTPLUG_H */ --- a/include/linux/memremap.h~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range +++ a/include/linux/memremap.h @@ -17,7 +17,7 @@ struct device; * @alloc: track pages consumed, private to vmemmap_populate() */ struct vmem_altmap { - const unsigned long base_pfn; + unsigned long base_pfn; const unsigned long end_pfn; const unsigned long reserve; unsigned long free; --- a/include/linux/mmzone.h~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range +++ a/include/linux/mmzone.h @@ -436,6 +436,11 @@ enum zone_type { * situations where ZERO_PAGE(0) which is allocated differently * on different platforms may end up in a movable zone. ZERO_PAGE(0) * cannot be migrated. + * 7. Memory-hotplug: when using memmap_on_memory and onlining the + * memory to the MOVABLE zone, the vmemmap pages are also placed in + * such zone. Such pages cannot be really moved around as they are + * self-stored in the range, but they are treated as movable when + * the range they describe is about to be offlined. * * In general, no unmovable allocations that degrade memory offlining * should end up in ZONE_MOVABLE. Allocators (like alloc_contig_range()) @@ -1392,10 +1397,8 @@ static inline int online_section_nr(unsi #ifdef CONFIG_MEMORY_HOTPLUG void online_mem_sections(unsigned long start_pfn, unsigned long end_pfn); -#ifdef CONFIG_MEMORY_HOTREMOVE void offline_mem_sections(unsigned long start_pfn, unsigned long end_pfn); #endif -#endif static inline struct mem_section *__pfn_to_section(unsigned long pfn) { --- a/mm/Kconfig~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range +++ a/mm/Kconfig @@ -188,6 +188,11 @@ config MEMORY_HOTREMOVE depends on MEMORY_HOTPLUG && ARCH_ENABLE_MEMORY_HOTREMOVE depends on MIGRATION +config MHP_MEMMAP_ON_MEMORY + def_bool y + depends on MEMORY_HOTPLUG && SPARSEMEM_VMEMMAP + depends on ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE + # Heavily threaded applications may benefit from splitting the mm-wide # page_table_lock, so that faults on different parts of the user address # space can be handled with less contention: split it at this NR_CPUS. --- a/mm/memory_hotplug.c~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range +++ a/mm/memory_hotplug.c @@ -42,6 +42,8 @@ #include "internal.h" #include "shuffle.h" +static bool memmap_on_memory; + /* * online_page_callback contains pointer to current page onlining function. * Initially it is generic_online_page(). If it is required it could be @@ -648,9 +650,16 @@ static void online_pages_range(unsigned * decide to not expose all pages to the buddy (e.g., expose them * later). We account all pages as being online and belonging to this * zone ("present"). + * When using memmap_on_memory, the range might not be aligned to + * MAX_ORDER_NR_PAGES - 1, but pageblock aligned. __ffs() will detect + * this and the first chunk to online will be pageblock_nr_pages. */ - for (pfn = start_pfn; pfn < end_pfn; pfn += MAX_ORDER_NR_PAGES) - (*online_page_callback)(pfn_to_page(pfn), MAX_ORDER - 1); + for (pfn = start_pfn; pfn < end_pfn;) { + int order = min(MAX_ORDER - 1UL, __ffs(pfn)); + + (*online_page_callback)(pfn_to_page(pfn), order); + pfn += (1UL << order); + } /* mark all involved sections as online */ online_mem_sections(start_pfn, end_pfn); @@ -829,7 +838,11 @@ struct zone * zone_for_pfn_range(int onl return default_zone_for_pfn(nid, start_pfn, nr_pages); } -static void adjust_present_page_count(struct zone *zone, long nr_pages) +/* + * This function should only be called by memory_block_{online,offline}, + * and {online,offline}_pages. + */ +void adjust_present_page_count(struct zone *zone, long nr_pages) { unsigned long flags; @@ -839,12 +852,54 @@ static void adjust_present_page_count(st pgdat_resize_unlock(zone->zone_pgdat, &flags); } -int __ref online_pages(unsigned long pfn, unsigned long nr_pages, - int online_type, int nid) +int mhp_init_memmap_on_memory(unsigned long pfn, unsigned long nr_pages, + struct zone *zone) +{ + unsigned long end_pfn = pfn + nr_pages; + int ret; + + ret = kasan_add_zero_shadow(__va(PFN_PHYS(pfn)), PFN_PHYS(nr_pages)); + if (ret) + return ret; + + move_pfn_range_to_zone(zone, pfn, nr_pages, NULL, MIGRATE_UNMOVABLE); + + /* + * It might be that the vmemmap_pages fully span sections. If that is + * the case, mark those sections online here as otherwise they will be + * left offline. + */ + if (nr_pages >= PAGES_PER_SECTION) + online_mem_sections(pfn, ALIGN_DOWN(end_pfn, PAGES_PER_SECTION)); + + return ret; +} + +void mhp_deinit_memmap_on_memory(unsigned long pfn, unsigned long nr_pages) +{ + unsigned long end_pfn = pfn + nr_pages; + + /* + * It might be that the vmemmap_pages fully span sections. If that is + * the case, mark those sections offline here as otherwise they will be + * left online. + */ + if (nr_pages >= PAGES_PER_SECTION) + offline_mem_sections(pfn, ALIGN_DOWN(end_pfn, PAGES_PER_SECTION)); + + /* + * The pages associated with this vmemmap have been offlined, so + * we can reset its state here. + */ + remove_pfn_range_from_zone(page_zone(pfn_to_page(pfn)), pfn, nr_pages); + kasan_remove_zero_shadow(__va(PFN_PHYS(pfn)), PFN_PHYS(nr_pages)); +} + +int __ref online_pages(unsigned long pfn, unsigned long nr_pages, struct zone *zone) { unsigned long flags; - struct zone *zone; int need_zonelists_rebuild = 0; + const int nid = zone_to_nid(zone); int ret; struct memory_notify arg; @@ -863,7 +918,6 @@ int __ref online_pages(unsigned long pfn mem_hotplug_begin(); /* associate pfn range with the zone */ - zone = zone_for_pfn_range(online_type, nid, pfn, nr_pages); move_pfn_range_to_zone(zone, pfn, nr_pages, NULL, MIGRATE_ISOLATE); arg.start_pfn = pfn; @@ -1077,6 +1131,45 @@ static int online_memory_block(struct me return device_online(&mem->dev); } +bool mhp_supports_memmap_on_memory(unsigned long size) +{ + unsigned long nr_vmemmap_pages = size / PAGE_SIZE; + unsigned long vmemmap_size = nr_vmemmap_pages * sizeof(struct page); + unsigned long remaining_size = size - vmemmap_size; + + /* + * Besides having arch support and the feature enabled at runtime, we + * need a few more assumptions to hold true: + * + * a) We span a single memory block: memory onlining/offlinin;g happens + * in memory block granularity. We don't want the vmemmap of online + * memory blocks to reside on offline memory blocks. In the future, + * we might want to support variable-sized memory blocks to make the + * feature more versatile. + * + * b) The vmemmap pages span complete PMDs: We don't want vmemmap code + * to populate memory from the altmap for unrelated parts (i.e., + * other memory blocks) + * + * c) The vmemmap pages (and thereby the pages that will be exposed to + * the buddy) have to cover full pageblocks: memory onlining/offlining + * code requires applicable ranges to be page-aligned, for example, to + * set the migratetypes properly. + * + * TODO: Although we have a check here to make sure that vmemmap pages + * fully populate a PMD, it is not the right place to check for + * this. A much better solution involves improving vmemmap code + * to fallback to base pages when trying to populate vmemmap using + * altmap as an alternative source of memory, and we do not exactly + * populate a single PMD. + */ + return memmap_on_memory && + IS_ENABLED(CONFIG_MHP_MEMMAP_ON_MEMORY) && + size == memory_block_size_bytes() && + IS_ALIGNED(vmemmap_size, PMD_SIZE) && + IS_ALIGNED(remaining_size, (pageblock_nr_pages << PAGE_SHIFT)); +} + /* * NOTE: The caller must call lock_device_hotplug() to serialize hotplug * and online/offline operations (triggered e.g. by sysfs). @@ -1086,6 +1179,7 @@ static int online_memory_block(struct me int __ref add_memory_resource(int nid, struct resource *res, mhp_t mhp_flags) { struct mhp_params params = { .pgprot = pgprot_mhp(PAGE_KERNEL) }; + struct vmem_altmap mhp_altmap = {}; u64 start, size; bool new_node = false; int ret; @@ -1112,13 +1206,26 @@ int __ref add_memory_resource(int nid, s goto error; new_node = ret; + /* + * Self hosted memmap array + */ + if (mhp_flags & MHP_MEMMAP_ON_MEMORY) { + if (!mhp_supports_memmap_on_memory(size)) { + ret = -EINVAL; + goto error; + } + mhp_altmap.free = PHYS_PFN(size); + mhp_altmap.base_pfn = PHYS_PFN(start); + params.altmap = &mhp_altmap; + } + /* call arch's memory hotadd */ ret = arch_add_memory(nid, start, size, ¶ms); if (ret < 0) goto error; /* create memory block devices after memory was added */ - ret = create_memory_block_devices(start, size); + ret = create_memory_block_devices(start, size, mhp_altmap.alloc); if (ret) { arch_remove_memory(nid, start, size, NULL); goto error; @@ -1767,6 +1874,14 @@ static int check_memblock_offlined_cb(st return 0; } +static int get_nr_vmemmap_pages_cb(struct memory_block *mem, void *arg) +{ + /* + * If not set, continue with the next block. + */ + return mem->nr_vmemmap_pages; +} + static int check_cpu_on_node(pg_data_t *pgdat) { int cpu; @@ -1841,6 +1956,9 @@ EXPORT_SYMBOL(try_offline_node); static int __ref try_remove_memory(int nid, u64 start, u64 size) { int rc = 0; + struct vmem_altmap mhp_altmap = {}; + struct vmem_altmap *altmap = NULL; + unsigned long nr_vmemmap_pages; BUG_ON(check_hotplug_memory_range(start, size)); @@ -1853,6 +1971,31 @@ static int __ref try_remove_memory(int n if (rc) return rc; + /* + * We only support removing memory added with MHP_MEMMAP_ON_MEMORY in + * the same granularity it was added - a single memory block. + */ + if (memmap_on_memory) { + nr_vmemmap_pages = walk_memory_blocks(start, size, NULL, + get_nr_vmemmap_pages_cb); + if (nr_vmemmap_pages) { + if (size != memory_block_size_bytes()) { + pr_warn("Refuse to remove %#llx - %#llx," + "wrong granularity\n", + start, start + size); + return -EINVAL; + } + + /* + * Let remove_pmd_table->free_hugepage_table do the + * right thing if we used vmem_altmap when hot-adding + * the range. + */ + mhp_altmap.alloc = nr_vmemmap_pages; + altmap = &mhp_altmap; + } + } + /* remove memmap entry */ firmware_map_remove(start, start + size, "System RAM"); @@ -1864,7 +2007,7 @@ static int __ref try_remove_memory(int n mem_hotplug_begin(); - arch_remove_memory(nid, start, size, NULL); + arch_remove_memory(nid, start, size, altmap); if (IS_ENABLED(CONFIG_ARCH_KEEP_MEMBLOCK)) { memblock_free(start, size); --- a/mm/sparse.c~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range +++ a/mm/sparse.c @@ -624,7 +624,6 @@ void online_mem_sections(unsigned long s } } -#ifdef CONFIG_MEMORY_HOTREMOVE /* Mark all memory sections within the pfn range as offline */ void offline_mem_sections(unsigned long start_pfn, unsigned long end_pfn) { @@ -645,7 +644,6 @@ void offline_mem_sections(unsigned long ms->section_mem_map &= ~SECTION_IS_ONLINE; } } -#endif #ifdef CONFIG_SPARSEMEM_VMEMMAP static struct page * __meminit populate_section_memmap(unsigned long pfn, _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 129/143] acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported 2021-05-05 1:32 incoming Andrew Morton ` (124 preceding siblings ...) 2021-05-05 1:39 ` [patch 128/143] mm,memory_hotplug: allocate memmap from the added memory range Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 130/143] mm,memory_hotplug: add kernel boot option to enable memmap_on_memory Andrew Morton ` (14 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits, osalvador, pasha.tatashin, torvalds, vbabka From: Oscar Salvador <osalvador@suse.de> Subject: acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported Let the caller check whether it can pass MHP_MEMMAP_ON_MEMORY by checking mhp_supports_memmap_on_memory(). MHP_MEMMAP_ON_MEMORY can only be set in case ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE is enabled, the architecture supports altmap, and the range to be added spans a single memory block. Link: https://lkml.kernel.org/r/20210421102701.25051-6-osalvador@suse.de Signed-off-by: Oscar Salvador <osalvador@suse.de> Reviewed-by: David Hildenbrand <david@redhat.com> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/acpi/acpi_memhotplug.c | 5 ++++- 1 file changed, 4 insertions(+), 1 deletion(-) --- a/drivers/acpi/acpi_memhotplug.c~acpimemhotplug-enable-mhp_memmap_on_memory-when-supported +++ a/drivers/acpi/acpi_memhotplug.c @@ -171,6 +171,7 @@ static int acpi_memory_enable_device(str acpi_handle handle = mem_device->device->handle; int result, num_enabled = 0; struct acpi_memory_info *info; + mhp_t mhp_flags = MHP_NONE; int node; node = acpi_get_node(handle); @@ -194,8 +195,10 @@ static int acpi_memory_enable_device(str if (node < 0) node = memory_add_physaddr_to_nid(info->start_addr); + if (mhp_supports_memmap_on_memory(info->length)) + mhp_flags |= MHP_MEMMAP_ON_MEMORY; result = __add_memory(node, info->start_addr, info->length, - MHP_NONE); + mhp_flags); /* * If the memory block has been used by the kernel, add_memory() _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 130/143] mm,memory_hotplug: add kernel boot option to enable memmap_on_memory 2021-05-05 1:32 incoming Andrew Morton ` (125 preceding siblings ...) 2021-05-05 1:39 ` [patch 129/143] acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 131/143] x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE Andrew Morton ` (13 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits, osalvador, pasha.tatashin, torvalds, vbabka From: Oscar Salvador <osalvador@suse.de> Subject: mm,memory_hotplug: add kernel boot option to enable memmap_on_memory Self stored memmap leads to a sparse memory situation which is unsuitable for workloads that requires large contiguous memory chunks, so make this an opt-in which needs to be explicitly enabled. To control this, let memory_hotplug have its own memory space, as suggested by David, so we can add memory_hotplug.memmap_on_memory parameter. Link: https://lkml.kernel.org/r/20210421102701.25051-7-osalvador@suse.de Signed-off-by: Oscar Salvador <osalvador@suse.de> Reviewed-by: David Hildenbrand <david@redhat.com> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/admin-guide/kernel-parameters.txt | 17 ++++++++++++++ mm/Makefile | 5 +++- mm/memory_hotplug.c | 10 +++++++- 3 files changed, 30 insertions(+), 2 deletions(-) --- a/Documentation/admin-guide/kernel-parameters.txt~mmmemory_hotplug-add-kernel-boot-option-to-enable-memmap_on_memory +++ a/Documentation/admin-guide/kernel-parameters.txt @@ -2801,6 +2801,23 @@ seconds. Use this parameter to check at some other rate. 0 disables periodic checking. + memory_hotplug.memmap_on_memory + [KNL,X86,ARM] Boolean flag to enable this feature. + Format: {on | off (default)} + When enabled, runtime hotplugged memory will + allocate its internal metadata (struct pages) + from the hotadded memory which will allow to + hotadd a lot of memory without requiring + additional memory to do so. + This feature is disabled by default because it + has some implication on large (e.g. GB) + allocations in some configurations (e.g. small + memory blocks). + The state of the flag can be read in + /sys/module/memory_hotplug/parameters/memmap_on_memory. + Note that even when enabled, there are a few cases where + the feature is not effective. + memtest= [KNL,X86,ARM,PPC] Enable memtest Format: <integer> default : 0 <disable> --- a/mm/Makefile~mmmemory_hotplug-add-kernel-boot-option-to-enable-memmap_on_memory +++ a/mm/Makefile @@ -58,9 +58,13 @@ obj-y := filemap.o mempool.o oom_kill. page-alloc-y := page_alloc.o page-alloc-$(CONFIG_SHUFFLE_PAGE_ALLOCATOR) += shuffle.o +# Give 'memory_hotplug' its own module-parameter namespace +memory-hotplug-$(CONFIG_MEMORY_HOTPLUG) += memory_hotplug.o + obj-y += page-alloc.o obj-y += init-mm.o obj-y += memblock.o +obj-y += $(memory-hotplug-y) ifdef CONFIG_MMU obj-$(CONFIG_ADVISE_SYSCALLS) += madvise.o @@ -83,7 +87,6 @@ obj-$(CONFIG_SLUB) += slub.o obj-$(CONFIG_KASAN) += kasan/ obj-$(CONFIG_KFENCE) += kfence/ obj-$(CONFIG_FAILSLAB) += failslab.o -obj-$(CONFIG_MEMORY_HOTPLUG) += memory_hotplug.o obj-$(CONFIG_MEMTEST) += memtest.o obj-$(CONFIG_MIGRATION) += migrate.o obj-$(CONFIG_TRANSPARENT_HUGEPAGE) += huge_memory.o khugepaged.o --- a/mm/memory_hotplug.c~mmmemory_hotplug-add-kernel-boot-option-to-enable-memmap_on_memory +++ a/mm/memory_hotplug.c @@ -42,7 +42,15 @@ #include "internal.h" #include "shuffle.h" -static bool memmap_on_memory; + +/* + * memory_hotplug.memmap_on_memory parameter + */ +static bool memmap_on_memory __ro_after_init; +#ifdef CONFIG_MHP_MEMMAP_ON_MEMORY +module_param(memmap_on_memory, bool, 0444); +MODULE_PARM_DESC(memmap_on_memory, "Enable memmap on memory for memory hotplug"); +#endif /* * online_page_callback contains pointer to current page onlining function. _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 131/143] x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE 2021-05-05 1:32 incoming Andrew Morton ` (126 preceding siblings ...) 2021-05-05 1:39 ` [patch 130/143] mm,memory_hotplug: add kernel boot option to enable memmap_on_memory Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 132/143] arm64/Kconfig: " Andrew Morton ` (12 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits, osalvador, pasha.tatashin, torvalds, vbabka From: Oscar Salvador <osalvador@suse.de> Subject: x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE Enable x86_64 platform to use the MHP_MEMMAP_ON_MEMORY feature. Link: https://lkml.kernel.org/r/20210421102701.25051-8-osalvador@suse.de Signed-off-by: Oscar Salvador <osalvador@suse.de> Reviewed-by: David Hildenbrand <david@redhat.com> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/x86/Kconfig | 3 +++ 1 file changed, 3 insertions(+) --- a/arch/x86/Kconfig~x86-kconfig-introduce-arch_mhp_memmap_on_memory_enable +++ a/arch/x86/Kconfig @@ -2432,6 +2432,9 @@ config ARCH_HAS_ADD_PAGES def_bool y depends on X86_64 && ARCH_ENABLE_MEMORY_HOTPLUG +config ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE + def_bool y + config USE_PERCPU_NUMA_NODE_ID def_bool y depends on NUMA _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 132/143] arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE 2021-05-05 1:32 incoming Andrew Morton ` (127 preceding siblings ...) 2021-05-05 1:39 ` [patch 131/143] x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:39 ` [patch 133/143] mm/zswap.c: switch from strlcpy to strscpy Andrew Morton ` (11 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits, osalvador, pasha.tatashin, torvalds, vbabka From: Oscar Salvador <osalvador@suse.de> Subject: arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE Enable arm64 platform to use the MHP_MEMMAP_ON_MEMORY feature. Link: https://lkml.kernel.org/r/20210421102701.25051-9-osalvador@suse.de Signed-off-by: Oscar Salvador <osalvador@suse.de> Reviewed-by: David Hildenbrand <david@redhat.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Michal Hocko <mhocko@suse.com> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm64/Kconfig | 3 +++ 1 file changed, 3 insertions(+) --- a/arch/arm64/Kconfig~arm64-kconfig-introduce-arch_mhp_memmap_on_memory_enable +++ a/arch/arm64/Kconfig @@ -316,6 +316,9 @@ config ZONE_DMA32 bool "Support DMA32 zone" if EXPERT default y +config ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE + def_bool y + config SMP def_bool y _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 133/143] mm/zswap.c: switch from strlcpy to strscpy 2021-05-05 1:32 incoming Andrew Morton ` (128 preceding siblings ...) 2021-05-05 1:39 ` [patch 132/143] arm64/Kconfig: " Andrew Morton @ 2021-05-05 1:39 ` Andrew Morton 2021-05-05 1:40 ` [patch 134/143] mm/zsmalloc: use BUG_ON instead of if condition followed by BUG Andrew Morton ` (10 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw) To: akpm, daizhiyuan, ddstreet, linux-mm, mm-commits, sjenning, torvalds, vitaly.wool From: Zhiyuan Dai <daizhiyuan@phytium.com.cn> Subject: mm/zswap.c: switch from strlcpy to strscpy strlcpy is marked as deprecated in Documentation/process/deprecated.rst, and there is no functional difference when the caller expects truncation (when not checking the return value). strscpy is relatively better as it also avoids scanning the whole source string. Link: https://lkml.kernel.org/r/1614227981-20367-1-git-send-email-daizhiyuan@phytium.com.cn Signed-off-by: Zhiyuan Dai <daizhiyuan@phytium.com.cn> Cc: Seth Jennings <sjenning@redhat.com> Cc: Dan Streetman <ddstreet@ieee.org> Cc: Vitaly Wool <vitaly.wool@konsulko.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/zswap.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/zswap.c~mm-zswap-switch-from-strlcpy-to-strscpy +++ a/mm/zswap.c @@ -614,7 +614,7 @@ static struct zswap_pool *zswap_pool_cre } pr_debug("using %s zpool\n", zpool_get_type(pool->zpool)); - strlcpy(pool->tfm_name, compressor, sizeof(pool->tfm_name)); + strscpy(pool->tfm_name, compressor, sizeof(pool->tfm_name)); pool->acomp_ctx = alloc_percpu(*pool->acomp_ctx); if (!pool->acomp_ctx) { _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 134/143] mm/zsmalloc: use BUG_ON instead of if condition followed by BUG. 2021-05-05 1:32 incoming Andrew Morton ` (129 preceding siblings ...) 2021-05-05 1:39 ` [patch 133/143] mm/zswap.c: switch from strlcpy to strscpy Andrew Morton @ 2021-05-05 1:40 ` Andrew Morton 2021-05-05 1:40 ` [patch 135/143] iov_iter: lift memzero_page() to highmem.h Andrew Morton ` (9 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw) To: akpm, linux-mm, minchan, mm-commits, sergey.senozhatsky.work, torvalds, zhouchuangao From: zhouchuangao <zhouchuangao@vivo.com> Subject: mm/zsmalloc: use BUG_ON instead of if condition followed by BUG. It can be optimized at compile time. Link: https://lkml.kernel.org/r/1616727798-9110-1-git-send-email-zhouchuangao@vivo.com Signed-off-by: zhouchuangao <zhouchuangao@vivo.com> Cc: Minchan Kim <minchan@kernel.org> Cc: Sergey Senozhatsky <sergey.senozhatsky.work@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/zsmalloc.c | 6 ++---- 1 file changed, 2 insertions(+), 4 deletions(-) --- a/mm/zsmalloc.c~mm-zsmalloc-use-bug_on-instead-of-if-condition-followed-by-bug +++ a/mm/zsmalloc.c @@ -1987,8 +1987,7 @@ static int zs_page_migrate(struct addres head = obj_to_head(page, addr); if (head & OBJ_ALLOCATED_TAG) { handle = head & ~OBJ_ALLOCATED_TAG; - if (!testpin_tag(handle)) - BUG(); + BUG_ON(!testpin_tag(handle)); old_obj = handle_to_obj(handle); obj_to_location(old_obj, &dummy, &obj_idx); @@ -2035,8 +2034,7 @@ unpin_objects: head = obj_to_head(page, addr); if (head & OBJ_ALLOCATED_TAG) { handle = head & ~OBJ_ALLOCATED_TAG; - if (!testpin_tag(handle)) - BUG(); + BUG_ON(!testpin_tag(handle)); unpin_tag(handle); } } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 135/143] iov_iter: lift memzero_page() to highmem.h 2021-05-05 1:32 incoming Andrew Morton ` (130 preceding siblings ...) 2021-05-05 1:40 ` [patch 134/143] mm/zsmalloc: use BUG_ON instead of if condition followed by BUG Andrew Morton @ 2021-05-05 1:40 ` Andrew Morton 2021-05-05 1:40 ` [patch 136/143] btrfs: use memzero_page() instead of open coded kmap pattern Andrew Morton ` (8 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw) To: akpm, chaitanya.kulkarni, clm, dsterba, ira.weiny, josef, linux-mm, mm-commits, torvalds, viro From: Ira Weiny <ira.weiny@intel.com> Subject: iov_iter: lift memzero_page() to highmem.h Patch series "btrfs: Convert kmap/memset/kunmap to memzero_user()". Lifting memzero_user(), convert it to kmap_local_page() and then use it in btrfs. This patch (of 3): memzero_page() can replace the kmap/memset/kunmap pattern in other places in the code. While zero_user() has the same interface it is not the same call and its use should be limited and some of those calls may be better converted from zero_user() to memzero_page().[1] But that is not addressed in this series. Lift memzero_page() to highmem. [1] https://lore.kernel.org/lkml/CAHk-=wijdojzo56FzYqE5TOYw2Vws7ik3LEMGj9SPQaJJ+Z73Q@mail.gmail.com/ Link: https://lkml.kernel.org/r/20210309212137.2610186-1-ira.weiny@intel.com Link: https://lkml.kernel.org/r/20210309212137.2610186-2-ira.weiny@intel.com Signed-off-by: Ira Weiny <ira.weiny@intel.com> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: David Sterba <dsterba@suse.com> Cc: Chris Mason <clm@fb.com> Cc: Josef Bacik <josef@toxicpanda.com> Cc: Chaitanya Kulkarni <chaitanya.kulkarni@wdc.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/highmem.h | 7 +++++++ lib/iov_iter.c | 8 +------- 2 files changed, 8 insertions(+), 7 deletions(-) --- a/include/linux/highmem.h~iov_iter-lift-memzero_page-to-highmemh +++ a/include/linux/highmem.h @@ -332,4 +332,11 @@ static inline void memcpy_to_page(struct kunmap_local(to); } +static inline void memzero_page(struct page *page, size_t offset, size_t len) +{ + char *addr = kmap_atomic(page); + memset(addr + offset, 0, len); + kunmap_atomic(addr); +} + #endif /* _LINUX_HIGHMEM_H */ --- a/lib/iov_iter.c~iov_iter-lift-memzero_page-to-highmemh +++ a/lib/iov_iter.c @@ -5,6 +5,7 @@ #include <linux/fault-inject-usercopy.h> #include <linux/uio.h> #include <linux/pagemap.h> +#include <linux/highmem.h> #include <linux/slab.h> #include <linux/vmalloc.h> #include <linux/splice.h> @@ -507,13 +508,6 @@ void iov_iter_init(struct iov_iter *i, u } EXPORT_SYMBOL(iov_iter_init); -static void memzero_page(struct page *page, size_t offset, size_t len) -{ - char *addr = kmap_atomic(page); - memset(addr + offset, 0, len); - kunmap_atomic(addr); -} - static inline bool allocated(struct pipe_buffer *buf) { return buf->ops == &default_pipe_buf_ops; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 136/143] btrfs: use memzero_page() instead of open coded kmap pattern 2021-05-05 1:32 incoming Andrew Morton ` (131 preceding siblings ...) 2021-05-05 1:40 ` [patch 135/143] iov_iter: lift memzero_page() to highmem.h Andrew Morton @ 2021-05-05 1:40 ` Andrew Morton 2021-05-05 1:40 ` [patch 137/143] mm/highmem.c: fix coding style issue Andrew Morton ` (7 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw) To: akpm, chaitanya.kulkarni, clm, dsterba, ira.weiny, josef, linux-mm, mm-commits, torvalds, viro From: Ira Weiny <ira.weiny@intel.com> Subject: btrfs: use memzero_page() instead of open coded kmap pattern There are many places where kmap/memset/kunmap patterns occur. Use the newly lifted memzero_page() to eliminate direct uses of kmap and leverage the new core functions use of kmap_local_page(). The development of this patch was aided by the following coccinelle script: // <smpl> // SPDX-License-Identifier: GPL-2.0-only // Find kmap/memset/kunmap pattern and replace with memset*page calls // // NOTE: Offsets and other expressions may be more complex than what the script // will automatically generate. Therefore a catchall rule is provided to find // the pattern which then must be evaluated by hand. // // Confidence: Low // Copyright: (C) 2021 Intel Corporation // URL: http://coccinelle.lip6.fr/ // Comments: // Options: // // Then the memset pattern // @ memset_rule1 @ expression page, V, L, Off; identifier ptr; type VP; @@ ( -VP ptr = kmap(page); | -ptr = kmap(page); | -VP ptr = kmap_atomic(page); | -ptr = kmap_atomic(page); ) <+... ( -memset(ptr, 0, L); +memzero_page(page, 0, L); | -memset(ptr + Off, 0, L); +memzero_page(page, Off, L); | -memset(ptr, V, L); +memset_page(page, V, 0, L); | -memset(ptr + Off, V, L); +memset_page(page, V, Off, L); ) ...+> ( -kunmap(page); | -kunmap_atomic(ptr); ) // Remove any pointers left unused @ depends on memset_rule1 @ identifier memset_rule1.ptr; type VP, VP1; @@ -VP ptr; ... when != ptr; ? VP1 ptr; // // Catch all // @ memset_rule2 @ expression page; identifier ptr; expression GenTo, GenSize, GenValue; type VP; @@ ( -VP ptr = kmap(page); | -ptr = kmap(page); | -VP ptr = kmap_atomic(page); | -ptr = kmap_atomic(page); ) <+... ( // // Some call sites have complex expressions within the memset/memcpy // The follow are catch alls which need to be evaluated by hand. // -memset(GenTo, 0, GenSize); +memzero_pageExtra(page, GenTo, GenSize); | -memset(GenTo, GenValue, GenSize); +memset_pageExtra(page, GenValue, GenTo, GenSize); ) ...+> ( -kunmap(page); | -kunmap_atomic(ptr); ) // Remove any pointers left unused @ depends on memset_rule2 @ identifier memset_rule2.ptr; type VP, VP1; @@ -VP ptr; ... when != ptr; ? VP1 ptr; // </smpl> Link: https://lkml.kernel.org/r/20210309212137.2610186-4-ira.weiny@intel.com Signed-off-by: Ira Weiny <ira.weiny@intel.com> Reviewed-by: David Sterba <dsterba@suse.com> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Chaitanya Kulkarni <chaitanya.kulkarni@wdc.com> Cc: Chris Mason <clm@fb.com> Cc: Josef Bacik <josef@toxicpanda.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/btrfs/compression.c | 5 +---- fs/btrfs/extent_io.c | 22 ++++------------------ fs/btrfs/inode.c | 33 ++++++++++----------------------- fs/btrfs/reflink.c | 6 +----- fs/btrfs/zlib.c | 5 +---- fs/btrfs/zstd.c | 5 +---- 6 files changed, 18 insertions(+), 58 deletions(-) --- a/fs/btrfs/compression.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern +++ a/fs/btrfs/compression.c @@ -591,16 +591,13 @@ static noinline int add_ra_bio_pages(str free_extent_map(em); if (page->index == end_index) { - char *userpage; size_t zero_offset = offset_in_page(isize); if (zero_offset) { int zeros; zeros = PAGE_SIZE - zero_offset; - userpage = kmap_atomic(page); - memset(userpage + zero_offset, 0, zeros); + memzero_page(page, zero_offset, zeros); flush_dcache_page(page); - kunmap_atomic(userpage); } } --- a/fs/btrfs/extent_io.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern +++ a/fs/btrfs/extent_io.c @@ -3421,15 +3421,12 @@ int btrfs_do_readpage(struct page *page, } if (page->index == last_byte >> PAGE_SHIFT) { - char *userpage; size_t zero_offset = offset_in_page(last_byte); if (zero_offset) { iosize = PAGE_SIZE - zero_offset; - userpage = kmap_atomic(page); - memset(userpage + zero_offset, 0, iosize); + memzero_page(page, zero_offset, iosize); flush_dcache_page(page); - kunmap_atomic(userpage); } } begin_page_read(fs_info, page); @@ -3438,14 +3435,11 @@ int btrfs_do_readpage(struct page *page, u64 disk_bytenr; if (cur >= last_byte) { - char *userpage; struct extent_state *cached = NULL; iosize = PAGE_SIZE - pg_offset; - userpage = kmap_atomic(page); - memset(userpage + pg_offset, 0, iosize); + memzero_page(page, pg_offset, iosize); flush_dcache_page(page); - kunmap_atomic(userpage); set_extent_uptodate(tree, cur, cur + iosize - 1, &cached, GFP_NOFS); unlock_extent_cached(tree, cur, @@ -3528,13 +3522,10 @@ int btrfs_do_readpage(struct page *page, /* we've found a hole, just zero and go on */ if (block_start == EXTENT_MAP_HOLE) { - char *userpage; struct extent_state *cached = NULL; - userpage = kmap_atomic(page); - memset(userpage + pg_offset, 0, iosize); + memzero_page(page, pg_offset, iosize); flush_dcache_page(page); - kunmap_atomic(userpage); set_extent_uptodate(tree, cur, cur + iosize - 1, &cached, GFP_NOFS); @@ -3845,12 +3836,7 @@ static int __extent_writepage(struct pag } if (page->index == end_index) { - char *userpage; - - userpage = kmap_atomic(page); - memset(userpage + pg_offset, 0, - PAGE_SIZE - pg_offset); - kunmap_atomic(userpage); + memzero_page(page, pg_offset, PAGE_SIZE - pg_offset); flush_dcache_page(page); } --- a/fs/btrfs/inode.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern +++ a/fs/btrfs/inode.c @@ -646,17 +646,12 @@ again: if (!ret) { unsigned long offset = offset_in_page(total_compressed); struct page *page = pages[nr_pages - 1]; - char *kaddr; /* zero the tail end of the last page, we might be * sending it down to disk */ - if (offset) { - kaddr = kmap_atomic(page); - memset(kaddr + offset, 0, - PAGE_SIZE - offset); - kunmap_atomic(kaddr); - } + if (offset) + memzero_page(page, offset, PAGE_SIZE - offset); will_compress = 1; } } @@ -4833,7 +4828,6 @@ int btrfs_truncate_block(struct btrfs_in struct btrfs_ordered_extent *ordered; struct extent_state *cached_state = NULL; struct extent_changeset *data_reserved = NULL; - char *kaddr; bool only_release_metadata = false; u32 blocksize = fs_info->sectorsize; pgoff_t index = from >> PAGE_SHIFT; @@ -4925,15 +4919,13 @@ again: if (offset != blocksize) { if (!len) len = blocksize - offset; - kaddr = kmap(page); if (front) - memset(kaddr + (block_start - page_offset(page)), - 0, offset); + memzero_page(page, (block_start - page_offset(page)), + offset); else - memset(kaddr + (block_start - page_offset(page)) + offset, - 0, len); + memzero_page(page, (block_start - page_offset(page)) + offset, + len); flush_dcache_page(page); - kunmap(page); } ClearPageChecked(page); set_page_dirty(page); @@ -6832,11 +6824,9 @@ static noinline int uncompress_inline(st * cover that region here. */ - if (max_size + pg_offset < PAGE_SIZE) { - char *map = kmap(page); - memset(map + pg_offset + max_size, 0, PAGE_SIZE - max_size - pg_offset); - kunmap(page); - } + if (max_size + pg_offset < PAGE_SIZE) + memzero_page(page, pg_offset + max_size, + PAGE_SIZE - max_size - pg_offset); kfree(tmp); return ret; } @@ -8506,7 +8496,6 @@ vm_fault_t btrfs_page_mkwrite(struct vm_ struct btrfs_ordered_extent *ordered; struct extent_state *cached_state = NULL; struct extent_changeset *data_reserved = NULL; - char *kaddr; unsigned long zero_start; loff_t size; vm_fault_t ret; @@ -8620,10 +8609,8 @@ again: zero_start = PAGE_SIZE; if (zero_start != PAGE_SIZE) { - kaddr = kmap(page); - memset(kaddr + zero_start, 0, PAGE_SIZE - zero_start); + memzero_page(page, zero_start, PAGE_SIZE - zero_start); flush_dcache_page(page); - kunmap(page); } ClearPageChecked(page); set_page_dirty(page); --- a/fs/btrfs/reflink.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern +++ a/fs/btrfs/reflink.c @@ -129,12 +129,8 @@ static int copy_inline_to_page(struct bt * So what's in the range [500, 4095] corresponds to zeroes. */ if (datal < block_size) { - char *map; - - map = kmap(page); - memset(map + datal, 0, block_size - datal); + memzero_page(page, datal, block_size - datal); flush_dcache_page(page); - kunmap(page); } SetPageUptodate(page); --- a/fs/btrfs/zlib.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern +++ a/fs/btrfs/zlib.c @@ -375,7 +375,6 @@ int zlib_decompress(struct list_head *ws unsigned long bytes_left; unsigned long total_out = 0; unsigned long pg_offset = 0; - char *kaddr; destlen = min_t(unsigned long, destlen, PAGE_SIZE); bytes_left = destlen; @@ -455,9 +454,7 @@ next: * end of the inline extent (destlen) to the end of the page */ if (pg_offset < destlen) { - kaddr = kmap_atomic(dest_page); - memset(kaddr + pg_offset, 0, destlen - pg_offset); - kunmap_atomic(kaddr); + memzero_page(dest_page, pg_offset, destlen - pg_offset); } return ret; } --- a/fs/btrfs/zstd.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern +++ a/fs/btrfs/zstd.c @@ -631,7 +631,6 @@ int zstd_decompress(struct list_head *ws size_t ret2; unsigned long total_out = 0; unsigned long pg_offset = 0; - char *kaddr; stream = ZSTD_initDStream( ZSTD_BTRFS_MAX_INPUT, workspace->mem, workspace->size); @@ -696,9 +695,7 @@ int zstd_decompress(struct list_head *ws ret = 0; finish: if (pg_offset < destlen) { - kaddr = kmap_atomic(dest_page); - memset(kaddr + pg_offset, 0, destlen - pg_offset); - kunmap_atomic(kaddr); + memzero_page(dest_page, pg_offset, destlen - pg_offset); } return ret; } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 137/143] mm/highmem.c: fix coding style issue 2021-05-05 1:32 incoming Andrew Morton ` (132 preceding siblings ...) 2021-05-05 1:40 ` [patch 136/143] btrfs: use memzero_page() instead of open coded kmap pattern Andrew Morton @ 2021-05-05 1:40 ` Andrew Morton 2021-05-05 1:40 ` [patch 138/143] mm/mempool: minor coding style tweaks Andrew Morton ` (6 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw) To: akpm, david, linux-mm, mm-commits, songqiang, torvalds From: songqiang <songqiang@uniontech.com> Subject: mm/highmem.c: fix coding style issue Delete/add some blank lines and some blank spaces Link: https://lkml.kernel.org/r/20210311095015.14277-1-songqiang@uniontech.com Signed-off-by: songqiang <songqiang@uniontech.com> Reviewed-by: David Hildenbrand <david@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/highmem.c | 11 +++++------ 1 file changed, 5 insertions(+), 6 deletions(-) --- a/mm/highmem.c~mm-highmemc-fix-coding-style-issue +++ a/mm/highmem.c @@ -104,7 +104,7 @@ static inline wait_queue_head_t *get_pkm atomic_long_t _totalhigh_pages __read_mostly; EXPORT_SYMBOL(_totalhigh_pages); -unsigned int __nr_free_highpages (void) +unsigned int __nr_free_highpages(void) { struct zone *zone; unsigned int pages = 0; @@ -120,7 +120,7 @@ unsigned int __nr_free_highpages (void) static int pkmap_count[LAST_PKMAP]; static __cacheline_aligned_in_smp DEFINE_SPINLOCK(kmap_lock); -pte_t * pkmap_page_table; +pte_t *pkmap_page_table; /* * Most architectures have no use for kmap_high_get(), so let's abstract @@ -147,6 +147,7 @@ struct page *__kmap_to_page(void *vaddr) if (addr >= PKMAP_ADDR(0) && addr < PKMAP_ADDR(LAST_PKMAP)) { int i = PKMAP_NR(addr); + return pte_page(pkmap_page_table[i]); } @@ -278,9 +279,8 @@ void *kmap_high(struct page *page) pkmap_count[PKMAP_NR(vaddr)]++; BUG_ON(pkmap_count[PKMAP_NR(vaddr)] < 2); unlock_kmap(); - return (void*) vaddr; + return (void *) vaddr; } - EXPORT_SYMBOL(kmap_high); #ifdef ARCH_NEEDS_KMAP_HIGH_GET @@ -305,7 +305,7 @@ void *kmap_high_get(struct page *page) pkmap_count[PKMAP_NR(vaddr)]++; } unlock_kmap_any(flags); - return (void*) vaddr; + return (void *) vaddr; } #endif @@ -737,7 +737,6 @@ done: spin_unlock_irqrestore(&pas->lock, flags); return ret; } - EXPORT_SYMBOL(page_address); /** _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 138/143] mm/mempool: minor coding style tweaks 2021-05-05 1:32 incoming Andrew Morton ` (133 preceding siblings ...) 2021-05-05 1:40 ` [patch 137/143] mm/highmem.c: fix coding style issue Andrew Morton @ 2021-05-05 1:40 ` Andrew Morton 2021-05-05 1:40 ` [patch 139/143] mm/process_vm_access.c: remove duplicate include Andrew Morton ` (5 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw) To: akpm, daizhiyuan, linux-mm, mm-commits, torvalds From: Zhiyuan Dai <daizhiyuan@phytium.com.cn> Subject: mm/mempool: minor coding style tweaks Various coding style tweaks to various files under mm/ [daizhiyuan@phytium.com.cn: mm/swapfile: minor coding style tweaks] Link: https://lkml.kernel.org/r/1614223624-16055-1-git-send-email-daizhiyuan@phytium.com.cn [daizhiyuan@phytium.com.cn: mm/sparse: minor coding style tweaks] Link: https://lkml.kernel.org/r/1614227288-19363-1-git-send-email-daizhiyuan@phytium.com.cn [daizhiyuan@phytium.com.cn: mm/vmscan: minor coding style tweaks] Link: https://lkml.kernel.org/r/1614227649-19853-1-git-send-email-daizhiyuan@phytium.com.cn [daizhiyuan@phytium.com.cn: mm/compaction: minor coding style tweaks] Link: https://lkml.kernel.org/r/1614228218-20770-1-git-send-email-daizhiyuan@phytium.com.cn [daizhiyuan@phytium.com.cn: mm/oom_kill: minor coding style tweaks] Link: https://lkml.kernel.org/r/1614228360-21168-1-git-send-email-daizhiyuan@phytium.com.cn [daizhiyuan@phytium.com.cn: mm/shmem: minor coding style tweaks] Link: https://lkml.kernel.org/r/1614228504-21491-1-git-send-email-daizhiyuan@phytium.com.cn [daizhiyuan@phytium.com.cn: mm/page_alloc: minor coding style tweaks] Link: https://lkml.kernel.org/r/1614228613-21754-1-git-send-email-daizhiyuan@phytium.com.cn [daizhiyuan@phytium.com.cn: mm/filemap: minor coding style tweaks] Link: https://lkml.kernel.org/r/1614228936-22337-1-git-send-email-daizhiyuan@phytium.com.cn [daizhiyuan@phytium.com.cn: mm/mlock: minor coding style tweaks] Link: https://lkml.kernel.org/r/1613956588-2453-1-git-send-email-daizhiyuan@phytium.com.cn [daizhiyuan@phytium.com.cn: mm/frontswap: minor coding style tweaks] Link: https://lkml.kernel.org/r/1613962668-15045-1-git-send-email-daizhiyuan@phytium.com.cn [daizhiyuan@phytium.com.cn: mm/vmalloc: minor coding style tweaks] Link: https://lkml.kernel.org/r/1613963379-15988-1-git-send-email-daizhiyuan@phytium.com.cn [daizhiyuan@phytium.com.cn: mm/memory_hotplug: minor coding style tweaks] Link: https://lkml.kernel.org/r/1613971784-24878-1-git-send-email-daizhiyuan@phytium.com.cn [daizhiyuan@phytium.com.cn: mm/mempolicy: minor coding style tweaks] Link: https://lkml.kernel.org/r/1613972228-25501-1-git-send-email-daizhiyuan@phytium.com.cn Link: https://lkml.kernel.org/r/1614222374-13805-1-git-send-email-daizhiyuan@phytium.com.cn Signed-off-by: Zhiyuan Dai <daizhiyuan@phytium.com.cn> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/compaction.c | 2 +- mm/filemap.c | 8 ++++---- mm/frontswap.c | 12 ++++++++---- mm/memory_hotplug.c | 2 +- mm/mempolicy.c | 4 ++-- mm/mempool.c | 2 +- mm/mlock.c | 4 ++-- mm/oom_kill.c | 2 +- mm/page_alloc.c | 2 +- mm/shmem.c | 2 +- mm/sparse.c | 2 +- mm/swapfile.c | 4 ++-- mm/vmalloc.c | 2 +- mm/vmscan.c | 2 +- 14 files changed, 27 insertions(+), 23 deletions(-) --- a/mm/compaction.c~mm-mempool-minor-coding-style-tweaks +++ a/mm/compaction.c @@ -2885,7 +2885,7 @@ void wakeup_kcompactd(pg_data_t *pgdat, */ static int kcompactd(void *p) { - pg_data_t *pgdat = (pg_data_t*)p; + pg_data_t *pgdat = (pg_data_t *)p; struct task_struct *tsk = current; unsigned int proactive_defer = 0; --- a/mm/filemap.c~mm-mempool-minor-coding-style-tweaks +++ a/mm/filemap.c @@ -3267,7 +3267,7 @@ const struct vm_operations_struct generi /* This is used for a general mmap of a disk file */ -int generic_file_mmap(struct file * file, struct vm_area_struct * vma) +int generic_file_mmap(struct file *file, struct vm_area_struct *vma) { struct address_space *mapping = file->f_mapping; @@ -3292,11 +3292,11 @@ vm_fault_t filemap_page_mkwrite(struct v { return VM_FAULT_SIGBUS; } -int generic_file_mmap(struct file * file, struct vm_area_struct * vma) +int generic_file_mmap(struct file *file, struct vm_area_struct *vma) { return -ENOSYS; } -int generic_file_readonly_mmap(struct file * file, struct vm_area_struct * vma) +int generic_file_readonly_mmap(struct file *file, struct vm_area_struct *vma) { return -ENOSYS; } @@ -3724,7 +3724,7 @@ EXPORT_SYMBOL(generic_perform_write); ssize_t __generic_file_write_iter(struct kiocb *iocb, struct iov_iter *from) { struct file *file = iocb->ki_filp; - struct address_space * mapping = file->f_mapping; + struct address_space *mapping = file->f_mapping; struct inode *inode = mapping->host; ssize_t written = 0; ssize_t err; --- a/mm/frontswap.c~mm-mempool-minor-coding-style-tweaks +++ a/mm/frontswap.c @@ -60,16 +60,20 @@ static u64 frontswap_succ_stores; static u64 frontswap_failed_stores; static u64 frontswap_invalidates; -static inline void inc_frontswap_loads(void) { +static inline void inc_frontswap_loads(void) +{ data_race(frontswap_loads++); } -static inline void inc_frontswap_succ_stores(void) { +static inline void inc_frontswap_succ_stores(void) +{ data_race(frontswap_succ_stores++); } -static inline void inc_frontswap_failed_stores(void) { +static inline void inc_frontswap_failed_stores(void) +{ data_race(frontswap_failed_stores++); } -static inline void inc_frontswap_invalidates(void) { +static inline void inc_frontswap_invalidates(void) +{ data_race(frontswap_invalidates++); } #else --- a/mm/memory_hotplug.c~mm-mempool-minor-coding-style-tweaks +++ a/mm/memory_hotplug.c @@ -834,7 +834,7 @@ static inline struct zone *default_zone_ return movable_node_enabled ? movable_zone : kernel_zone; } -struct zone * zone_for_pfn_range(int online_type, int nid, unsigned start_pfn, +struct zone *zone_for_pfn_range(int online_type, int nid, unsigned start_pfn, unsigned long nr_pages) { if (online_type == MMOP_ONLINE_KERNEL) --- a/mm/mempolicy.c~mm-mempool-minor-coding-style-tweaks +++ a/mm/mempolicy.c @@ -330,7 +330,7 @@ static void mpol_rebind_nodemask(struct else if (pol->flags & MPOL_F_RELATIVE_NODES) mpol_relative_nodemask(&tmp, &pol->w.user_nodemask, nodes); else { - nodes_remap(tmp, pol->v.nodes,pol->w.cpuset_mems_allowed, + nodes_remap(tmp, pol->v.nodes, pol->w.cpuset_mems_allowed, *nodes); pol->w.cpuset_mems_allowed = *nodes; } @@ -1161,7 +1161,7 @@ int do_migrate_pages(struct mm_struct *m tmp = *from; while (!nodes_empty(tmp)) { - int s,d; + int s, d; int source = NUMA_NO_NODE; int dest = 0; --- a/mm/mempool.c~mm-mempool-minor-coding-style-tweaks +++ a/mm/mempool.c @@ -251,7 +251,7 @@ EXPORT_SYMBOL(mempool_init); mempool_t *mempool_create(int min_nr, mempool_alloc_t *alloc_fn, mempool_free_t *free_fn, void *pool_data) { - return mempool_create_node(min_nr,alloc_fn,free_fn, pool_data, + return mempool_create_node(min_nr, alloc_fn, free_fn, pool_data, GFP_KERNEL, NUMA_NO_NODE); } EXPORT_SYMBOL(mempool_create); --- a/mm/mlock.c~mm-mempool-minor-coding-style-tweaks +++ a/mm/mlock.c @@ -559,7 +559,7 @@ static int apply_vma_lock_flags(unsigned vm_flags_t flags) { unsigned long nstart, end, tmp; - struct vm_area_struct * vma, * prev; + struct vm_area_struct *vma, *prev; int error; VM_BUG_ON(offset_in_page(start)); @@ -737,7 +737,7 @@ SYSCALL_DEFINE2(munlock, unsigned long, */ static int apply_mlockall_flags(int flags) { - struct vm_area_struct * vma, * prev = NULL; + struct vm_area_struct *vma, *prev = NULL; vm_flags_t to_add = 0; current->mm->def_flags &= VM_LOCKED_CLEAR_MASK; --- a/mm/oom_kill.c~mm-mempool-minor-coding-style-tweaks +++ a/mm/oom_kill.c @@ -993,7 +993,7 @@ static void oom_kill_process(struct oom_ if (oom_group) { mem_cgroup_print_oom_group(oom_group); mem_cgroup_scan_tasks(oom_group, oom_kill_memcg_member, - (void*)message); + (void *)message); mem_cgroup_put(oom_group); } } --- a/mm/page_alloc.c~mm-mempool-minor-coding-style-tweaks +++ a/mm/page_alloc.c @@ -8808,7 +8808,7 @@ int alloc_contig_range(unsigned long sta ret = __alloc_contig_migrate_range(&cc, start, end); if (ret && ret != -EBUSY) goto done; - ret =0; + ret = 0; /* * Pages from [start, end) are within a MAX_ORDER_NR_PAGES --- a/mm/shmem.c~mm-mempool-minor-coding-style-tweaks +++ a/mm/shmem.c @@ -3508,7 +3508,7 @@ static int shmem_parse_options(struct fs } } if (*this_char) { - char *value = strchr(this_char,'='); + char *value = strchr(this_char, '='); size_t len = 0; int err; --- a/mm/sparse.c~mm-mempool-minor-coding-style-tweaks +++ a/mm/sparse.c @@ -257,7 +257,7 @@ static void __init memory_present(int ni if (unlikely(!mem_section)) { unsigned long size, align; - size = sizeof(struct mem_section*) * NR_SECTION_ROOTS; + size = sizeof(struct mem_section *) * NR_SECTION_ROOTS; align = 1 << (INTERNODE_CACHE_SHIFT); mem_section = memblock_alloc(size, align); if (!mem_section) --- a/mm/swapfile.c~mm-mempool-minor-coding-style-tweaks +++ a/mm/swapfile.c @@ -2780,7 +2780,7 @@ static int swap_show(struct seq_file *sw unsigned int bytes, inuse; if (si == SEQ_START_TOKEN) { - seq_puts(swap,"Filename\t\t\t\tType\t\tSize\t\tUsed\t\tPriority\n"); + seq_puts(swap, "Filename\t\t\t\tType\t\tSize\t\tUsed\t\tPriority\n"); return 0; } @@ -3284,7 +3284,7 @@ SYSCALL_DEFINE2(swapon, const char __use sizeof(long), GFP_KERNEL); - if (p->bdev &&(swap_flags & SWAP_FLAG_DISCARD) && swap_discardable(p)) { + if (p->bdev && (swap_flags & SWAP_FLAG_DISCARD) && swap_discardable(p)) { /* * When discard is enabled for swap with no particular * policy flagged, we set all swap discard flags here in --- a/mm/vmalloc.c~mm-mempool-minor-coding-style-tweaks +++ a/mm/vmalloc.c @@ -3083,7 +3083,7 @@ EXPORT_SYMBOL(vzalloc_node); * 64b systems should always have either DMA or DMA32 zones. For others * GFP_DMA32 should do the right thing and use the normal zone. */ -#define GFP_VMALLOC32 GFP_DMA32 | GFP_KERNEL +#define GFP_VMALLOC32 (GFP_DMA32 | GFP_KERNEL) #endif /** --- a/mm/vmscan.c~mm-mempool-minor-coding-style-tweaks +++ a/mm/vmscan.c @@ -4059,7 +4059,7 @@ static int kswapd(void *p) { unsigned int alloc_order, reclaim_order; unsigned int highest_zoneidx = MAX_NR_ZONES - 1; - pg_data_t *pgdat = (pg_data_t*)p; + pg_data_t *pgdat = (pg_data_t *)p; struct task_struct *tsk = current; const struct cpumask *cpumask = cpumask_of_node(pgdat->node_id); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 139/143] mm/process_vm_access.c: remove duplicate include 2021-05-05 1:32 incoming Andrew Morton ` (134 preceding siblings ...) 2021-05-05 1:40 ` [patch 138/143] mm/mempool: minor coding style tweaks Andrew Morton @ 2021-05-05 1:40 ` Andrew Morton 2021-05-05 1:40 ` [patch 140/143] kfence: zero guard page after out-of-bounds access Andrew Morton ` (4 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, torvalds, zhang.yunkai From: Zhang Yunkai <zhang.yunkai@zte.com.cn> Subject: mm/process_vm_access.c: remove duplicate include 'linux/compat.h' included in 'process_vm_access.c' is duplicated. Link: https://lkml.kernel.org/r/20210306132122.220431-1-zhang.yunkai@zte.com.cn Signed-off-by: Zhang Yunkai <zhang.yunkai@zte.com.cn> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/process_vm_access.c | 1 - 1 file changed, 1 deletion(-) --- a/mm/process_vm_access.c~mm-process_vm_access-remove-duplicate-include +++ a/mm/process_vm_access.c @@ -9,7 +9,6 @@ #include <linux/mm.h> #include <linux/uio.h> #include <linux/sched.h> -#include <linux/compat.h> #include <linux/sched/mm.h> #include <linux/highmem.h> #include <linux/ptrace.h> _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 140/143] kfence: zero guard page after out-of-bounds access 2021-05-05 1:32 incoming Andrew Morton ` (135 preceding siblings ...) 2021-05-05 1:40 ` [patch 139/143] mm/process_vm_access.c: remove duplicate include Andrew Morton @ 2021-05-05 1:40 ` Andrew Morton 2021-05-05 1:40 ` [patch 141/143] kfence: await for allocation using wait_event Andrew Morton ` (3 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw) To: akpm, andreyknvl, dvyukov, elver, glider, jannh, linux-mm, mm-commits, torvalds From: Marco Elver <elver@google.com> Subject: kfence: zero guard page after out-of-bounds access After an out-of-bounds accesses, zero the guard page before re-protecting in kfence_guarded_free(). On one hand this helps make the failure mode of subsequent out-of-bounds accesses more deterministic, but could also prevent certain information leaks. Link: https://lkml.kernel.org/r/20210312121653.348518-1-elver@google.com Signed-off-by: Marco Elver <elver@google.com> Acked-by: Alexander Potapenko <glider@google.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Andrey Konovalov <andreyknvl@google.com> Cc: Jann Horn <jannh@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kfence/core.c | 1 + 1 file changed, 1 insertion(+) --- a/mm/kfence/core.c~kfence-zero-guard-page-after-out-of-bounds-access +++ a/mm/kfence/core.c @@ -372,6 +372,7 @@ static void kfence_guarded_free(void *ad /* Restore page protection if there was an OOB access. */ if (meta->unprotected_page) { + memzero_explicit((void *)ALIGN_DOWN(meta->unprotected_page, PAGE_SIZE), PAGE_SIZE); kfence_protect(meta->unprotected_page); meta->unprotected_page = 0; } _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 141/143] kfence: await for allocation using wait_event 2021-05-05 1:32 incoming Andrew Morton ` (136 preceding siblings ...) 2021-05-05 1:40 ` [patch 140/143] kfence: zero guard page after out-of-bounds access Andrew Morton @ 2021-05-05 1:40 ` Andrew Morton 2021-05-05 1:40 ` [patch 142/143] kfence: maximize allocation wait timeout duration Andrew Morton ` (2 subsequent siblings) 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw) To: akpm, dvyukov, elver, glider, hdanton, jannh, linux-mm, mark.rutland, mm-commits, torvalds From: Marco Elver <elver@google.com> Subject: kfence: await for allocation using wait_event Patch series "kfence: optimize timer scheduling", v2. We have observed that mostly-idle systems with KFENCE enabled wake up otherwise idle CPUs, preventing such to enter a lower power state. Debugging revealed that KFENCE spends too much active time in toggle_allocation_gate(). While the first version of KFENCE was using all the right bits to be scheduling optimal, and thus power efficient, by simply using wait_event() + wake_up(), that code was unfortunately removed. As KFENCE was exposed to various different configs and tests, the scheduling optimal code slowly disappeared. First because of hung task warnings, and finally because of deadlocks when an allocation is made by timer code with debug objects enabled. Clearly, the "fixes" were not too friendly for devices that want to be power efficient. Therefore, let's try a little harder to fix the hung task and deadlock problems that we have with wait_event() + wake_up(), while remaining as scheduling friendly and power efficient as possible. Crucially, we need to defer the wake_up() to an irq_work, avoiding any potential for deadlock. The result with this series is that on the devices where we observed a power regression, power usage returns back to baseline levels. This patch (of 3): On mostly-idle systems, we have observed that toggle_allocation_gate() is a cause of frequent wake-ups, preventing an otherwise idle CPU to go into a lower power state. A late change in KFENCE's development, due to a potential deadlock [1], required changing the scheduling-friendly wait_event_timeout() and wake_up() to an open-coded wait-loop using schedule_timeout(). [1] https://lkml.kernel.org/r/000000000000c0645805b7f982e4@google.com To avoid unnecessary wake-ups, switch to using wait_event_timeout(). Unfortunately, we still cannot use a version with direct wake_up() in __kfence_alloc() due to the same potential for deadlock as in [1]. Instead, add a level of indirection via an irq_work that is scheduled if we determine that the kfence_timer requires a wake_up(). Link: https://lkml.kernel.org/r/20210421105132.3965998-1-elver@google.com Link: https://lkml.kernel.org/r/20210421105132.3965998-2-elver@google.com Fixes: 0ce20dd84089 ("mm: add Kernel Electric-Fence infrastructure") Signed-off-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Jann Horn <jannh@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Hillf Danton <hdanton@sina.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- lib/Kconfig.kfence | 1 + mm/kfence/core.c | 43 ++++++++++++++++++++++++++++--------------- 2 files changed, 29 insertions(+), 15 deletions(-) --- a/lib/Kconfig.kfence~kfence-await-for-allocation-using-wait_event +++ a/lib/Kconfig.kfence @@ -7,6 +7,7 @@ menuconfig KFENCE bool "KFENCE: low-overhead sampling-based memory safety error detector" depends on HAVE_ARCH_KFENCE && (SLAB || SLUB) select STACKTRACE + select IRQ_WORK help KFENCE is a low-overhead sampling-based detector of heap out-of-bounds access, use-after-free, and invalid-free errors. KFENCE is designed --- a/mm/kfence/core.c~kfence-await-for-allocation-using-wait_event +++ a/mm/kfence/core.c @@ -10,6 +10,7 @@ #include <linux/atomic.h> #include <linux/bug.h> #include <linux/debugfs.h> +#include <linux/irq_work.h> #include <linux/kcsan-checks.h> #include <linux/kfence.h> #include <linux/kmemleak.h> @@ -587,6 +588,17 @@ late_initcall(kfence_debugfs_init); /* === Allocation Gate Timer ================================================ */ +#ifdef CONFIG_KFENCE_STATIC_KEYS +/* Wait queue to wake up allocation-gate timer task. */ +static DECLARE_WAIT_QUEUE_HEAD(allocation_wait); + +static void wake_up_kfence_timer(struct irq_work *work) +{ + wake_up(&allocation_wait); +} +static DEFINE_IRQ_WORK(wake_up_kfence_timer_work, wake_up_kfence_timer); +#endif + /* * Set up delayed work, which will enable and disable the static key. We need to * use a work queue (rather than a simple timer), since enabling and disabling a @@ -604,25 +616,13 @@ static void toggle_allocation_gate(struc if (!READ_ONCE(kfence_enabled)) return; - /* Enable static key, and await allocation to happen. */ atomic_set(&kfence_allocation_gate, 0); #ifdef CONFIG_KFENCE_STATIC_KEYS + /* Enable static key, and await allocation to happen. */ static_branch_enable(&kfence_allocation_key); - /* - * Await an allocation. Timeout after 1 second, in case the kernel stops - * doing allocations, to avoid stalling this worker task for too long. - */ - { - unsigned long end_wait = jiffies + HZ; - do { - set_current_state(TASK_UNINTERRUPTIBLE); - if (atomic_read(&kfence_allocation_gate) != 0) - break; - schedule_timeout(1); - } while (time_before(jiffies, end_wait)); - __set_current_state(TASK_RUNNING); - } + wait_event_timeout(allocation_wait, atomic_read(&kfence_allocation_gate), HZ); + /* Disable static key and reset timer. */ static_branch_disable(&kfence_allocation_key); #endif @@ -729,6 +729,19 @@ void *__kfence_alloc(struct kmem_cache * */ if (atomic_read(&kfence_allocation_gate) || atomic_inc_return(&kfence_allocation_gate) > 1) return NULL; +#ifdef CONFIG_KFENCE_STATIC_KEYS + /* + * waitqueue_active() is fully ordered after the update of + * kfence_allocation_gate per atomic_inc_return(). + */ + if (waitqueue_active(&allocation_wait)) { + /* + * Calling wake_up() here may deadlock when allocations happen + * from within timer code. Use an irq_work to defer it. + */ + irq_work_queue(&wake_up_kfence_timer_work); + } +#endif if (!READ_ONCE(kfence_enabled)) return NULL; _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 142/143] kfence: maximize allocation wait timeout duration 2021-05-05 1:32 incoming Andrew Morton ` (137 preceding siblings ...) 2021-05-05 1:40 ` [patch 141/143] kfence: await for allocation using wait_event Andrew Morton @ 2021-05-05 1:40 ` Andrew Morton 2021-05-05 1:40 ` [patch 143/143] kfence: use power-efficient work queue to run delayed work Andrew Morton 2021-05-05 1:47 ` incoming Linus Torvalds 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw) To: akpm, dvyukov, elver, glider, hdanton, jannh, linux-mm, mark.rutland, mm-commits, torvalds From: Marco Elver <elver@google.com> Subject: kfence: maximize allocation wait timeout duration The allocation wait timeout was initially added because of warnings due to CONFIG_DETECT_HUNG_TASK=y [1]. While the 1 sec timeout is sufficient to resolve the warnings (given the hung task timeout must be 1 sec or larger) it may cause unnecessary wake-ups if the system is idle. [1] https://lkml.kernel.org/r/CADYN=9J0DQhizAGB0-jz4HOBBh+05kMBXb4c0cXMS7Qi5NAJiw@mail.gmail.com Fix it by computing the timeout duration in terms of the current sysctl_hung_task_timeout_secs value. Link: https://lkml.kernel.org/r/20210421105132.3965998-3-elver@google.com Signed-off-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Hillf Danton <hdanton@sina.com> Cc: Jann Horn <jannh@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kfence/core.c | 12 +++++++++++- 1 file changed, 11 insertions(+), 1 deletion(-) --- a/mm/kfence/core.c~kfence-maximize-allocation-wait-timeout-duration +++ a/mm/kfence/core.c @@ -20,6 +20,7 @@ #include <linux/moduleparam.h> #include <linux/random.h> #include <linux/rcupdate.h> +#include <linux/sched/sysctl.h> #include <linux/seq_file.h> #include <linux/slab.h> #include <linux/spinlock.h> @@ -621,7 +622,16 @@ static void toggle_allocation_gate(struc /* Enable static key, and await allocation to happen. */ static_branch_enable(&kfence_allocation_key); - wait_event_timeout(allocation_wait, atomic_read(&kfence_allocation_gate), HZ); + if (sysctl_hung_task_timeout_secs) { + /* + * During low activity with no allocations we might wait a + * while; let's avoid the hung task warning. + */ + wait_event_timeout(allocation_wait, atomic_read(&kfence_allocation_gate), + sysctl_hung_task_timeout_secs * HZ / 2); + } else { + wait_event(allocation_wait, atomic_read(&kfence_allocation_gate)); + } /* Disable static key and reset timer. */ static_branch_disable(&kfence_allocation_key); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 143/143] kfence: use power-efficient work queue to run delayed work 2021-05-05 1:32 incoming Andrew Morton ` (138 preceding siblings ...) 2021-05-05 1:40 ` [patch 142/143] kfence: maximize allocation wait timeout duration Andrew Morton @ 2021-05-05 1:40 ` Andrew Morton 2021-05-05 1:47 ` incoming Linus Torvalds 140 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw) To: akpm, dvyukov, elver, glider, hdanton, jannh, linux-mm, mark.rutland, mm-commits, torvalds From: Marco Elver <elver@google.com> Subject: kfence: use power-efficient work queue to run delayed work Use the power-efficient work queue, to avoid the pathological case where we keep pinning ourselves on the same possibly idle CPU on systems that want to be power-efficient (https://lwn.net/Articles/731052/). Link: https://lkml.kernel.org/r/20210421105132.3965998-4-elver@google.com Signed-off-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Hillf Danton <hdanton@sina.com> Cc: Jann Horn <jannh@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kfence/core.c | 5 +++-- 1 file changed, 3 insertions(+), 2 deletions(-) --- a/mm/kfence/core.c~kfence-use-power-efficient-work-queue-to-run-delayed-work +++ a/mm/kfence/core.c @@ -636,7 +636,8 @@ static void toggle_allocation_gate(struc /* Disable static key and reset timer. */ static_branch_disable(&kfence_allocation_key); #endif - schedule_delayed_work(&kfence_timer, msecs_to_jiffies(kfence_sample_interval)); + queue_delayed_work(system_power_efficient_wq, &kfence_timer, + msecs_to_jiffies(kfence_sample_interval)); } static DECLARE_DELAYED_WORK(kfence_timer, toggle_allocation_gate); @@ -665,7 +666,7 @@ void __init kfence_init(void) } WRITE_ONCE(kfence_enabled, true); - schedule_delayed_work(&kfence_timer, 0); + queue_delayed_work(system_power_efficient_wq, &kfence_timer, 0); pr_info("initialized - using %lu bytes for %d objects at 0x%p-0x%p\n", KFENCE_POOL_SIZE, CONFIG_KFENCE_NUM_OBJECTS, (void *)__kfence_pool, (void *)(__kfence_pool + KFENCE_POOL_SIZE)); _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-05-05 1:32 incoming Andrew Morton ` (139 preceding siblings ...) 2021-05-05 1:40 ` [patch 143/143] kfence: use power-efficient work queue to run delayed work Andrew Morton @ 2021-05-05 1:47 ` Linus Torvalds 2021-05-05 3:16 ` incoming Andrew Morton 140 siblings, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2021-05-05 1:47 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 143 patches Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing. Maybe just some mail delay? But at least right now https://lore.kernel.org/mm-commits/ doesn't show them (and thus 'b4' doesn't work). I'll check again later. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-05-05 1:47 ` incoming Linus Torvalds @ 2021-05-05 3:16 ` Andrew Morton 2021-05-05 17:10 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2021-05-05 3:16 UTC (permalink / raw) To: Linus Torvalds; +Cc: Linux-MM, mm-commits On Tue, 4 May 2021 18:47:19 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > 143 patches > > Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing. > > Maybe just some mail delay? But at least right now > > https://lore.kernel.org/mm-commits/ > > doesn't show them (and thus 'b4' doesn't work). > > I'll check again later. > Well that's strange. I see all three via cc:me, but not on linux-mm or mm-commits. Let me resend right now with the same in-reply-to. Hopefully they will land in the correct place. ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-05-05 3:16 ` incoming Andrew Morton @ 2021-05-05 17:10 ` Linus Torvalds 2021-05-05 17:44 ` incoming Andrew Morton 0 siblings, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2021-05-05 17:10 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > Let me resend right now with the same in-reply-to. Hopefully they will > land in the correct place. Well, you re-sent it twice, and I have three copies in my own mailbox, bot they still don't show up on the mm-commits mailing list. So the list hates them for some odd reason. I've picked them up locally, but adding Konstantin to the participants to see if he can see what's up. Konstantin: patches 103/106/107 are missing on lore out of Andrew's series of 143. Odd. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-05-05 17:10 ` incoming Linus Torvalds @ 2021-05-05 17:44 ` Andrew Morton 2021-05-06 3:19 ` incoming Anshuman Khandual 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2021-05-05 17:44 UTC (permalink / raw) To: Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits [-- Attachment #1: Type: text/plain, Size: 1387 bytes --] On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > Let me resend right now with the same in-reply-to. Hopefully they will > > land in the correct place. > > Well, you re-sent it twice, and I have three copies in my own mailbox, > bot they still don't show up on the mm-commits mailing list. > > So the list hates them for some odd reason. > > I've picked them up locally, but adding Konstantin to the participants > to see if he can see what's up. > > Konstantin: patches 103/106/107 are missing on lore out of Andrew's > series of 143. Odd. It's weird. They don't turn up on linux-mm either, and that's running at kvack.org, also majordomo. They don't get through when sent with either heirloom-mailx or with sylpheed. Also, it seems that when Anshuman originally sent the patch, linux-mm and linux-kernel didn't send it back out. So perhaps a spam filter triggered? I'm seeing https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/ which is via linux-arm-kernel@lists.infradead.org but the linux-kernel server massacred that patch series. Searching https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7 email series. One of the emails (as sent my me) is attached, if that helps. [-- Attachment #2: x.txt --] [-- Type: text/plain, Size: 21048 bytes --] Return-Path: <akpm@linux-foundation.org> X-Spam-Checker-Version: SpamAssassin 3.4.1 (2015-04-28) on y X-Spam-Level: (none) X-Spam-Status: No, score=-101.5 required=2.5 tests=BAYES_00,T_DKIM_INVALID, USER_IN_WHITELIST autolearn=ham autolearn_force=no version=3.4.1 Received: from localhost.localdomain (localhost.localdomain [127.0.0.1]) by localhost.localdomain (8.15.2/8.15.2/Debian-8ubuntu1) with ESMTP id 1453H2fk032202 for <akpm@localhost>; Tue, 4 May 2021 20:17:03 -0700 Received: from imap.fastmail.com [66.111.4.135] by localhost.localdomain with IMAP (fetchmail-6.3.26) for <akpm@localhost> (single-drop); Tue, 04 May 2021 20:17:03 -0700 (PDT) Received: from compute1.internal (compute1.nyi.internal [10.202.2.41]) by sloti11d1t06 (Cyrus 3.5.0-alpha0-442-g5daca166b9-fm-20210428.001-g5daca166) with LMTPA; Tue, 04 May 2021 23:16:31 -0400 X-Cyrus-Session-Id: sloti11d1t06-1620184591-1699471-2-6359664467419938249 X-Sieve: CMU Sieve 3.0 X-Resolved-to: akpm@mbx.kernel.org X-Delivered-to: akpm@mbx.kernel.org X-Mail-from: akpm@linux-foundation.org Received: from mx6 ([10.202.2.205]) by compute1.internal (LMTPProxy); Tue, 04 May 2021 23:16:31 -0400 Received: from mx6.messagingengine.com (localhost [127.0.0.1]) by mailmx.nyi.internal (Postfix) with ESMTP id 40796C800E1 for <akpm@mbx.kernel.org>; Tue, 4 May 2021 23:16:31 -0400 (EDT) Received: from mx6.messagingengine.com (localhost [127.0.0.1]) by mx6.messagingengine.com (Authentication Milter) with ESMTP id 14870833D7F; Tue, 4 May 2021 23:16:31 -0400 ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=messagingengine.com; s=fm2; t= 1620184591; b=FBo7Gf3JFN+4QYg5Byan0oNm6RESv+sIf5HcaslVNsUd9SOTGS yI0+IsXr1CUpGH783hE6fmgEq9SyfOwQVZjdikLaJS1+7u0JtfAYQFU3RORCtXlr djJWrScfjVa8nAHX4rQCtzvtPYuzx5w7cTgGgeILgoJMxgLj7EC9xcT8BIf68+9W Lw+ohAmcuiKhL2ez+de4SMuwdh3dh2FwAIHQOsSjEU1/NV+WGxMLwYbxWgTrqQGH RQIzFNdq30qslW9huK47+e80uHOX2tXwxtshwbThFEn458bdV5LL6Y8Oh4ZWMbv1 tFgTt515DVedonZknxc07XsXtAjaJyB8bfHw== ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=date:from:to:subject:message-id :in-reply-to; s=fm2; t=1620184591; bh=LuH7mbm3+zp863vKBEqKeoZtnp uFxYpIb5oTVwf56Es=; b=m5E1fbz2b+an/X406oY3BuG0Zm4/W05vWAki8Lsnud gPCc1LfPUFSuXaMppcEDPbLKprp4hH3T52itK4pivXMQCLEOyme7kVStaLMVTiky Xxqh5ZdhOWvygBfda/GjfuLBSbbj2gfm8HPKpbL7CA5foelknIBhJHDzGkJyxetZ YagZfVvtdo2OEwnC1mmjUCpKPO5+m5kaZO0ol6rPdl+TV0MKGhjLg+/i6Ia+0nFp zDwV4VeACvVcGb2xY7KG5Z+BtqVxeVFn+w5JcqpWUtxEKoSBR4bWARzjwHg6eouh 7psOOKPTt/NzDKk+3f49lso5KlPiTF2xEU/+5SIttCkQ== ARC-Authentication-Results: i=2; mx6.messagingengine.com; arc=pass (as.1.google.com=pass, ams.1.google.com=pass) smtp.remote-ip=209.85.215.198; bimi=skipped (DMARC did not pass); dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256 header.s=korg x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=linux-foundation.org; iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com); spf=pass smtp.mailfrom=akpm@linux-foundation.org smtp.helo=mail-pg1-f198.google.com; x-aligned-from=pass (Address match); x-arc-spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1 x-arc-domain=google.com (Trusted from aar.1.google.com); x-csa=none; x-google-dkim=fail (message has been altered, 2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf; x-me-sender=none; x-ptr=pass smtp.helo=mail-pg1-f198.google.com policy.ptr=mail-pg1-f198.google.com; x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM); x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM); x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384 smtp.bits=256/256; x-vs=clean score=40 state=0 Authentication-Results: mx6.messagingengine.com; arc=pass (as.1.google.com=pass, ams.1.google.com=pass) smtp.remote-ip=209.85.215.198; bimi=skipped (DMARC did not pass); dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256 header.s=korg x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=linux-foundation.org; iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com); spf=pass smtp.mailfrom=akpm@linux-foundation.org smtp.helo=mail-pg1-f198.google.com; x-aligned-from=pass (Address match); x-arc-spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1 x-arc-domain=google.com (Trusted from aar.1.google.com); x-csa=none; x-google-dkim=fail (message has been altered, 2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf; x-me-sender=none; x-ptr=pass smtp.helo=mail-pg1-f198.google.com policy.ptr=mail-pg1-f198.google.com; x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM); x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM); x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384 smtp.bits=256/256; x-vs=clean score=40 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrvdefjedgieegucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucgoufhorhhtvggutfgvtg hiphdvucdlgedtmdenucfjughrpeffhffvuffkjggfsedttdertddtredtnecuhfhrohhm peetnhgurhgvficuofhorhhtohhnuceorghkphhmsehlihhnuhigqdhfohhunhgurghtih honhdrohhrgheqnecuggftrfgrthhtvghrnhepjeevfeduveffvddvudetkefhgeduveeu geevvdfhhfevhfekkedtieefgfduheeinecuffhomhgrihhnpehkvghrnhgvlhdrohhrgh enucfkphepvddtledrkeehrddvudehrdduleekpdduleekrddugeehrddvledrleelnecu uegrugftvghpuhhtkfhppeduleekrddugeehrddvledrleelnecuvehluhhsthgvrhfuih iivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudehrdduleekpdhhvghl ohepmhgrihhlqdhpghduqdhfudelkedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomh epoegrkhhpmheslhhinhhugidqfhhouhhnuggrthhiohhnrdhorhhgqe X-ME-VSScore: 40 X-ME-VSCategory: clean X-ME-CSA: none Received-SPF: pass (linux-foundation.org: Sender is authorized to use 'akpm@linux-foundation.org' in 'mfrom' identity (mechanism 'include:_spf.google.com' matched)) receiver=mx6.messagingengine.com; identity=mailfrom; envelope-from="akpm@linux-foundation.org"; helo=mail-pg1-f198.google.com; client-ip=209.85.215.198 Received: from mail-pg1-f198.google.com (mail-pg1-f198.google.com [209.85.215.198]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by mx6.messagingengine.com (Postfix) with ESMTPS for <akpm@mbx.kernel.org>; Tue, 4 May 2021 23:16:31 -0400 (EDT) Received: by mail-pg1-f198.google.com with SMTP id g5-20020a63f4050000b02901f6c7b9a6d0so593624pgi.5 for <akpm@mbx.kernel.org>; Tue, 04 May 2021 20:16:30 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:dkim-signature:date:from:to:subject:message-id :in-reply-to:user-agent; bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=; b=VZuDOxUfeHXJz1/CiFfcxuMVHkmW5RznvqYS+Py8Ub6nHHXprQJGE9Ze3WgH+1ylSe NJLEC7xgv15SR9A+e/MT4RTj3OVOwtd1Zi2vPav39a9K4tP+2uL2Ei+5d7FtT3LLZsjo feek/DqCGSkJ/EC5woLyU9BBkfLUuQ9/2HiDCk10BMetEfWdor69Slb39NOXES8br02X 25Btabu9ZCWroyjQj7W5gwGr5Z6Hs2nbnnfAb+e92FalcUD/4ql77lNzRcWGi4/9TT8s ntqI2g46Xv+k5LURaRH5CRBpxkkKgzcrioRPYFUHkEgOEWy1hPzg9QPk8ZO35Xm9R9d2 vl3Q== X-Gm-Message-State: AOAM531IlYUTVWcMrsTunnxZWB7SKeeOmoZj5mZ1A5tl7N/JlZUueN8L tvyRKnvxHr6a5mDaGHN9Tb1N/iCzT0U5oQgRVTxTnj1qFGibRa9+leLQNKX0aGlNg9JiaMfromb xyOlCUpVXOlVvchuwTUSTn7rXum+Hh3PWQZm5II/EX+0AkzKqez62Z8U= X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203271pjq.53.1620184589161; Tue, 04 May 2021 20:16:29 -0700 (PDT) X-Google-Smtp-Source: ABdhPJxffoGdRqAjUagWoMVD5p/Lk1KTEDftEhkWh8ewatgDmZLlxh0lO1hxYIdYYwoO5dsJ/i0z X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203198pjq.53.1620184588109; Tue, 04 May 2021 20:16:28 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1620184588; cv=none; d=google.com; s=arc-20160816; b=Fr2b2AMXJr6OeNpSql45tq1korkuDOunp7t+DpARuEBnwvQnKfagyipQ93jywsRf/c /i/mP2eTmJwOLWNORClh1MGF/0VfBx1ULoB9W4CI3LpVgGFXGGFis8LTcvUYD5yvhlsV 50rm2j34iS9lyo04FB/hbhGkwLtUhz2PGkLGuqHspTd+pUpUCf5SLxGJbZC5uCcUEsbO 8WSDBWyvaCPjFzJQZK60gK70ticKW+fCG1xHtOG4qsFCbqEpFKBy8eVK83OBazo/dQDr DOheWNWyw2o/WMP4GpZMvZuj30dx3j8xnBahIpnMIQJaog6wLMcVX9pkQ8UJym3/PGNm pO/g== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=user-agent:in-reply-to:message-id:subject:to:from:date :dkim-signature; bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=; b=vVN16NPMKjoxSJQ6b36VXFCkZqnmG7wABfilgE069txZqmHpEMyZb8lRStkHy557LM Kn7UfJFP3xwsP8ZTCipVDZ6tpFW/hYFU9o4th9G8asWs+MOf9xpWX2LQZ1FTmaao2Fg5 uCHypz39cnAh0Z1EJfNsTcaTGIrkbBd6zje+mtBgs8hnfH8HcWBYTPCHCCx950Z928tb XOPd/Igs7yzD1ioBiGXZj/ciwPbWVTaZXBg4JOZSApxkDMfuMyfyLLOs++EVkyxJHUme TmgwvLkixcwEtKF7gIeqEhwvOUSVvilLuJLFVaLumwTcjJ1amVfGcJhBE7LIM9C3SMpA rOOg== ARC-Authentication-Results: i=1; mx.google.com; dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9"; spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org Received: from mail.kernel.org (mail.kernel.org. [198.145.29.99]) by mx.google.com with ESMTPS id c85si20173199pfb.8.2021.05.04.20.16.27 (version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128); Tue, 04 May 2021 20:16:28 -0700 (PDT) Received-SPF: pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) client-ip=198.145.29.99; Authentication-Results: mx.google.com; dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9"; spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org Received: by mail.kernel.org (Postfix) with ESMTPSA id A4DB4610D2; Wed, 5 May 2021 03:16:26 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=linux-foundation.org; s=korg; t=1620184587; bh=TxN4wgKcKf2UUem+5pL09m9GL/7U592mEalo2U6vwAU=; h=Date:From:To:Subject:In-Reply-To:From; b=Gdz/3wY9ktH3hOmn2DAOkfh0JXwPdMJ8xsNQFa9eI25K39Z3iHdRGo9jX3QtMDtog D4Zakt52CQCYsV91c9oCai8KnCTkkAjJq/Ez7p8UHpz97Go3yYYxqg6DDl6d8HCQvN H47dTaZAgeH2sw29bjB9fRzNuTx7k4RAPlqZIpiE= Date: Tue, 04 May 2021 20:16:26 -0700 From: Andrew Morton <akpm@linux-foundation.org> To: akpm@linux-foundation.org, anshuman.khandual@arm.com, aou@eecs.berkeley.edu, arnd@arndb.de, benh@kernel.crashing.org, borntraeger@de.ibm.com, bp@alien8.de, catalin.marinas@arm.com, dalias@libc.org, deller@gmx.de, gor@linux.ibm.com, hca@linux.ibm.com, hpa@zytor.com, James.Bottomley@HansenPartnership.com, linux-mm@kvack.org, linux@armlinux.org.uk, mingo@redhat.com, mm-commits@vger.kernel.org, mpe@ellerman.id.au, palmerdabbelt@google.com, paul.walmsley@sifive.com, paulus@samba.org, tglx@linutronix.de, torvalds@linux-foundation.org, tsbogend@alpha.franken.de, vgupta@synopsys.com, viro@zeniv.linux.org.uk, will@kernel.org, ysato@users.osdn.me Subject: [patch 103/143] mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS) Message-ID: <20210505031626.c8o4WL7KE%akpm@linux-foundation.org> In-Reply-To: <20210504183219.a3cc46aee4013d77402276c5@linux-foundation.org> User-Agent: s-nail v14.8.16 X-Gm-Original-To: akpm@linux-foundation.org From: Anshuman Khandual <anshuman.khandual@arm.com> Subject: mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS) SYS_SUPPORTS_HUGETLBFS config has duplicate definitions on platforms that subscribe it. Instead, just make it a generic option which can be selected on applicable platforms. Also rename it as ARCH_SUPPORTS_HUGETLBFS instead. This reduces code duplication and makes it cleaner. Link: https://lkml.kernel.org/r/1617259448-22529-3-git-send-email-anshuman.khandual@arm.com Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com> Acked-by: Catalin Marinas <catalin.marinas@arm.com> [arm64] Acked-by: Palmer Dabbelt <palmerdabbelt@google.com> [riscv] Acked-by: Michael Ellerman <mpe@ellerman.id.au> [powerpc] Cc: Russell King <linux@armlinux.org.uk> Cc: Will Deacon <will@kernel.org> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com> Cc: Helge Deller <deller@gmx.de> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Albert Ou <aou@eecs.berkeley.edu> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Cc: Rich Felker <dalias@libc.org> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Arnd Bergmann <arnd@arndb.de> Cc: Borislav Petkov <bp@alien8.de> Cc: Christian Borntraeger <borntraeger@de.ibm.com> Cc: Heiko Carstens <hca@linux.ibm.com> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Vasily Gorbik <gor@linux.ibm.com> Cc: Vineet Gupta <vgupta@synopsys.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm/Kconfig | 5 +---- arch/arm64/Kconfig | 4 +--- arch/mips/Kconfig | 6 +----- arch/parisc/Kconfig | 5 +---- arch/powerpc/Kconfig | 3 --- arch/powerpc/platforms/Kconfig.cputype | 6 +++--- arch/riscv/Kconfig | 5 +---- arch/sh/Kconfig | 5 +---- fs/Kconfig | 5 ++++- 9 files changed, 13 insertions(+), 31 deletions(-) --- a/arch/arm64/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/arm64/Kconfig @@ -73,6 +73,7 @@ config ARM64 select ARCH_USE_QUEUED_SPINLOCKS select ARCH_USE_SYM_ANNOTATIONS select ARCH_SUPPORTS_DEBUG_PAGEALLOC + select ARCH_SUPPORTS_HUGETLBFS select ARCH_SUPPORTS_MEMORY_FAILURE select ARCH_SUPPORTS_SHADOW_CALL_STACK if CC_HAVE_SHADOW_CALL_STACK select ARCH_SUPPORTS_LTO_CLANG if CPU_LITTLE_ENDIAN @@ -1072,9 +1073,6 @@ config HW_PERF_EVENTS def_bool y depends on ARM_PMU -config SYS_SUPPORTS_HUGETLBFS - def_bool y - config ARCH_HAS_FILTER_PGPROT def_bool y --- a/arch/arm/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/arm/Kconfig @@ -31,6 +31,7 @@ config ARM select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT if CPU_V7 select ARCH_SUPPORTS_ATOMIC_RMW + select ARCH_SUPPORTS_HUGETLBFS if ARM_LPAE select ARCH_USE_BUILTIN_BSWAP select ARCH_USE_CMPXCHG_LOCKREF select ARCH_USE_MEMTEST @@ -1511,10 +1512,6 @@ config HW_PERF_EVENTS def_bool y depends on ARM_PMU -config SYS_SUPPORTS_HUGETLBFS - def_bool y - depends on ARM_LPAE - config HAVE_ARCH_TRANSPARENT_HUGEPAGE def_bool y depends on ARM_LPAE --- a/arch/mips/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/mips/Kconfig @@ -19,6 +19,7 @@ config MIPS select ARCH_USE_MEMTEST select ARCH_USE_QUEUED_RWLOCKS select ARCH_USE_QUEUED_SPINLOCKS + select ARCH_SUPPORTS_HUGETLBFS if CPU_SUPPORTS_HUGEPAGES select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU select ARCH_WANT_IPC_PARSE_VERSION select ARCH_WANT_LD_ORPHAN_WARN @@ -1287,11 +1288,6 @@ config SYS_SUPPORTS_BIG_ENDIAN config SYS_SUPPORTS_LITTLE_ENDIAN bool -config SYS_SUPPORTS_HUGETLBFS - bool - depends on CPU_SUPPORTS_HUGEPAGES - default y - config MIPS_HUGE_TLB_SUPPORT def_bool HUGETLB_PAGE || TRANSPARENT_HUGEPAGE --- a/arch/parisc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/parisc/Kconfig @@ -12,6 +12,7 @@ config PARISC select ARCH_HAS_STRICT_KERNEL_RWX select ARCH_HAS_UBSAN_SANITIZE_ALL select ARCH_NO_SG_CHAIN + select ARCH_SUPPORTS_HUGETLBFS if PA20 select ARCH_SUPPORTS_MEMORY_FAILURE select DMA_OPS select RTC_CLASS @@ -138,10 +139,6 @@ config PGTABLE_LEVELS default 3 if 64BIT && PARISC_PAGE_SIZE_4KB default 2 -config SYS_SUPPORTS_HUGETLBFS - def_bool y if PA20 - - menu "Processor type and features" choice --- a/arch/powerpc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/powerpc/Kconfig @@ -697,9 +697,6 @@ config ARCH_SPARSEMEM_DEFAULT def_bool y depends on PPC_BOOK3S_64 -config SYS_SUPPORTS_HUGETLBFS - bool - config ILLEGAL_POINTER_VALUE hex # This is roughly half way between the top of user space and the bottom --- a/arch/powerpc/platforms/Kconfig.cputype~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/powerpc/platforms/Kconfig.cputype @@ -40,8 +40,8 @@ config PPC_85xx config PPC_8xx bool "Freescale 8xx" + select ARCH_SUPPORTS_HUGETLBFS select FSL_SOC - select SYS_SUPPORTS_HUGETLBFS select PPC_HAVE_KUEP select PPC_HAVE_KUAP select HAVE_ARCH_VMAP_STACK @@ -95,9 +95,9 @@ config PPC_BOOK3S_64 bool "Server processors" select PPC_FPU select PPC_HAVE_PMU_SUPPORT - select SYS_SUPPORTS_HUGETLBFS select HAVE_ARCH_TRANSPARENT_HUGEPAGE select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE + select ARCH_SUPPORTS_HUGETLBFS select ARCH_SUPPORTS_NUMA_BALANCING select IRQ_WORK select PPC_MM_SLICES @@ -278,9 +278,9 @@ config FSL_BOOKE # this is for common code between PPC32 & PPC64 FSL BOOKE config PPC_FSL_BOOK3E bool + select ARCH_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64 select FSL_EMB_PERFMON select PPC_SMP_MUXED_IPI - select SYS_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64 select PPC_DOORBELL default y if FSL_BOOKE --- a/arch/riscv/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/riscv/Kconfig @@ -30,6 +30,7 @@ config RISCV select ARCH_HAS_STRICT_KERNEL_RWX if MMU select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT + select ARCH_SUPPORTS_HUGETLBFS if MMU select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU select ARCH_WANT_FRAME_POINTERS select ARCH_WANT_HUGE_PMD_SHARE if 64BIT @@ -165,10 +166,6 @@ config ARCH_WANT_GENERAL_HUGETLB config ARCH_SUPPORTS_UPROBES def_bool y -config SYS_SUPPORTS_HUGETLBFS - depends on MMU - def_bool y - config STACKTRACE_SUPPORT def_bool y --- a/arch/sh/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/sh/Kconfig @@ -101,9 +101,6 @@ config SYS_SUPPORTS_APM_EMULATION bool select ARCH_SUSPEND_POSSIBLE -config SYS_SUPPORTS_HUGETLBFS - bool - config SYS_SUPPORTS_SMP bool @@ -175,12 +172,12 @@ config CPU_SH3 config CPU_SH4 bool + select ARCH_SUPPORTS_HUGETLBFS if MMU select CPU_HAS_INTEVT select CPU_HAS_SR_RB select CPU_HAS_FPU if !CPU_SH4AL_DSP select SH_INTC select SYS_SUPPORTS_SH_TMU - select SYS_SUPPORTS_HUGETLBFS if MMU config CPU_SH4A bool --- a/fs/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/fs/Kconfig @@ -223,10 +223,13 @@ config TMPFS_INODE64 If unsure, say N. +config ARCH_SUPPORTS_HUGETLBFS + def_bool n + config HUGETLBFS bool "HugeTLB file system support" depends on X86 || IA64 || SPARC64 || (S390 && 64BIT) || \ - SYS_SUPPORTS_HUGETLBFS || BROKEN + ARCH_SUPPORTS_HUGETLBFS || BROKEN help hugetlbfs is a filesystem backing for HugeTLB pages, based on ramfs. For architectures that support it, say Y here and read _ ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-05-05 17:44 ` incoming Andrew Morton @ 2021-05-06 3:19 ` Anshuman Khandual 0 siblings, 0 replies; 348+ messages in thread From: Anshuman Khandual @ 2021-05-06 3:19 UTC (permalink / raw) To: Andrew Morton, Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits On 5/5/21 11:14 PM, Andrew Morton wrote: > On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > >> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote: >>> Let me resend right now with the same in-reply-to. Hopefully they will >>> land in the correct place. >> Well, you re-sent it twice, and I have three copies in my own mailbox, >> bot they still don't show up on the mm-commits mailing list. >> >> So the list hates them for some odd reason. >> >> I've picked them up locally, but adding Konstantin to the participants >> to see if he can see what's up. >> >> Konstantin: patches 103/106/107 are missing on lore out of Andrew's >> series of 143. Odd. > It's weird. They don't turn up on linux-mm either, and that's running > at kvack.org, also majordomo. They don't get through when sent with > either heirloom-mailx or with sylpheed. > > Also, it seems that when Anshuman originally sent the patch, linux-mm > and linux-kernel didn't send it back out. So perhaps a spam filter > triggered? > > I'm seeing > > https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/ > > which is via linux-arm-kernel@lists.infradead.org but the linux-kernel > server massacred that patch series. Searching > https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7 > email series. Yeah these patches faced problem from the very beginning getting into the MM/LKML list for some strange reason. ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-04-27 19:41 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-04-27 19:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 2 patches, based on d615b5416f8a1afeb82d13b238f8152c572d59c0. Subsystems affected by this patch series: mm/kasan mm/debug Subsystem: mm/kasan Zqiang <qiang1.zhang@intel.com>: kasan: prevent cpu_quarantine corruption when CPU offline and cache shrink occur at same time Subsystem: mm/debug Akira Yokosawa <akiyks@gmail.com>: docs: vm/page_owner: use literal blocks for param description Documentation/vm/page_owner.rst | 5 +++-- mm/kasan/quarantine.c | 7 +++++++ 2 files changed, 10 insertions(+), 2 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-04-21 23:35 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-04-21 23:35 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches 13 patches, based on b253435746d9a4a701b5f09211b9c14d3370d0da. Subsystems affected by this patch series: mm/memory-failure mm/memcg mm/userfaultfd mm/hugetlbfs mm/mremap mm/oom-kill mm/kasan kcov mm/hmm Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/hwpoison: fix race between hugetlb free/demotion and memory_failure_hugetlb() Xu Yu <xuyu@linux.alibaba.com>: mm/memory-failure.c: skip huge_zero_page in memory_failure() Subsystem: mm/memcg Shakeel Butt <shakeelb@google.com>: memcg: sync flush only if periodic flush is delayed Subsystem: mm/userfaultfd Nadav Amit <namit@vmware.com>: userfaultfd: mark uffd_wp regardless of VM_WRITE flag Subsystem: mm/hugetlbfs Christophe Leroy <christophe.leroy@csgroup.eu>: mm, hugetlb: allow for "high" userspace addresses Subsystem: mm/mremap Sidhartha Kumar <sidhartha.kumar@oracle.com>: selftest/vm: verify mmap addr in mremap_test selftest/vm: verify remap destination address in mremap_test selftest/vm: support xfail in mremap_test selftest/vm: add skip support to mremap_test Subsystem: mm/oom-kill Nico Pache <npache@redhat.com>: oom_kill.c: futex: delay the OOM reaper to allow time for proper futex cleanup Subsystem: mm/kasan Vincenzo Frascino <vincenzo.frascino@arm.com>: MAINTAINERS: add Vincenzo Frascino to KASAN reviewers Subsystem: kcov Aleksandr Nogikh <nogikh@google.com>: kcov: don't generate a warning on vm_insert_page()'s failure Subsystem: mm/hmm Alistair Popple <apopple@nvidia.com>: mm/mmu_notifier.c: fix race in mmu_interval_notifier_remove() MAINTAINERS | 1 fs/hugetlbfs/inode.c | 9 - include/linux/hugetlb.h | 6 + include/linux/memcontrol.h | 5 include/linux/mm.h | 8 + include/linux/sched.h | 1 include/linux/sched/mm.h | 8 + kernel/kcov.c | 7 - mm/hugetlb.c | 10 + mm/memcontrol.c | 12 ++ mm/memory-failure.c | 158 ++++++++++++++++++++++-------- mm/mmap.c | 8 - mm/mmu_notifier.c | 14 ++ mm/oom_kill.c | 54 +++++++--- mm/userfaultfd.c | 15 +- mm/workingset.c | 2 tools/testing/selftests/vm/mremap_test.c | 85 +++++++++++++++- tools/testing/selftests/vm/run_vmtests.sh | 11 +- 18 files changed, 327 insertions(+), 87 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-04-15 2:12 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-04-15 2:12 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 14 patches, based on 115acbb56978941bb7537a97dfc303da286106c1. Subsystems affected by this patch series: MAINTAINERS mm/tmpfs m/secretmem mm/kasan mm/kfence mm/pagealloc mm/zram mm/compaction mm/hugetlb binfmt mm/vmalloc mm/kmemleak Subsystem: MAINTAINERS Joe Perches <joe@perches.com>: MAINTAINERS: Broadcom internal lists aren't maintainers Subsystem: mm/tmpfs Hugh Dickins <hughd@google.com>: tmpfs: fix regressions from wider use of ZERO_PAGE Subsystem: m/secretmem Axel Rasmussen <axelrasmussen@google.com>: mm/secretmem: fix panic when growing a memfd_secret Subsystem: mm/kasan Zqiang <qiang1.zhang@intel.com>: irq_work: use kasan_record_aux_stack_noalloc() record callstack Vincenzo Frascino <vincenzo.frascino@arm.com>: kasan: fix hw tags enablement when KUNIT tests are disabled Subsystem: mm/kfence Marco Elver <elver@google.com>: mm, kfence: support kmem_dump_obj() for KFENCE objects Subsystem: mm/pagealloc Juergen Gross <jgross@suse.com>: mm, page_alloc: fix build_zonerefs_node() Subsystem: mm/zram Minchan Kim <minchan@kernel.org>: mm: fix unexpected zeroed page mapping with zram swap Subsystem: mm/compaction Charan Teja Kalla <quic_charante@quicinc.com>: mm: compaction: fix compiler warning when CONFIG_COMPACTION=n Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: do not demote poisoned hugetlb pages Subsystem: binfmt Andrew Morton <akpm@linux-foundation.org>: revert "fs/binfmt_elf: fix PT_LOAD p_align values for loaders" revert "fs/binfmt_elf: use PT_LOAD p_align values for static PIE" Subsystem: mm/vmalloc Omar Sandoval <osandov@fb.com>: mm/vmalloc: fix spinning drain_vmap_work after reading from /proc/vmcore Subsystem: mm/kmemleak Patrick Wang <patrick.wang.shcn@gmail.com>: mm: kmemleak: take a full lowmem check in kmemleak_*_phys() MAINTAINERS | 64 ++++++++++++++++++++-------------------- arch/x86/include/asm/io.h | 2 - arch/x86/kernel/crash_dump_64.c | 1 fs/binfmt_elf.c | 6 +-- include/linux/kfence.h | 24 +++++++++++++++ kernel/irq_work.c | 2 - mm/compaction.c | 10 +++--- mm/filemap.c | 6 --- mm/hugetlb.c | 17 ++++++---- mm/kasan/hw_tags.c | 5 +-- mm/kasan/kasan.h | 10 +++--- mm/kfence/core.c | 21 ------------- mm/kfence/kfence.h | 21 +++++++++++++ mm/kfence/report.c | 47 +++++++++++++++++++++++++++++ mm/kmemleak.c | 8 ++--- mm/page_alloc.c | 2 - mm/page_io.c | 54 --------------------------------- mm/secretmem.c | 17 ++++++++++ mm/shmem.c | 31 ++++++++++++------- mm/slab.c | 2 - mm/slab.h | 2 - mm/slab_common.c | 9 +++++ mm/slob.c | 2 - mm/slub.c | 2 - mm/vmalloc.c | 11 ------ 25 files changed, 207 insertions(+), 169 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-04-08 20:08 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-04-08 20:08 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 9 patches, based on d00c50b35101b862c3db270ffeba53a63a1063d9. Subsystems affected by this patch series: mm/migration mm/highmem lz4 mm/sparsemem mm/mremap mm/mempolicy mailmap mm/memcg MAINTAINERS Subsystem: mm/migration Zi Yan <ziy@nvidia.com>: mm: migrate: use thp_order instead of HPAGE_PMD_ORDER for new page allocation. Subsystem: mm/highmem Max Filippov <jcmvbkbc@gmail.com>: highmem: fix checks in __kmap_local_sched_{in,out} Subsystem: lz4 Guo Xuenan <guoxuenan@huawei.com>: lz4: fix LZ4_decompress_safe_partial read out of bound Subsystem: mm/sparsemem Waiman Long <longman@redhat.com>: mm/sparsemem: fix 'mem_section' will never be NULL gcc 12 warning Subsystem: mm/mremap Paolo Bonzini <pbonzini@redhat.com>: mmmremap.c: avoid pointless invalidate_range_start/end on mremap(old_size=0) Subsystem: mm/mempolicy Miaohe Lin <linmiaohe@huawei.com>: mm/mempolicy: fix mpol_new leak in shared_policy_replace Subsystem: mailmap Vasily Averin <vasily.averin@linux.dev>: mailmap: update Vasily Averin's email address Subsystem: mm/memcg Andrew Morton <akpm@linux-foundation.org>: mm/list_lru.c: revert "mm/list_lru: optimize memcg_reparent_list_lru_node()" Subsystem: MAINTAINERS Tom Rix <trix@redhat.com>: MAINTAINERS: add Tom as clang reviewer .mailmap | 4 ++++ MAINTAINERS | 1 + include/linux/mmzone.h | 11 +++++++---- lib/lz4/lz4_decompress.c | 8 ++++++-- mm/highmem.c | 4 ++-- mm/list_lru.c | 6 ------ mm/mempolicy.c | 3 ++- mm/migrate.c | 2 +- mm/mremap.c | 3 +++ 9 files changed, 26 insertions(+), 16 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-04-01 18:27 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-04-01 18:27 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696. Subsystems affected by this patch series: mm/madvise ofs2 nilfs2 mm/mlock mm/mfence mailmap mm/memory-failure mm/kasan mm/debug mm/kmemleak mm/damon Subsystem: mm/madvise Charan Teja Kalla <quic_charante@quicinc.com>: Revert "mm: madvise: skip unmapped vma holes passed to process_madvise" Subsystem: ofs2 Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: fix crash when mount with quota enabled Subsystem: nilfs2 Ryusuke Konishi <konishi.ryusuke@gmail.com>: Patch series "nilfs2 lockdep warning fixes": nilfs2: fix lockdep warnings in page operations for btree nodes nilfs2: fix lockdep warnings during disk space reclamation nilfs2: get rid of nilfs_mapping_init() Subsystem: mm/mlock Hugh Dickins <hughd@google.com>: mm/munlock: add lru_add_drain() to fix memcg_stat_test mm/munlock: update Documentation/vm/unevictable-lru.rst Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/munlock: protect the per-CPU pagevec by a local_lock_t Subsystem: mm/kfence Muchun Song <songmuchun@bytedance.com>: mm: kfence: fix objcgs vector allocation Subsystem: mailmap Kirill Tkhai <kirill.tkhai@openvz.org>: mailmap: update Kirill's email Subsystem: mm/memory-failure Rik van Riel <riel@surriel.com>: mm,hwpoison: unmap poisoned page before invalidation Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP Subsystem: mm/debug Yinan Zhang <zhangyinan2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: remove -c option doc/vm/page_owner.rst: remove content related to -c option Subsystem: mm/kmemleak Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: mm/kmemleak: reset tag when compare object pointer Subsystem: mm/damon Jonghyeon Kim <tome01@ajou.ac.kr>: mm/damon: prevent activated scheme from sleeping by deactivated schemes .mailmap | 1 Documentation/vm/page_owner.rst | 1 Documentation/vm/unevictable-lru.rst | 473 +++++++++++++++-------------------- fs/nilfs2/btnode.c | 23 + fs/nilfs2/btnode.h | 1 fs/nilfs2/btree.c | 27 + fs/nilfs2/dat.c | 4 fs/nilfs2/gcinode.c | 7 fs/nilfs2/inode.c | 167 +++++++++++- fs/nilfs2/mdt.c | 45 ++- fs/nilfs2/mdt.h | 6 fs/nilfs2/nilfs.h | 16 - fs/nilfs2/page.c | 16 - fs/nilfs2/page.h | 1 fs/nilfs2/segment.c | 9 fs/nilfs2/super.c | 5 fs/ocfs2/quota_global.c | 23 - fs/ocfs2/quota_local.c | 2 include/linux/gfp.h | 4 mm/damon/core.c | 5 mm/gup.c | 10 mm/internal.h | 6 mm/kfence/core.c | 11 mm/kfence/kfence.h | 3 mm/kmemleak.c | 9 mm/madvise.c | 9 mm/memory.c | 12 mm/migrate.c | 2 mm/mlock.c | 46 ++- mm/page_alloc.c | 1 mm/rmap.c | 4 mm/swap.c | 4 tools/vm/page_owner_sort.c | 6 33 files changed, 560 insertions(+), 399 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-04-01 18:20 Andrew Morton 2022-04-01 18:27 ` incoming Andrew Morton 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2022-04-01 18:20 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696. Subsystems affected by this patch series: mm/madvise ofs2 nilfs2 mm/mlock mm/mfence mailmap mm/memory-failure mm/kasan mm/debug mm/kmemleak mm/damon Subsystem: mm/madvise Charan Teja Kalla <quic_charante@quicinc.com>: Revert "mm: madvise: skip unmapped vma holes passed to process_madvise" Subsystem: ofs2 Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: fix crash when mount with quota enabled Subsystem: nilfs2 Ryusuke Konishi <konishi.ryusuke@gmail.com>: Patch series "nilfs2 lockdep warning fixes": nilfs2: fix lockdep warnings in page operations for btree nodes nilfs2: fix lockdep warnings during disk space reclamation nilfs2: get rid of nilfs_mapping_init() Subsystem: mm/mlock Hugh Dickins <hughd@google.com>: mm/munlock: add lru_add_drain() to fix memcg_stat_test mm/munlock: update Documentation/vm/unevictable-lru.rst Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/munlock: protect the per-CPU pagevec by a local_lock_t Subsystem: mm/kfence Muchun Song <songmuchun@bytedance.com>: mm: kfence: fix objcgs vector allocation Subsystem: mailmap Kirill Tkhai <kirill.tkhai@openvz.org>: mailmap: update Kirill's email Subsystem: mm/memory-failure Rik van Riel <riel@surriel.com>: mm,hwpoison: unmap poisoned page before invalidation Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP Subsystem: mm/debug Yinan Zhang <zhangyinan2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: remove -c option doc/vm/page_owner.rst: remove content related to -c option Subsystem: mm/kmemleak Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: mm/kmemleak: reset tag when compare object pointer Subsystem: mm/damon Jonghyeon Kim <tome01@ajou.ac.kr>: mm/damon: prevent activated scheme from sleeping by deactivated schemes .mailmap | 1 Documentation/vm/page_owner.rst | 1 Documentation/vm/unevictable-lru.rst | 473 +++++++++++++++-------------------- fs/nilfs2/btnode.c | 23 + fs/nilfs2/btnode.h | 1 fs/nilfs2/btree.c | 27 + fs/nilfs2/dat.c | 4 fs/nilfs2/gcinode.c | 7 fs/nilfs2/inode.c | 167 +++++++++++- fs/nilfs2/mdt.c | 45 ++- fs/nilfs2/mdt.h | 6 fs/nilfs2/nilfs.h | 16 - fs/nilfs2/page.c | 16 - fs/nilfs2/page.h | 1 fs/nilfs2/segment.c | 9 fs/nilfs2/super.c | 5 fs/ocfs2/quota_global.c | 23 - fs/ocfs2/quota_local.c | 2 include/linux/gfp.h | 4 mm/damon/core.c | 5 mm/gup.c | 10 mm/internal.h | 6 mm/kfence/core.c | 11 mm/kfence/kfence.h | 3 mm/kmemleak.c | 9 mm/madvise.c | 9 mm/memory.c | 12 mm/migrate.c | 2 mm/mlock.c | 46 ++- mm/page_alloc.c | 1 mm/rmap.c | 4 mm/swap.c | 4 tools/vm/page_owner_sort.c | 6 33 files changed, 560 insertions(+), 399 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2022-04-01 18:20 incoming Andrew Morton @ 2022-04-01 18:27 ` Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-04-01 18:27 UTC (permalink / raw) To: Linus Torvalds, linux-mm, mm-commits, patches Argh, messed up in-reply-to. Let me redo... ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-03-25 1:07 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-03-25 1:07 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches This is the material which was staged after willystuff in linux-next. Everything applied seamlessly on your latest, all looks well. 114 patches, based on 52deda9551a01879b3562e7b41748e85c591f14c. Subsystems affected by this patch series: mm/debug mm/selftests mm/pagecache mm/thp mm/rmap mm/migration mm/kasan mm/hugetlb mm/pagemap mm/madvise selftests Subsystem: mm/debug Sean Anderson <seanga2@gmail.com>: tools/vm/page_owner_sort.c: sort by stacktrace before culling tools/vm/page_owner_sort.c: support sorting by stack trace Yinan Zhang <zhangyinan2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: add switch between culling by stacktrace and txt Chongxi Zhao <zhaochongxi2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: support sorting pid and time Shenghong Han <hanshenghong2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: two trivial fixes Yixuan Cao <caoyixuan2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: delete invalid duplicate code Shenghong Han <hanshenghong2019@email.szu.edu.cn>: Documentation/vm/page_owner.rst: update the documentation Shuah Khan <skhan@linuxfoundation.org>: Documentation/vm/page_owner.rst: fix unexpected indentation warns Waiman Long <longman@redhat.com>: Patch series "mm/page_owner: Extend page_owner to show memcg information", v4: lib/vsprintf: avoid redundant work with 0 size mm/page_owner: use scnprintf() to avoid excessive buffer overrun check mm/page_owner: print memcg information mm/page_owner: record task command name Yixuan Cao <caoyixuan2019@email.szu.edu.cn>: mm/page_owner.c: record tgid tools/vm/page_owner_sort.c: fix the instructions for use Jiajian Ye <yejiajian2018@email.szu.edu.cn>: tools/vm/page_owner_sort.c: fix comments tools/vm/page_owner_sort.c: add a security check tools/vm/page_owner_sort.c: support sorting by tgid and update documentation tools/vm/page_owner_sort: fix three trivival places tools/vm/page_owner_sort: support for sorting by task command name tools/vm/page_owner_sort.c: support for selecting by PID, TGID or task command name tools/vm/page_owner_sort.c: support for user-defined culling rules Christoph Hellwig <hch@lst.de>: mm: unexport page_init_poison Subsystem: mm/selftests "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: selftest/vm: add util.h and and move helper functions there Mike Rapoport <rppt@kernel.org>: selftest/vm: add helpers to detect PAGE_SIZE and PAGE_SHIFT Subsystem: mm/pagecache Hugh Dickins <hughd@google.com>: mm: delete __ClearPageWaiters() mm: filemap_unaccount_folio() large skip mapcount fixup Subsystem: mm/thp Hugh Dickins <hughd@google.com>: mm/thp: fix NR_FILE_MAPPED accounting in page_*_file_rmap() Subsystem: mm/rmap Subsystem: mm/migration Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/migration: Add trace events", v3: mm/migration: add trace events for THP migrations mm/migration: add trace events for base page and HugeTLB migrations Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan, vmalloc, arm64: add vmalloc tagging support for SW/HW_TAGS", v6: kasan, page_alloc: deduplicate should_skip_kasan_poison kasan, page_alloc: move tag_clear_highpage out of kernel_init_free_pages kasan, page_alloc: merge kasan_free_pages into free_pages_prepare kasan, page_alloc: simplify kasan_poison_pages call site kasan, page_alloc: init memory of skipped pages on free kasan: drop skip_kasan_poison variable in free_pages_prepare mm: clarify __GFP_ZEROTAGS comment kasan: only apply __GFP_ZEROTAGS when memory is zeroed kasan, page_alloc: refactor init checks in post_alloc_hook kasan, page_alloc: merge kasan_alloc_pages into post_alloc_hook kasan, page_alloc: combine tag_clear_highpage calls in post_alloc_hook kasan, page_alloc: move SetPageSkipKASanPoison in post_alloc_hook kasan, page_alloc: move kernel_init_free_pages in post_alloc_hook kasan, page_alloc: rework kasan_unpoison_pages call site kasan: clean up metadata byte definitions kasan: define KASAN_VMALLOC_INVALID for SW_TAGS kasan, x86, arm64, s390: rename functions for modules shadow kasan, vmalloc: drop outdated VM_KASAN comment kasan: reorder vmalloc hooks kasan: add wrappers for vmalloc hooks kasan, vmalloc: reset tags in vmalloc functions kasan, fork: reset pointer tags of vmapped stacks kasan, arm64: reset pointer tags of vmapped stacks kasan, vmalloc: add vmalloc tagging for SW_TAGS kasan, vmalloc, arm64: mark vmalloc mappings as pgprot_tagged kasan, vmalloc: unpoison VM_ALLOC pages after mapping kasan, mm: only define ___GFP_SKIP_KASAN_POISON with HW_TAGS kasan, page_alloc: allow skipping unpoisoning for HW_TAGS kasan, page_alloc: allow skipping memory init for HW_TAGS kasan, vmalloc: add vmalloc tagging for HW_TAGS kasan, vmalloc: only tag normal vmalloc allocations kasan, arm64: don't tag executable vmalloc allocations kasan: mark kasan_arg_stacktrace as __initdata kasan: clean up feature flags for HW_TAGS mode kasan: add kasan.vmalloc command line flag kasan: allow enabling KASAN_VMALLOC and SW/HW_TAGS arm64: select KASAN_VMALLOC for SW/HW_TAGS modes kasan: documentation updates kasan: improve vmalloc tests kasan: test: support async (again) and asymm modes for HW_TAGS tangmeng <tangmeng@uniontech.com>: mm/kasan: remove unnecessary CONFIG_KASAN option Peter Collingbourne <pcc@google.com>: kasan: update function name in comments Andrey Konovalov <andreyknvl@google.com>: kasan: print virtual mapping info in reports Patch series "kasan: report clean-ups and improvements": kasan: drop addr check from describe_object_addr kasan: more line breaks in reports kasan: rearrange stack frame info in reports kasan: improve stack frame info in reports kasan: print basic stack frame info for SW_TAGS kasan: simplify async check in end_report() kasan: simplify kasan_update_kunit_status() and call sites kasan: check CONFIG_KASAN_KUNIT_TEST instead of CONFIG_KUNIT kasan: move update_kunit_status to start_report kasan: move disable_trace_on_warning to start_report kasan: split out print_report from __kasan_report kasan: simplify kasan_find_first_bad_addr call sites kasan: restructure kasan_report kasan: merge __kasan_report into kasan_report kasan: call print_report from kasan_report_invalid_free kasan: move and simplify kasan_report_async kasan: rename kasan_access_info to kasan_report_info kasan: add comment about UACCESS regions to kasan_report kasan: respect KASAN_BIT_REPORTED in all reporting routines kasan: reorder reporting functions kasan: move and hide kasan_save_enable/restore_multi_shot kasan: disable LOCKDEP when printing reports Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: Patch series "Add hugetlb MADV_DONTNEED support", v3: mm: enable MADV_DONTNEED for hugetlb mappings selftests/vm: add hugetlb madvise MADV_DONTNEED MADV_REMOVE test userfaultfd/selftests: enable hugetlb remap and remove event testing Miaohe Lin <linmiaohe@huawei.com>: mm/huge_memory: make is_transparent_hugepage() static Subsystem: mm/pagemap David Hildenbrand <david@redhat.com>: Patch series "mm: COW fixes part 1: fix the COW security issue for THP and swap", v3: mm: optimize do_wp_page() for exclusive pages in the swapcache mm: optimize do_wp_page() for fresh pages in local LRU pagevecs mm: slightly clarify KSM logic in do_swap_page() mm: streamline COW logic in do_swap_page() mm/huge_memory: streamline COW logic in do_huge_pmd_wp_page() mm/khugepaged: remove reuse_swap_page() usage mm/swapfile: remove stale reuse_swap_page() mm/huge_memory: remove stale page_trans_huge_mapcount() mm/huge_memory: remove stale locking logic from __split_huge_pmd() Hugh Dickins <hughd@google.com>: mm: warn on deleting redirtied only if accounted mm: unmap_mapping_range_tree() with i_mmap_rwsem shared Anshuman Khandual <anshuman.khandual@arm.com>: mm: generalize ARCH_HAS_FILTER_PGPROT Subsystem: mm/madvise Mauricio Faria de Oliveira <mfo@canonical.com>: mm: fix race between MADV_FREE reclaim and blkdev direct IO read Johannes Weiner <hannes@cmpxchg.org>: mm: madvise: MADV_DONTNEED_LOCKED Subsystem: selftests Muhammad Usama Anjum <usama.anjum@collabora.com>: selftests: vm: remove dependecy from internal kernel macros Kees Cook <keescook@chromium.org>: selftests: kselftest framework: provide "finished" helper Documentation/dev-tools/kasan.rst | 17 Documentation/vm/page_owner.rst | 72 ++ arch/alpha/include/uapi/asm/mman.h | 2 arch/arm64/Kconfig | 2 arch/arm64/include/asm/vmalloc.h | 6 arch/arm64/include/asm/vmap_stack.h | 5 arch/arm64/kernel/module.c | 5 arch/arm64/mm/pageattr.c | 2 arch/arm64/net/bpf_jit_comp.c | 3 arch/mips/include/uapi/asm/mman.h | 2 arch/parisc/include/uapi/asm/mman.h | 2 arch/powerpc/mm/book3s64/trace.c | 1 arch/s390/kernel/module.c | 2 arch/x86/Kconfig | 3 arch/x86/kernel/module.c | 2 arch/x86/mm/init.c | 1 arch/xtensa/include/uapi/asm/mman.h | 2 include/linux/gfp.h | 53 +- include/linux/huge_mm.h | 6 include/linux/kasan.h | 136 +++-- include/linux/mm.h | 5 include/linux/page-flags.h | 2 include/linux/pagemap.h | 3 include/linux/swap.h | 4 include/linux/vmalloc.h | 18 include/trace/events/huge_memory.h | 1 include/trace/events/migrate.h | 31 + include/trace/events/mmflags.h | 18 include/trace/events/thp.h | 27 + include/uapi/asm-generic/mman-common.h | 2 kernel/fork.c | 13 kernel/scs.c | 16 lib/Kconfig.kasan | 18 lib/test_kasan.c | 239 ++++++++- lib/vsprintf.c | 8 mm/Kconfig | 3 mm/debug.c | 1 mm/filemap.c | 63 +- mm/huge_memory.c | 109 ---- mm/kasan/Makefile | 2 mm/kasan/common.c | 4 mm/kasan/hw_tags.c | 243 +++++++--- mm/kasan/kasan.h | 76 ++- mm/kasan/report.c | 516 +++++++++++---------- mm/kasan/report_generic.c | 34 - mm/kasan/report_hw_tags.c | 1 mm/kasan/report_sw_tags.c | 16 mm/kasan/report_tags.c | 2 mm/kasan/shadow.c | 76 +-- mm/khugepaged.c | 11 mm/madvise.c | 57 +- mm/memory.c | 129 +++-- mm/memremap.c | 2 mm/migrate.c | 4 mm/page-writeback.c | 18 mm/page_alloc.c | 270 ++++++----- mm/page_owner.c | 86 ++- mm/rmap.c | 62 +- mm/swap.c | 4 mm/swapfile.c | 104 ---- mm/vmalloc.c | 167 ++++-- tools/testing/selftests/kselftest.h | 10 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 1 tools/testing/selftests/vm/gup_test.c | 3 tools/testing/selftests/vm/hugetlb-madvise.c | 410 ++++++++++++++++ tools/testing/selftests/vm/ksm_tests.c | 38 - tools/testing/selftests/vm/memfd_secret.c | 2 tools/testing/selftests/vm/run_vmtests.sh | 15 tools/testing/selftests/vm/transhuge-stress.c | 41 - tools/testing/selftests/vm/userfaultfd.c | 72 +- tools/testing/selftests/vm/util.h | 75 ++- tools/vm/page_owner_sort.c | 628 +++++++++++++++++++++----- 73 files changed, 2797 insertions(+), 1288 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-03-23 23:04 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-03-23 23:04 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches Various misc subsystems, before getting into the post-linux-next material. This is all based on v5.17. I tested applying and compiling against today's 1bc191051dca28fa6. One patch required an extra whack, all looks good. 41 patches, based on f443e374ae131c168a065ea1748feac6b2e76613. Subsystems affected by this patch series: procfs misc core-kernel lib checkpatch init pipe minix fat cgroups kexec kdump taskstats panic kcov resource ubsan Subsystem: procfs Hao Lee <haolee.swjtu@gmail.com>: proc: alloc PATH_MAX bytes for /proc/${pid}/fd/ symlinks David Hildenbrand <david@redhat.com>: proc/vmcore: fix possible deadlock on concurrent mmap and read Yang Li <yang.lee@linux.alibaba.com>: proc/vmcore: fix vmcore_alloc_buf() kernel-doc comment Subsystem: misc Bjorn Helgaas <bhelgaas@google.com>: linux/types.h: remove unnecessary __bitwise__ Documentation/sparse: add hints about __CHECKER__ Subsystem: core-kernel Miaohe Lin <linmiaohe@huawei.com>: kernel/ksysfs.c: use helper macro __ATTR_RW Subsystem: lib Kees Cook <keescook@chromium.org>: Kconfig.debug: make DEBUG_INFO selectable from a choice Rasmus Villemoes <linux@rasmusvillemoes.dk>: include: drop pointless __compiler_offsetof indirection Christophe Leroy <christophe.leroy@csgroup.eu>: ilog2: force inlining of __ilog2_u32() and __ilog2_u64() Andy Shevchenko <andriy.shevchenko@linux.intel.com>: bitfield: add explicit inclusions to the example Feng Tang <feng.tang@intel.com>: lib/Kconfig.debug: add ARCH dependency for FUNCTION_ALIGN option Randy Dunlap <rdunlap@infradead.org>: lib: bitmap: fix many kernel-doc warnings Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: prefer MODULE_LICENSE("GPL") over MODULE_LICENSE("GPL v2") checkpatch: add --fix option for some TRAILING_STATEMENTS checkpatch: add early_param exception to blank line after struct/function test Sagar Patel <sagarmp@cs.unc.edu>: checkpatch: use python3 to find codespell dictionary Subsystem: init Mark-PK Tsai <mark-pk.tsai@mediatek.com>: init: use ktime_us_delta() to make initcall_debug log more precise Randy Dunlap <rdunlap@infradead.org>: init.h: improve __setup and early_param documentation init/main.c: return 1 from handled __setup() functions Subsystem: pipe Andrei Vagin <avagin@gmail.com>: fs/pipe: use kvcalloc to allocate a pipe_buffer array fs/pipe.c: local vars have to match types of proper pipe_inode_info fields Subsystem: minix Qinghua Jin <qhjin.dev@gmail.com>: minix: fix bug when opening a file with O_DIRECT Subsystem: fat Helge Deller <deller@gmx.de>: fat: use pointer to simple type in put_user() Subsystem: cgroups Sebastian Andrzej Siewior <bigeasy@linutronix.de>: cgroup: use irqsave in cgroup_rstat_flush_locked(). cgroup: add a comment to cgroup_rstat_flush_locked(). Subsystem: kexec Jisheng Zhang <jszhang@kernel.org>: Patch series "kexec: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef", v2: kexec: make crashk_res, crashk_low_res and crash_notes symbols always visible riscv: mm: init: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef x86/setup: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef arm64: mm: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef Subsystem: kdump Tiezhu Yang <yangtiezhu@loongson.cn>: Patch series "Update doc and fix some issues about kdump", v2: docs: kdump: update description about sysfs file system support docs: kdump: add scp example to write out the dump file panic: unset panic_on_warn inside panic() ubsan: no need to unset panic_on_warn in ubsan_epilogue() kasan: no need to unset panic_on_warn in end_report() Subsystem: taskstats Lukas Bulwahn <lukas.bulwahn@gmail.com>: taskstats: remove unneeded dead assignment Subsystem: panic "Guilherme G. Piccoli" <gpiccoli@igalia.com>: Patch series "Some improvements on panic_print": docs: sysctl/kernel: add missing bit to panic_print panic: add option to dump all CPUs backtraces in panic_print panic: move panic_print before kmsg dumpers Subsystem: kcov Aleksandr Nogikh <nogikh@google.com>: Patch series "kcov: improve mmap processing", v3: kcov: split ioctl handling into locked and unlocked parts kcov: properly handle subsequent mmap calls Subsystem: resource Miaohe Lin <linmiaohe@huawei.com>: kernel/resource: fix kfree() of bootmem memory again Subsystem: ubsan Marco Elver <elver@google.com>: Revert "ubsan, kcsan: Don't combine sanitizer with kcov on clang" Documentation/admin-guide/kdump/kdump.rst | 10 + Documentation/admin-guide/kernel-parameters.txt | 5 Documentation/admin-guide/sysctl/kernel.rst | 2 Documentation/dev-tools/sparse.rst | 2 arch/arm64/mm/init.c | 9 - arch/riscv/mm/init.c | 6 - arch/x86/kernel/setup.c | 10 - fs/fat/dir.c | 2 fs/minix/inode.c | 3 fs/pipe.c | 13 +- fs/proc/base.c | 8 - fs/proc/vmcore.c | 43 +++---- include/linux/bitfield.h | 3 include/linux/compiler_types.h | 3 include/linux/init.h | 11 + include/linux/kexec.h | 12 +- include/linux/log2.h | 4 include/linux/stddef.h | 6 - include/uapi/linux/types.h | 6 - init/main.c | 14 +- kernel/cgroup/rstat.c | 13 +- kernel/kcov.c | 102 ++++++++--------- kernel/ksysfs.c | 3 kernel/panic.c | 37 ++++-- kernel/resource.c | 41 +----- kernel/taskstats.c | 5 lib/Kconfig.debug | 142 ++++++++++++------------ lib/Kconfig.kcsan | 11 - lib/Kconfig.ubsan | 12 -- lib/bitmap.c | 24 ++-- lib/ubsan.c | 10 - mm/kasan/report.c | 10 - scripts/checkpatch.pl | 31 ++++- tools/include/linux/types.h | 5 34 files changed, 313 insertions(+), 305 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-03-22 21:38 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-03-22 21:38 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches - A few misc subsystems - There is a lot of MM material in Willy's tree. Folio work and non-folio patches which depended on that work. Here I send almost all the MM patches which precede the patches in Willy's tree. The remaining ~100 MM patches are staged on Willy's tree and I'll send those along once Willy is merged up. I tried this batch against your current tree (as of 51912904076680281) and a couple need some extra persuasion to apply, but all looks OK otherwise. 227 patches, based on f443e374ae131c168a065ea1748feac6b2e76613 Subsystems affected by this patch series: kthread scripts ntfs ocfs2 block vfs mm/kasan mm/pagecache mm/gup mm/swap mm/shmem mm/memcg mm/selftests mm/pagemap mm/mremap mm/sparsemem mm/vmalloc mm/pagealloc mm/memory-failure mm/mlock mm/hugetlb mm/userfaultfd mm/vmscan mm/compaction mm/mempolicy mm/oom-kill mm/migration mm/thp mm/cma mm/autonuma mm/psi mm/ksm mm/page-poison mm/madvise mm/memory-hotplug mm/rmap mm/zswap mm/uaccess mm/ioremap mm/highmem mm/cleanups mm/kfence mm/hmm mm/damon Subsystem: kthread Rasmus Villemoes <linux@rasmusvillemoes.dk>: linux/kthread.h: remove unused macros Subsystem: scripts Colin Ian King <colin.i.king@gmail.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ntfs Dongliang Mu <mudongliangabcd@gmail.com>: ntfs: add sanity check on allocation size Subsystem: ocfs2 Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: cleanup some return variables hongnanli <hongnan.li@linux.alibaba.com>: fs/ocfs2: fix comments mentioning i_mutex Subsystem: block NeilBrown <neilb@suse.de>: Patch series "Remove remaining parts of congestion tracking code", v2: doc: convert 'subsection' to 'section' in gfp.h mm: document and polish read-ahead code mm: improve cleanup when ->readpages doesn't process all pages fuse: remove reliance on bdi congestion nfs: remove reliance on bdi congestion ceph: remove reliance on bdi congestion remove inode_congested() remove bdi_congested() and wb_congested() and related functions f2fs: replace congestion_wait() calls with io_schedule_timeout() block/bfq-iosched.c: use "false" rather than "BLK_RW_ASYNC" remove congestion tracking framework Subsystem: vfs Anthony Iliopoulos <ailiop@suse.com>: mount: warn only once about timestamp range expiration Subsystem: mm/kasan Miaohe Lin <linmiaohe@huawei.com>: mm/memremap: avoid calling kasan_remove_zero_shadow() for device private memory Subsystem: mm/pagecache Miaohe Lin <linmiaohe@huawei.com>: filemap: remove find_get_pages() mm/writeback: minor clean up for highmem_dirtyable_memory Minchan Kim <minchan@kernel.org>: mm: fs: fix lru_cache_disabled race in bh_lru Subsystem: mm/gup Peter Xu <peterx@redhat.com>: Patch series "mm/gup: some cleanups", v5: mm: fix invalid page pointer returned with FOLL_PIN gups John Hubbard <jhubbard@nvidia.com>: mm/gup: follow_pfn_pte(): -EEXIST cleanup mm/gup: remove unused pin_user_pages_locked() mm: change lookup_node() to use get_user_pages_fast() mm/gup: remove unused get_user_pages_locked() Subsystem: mm/swap Bang Li <libang.linuxer@gmail.com>: mm/swap: fix confusing comment in folio_mark_accessed Subsystem: mm/shmem Xavier Roche <xavier.roche@algolia.com>: tmpfs: support for file creation time Hugh Dickins <hughd@google.com>: shmem: mapping_set_exiting() to help mapped resilience tmpfs: do not allocate pages on read Miaohe Lin <linmiaohe@huawei.com>: mm: shmem: use helper macro __ATTR_RW Subsystem: mm/memcg Shakeel Butt <shakeelb@google.com>: memcg: replace in_interrupt() with !in_task() Yosry Ahmed <yosryahmed@google.com>: memcg: add per-memcg total kernel memory stat Wei Yang <richard.weiyang@gmail.com>: mm/memcg: mem_cgroup_per_node is already set to 0 on allocation mm/memcg: retrieve parent memcg from css.parent Shakeel Butt <shakeelb@google.com>: Patch series "memcg: robust enforcement of memory.high", v2: memcg: refactor mem_cgroup_oom memcg: unify force charging conditions selftests: memcg: test high limit for single entry allocation memcg: synchronously enforce memory.high for large overcharges Randy Dunlap <rdunlap@infradead.org>: mm/memcontrol: return 1 from cgroup.memory __setup() handler Michal Hocko <mhocko@suse.com>: Patch series "mm/memcg: Address PREEMPT_RT problems instead of disabling it", v5: mm/memcg: revert ("mm/memcg: optimize user context object stock access") Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/memcg: disable threshold event handlers on PREEMPT_RT mm/memcg: protect per-CPU counter by disabling preemption on PREEMPT_RT where needed. Johannes Weiner <hannes@cmpxchg.org>: mm/memcg: opencode the inner part of obj_cgroup_uncharge_pages() in drain_obj_stock() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/memcg: protect memcg_stock with a local_lock_t mm/memcg: disable migration instead of preemption in drain_all_stock(). Muchun Song <songmuchun@bytedance.com>: Patch series "Optimize list lru memory consumption", v6: mm: list_lru: transpose the array of per-node per-memcg lru lists mm: introduce kmem_cache_alloc_lru fs: introduce alloc_inode_sb() to allocate filesystems specific inode fs: allocate inode by using alloc_inode_sb() f2fs: allocate inode by using alloc_inode_sb() mm: dcache: use kmem_cache_alloc_lru() to allocate dentry xarray: use kmem_cache_alloc_lru to allocate xa_node mm: memcontrol: move memcg_online_kmem() to mem_cgroup_css_online() mm: list_lru: allocate list_lru_one only when needed mm: list_lru: rename memcg_drain_all_list_lrus to memcg_reparent_list_lrus mm: list_lru: replace linear array with xarray mm: memcontrol: reuse memory cgroup ID for kmem ID mm: memcontrol: fix cannot alloc the maximum memcg ID mm: list_lru: rename list_lru_per_memcg to list_lru_memcg mm: memcontrol: rename memcg_cache_id to memcg_kmem_id Vasily Averin <vvs@virtuozzo.com>: memcg: enable accounting for tty-related objects Subsystem: mm/selftests Guillaume Tucker <guillaume.tucker@collabora.com>: selftests, x86: fix how check_cc.sh is being invoked Subsystem: mm/pagemap Anshuman Khandual <anshuman.khandual@arm.com>: mm: merge pte_mkhuge() call into arch_make_huge_pte() Stafford Horne <shorne@gmail.com>: mm: remove mmu_gathers storage from remaining architectures Muchun Song <songmuchun@bytedance.com>: Patch series "Fix some cache flush bugs", v5: mm: thp: fix wrong cache flush in remove_migration_pmd() mm: fix missing cache flush for all tail pages of compound page mm: hugetlb: fix missing cache flush in copy_huge_page_from_user() mm: hugetlb: fix missing cache flush in hugetlb_mcopy_atomic_pte() mm: shmem: fix missing cache flush in shmem_mfill_atomic_pte() mm: userfaultfd: fix missing cache flush in mcopy_atomic_pte() and __mcopy_atomic() mm: replace multiple dcache flush with flush_dcache_folio() Peter Xu <peterx@redhat.com>: Patch series "mm: Rework zap ptes on swap entries", v5: mm: don't skip swap entry even if zap_details specified mm: rename zap_skip_check_mapping() to should_zap_page() mm: change zap_details.zap_mapping into even_cows mm: rework swap handling of zap_pte_range Randy Dunlap <rdunlap@infradead.org>: mm/mmap: return 1 from stack_guard_gap __setup() handler Miaohe Lin <linmiaohe@huawei.com>: mm/memory.c: use helper function range_in_vma() mm/memory.c: use helper macro min and max in unmap_mapping_range_tree() Hugh Dickins <hughd@google.com>: mm: _install_special_mapping() apply VM_LOCKED_CLEAR_MASK Miaohe Lin <linmiaohe@huawei.com>: mm/mmap: remove obsolete comment in ksys_mmap_pgoff Subsystem: mm/mremap Miaohe Lin <linmiaohe@huawei.com>: mm/mremap:: use vma_lookup() instead of find_vma() Subsystem: mm/sparsemem Miaohe Lin <linmiaohe@huawei.com>: mm/sparse: make mminit_validate_memmodel_limits() static Subsystem: mm/vmalloc Miaohe Lin <linmiaohe@huawei.com>: mm/vmalloc: remove unneeded function forward declaration "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: Move draining areas out of caller context Uladzislau Rezki <uladzislau.rezki@sony.com>: mm/vmalloc: add adjust_search_size parameter "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: eliminate an extra orig_gfp_mask Jiapeng Chong <jiapeng.chong@linux.alibaba.com>: mm/vmalloc.c: fix "unused function" warning Bang Li <libang.linuxer@gmail.com>: mm/vmalloc: fix comments about vmap_area struct Subsystem: mm/pagealloc Zi Yan <ziy@nvidia.com>: mm: page_alloc: avoid merging non-fallbackable pageblocks with others Peter Collingbourne <pcc@google.com>: mm/mmzone.c: use try_cmpxchg() in page_cpupid_xchg_last() Miaohe Lin <linmiaohe@huawei.com>: mm/mmzone.h: remove unused macros Nicolas Saenz Julienne <nsaenzju@redhat.com>: mm/page_alloc: don't pass pfn to free_unref_page_commit() David Hildenbrand <david@redhat.com>: Patch series "mm: enforce pageblock_order < MAX_ORDER": cma: factor out minimum alignment requirement mm: enforce pageblock_order < MAX_ORDER Nathan Chancellor <nathan@kernel.org>: mm/page_alloc: mark pagesets as __maybe_unused Alistair Popple <apopple@nvidia.com>: mm/pages_alloc.c: don't create ZONE_MOVABLE beyond the end of a node Mel Gorman <mgorman@techsingularity.net>: Patch series "Follow-up on high-order PCP caching", v2: mm/page_alloc: fetch the correct pcp buddy during bulk free mm/page_alloc: track range of active PCP lists during bulk free mm/page_alloc: simplify how many pages are selected per pcp list during bulk free mm/page_alloc: drain the requested list first during bulk free mm/page_alloc: free pages in a single pass during bulk free mm/page_alloc: limit number of high-order pages on PCP during bulk free mm/page_alloc: do not prefetch buddies during bulk free Oscar Salvador <osalvador@suse.de>: arch/x86/mm/numa: Do not initialize nodes twice Suren Baghdasaryan <surenb@google.com>: mm: count time in drain_all_pages during direct reclaim as memory pressure Eric Dumazet <edumazet@google.com>: mm/page_alloc: call check_new_pages() while zone spinlock is not held Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: check high-order pages for corruption during PCP operations Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/memory-failure.c: remove obsolete comment mm/hwpoison: fix error page recovered but reported "not recovered" Rik van Riel <riel@surriel.com>: mm: invalidate hwpoison page cache page in fault path Miaohe Lin <linmiaohe@huawei.com>: Patch series "A few cleanup and fixup patches for memory failure", v3: mm/memory-failure.c: minor clean up for memory_failure_dev_pagemap mm/memory-failure.c: catch unexpected -EFAULT from vma_address() mm/memory-failure.c: rework the signaling logic in kill_proc mm/memory-failure.c: fix race with changing page more robustly mm/memory-failure.c: remove PageSlab check in hwpoison_filter_dev mm/memory-failure.c: rework the try_to_unmap logic in hwpoison_user_mappings() mm/memory-failure.c: remove obsolete comment in __soft_offline_page mm/memory-failure.c: remove unnecessary PageTransTail check mm/hwpoison-inject: support injecting hwpoison to free page luofei <luofei@unicloud.com>: mm/hwpoison: avoid the impact of hwpoison_filter() return value on mce handler mm/hwpoison: add in-use hugepage hwpoison filter judgement Miaohe Lin <linmiaohe@huawei.com>: Patch series "A few fixup patches for memory failure", v2: mm/memory-failure.c: fix race with changing page compound again mm/memory-failure.c: avoid calling invalidate_inode_page() with unexpected pages mm/memory-failure.c: make non-LRU movable pages unhandlable Vlastimil Babka <vbabka@suse.cz>: mm, fault-injection: declare should_fail_alloc_page() Subsystem: mm/mlock Miaohe Lin <linmiaohe@huawei.com>: mm/mlock: fix potential imbalanced rlimit ucounts adjustment Subsystem: mm/hugetlb Muchun Song <songmuchun@bytedance.com>: Patch series "Free the 2nd vmemmap page associated with each HugeTLB page", v7: mm: hugetlb: free the 2nd vmemmap page associated with each HugeTLB page mm: hugetlb: replace hugetlb_free_vmemmap_enabled with a static_key mm: sparsemem: use page table lock to protect kernel pmd operations selftests: vm: add a hugetlb test case mm: sparsemem: move vmemmap related to HugeTLB to CONFIG_HUGETLB_PAGE_FREE_VMEMMAP Anshuman Khandual <anshuman.khandual@arm.com>: mm/hugetlb: generalize ARCH_WANT_GENERAL_HUGETLB Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: clean up potential spectre issue warnings Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: use helper macro __ATTR_RW David Howells <dhowells@redhat.com>: mm/hugetlb.c: export PageHeadHuge() Miaohe Lin <linmiaohe@huawei.com>: mm: remove unneeded local variable follflags Subsystem: mm/userfaultfd Nadav Amit <namit@vmware.com>: userfaultfd: provide unmasked address on page-fault Guo Zhengkui <guozhengkui@vivo.com>: userfaultfd/selftests: fix uninitialized_var.cocci warning Subsystem: mm/vmscan Hugh Dickins <hughd@google.com>: mm/fs: delete PF_SWAPWRITE mm: __isolate_lru_page_prepare() in isolate_migratepages_block() Waiman Long <longman@redhat.com>: mm/list_lru: optimize memcg_reparent_list_lru_node() Marcelo Tosatti <mtosatti@redhat.com>: mm: lru_cache_disable: replace work queue synchronization with synchronize_rcu Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm: workingset: replace IRQ-off check with a lockdep assert. Charan Teja Kalla <quic_charante@quicinc.com>: mm: vmscan: fix documentation for page_check_references() Subsystem: mm/compaction Baolin Wang <baolin.wang@linux.alibaba.com>: mm: compaction: cleanup the compaction trace events Subsystem: mm/mempolicy Hugh Dickins <hughd@google.com>: mempolicy: mbind_range() set_policy() after vma_merge() Subsystem: mm/oom-kill Miaohe Lin <linmiaohe@huawei.com>: mm/oom_kill: remove unneeded is_memcg_oom check Subsystem: mm/migration Huang Ying <ying.huang@intel.com>: mm,migrate: fix establishing demotion target "andrew.yang" <andrew.yang@mediatek.com>: mm/migrate: fix race between lock page and clear PG_Isolated Subsystem: mm/thp Hugh Dickins <hughd@google.com>: mm/thp: refix __split_huge_pmd_locked() for migration PMD Subsystem: mm/cma Hari Bathini <hbathini@linux.ibm.com>: Patch series "powerpc/fadump: handle CMA activation failure appropriately", v3: mm/cma: provide option to opt out from exposing pages on activation failure powerpc/fadump: opt out from freeing pages on cma activation failure Subsystem: mm/autonuma Huang Ying <ying.huang@intel.com>: Patch series "NUMA balancing: optimize memory placement for memory tiering system", v13: NUMA Balancing: add page promotion counter NUMA balancing: optimize page placement for memory tiering system memory tiering: skip to scan fast memory Subsystem: mm/psi Johannes Weiner <hannes@cmpxchg.org>: mm: page_io: fix psi memory pressure error on cold swapins Subsystem: mm/ksm Yang Yang <yang.yang29@zte.com.cn>: mm/vmstat: add event for ksm swapping in copy Miaohe Lin <linmiaohe@huawei.com>: mm/ksm: use helper macro __ATTR_RW Subsystem: mm/page-poison "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/hwpoison: check the subpage, not the head page Subsystem: mm/madvise Miaohe Lin <linmiaohe@huawei.com>: mm/madvise: use vma_lookup() instead of find_vma() Charan Teja Kalla <quic_charante@quicinc.com>: Patch series "mm: madvise: return correct bytes processed with: mm: madvise: return correct bytes advised with process_madvise mm: madvise: skip unmapped vma holes passed to process_madvise Subsystem: mm/memory-hotplug Michal Hocko <mhocko@suse.com>: Patch series "mm, memory_hotplug: handle unitialized numa node gracefully": mm, memory_hotplug: make arch_alloc_nodedata independent on CONFIG_MEMORY_HOTPLUG mm: handle uninitialized numa nodes gracefully mm, memory_hotplug: drop arch_free_nodedata mm, memory_hotplug: reorganize new pgdat initialization mm: make free_area_init_node aware of memory less nodes Wei Yang <richard.weiyang@gmail.com>: memcg: do not tweak node in alloc_mem_cgroup_per_node_info David Hildenbrand <david@redhat.com>: drivers/base/memory: add memory block to memory group after registration succeeded drivers/base/node: consolidate node device subsystem initialization in node_dev_init() Miaohe Lin <linmiaohe@huawei.com>: Patch series "A few cleanup patches around memory_hotplug": mm/memory_hotplug: remove obsolete comment of __add_pages mm/memory_hotplug: avoid calling zone_intersects() for ZONE_NORMAL mm/memory_hotplug: clean up try_offline_node mm/memory_hotplug: fix misplaced comment in offline_pages David Hildenbrand <david@redhat.com>: Patch series "drivers/base/memory: determine and store zone for single-zone memory blocks", v2: drivers/base/node: rename link_mem_sections() to register_memory_block_under_node() drivers/base/memory: determine and store zone for single-zone memory blocks drivers/base/memory: clarify adding and removing of memory blocks Oscar Salvador <osalvador@suse.de>: mm: only re-generate demotion targets when a numa node changes its N_CPU state Subsystem: mm/rmap Hugh Dickins <hughd@google.com>: mm/thp: ClearPageDoubleMap in first page_add_file_rmap() Subsystem: mm/zswap "Maciej S. Szmigiero" <maciej.szmigiero@oracle.com>: mm/zswap.c: allow handling just same-value filled pages Subsystem: mm/uaccess Christophe Leroy <christophe.leroy@csgroup.eu>: mm: remove usercopy_warn() mm: uninline copy_overflow() Randy Dunlap <rdunlap@infradead.org>: mm/usercopy: return 1 from hardened_usercopy __setup() handler Subsystem: mm/ioremap Vlastimil Babka <vbabka@suse.cz>: mm/early_ioremap: declare early_memremap_pgprot_adjust() Subsystem: mm/highmem Ira Weiny <ira.weiny@intel.com>: highmem: document kunmap_local() Miaohe Lin <linmiaohe@huawei.com>: mm/highmem: remove unnecessary done label Subsystem: mm/cleanups "Dr. David Alan Gilbert" <linux@treblig.org>: mm/page_table_check.c: use strtobool for param parsing Subsystem: mm/kfence tangmeng <tangmeng@uniontech.com>: mm/kfence: remove unnecessary CONFIG_KFENCE option Tianchen Ding <dtcccc@linux.alibaba.com>: Patch series "provide the flexibility to enable KFENCE", v3: kfence: allow re-enabling KFENCE after system startup kfence: alloc kfence_pool after system startup Peng Liu <liupeng256@huawei.com>: Patch series "kunit: fix a UAF bug and do some optimization", v2: kunit: fix UAF when run kfence test case test_gfpzero kunit: make kunit_test_timeout compatible with comment kfence: test: try to avoid test_gfpzero trigger rcu_stall Marco Elver <elver@google.com>: kfence: allow use of a deferrable timer Subsystem: mm/hmm Miaohe Lin <linmiaohe@huawei.com>: mm/hmm.c: remove unneeded local variable ret Subsystem: mm/damon SeongJae Park <sj@kernel.org>: Patch series "Remove the type-unclear target id concept": mm/damon/dbgfs/init_regions: use target index instead of target id Docs/admin-guide/mm/damon/usage: update for changed initail_regions file input mm/damon/core: move damon_set_targets() into dbgfs mm/damon: remove the target id concept Baolin Wang <baolin.wang@linux.alibaba.com>: mm/damon: remove redundant page validation SeongJae Park <sj@kernel.org>: Patch series "Allow DAMON user code independent of monitoring primitives": mm/damon: rename damon_primitives to damon_operations mm/damon: let monitoring operations can be registered and selected mm/damon/paddr,vaddr: register themselves to DAMON in subsys_initcall mm/damon/reclaim: use damon_select_ops() instead of damon_{v,p}a_set_operations() mm/damon/dbgfs: use damon_select_ops() instead of damon_{v,p}a_set_operations() mm/damon/dbgfs: use operations id for knowing if the target has pid mm/damon/dbgfs-test: fix is_target_id() change mm/damon/paddr,vaddr: remove damon_{p,v}a_{target_valid,set_operations}() tangmeng <tangmeng@uniontech.com>: mm/damon: remove unnecessary CONFIG_DAMON option SeongJae Park <sj@kernel.org>: Patch series "Docs/damon: Update documents for better consistency": Docs/vm/damon: call low level monitoring primitives the operations Docs/vm/damon/design: update DAMON-Idle Page Tracking interference handling Docs/damon: update outdated term 'regions update interval' Patch series "Introduce DAMON sysfs interface", v3: mm/damon/core: allow non-exclusive DAMON start/stop mm/damon/core: add number of each enum type values mm/damon: implement a minimal stub for sysfs-based DAMON interface mm/damon/sysfs: link DAMON for virtual address spaces monitoring mm/damon/sysfs: support the physical address space monitoring mm/damon/sysfs: support DAMON-based Operation Schemes mm/damon/sysfs: support DAMOS quotas mm/damon/sysfs: support schemes prioritization mm/damon/sysfs: support DAMOS watermarks mm/damon/sysfs: support DAMOS stats selftests/damon: add a test for DAMON sysfs interface Docs/admin-guide/mm/damon/usage: document DAMON sysfs interface Docs/ABI/testing: add DAMON sysfs interface ABI document Xin Hao <xhao@linux.alibaba.com>: mm/damon/sysfs: remove repeat container_of() in damon_sysfs_kdamond_release() Documentation/ABI/testing/sysfs-kernel-mm-damon | 274 ++ Documentation/admin-guide/cgroup-v1/memory.rst | 2 Documentation/admin-guide/cgroup-v2.rst | 5 Documentation/admin-guide/kernel-parameters.txt | 2 Documentation/admin-guide/mm/damon/usage.rst | 380 +++ Documentation/admin-guide/mm/zswap.rst | 22 Documentation/admin-guide/sysctl/kernel.rst | 31 Documentation/core-api/mm-api.rst | 19 Documentation/dev-tools/kfence.rst | 12 Documentation/filesystems/porting.rst | 6 Documentation/filesystems/vfs.rst | 16 Documentation/vm/damon/design.rst | 43 Documentation/vm/damon/faq.rst | 2 MAINTAINERS | 1 arch/arm/Kconfig | 4 arch/arm64/kernel/setup.c | 3 arch/arm64/mm/hugetlbpage.c | 1 arch/hexagon/mm/init.c | 2 arch/ia64/kernel/topology.c | 10 arch/ia64/mm/discontig.c | 11 arch/mips/kernel/topology.c | 5 arch/nds32/mm/init.c | 1 arch/openrisc/mm/init.c | 2 arch/powerpc/include/asm/fadump-internal.h | 5 arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h | 4 arch/powerpc/kernel/fadump.c | 8 arch/powerpc/kernel/sysfs.c | 17 arch/riscv/Kconfig | 4 arch/riscv/kernel/setup.c | 3 arch/s390/kernel/numa.c | 7 arch/sh/kernel/topology.c | 5 arch/sparc/kernel/sysfs.c | 12 arch/sparc/mm/hugetlbpage.c | 1 arch/x86/Kconfig | 4 arch/x86/kernel/cpu/mce/core.c | 8 arch/x86/kernel/topology.c | 5 arch/x86/mm/numa.c | 33 block/bdev.c | 2 block/bfq-iosched.c | 2 drivers/base/init.c | 1 drivers/base/memory.c | 149 + drivers/base/node.c | 48 drivers/block/drbd/drbd_int.h | 3 drivers/block/drbd/drbd_req.c | 3 drivers/dax/super.c | 2 drivers/of/of_reserved_mem.c | 9 drivers/tty/tty_io.c | 2 drivers/virtio/virtio_mem.c | 9 fs/9p/vfs_inode.c | 2 fs/adfs/super.c | 2 fs/affs/super.c | 2 fs/afs/super.c | 2 fs/befs/linuxvfs.c | 2 fs/bfs/inode.c | 2 fs/btrfs/inode.c | 2 fs/buffer.c | 8 fs/ceph/addr.c | 22 fs/ceph/inode.c | 2 fs/ceph/super.c | 1 fs/ceph/super.h | 1 fs/cifs/cifsfs.c | 2 fs/coda/inode.c | 2 fs/dcache.c | 3 fs/ecryptfs/super.c | 2 fs/efs/super.c | 2 fs/erofs/super.c | 2 fs/exfat/super.c | 2 fs/ext2/ialloc.c | 5 fs/ext2/super.c | 2 fs/ext4/super.c | 2 fs/f2fs/compress.c | 4 fs/f2fs/data.c | 3 fs/f2fs/f2fs.h | 6 fs/f2fs/segment.c | 8 fs/f2fs/super.c | 14 fs/fat/inode.c | 2 fs/freevxfs/vxfs_super.c | 2 fs/fs-writeback.c | 40 fs/fuse/control.c | 17 fs/fuse/dev.c | 8 fs/fuse/file.c | 17 fs/fuse/inode.c | 2 fs/gfs2/super.c | 2 fs/hfs/super.c | 2 fs/hfsplus/super.c | 2 fs/hostfs/hostfs_kern.c | 2 fs/hpfs/super.c | 2 fs/hugetlbfs/inode.c | 2 fs/inode.c | 2 fs/isofs/inode.c | 2 fs/jffs2/super.c | 2 fs/jfs/super.c | 2 fs/minix/inode.c | 2 fs/namespace.c | 2 fs/nfs/inode.c | 2 fs/nfs/write.c | 14 fs/nilfs2/segbuf.c | 16 fs/nilfs2/super.c | 2 fs/ntfs/inode.c | 6 fs/ntfs3/super.c | 2 fs/ocfs2/alloc.c | 2 fs/ocfs2/aops.c | 2 fs/ocfs2/cluster/nodemanager.c | 2 fs/ocfs2/dir.c | 4 fs/ocfs2/dlmfs/dlmfs.c | 2 fs/ocfs2/file.c | 13 fs/ocfs2/inode.c | 2 fs/ocfs2/localalloc.c | 6 fs/ocfs2/namei.c | 2 fs/ocfs2/ocfs2.h | 4 fs/ocfs2/quota_global.c | 2 fs/ocfs2/stack_user.c | 18 fs/ocfs2/super.c | 2 fs/ocfs2/xattr.c | 2 fs/openpromfs/inode.c | 2 fs/orangefs/super.c | 2 fs/overlayfs/super.c | 2 fs/proc/inode.c | 2 fs/qnx4/inode.c | 2 fs/qnx6/inode.c | 2 fs/reiserfs/super.c | 2 fs/romfs/super.c | 2 fs/squashfs/super.c | 2 fs/sysv/inode.c | 2 fs/ubifs/super.c | 2 fs/udf/super.c | 2 fs/ufs/super.c | 2 fs/userfaultfd.c | 5 fs/vboxsf/super.c | 2 fs/xfs/libxfs/xfs_btree.c | 2 fs/xfs/xfs_buf.c | 3 fs/xfs/xfs_icache.c | 2 fs/zonefs/super.c | 2 include/linux/backing-dev-defs.h | 8 include/linux/backing-dev.h | 50 include/linux/cma.h | 14 include/linux/damon.h | 95 include/linux/fault-inject.h | 2 include/linux/fs.h | 21 include/linux/gfp.h | 10 include/linux/highmem-internal.h | 10 include/linux/hugetlb.h | 8 include/linux/kthread.h | 22 include/linux/list_lru.h | 45 include/linux/memcontrol.h | 46 include/linux/memory.h | 12 include/linux/memory_hotplug.h | 132 - include/linux/migrate.h | 8 include/linux/mm.h | 11 include/linux/mmzone.h | 22 include/linux/nfs_fs_sb.h | 1 include/linux/node.h | 25 include/linux/page-flags.h | 96 include/linux/pageblock-flags.h | 7 include/linux/pagemap.h | 7 include/linux/sched.h | 1 include/linux/sched/sysctl.h | 10 include/linux/shmem_fs.h | 1 include/linux/slab.h | 3 include/linux/swap.h | 6 include/linux/thread_info.h | 5 include/linux/uaccess.h | 2 include/linux/vm_event_item.h | 3 include/linux/vmalloc.h | 4 include/linux/xarray.h | 9 include/ras/ras_event.h | 1 include/trace/events/compaction.h | 26 include/trace/events/writeback.h | 28 include/uapi/linux/userfaultfd.h | 8 ipc/mqueue.c | 2 kernel/dma/contiguous.c | 4 kernel/sched/core.c | 21 kernel/sysctl.c | 2 lib/Kconfig.kfence | 12 lib/kunit/try-catch.c | 3 lib/xarray.c | 10 mm/Kconfig | 6 mm/backing-dev.c | 57 mm/cma.c | 31 mm/cma.h | 1 mm/compaction.c | 60 mm/damon/Kconfig | 19 mm/damon/Makefile | 7 mm/damon/core-test.h | 23 mm/damon/core.c | 190 + mm/damon/dbgfs-test.h | 103 mm/damon/dbgfs.c | 264 +- mm/damon/ops-common.c | 133 + mm/damon/ops-common.h | 16 mm/damon/paddr.c | 62 mm/damon/prmtv-common.c | 133 - mm/damon/prmtv-common.h | 16 mm/damon/reclaim.c | 11 mm/damon/sysfs.c | 2632 ++++++++++++++++++++++- mm/damon/vaddr-test.h | 8 mm/damon/vaddr.c | 67 mm/early_ioremap.c | 1 mm/fadvise.c | 5 mm/filemap.c | 17 mm/gup.c | 103 mm/highmem.c | 9 mm/hmm.c | 3 mm/huge_memory.c | 41 mm/hugetlb.c | 23 mm/hugetlb_vmemmap.c | 74 mm/hwpoison-inject.c | 7 mm/internal.h | 19 mm/kfence/Makefile | 2 mm/kfence/core.c | 147 + mm/kfence/kfence_test.c | 3 mm/ksm.c | 6 mm/list_lru.c | 690 ++---- mm/maccess.c | 6 mm/madvise.c | 18 mm/memcontrol.c | 549 ++-- mm/memory-failure.c | 148 - mm/memory.c | 116 - mm/memory_hotplug.c | 136 - mm/mempolicy.c | 29 mm/memremap.c | 3 mm/migrate.c | 128 - mm/mlock.c | 1 mm/mmap.c | 5 mm/mmzone.c | 7 mm/mprotect.c | 13 mm/mremap.c | 4 mm/oom_kill.c | 3 mm/page-writeback.c | 12 mm/page_alloc.c | 429 +-- mm/page_io.c | 7 mm/page_table_check.c | 10 mm/ptdump.c | 16 mm/readahead.c | 124 + mm/rmap.c | 15 mm/shmem.c | 46 mm/slab.c | 39 mm/slab.h | 25 mm/slob.c | 6 mm/slub.c | 42 mm/sparse-vmemmap.c | 70 mm/sparse.c | 2 mm/swap.c | 25 mm/swapfile.c | 1 mm/usercopy.c | 16 mm/userfaultfd.c | 3 mm/vmalloc.c | 102 mm/vmscan.c | 138 - mm/vmstat.c | 19 mm/workingset.c | 7 mm/zswap.c | 15 net/socket.c | 2 net/sunrpc/rpc_pipe.c | 2 scripts/spelling.txt | 16 tools/testing/selftests/cgroup/cgroup_util.c | 15 tools/testing/selftests/cgroup/cgroup_util.h | 1 tools/testing/selftests/cgroup/test_memcontrol.c | 78 tools/testing/selftests/damon/Makefile | 1 tools/testing/selftests/damon/sysfs.sh | 306 ++ tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 7 tools/testing/selftests/vm/hugepage-vmemmap.c | 144 + tools/testing/selftests/vm/run_vmtests.sh | 11 tools/testing/selftests/vm/userfaultfd.c | 2 tools/testing/selftests/x86/Makefile | 6 264 files changed, 7205 insertions(+), 3090 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-03-16 23:14 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-03-16 23:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches 4 patches, based on 56e337f2cf1326323844927a04e9dbce9a244835. Subsystems affected by this patch series: mm/swap kconfig ocfs2 selftests Subsystem: mm/swap Guo Ziliang <guo.ziliang@zte.com.cn>: mm: swap: get rid of deadloop in swapin readahead Subsystem: kconfig Qian Cai <quic_qiancai@quicinc.com>: configs/debug: restore DEBUG_INFO=y for overriding Subsystem: ocfs2 Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: fix crash when initialize filecheck kobj fails Subsystem: selftests Yosry Ahmed <yosryahmed@google.com>: selftests: vm: fix clang build error multiple output files fs/ocfs2/super.c | 22 +++++++++++----------- kernel/configs/debug.config | 1 + mm/swap_state.c | 2 +- tools/testing/selftests/vm/Makefile | 6 ++---- 4 files changed, 15 insertions(+), 16 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-03-05 4:28 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-03-05 4:28 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches 8 patches, based on 07ebd38a0da24d2534da57b4841346379db9f354. Subsystems affected by this patch series: mm/hugetlb mm/pagemap memfd selftests mm/userfaultfd kconfig Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: selftests/vm: cleanup hugetlb file after mremap test Subsystem: mm/pagemap Suren Baghdasaryan <surenb@google.com>: mm: refactor vm_area_struct::anon_vma_name usage code mm: prevent vm_area_struct::anon_name refcount saturation mm: fix use-after-free when anon vma name is used after vma is freed Subsystem: memfd Hugh Dickins <hughd@google.com>: memfd: fix F_SEAL_WRITE after shmem huge page allocated Subsystem: selftests Chengming Zhou <zhouchengming@bytedance.com>: kselftest/vm: fix tests build with old libc Subsystem: mm/userfaultfd Yun Zhou <yun.zhou@windriver.com>: proc: fix documentation and description of pagemap Subsystem: kconfig Qian Cai <quic_qiancai@quicinc.com>: configs/debug: set CONFIG_DEBUG_INFO=y properly Documentation/admin-guide/mm/pagemap.rst | 2 fs/proc/task_mmu.c | 9 +- fs/userfaultfd.c | 6 - include/linux/mm.h | 7 + include/linux/mm_inline.h | 105 ++++++++++++++++++--------- include/linux/mm_types.h | 5 + kernel/configs/debug.config | 2 kernel/fork.c | 4 - kernel/sys.c | 19 +++- mm/madvise.c | 98 +++++++++---------------- mm/memfd.c | 40 +++++++--- mm/mempolicy.c | 2 mm/mlock.c | 2 mm/mmap.c | 12 +-- mm/mprotect.c | 2 tools/testing/selftests/vm/hugepage-mremap.c | 26 ++++-- tools/testing/selftests/vm/run_vmtests.sh | 3 tools/testing/selftests/vm/userfaultfd.c | 1 18 files changed, 201 insertions(+), 144 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-02-26 3:10 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-02-26 3:10 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches 12 patches, based on c47658311d60be064b839f329c0e4d34f5f0735b. Subsystems affected by this patch series: MAINTAINERS mm/hugetlb mm/kasan mm/hugetlbfs mm/pagemap mm/selftests mm/memcg m/slab mailmap memfd Subsystem: MAINTAINERS Luis Chamberlain <mcgrof@kernel.org>: MAINTAINERS: add sysctl-next git tree Subsystem: mm/hugetlb "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/hugetlb: fix kernel crash with hugetlb mremap Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: test: prevent cache merging in kmem_cache_double_destroy Subsystem: mm/hugetlbfs Liu Yuntao <liuyuntao10@huawei.com>: hugetlbfs: fix a truncation issue in hugepages parameter Subsystem: mm/pagemap Suren Baghdasaryan <surenb@google.com>: mm: fix use-after-free bug when mm->mmap is reused after being freed Subsystem: mm/selftests "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: selftest/vm: fix map_fixed_noreplace test failure Subsystem: mm/memcg Roman Gushchin <roman.gushchin@linux.dev>: MAINTAINERS: add Roman as a memcg co-maintainer Vladimir Davydov <vdavydov.dev@gmail.com>: MAINTAINERS: remove Vladimir from memcg maintainers Shakeel Butt <shakeelb@google.com>: MAINTAINERS: add Shakeel as a memcg co-maintainer Subsystem: m/slab Vlastimil Babka <vbabka@suse.cz>: MAINTAINERS, SLAB: add Roman as reviewer, git tree Subsystem: mailmap Roman Gushchin <roman.gushchin@linux.dev>: mailmap: update Roman Gushchin's email Subsystem: memfd Mike Kravetz <mike.kravetz@oracle.com>: selftests/memfd: clean up mapping in mfd_fail_write .mailmap | 3 + MAINTAINERS | 6 ++ lib/test_kasan.c | 5 +- mm/hugetlb.c | 11 ++--- mm/mmap.c | 1 tools/testing/selftests/memfd/memfd_test.c | 1 tools/testing/selftests/vm/map_fixed_noreplace.c | 49 +++++++++++++++++------ 7 files changed, 56 insertions(+), 20 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-02-12 0:27 Andrew Morton 2022-02-12 2:02 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2022-02-12 0:27 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43. Subsystems affected by this patch series: binfmt procfs mm/vmscan mm/memcg mm/kfence Subsystem: binfmt Mike Rapoport <rppt@linux.ibm.com>: fs/binfmt_elf: fix PT_LOAD p_align values for loaders Subsystem: procfs Yang Shi <shy828301@gmail.com>: fs/proc: task_mmu.c: don't read mapcount for migration entry Subsystem: mm/vmscan Mel Gorman <mgorman@suse.de>: mm: vmscan: remove deadlock due to throttling failing to make progress Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: memcg: synchronize objcg lists with a dedicated spinlock Subsystem: mm/kfence Peng Liu <liupeng256@huawei.com>: kfence: make test case compatible with run time set sample interval fs/binfmt_elf.c | 2 +- fs/proc/task_mmu.c | 40 +++++++++++++++++++++++++++++++--------- include/linux/kfence.h | 2 ++ include/linux/memcontrol.h | 5 +++-- mm/kfence/core.c | 3 ++- mm/kfence/kfence_test.c | 8 ++++---- mm/memcontrol.c | 10 +++++----- mm/vmscan.c | 4 +++- 8 files changed, 51 insertions(+), 23 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2022-02-12 0:27 incoming Andrew Morton @ 2022-02-12 2:02 ` Linus Torvalds 2022-02-12 5:24 ` incoming Andrew Morton 0 siblings, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2022-02-12 2:02 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits, patches On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43. So this *completely* flummoxed 'b4', because you first sent the wrong series, and then sent the right one in the same thread. I fetched the emails manually, but honestly, this was confusing even then, with two "[PATCH x/5]" series where the only way to tell the right one was basically by date of email. They did arrive in the same order in my mailbox, but even that wouldn't have been guaranteed if there had been some mailer delays somewhere.. So next time when you mess up, resend it all as a completely new series and completely new threading - so with a new header email too. Please? And since I'm here, let me just verify that yes, the series you actually want me to apply is this one (as described by the head email): Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values .. Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f.. Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl.. Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a .. Subject: [patch 5/5] kfence: make test case compatible with run.. and not the other one with GUP patches? Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2022-02-12 2:02 ` incoming Linus Torvalds @ 2022-02-12 5:24 ` Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-02-12 5:24 UTC (permalink / raw) To: Linus Torvalds; +Cc: Linux-MM, mm-commits, patches On Fri, 11 Feb 2022 18:02:53 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43. > > So this *completely* flummoxed 'b4', because you first sent the wrong > series, and then sent the right one in the same thread. > > I fetched the emails manually, but honestly, this was confusing even > then, with two "[PATCH x/5]" series where the only way to tell the > right one was basically by date of email. They did arrive in the same > order in my mailbox, but even that wouldn't have been guaranteed if > there had been some mailer delays somewhere.. Yes, I wondered. Sorry bout that. > So next time when you mess up, resend it all as a completely new > series and completely new threading - so with a new header email too. > Please? Wilco. > And since I'm here, let me just verify that yes, the series you > actually want me to apply is this one (as described by the head > email): > > Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values .. > Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f.. > Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl.. > Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a .. > Subject: [patch 5/5] kfence: make test case compatible with run.. > > and not the other one with GUP patches? Those are the ones. Five fixes, three with cc:stable. ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-02-04 4:48 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-02-04 4:48 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 10 patches, based on 1f2cfdd349b7647f438c1e552dc1b983da86d830. Subsystems affected by this patch series: mm/vmscan mm/debug mm/pagemap ipc mm/kmemleak MAINTAINERS mm/selftests Subsystem: mm/vmscan Chen Wandun <chenwandun@huawei.com>: Revert "mm/page_isolation: unset migratetype directly for non Buddy page" Subsystem: mm/debug Pasha Tatashin <pasha.tatashin@soleen.com>: Patch series "page table check fixes and cleanups", v5: mm/debug_vm_pgtable: remove pte entry from the page table mm/page_table_check: use unsigned long for page counters and cleanup mm/khugepaged: unify collapse pmd clear, flush and free mm/page_table_check: check entries at pmd levels Subsystem: mm/pagemap Mike Rapoport <rppt@linux.ibm.com>: mm/pgtable: define pte_index so that preprocessor could recognize it Subsystem: ipc Minghao Chi <chi.minghao@zte.com.cn>: ipc/sem: do not sleep with a spin lock held Subsystem: mm/kmemleak Lang Yu <lang.yu@amd.com>: mm/kmemleak: avoid scanning potential huge holes Subsystem: MAINTAINERS Mike Rapoport <rppt@linux.ibm.com>: MAINTAINERS: update rppt's email Subsystem: mm/selftests Shuah Khan <skhan@linuxfoundation.org>: kselftest/vm: revert "tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner" MAINTAINERS | 2 - include/linux/page_table_check.h | 19 ++++++++++ include/linux/pgtable.h | 1 ipc/sem.c | 4 +- mm/debug_vm_pgtable.c | 2 + mm/khugepaged.c | 37 +++++++++++--------- mm/kmemleak.c | 13 +++---- mm/page_isolation.c | 2 - mm/page_table_check.c | 55 +++++++++++++++---------------- tools/testing/selftests/vm/userfaultfd.c | 11 ++++-- 10 files changed, 89 insertions(+), 57 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-01-29 21:40 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-01-29 21:40 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 12 patches, based on f8c7e4ede46fe63ff10000669652648aab09d112. Subsystems affected by this patch series: sysctl binfmt ia64 mm/memory-failure mm/folios selftests mm/kasan mm/psi ocfs2 Subsystem: sysctl Andrew Morton <akpm@linux-foundation.org>: include/linux/sysctl.h: fix register_sysctl_mount_point() return type Subsystem: binfmt Tong Zhang <ztong0001@gmail.com>: binfmt_misc: fix crash when load/unload module Subsystem: ia64 Randy Dunlap <rdunlap@infradead.org>: ia64: make IA64_MCA_RECOVERY bool instead of tristate Subsystem: mm/memory-failure Joao Martins <joao.m.martins@oracle.com>: memory-failure: fetch compound_head after pgmap_pfn_valid() Subsystem: mm/folios Wei Yang <richard.weiyang@gmail.com>: mm: page->mapping folio->mapping should have the same offset Subsystem: selftests Maor Gottlieb <maorg@nvidia.com>: tools/testing/scatterlist: add missing defines Subsystem: mm/kasan Marco Elver <elver@google.com>: kasan: test: fix compatibility with FORTIFY_SOURCE Peter Collingbourne <pcc@google.com>: mm, kasan: use compare-exchange operation to set KASAN page tag Subsystem: mm/psi Suren Baghdasaryan <surenb@google.com>: psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n Subsystem: ocfs2 Joseph Qi <joseph.qi@linux.alibaba.com>: Patch series "ocfs2: fix a deadlock case": jbd2: export jbd2_journal_[grab|put]_journal_head ocfs2: fix a deadlock when commit trans arch/ia64/Kconfig | 2 fs/binfmt_misc.c | 8 +-- fs/jbd2/journal.c | 2 fs/ocfs2/suballoc.c | 25 ++++------- include/linux/mm.h | 17 +++++-- include/linux/mm_types.h | 1 include/linux/psi.h | 11 ++-- include/linux/sysctl.h | 2 kernel/sched/psi.c | 79 ++++++++++++++++++----------------- lib/test_kasan.c | 5 ++ mm/memory-failure.c | 6 ++ tools/testing/scatterlist/linux/mm.h | 3 - 12 files changed, 91 insertions(+), 70 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-01-29 2:13 Andrew Morton 2022-01-29 4:25 ` incoming Matthew Wilcox 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2022-01-29 2:13 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f. Subsystems affected by this patch series: sysctl binfmt ia64 mm/memory-failure mm/folios selftests mm/kasan mm/psi ocfs2 Subsystem: sysctl Andrew Morton <akpm@linux-foundation.org>: include/linux/sysctl.h: fix register_sysctl_mount_point() return type Subsystem: binfmt Tong Zhang <ztong0001@gmail.com>: binfmt_misc: fix crash when load/unload module Subsystem: ia64 Randy Dunlap <rdunlap@infradead.org>: ia64: make IA64_MCA_RECOVERY bool instead of tristate Subsystem: mm/memory-failure Joao Martins <joao.m.martins@oracle.com>: memory-failure: fetch compound_head after pgmap_pfn_valid() Subsystem: mm/folios Wei Yang <richard.weiyang@gmail.com>: mm: page->mapping folio->mapping should have the same offset Subsystem: selftests Maor Gottlieb <maorg@nvidia.com>: tools/testing/scatterlist: add missing defines Subsystem: mm/kasan Marco Elver <elver@google.com>: kasan: test: fix compatibility with FORTIFY_SOURCE Peter Collingbourne <pcc@google.com>: mm, kasan: use compare-exchange operation to set KASAN page tag Subsystem: mm/psi Suren Baghdasaryan <surenb@google.com>: psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n Subsystem: ocfs2 Joseph Qi <joseph.qi@linux.alibaba.com>: Patch series "ocfs2: fix a deadlock case": jbd2: export jbd2_journal_[grab|put]_journal_head ocfs2: fix a deadlock when commit trans arch/ia64/Kconfig | 2 fs/binfmt_misc.c | 8 +-- fs/jbd2/journal.c | 2 fs/ocfs2/suballoc.c | 25 ++++------- include/linux/mm.h | 17 +++++-- include/linux/mm_types.h | 1 include/linux/psi.h | 11 ++-- include/linux/sysctl.h | 2 kernel/sched/psi.c | 79 ++++++++++++++++++----------------- lib/test_kasan.c | 5 ++ mm/memory-failure.c | 6 ++ tools/testing/scatterlist/linux/mm.h | 3 - 12 files changed, 91 insertions(+), 70 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2022-01-29 2:13 incoming Andrew Morton @ 2022-01-29 4:25 ` Matthew Wilcox 2022-01-29 6:23 ` incoming Andrew Morton 0 siblings, 1 reply; 348+ messages in thread From: Matthew Wilcox @ 2022-01-29 4:25 UTC (permalink / raw) To: Andrew Morton; +Cc: Linus Torvalds, mm-commits, linux-mm On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote: > 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f. ^^ I see 7? ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2022-01-29 4:25 ` incoming Matthew Wilcox @ 2022-01-29 6:23 ` Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-01-29 6:23 UTC (permalink / raw) To: Matthew Wilcox; +Cc: Linus Torvalds, mm-commits, linux-mm On Sat, 29 Jan 2022 04:25:33 +0000 Matthew Wilcox <willy@infradead.org> wrote: > On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote: > > 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f. > ^^ > > I see 7? Crap, sorry, ignore all this, shall redo tomorrow. (It wasn't a good day over here. The thing with disk drives is that the bigger they are, the harder they fall). ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-01-22 6:10 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-01-22 6:10 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits This is the post-linux-next queue. Material which was based on or dependent upon material which was in -next. 69 patches, based on 9b57f458985742bd1c585f4c7f36d04634ce1143. Subsystems affected by this patch series: mm/migration sysctl mm/zsmalloc proc lib Subsystem: mm/migration Alistair Popple <apopple@nvidia.com>: mm/migrate.c: rework migration_entry_wait() to not take a pageref Subsystem: sysctl Xiaoming Ni <nixiaoming@huawei.com>: Patch series "sysctl: first set of kernel/sysctl cleanups", v2: sysctl: add a new register_sysctl_init() interface sysctl: move some boundary constants from sysctl.c to sysctl_vals hung_task: move hung_task sysctl interface to hung_task.c watchdog: move watchdog sysctl interface to watchdog.c Stephen Kitt <steve@sk2.org>: sysctl: make ngroups_max const Xiaoming Ni <nixiaoming@huawei.com>: sysctl: use const for typically used max/min proc sysctls sysctl: use SYSCTL_ZERO to replace some static int zero uses aio: move aio sysctl to aio.c dnotify: move dnotify sysctl to dnotify.c Luis Chamberlain <mcgrof@kernel.org>: Patch series "sysctl: second set of kernel/sysctl cleanups", v2: hpet: simplify subdirectory registration with register_sysctl() i915: simplify subdirectory registration with register_sysctl() macintosh/mac_hid.c: simplify subdirectory registration with register_sysctl() ocfs2: simplify subdirectory registration with register_sysctl() test_sysctl: simplify subdirectory registration with register_sysctl() Xiaoming Ni <nixiaoming@huawei.com>: inotify: simplify subdirectory registration with register_sysctl() Luis Chamberlain <mcgrof@kernel.org>: cdrom: simplify subdirectory registration with register_sysctl() Xiaoming Ni <nixiaoming@huawei.com>: eventpoll: simplify sysctl declaration with register_sysctl() Patch series "sysctl: 3rd set of kernel/sysctl cleanups", v2: firmware_loader: move firmware sysctl to its own files random: move the random sysctl declarations to its own file Luis Chamberlain <mcgrof@kernel.org>: sysctl: add helper to register a sysctl mount point fs: move binfmt_misc sysctl to its own file Xiaoming Ni <nixiaoming@huawei.com>: printk: move printk sysctl to printk/sysctl.c scsi/sg: move sg-big-buff sysctl to scsi/sg.c stackleak: move stack_erasing sysctl to stackleak.c Luis Chamberlain <mcgrof@kernel.org>: sysctl: share unsigned long const values Patch series "sysctl: 4th set of kernel/sysctl cleanups": fs: move inode sysctls to its own file fs: move fs stat sysctls to file_table.c fs: move dcache sysctls to its own file sysctl: move maxolduid as a sysctl specific const fs: move shared sysctls to fs/sysctls.c fs: move locking sysctls where they are used fs: move namei sysctls to its own file fs: move fs/exec.c sysctls into its own file fs: move pipe sysctls to is own file Patch series "sysctl: add and use base directory declarer and registration helper": sysctl: add and use base directory declarer and registration helper fs: move namespace sysctls and declare fs base directory kernel/sysctl.c: rename sysctl_init() to sysctl_init_bases() Xiaoming Ni <nixiaoming@huawei.com>: printk: fix build warning when CONFIG_PRINTK=n fs/coredump: move coredump sysctls into its own file kprobe: move sysctl_kprobes_optimization to kprobes.c Colin Ian King <colin.i.king@gmail.com>: kernel/sysctl.c: remove unused variable ten_thousand Baokun Li <libaokun1@huawei.com>: sysctl: returns -EINVAL when a negative value is passed to proc_doulongvec_minmax Subsystem: mm/zsmalloc Minchan Kim <minchan@kernel.org>: Patch series "zsmalloc: remove bit_spin_lock", v2: zsmalloc: introduce some helper functions zsmalloc: rename zs_stat_type to class_stat_type zsmalloc: decouple class actions from zspage works zsmalloc: introduce obj_allocated zsmalloc: move huge compressed obj from page to zspage zsmalloc: remove zspage isolation for migration locking/rwlocks: introduce write_lock_nested zsmalloc: replace per zpage lock with pool->migrate_lock Mike Galbraith <umgwanakikbuti@gmail.com>: zsmalloc: replace get_cpu_var with local_lock Subsystem: proc Muchun Song <songmuchun@bytedance.com>: fs: proc: store PDE()->data into inode->i_private proc: remove PDE_DATA() completely Subsystem: lib Vlastimil Babka <vbabka@suse.cz>: lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() lib/stackdepot: fix spelling mistake and grammar in pr_err message lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup3 lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup4 Marco Elver <elver@google.com>: lib/stackdepot: always do filter_irq_stacks() in stack_depot_save() Christoph Hellwig <hch@lst.de>: Patch series "remove Xen tmem leftovers": mm: remove cleancache frontswap: remove frontswap_writethrough frontswap: remove frontswap_tmem_exclusive_gets frontswap: remove frontswap_shrink frontswap: remove frontswap_curr_pages frontswap: simplify frontswap_init frontswap: remove the frontswap exports mm: simplify try_to_unuse frontswap: remove frontswap_test frontswap: simplify frontswap_register_ops mm: mark swap_lock and swap_active_head static frontswap: remove support for multiple ops mm: hide the FRONTSWAP Kconfig symbol Documentation/vm/cleancache.rst | 296 ------ Documentation/vm/frontswap.rst | 31 Documentation/vm/index.rst | 1 MAINTAINERS | 7 arch/alpha/kernel/srm_env.c | 4 arch/arm/configs/bcm2835_defconfig | 1 arch/arm/configs/qcom_defconfig | 1 arch/arm/kernel/atags_proc.c | 2 arch/arm/mm/alignment.c | 2 arch/ia64/kernel/salinfo.c | 10 arch/m68k/configs/amiga_defconfig | 1 arch/m68k/configs/apollo_defconfig | 1 arch/m68k/configs/atari_defconfig | 1 arch/m68k/configs/bvme6000_defconfig | 1 arch/m68k/configs/hp300_defconfig | 1 arch/m68k/configs/mac_defconfig | 1 arch/m68k/configs/multi_defconfig | 1 arch/m68k/configs/mvme147_defconfig | 1 arch/m68k/configs/mvme16x_defconfig | 1 arch/m68k/configs/q40_defconfig | 1 arch/m68k/configs/sun3_defconfig | 1 arch/m68k/configs/sun3x_defconfig | 1 arch/powerpc/kernel/proc_powerpc.c | 4 arch/s390/configs/debug_defconfig | 1 arch/s390/configs/defconfig | 1 arch/sh/mm/alignment.c | 4 arch/xtensa/platforms/iss/simdisk.c | 4 block/bdev.c | 5 drivers/acpi/proc.c | 2 drivers/base/firmware_loader/fallback.c | 7 drivers/base/firmware_loader/fallback.h | 11 drivers/base/firmware_loader/fallback_table.c | 25 drivers/cdrom/cdrom.c | 23 drivers/char/hpet.c | 22 drivers/char/random.c | 14 drivers/gpu/drm/drm_dp_mst_topology.c | 1 drivers/gpu/drm/drm_mm.c | 4 drivers/gpu/drm/drm_modeset_lock.c | 9 drivers/gpu/drm/i915/i915_perf.c | 22 drivers/gpu/drm/i915/intel_runtime_pm.c | 3 drivers/hwmon/dell-smm-hwmon.c | 4 drivers/macintosh/mac_hid.c | 24 drivers/net/bonding/bond_procfs.c | 8 drivers/net/wireless/cisco/airo.c | 22 drivers/net/wireless/intersil/hostap/hostap_ap.c | 16 drivers/net/wireless/intersil/hostap/hostap_download.c | 2 drivers/net/wireless/intersil/hostap/hostap_proc.c | 24 drivers/net/wireless/ray_cs.c | 2 drivers/nubus/proc.c | 36 drivers/parisc/led.c | 4 drivers/pci/proc.c | 10 drivers/platform/x86/thinkpad_acpi.c | 4 drivers/platform/x86/toshiba_acpi.c | 16 drivers/pnp/isapnp/proc.c | 2 drivers/pnp/pnpbios/proc.c | 4 drivers/scsi/scsi_proc.c | 4 drivers/scsi/sg.c | 35 drivers/usb/gadget/function/rndis.c | 4 drivers/zorro/proc.c | 2 fs/Makefile | 4 fs/afs/proc.c | 6 fs/aio.c | 31 fs/binfmt_misc.c | 6 fs/btrfs/extent_io.c | 10 fs/btrfs/super.c | 2 fs/coredump.c | 66 + fs/dcache.c | 37 fs/eventpoll.c | 10 fs/exec.c | 145 +-- fs/ext4/mballoc.c | 14 fs/ext4/readpage.c | 6 fs/ext4/super.c | 3 fs/f2fs/data.c | 13 fs/file_table.c | 47 - fs/inode.c | 39 fs/jbd2/journal.c | 2 fs/locks.c | 34 fs/mpage.c | 7 fs/namei.c | 58 + fs/namespace.c | 24 fs/notify/dnotify/dnotify.c | 21 fs/notify/fanotify/fanotify_user.c | 10 fs/notify/inotify/inotify_user.c | 11 fs/ntfs3/ntfs_fs.h | 1 fs/ocfs2/stackglue.c | 25 fs/ocfs2/super.c | 2 fs/pipe.c | 64 + fs/proc/generic.c | 6 fs/proc/inode.c | 1 fs/proc/internal.h | 5 fs/proc/proc_net.c | 8 fs/proc/proc_sysctl.c | 67 + fs/super.c | 3 fs/sysctls.c | 47 - include/linux/aio.h | 4 include/linux/cleancache.h | 124 -- include/linux/coredump.h | 10 include/linux/dcache.h | 10 include/linux/dnotify.h | 1 include/linux/fanotify.h | 2 include/linux/frontswap.h | 35 include/linux/fs.h | 18 include/linux/inotify.h | 3 include/linux/kprobes.h | 6 include/linux/migrate.h | 2 include/linux/mount.h | 3 include/linux/pipe_fs_i.h | 4 include/linux/poll.h | 2 include/linux/printk.h | 4 include/linux/proc_fs.h | 17 include/linux/ref_tracker.h | 2 include/linux/rwlock.h | 6 include/linux/rwlock_api_smp.h | 8 include/linux/rwlock_rt.h | 10 include/linux/sched/sysctl.h | 14 include/linux/seq_file.h | 2 include/linux/shmem_fs.h | 3 include/linux/spinlock_api_up.h | 1 include/linux/stackdepot.h | 25 include/linux/stackleak.h | 5 include/linux/swapfile.h | 3 include/linux/sysctl.h | 67 + include/scsi/sg.h | 4 init/main.c | 9 ipc/util.c | 2 kernel/hung_task.c | 81 + kernel/irq/proc.c | 8 kernel/kprobes.c | 30 kernel/locking/spinlock.c | 10 kernel/locking/spinlock_rt.c | 12 kernel/printk/Makefile | 5 kernel/printk/internal.h | 8 kernel/printk/printk.c | 4 kernel/printk/sysctl.c | 85 + kernel/resource.c | 4 kernel/stackleak.c | 26 kernel/sysctl.c | 790 +---------------- kernel/watchdog.c | 101 ++ lib/Kconfig | 4 lib/Kconfig.kasan | 2 lib/stackdepot.c | 46 lib/test_sysctl.c | 22 mm/Kconfig | 40 mm/Makefile | 1 mm/cleancache.c | 315 ------ mm/filemap.c | 102 +- mm/frontswap.c | 259 ----- mm/kasan/common.c | 1 mm/migrate.c | 38 mm/page_owner.c | 2 mm/shmem.c | 33 mm/swapfile.c | 90 - mm/truncate.c | 15 mm/zsmalloc.c | 557 ++++------- mm/zswap.c | 8 net/atm/proc.c | 4 net/bluetooth/af_bluetooth.c | 8 net/can/bcm.c | 2 net/can/proc.c | 2 net/core/neighbour.c | 6 net/core/pktgen.c | 6 net/ipv4/netfilter/ipt_CLUSTERIP.c | 6 net/ipv4/raw.c | 8 net/ipv4/tcp_ipv4.c | 2 net/ipv4/udp.c | 6 net/netfilter/x_tables.c | 10 net/netfilter/xt_hashlimit.c | 18 net/netfilter/xt_recent.c | 4 net/sunrpc/auth_gss/svcauth_gss.c | 4 net/sunrpc/cache.c | 24 net/sunrpc/stats.c | 2 sound/core/info.c | 4 172 files changed, 1877 insertions(+), 2931 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-01-20 2:07 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-01-20 2:07 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 55 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16") Subsystems affected by this patch series: percpu procfs sysctl misc core-kernel get_maintainer lib checkpatch binfmt nilfs2 hfs fat adfs panic delayacct kconfig kcov ubsan Subsystem: percpu Kefeng Wang <wangkefeng.wang@huawei.com>: Patch series "mm: percpu: Cleanup percpu first chunk function": mm: percpu: generalize percpu related config mm: percpu: add pcpu_fc_cpu_to_node_fn_t typedef mm: percpu: add generic pcpu_fc_alloc/free funciton mm: percpu: add generic pcpu_populate_pte() function Subsystem: procfs David Hildenbrand <david@redhat.com>: proc/vmcore: don't fake reading zeroes on surprise vmcore_cb unregistration Hans de Goede <hdegoede@redhat.com>: proc: make the proc_create[_data]() stubs static inlines Qi Zheng <zhengqi.arch@bytedance.com>: proc: convert the return type of proc_fd_access_allowed() to be boolean Subsystem: sysctl Geert Uytterhoeven <geert+renesas@glider.be>: sysctl: fix duplicate path separator in printed entries luo penghao <luo.penghao@zte.com.cn>: sysctl: remove redundant ret assignment Subsystem: misc Andy Shevchenko <andriy.shevchenko@linux.intel.com>: include/linux/unaligned: replace kernel.h with the necessary inclusions kernel.h: include a note to discourage people from including it in headers Subsystem: core-kernel Yafang Shao <laoar.shao@gmail.com>: Patch series "task comm cleanups", v2: fs/exec: replace strlcpy with strscpy_pad in __set_task_comm fs/exec: replace strncpy with strscpy_pad in __get_task_comm drivers/infiniband: replace open-coded string copy with get_task_comm fs/binfmt_elf: replace open-coded string copy with get_task_comm samples/bpf/test_overhead_kprobe_kern: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm tools/bpf/bpftool/skeleton: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm tools/testing/selftests/bpf: replace open-coded 16 with TASK_COMM_LEN kthread: dynamically allocate memory to store kthread's full name Davidlohr Bueso <dave@stgolabs.net>: kernel/sys.c: only take tasklist_lock for get/setpriority(PRIO_PGRP) Subsystem: get_maintainer Randy Dunlap <rdunlap@infradead.org>: get_maintainer: don't remind about no git repo when --nogit is used Subsystem: lib Alexey Dobriyan <adobriyan@gmail.com>: kstrtox: uninline everything Andy Shevchenko <andriy.shevchenko@linux.intel.com>: list: introduce list_is_head() helper and re-use it in list.h Zhen Lei <thunder.leizhen@huawei.com>: lib/list_debug.c: print more list debugging context in __list_del_entry_valid() Isabella Basso <isabbasso@riseup.net>: Patch series "test_hash.c: refactor into KUnit", v3: hash.h: remove unused define directive test_hash.c: split test_int_hash into arch-specific functions test_hash.c: split test_hash_init lib/Kconfig.debug: properly split hash test kernel entries test_hash.c: refactor into kunit Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kunit: replace kernel.h with the necessary inclusions uuid: discourage people from using UAPI header in new code uuid: remove licence boilerplate text from the header Andrey Konovalov <andreyknvl@google.com>: lib/test_meminit: destroy cache in kmem_cache_alloc_bulk() test Subsystem: checkpatch Jerome Forissier <jerome@forissier.org>: checkpatch: relax regexp for COMMIT_LOG_LONG_LINE Joe Perches <joe@perches.com>: checkpatch: improve Kconfig help test Rikard Falkeborn <rikard.falkeborn@gmail.com>: const_structs.checkpatch: add frequently used ops structs Subsystem: binfmt "H.J. Lu" <hjl.tools@gmail.com>: fs/binfmt_elf: use PT_LOAD p_align values for static PIE Subsystem: nilfs2 Colin Ian King <colin.i.king@gmail.com>: nilfs2: remove redundant pointer sbufs Subsystem: hfs Kees Cook <keescook@chromium.org>: hfsplus: use struct_group_attr() for memcpy() region Subsystem: fat "NeilBrown" <neilb@suse.de>: FAT: use io_schedule_timeout() instead of congestion_wait() Subsystem: adfs Minghao Chi <chi.minghao@zte.com.cn>: fs/adfs: remove unneeded variable make code cleaner Subsystem: panic Marco Elver <elver@google.com>: panic: use error_report_end tracepoint on warnings Sebastian Andrzej Siewior <bigeasy@linutronix.de>: panic: remove oops_id Subsystem: delayacct Yang Yang <yang.yang29@zte.com.cn>: delayacct: support swapin delay accounting for swapping without blkio delayacct: fix incomplete disable operation when switch enable to disable delayacct: cleanup flags in struct task_delay_info and functions use it wangyong <wang.yong12@zte.com.cn>: Documentation/accounting/delay-accounting.rst: add thrashing page cache and direct compact delayacct: track delays from memory compact Subsystem: kconfig Qian Cai <quic_qiancai@quicinc.com>: configs: introduce debug.config for CI-like setup Nathan Chancellor <nathan@kernel.org>: Patch series "Fix CONFIG_TEST_KMOD with 256kB page size": arch/Kconfig: split PAGE_SIZE_LESS_THAN_256KB from PAGE_SIZE_LESS_THAN_64KB btrfs: use generic Kconfig option for 256kB page size limit lib/Kconfig.debug: make TEST_KMOD depend on PAGE_SIZE_LESS_THAN_256KB Subsystem: kcov Marco Elver <elver@google.com>: kcov: fix generic Kconfig dependencies if ARCH_WANTS_NO_INSTR Subsystem: ubsan Kees Cook <keescook@chromium.org>: ubsan: remove CONFIG_UBSAN_OBJECT_SIZE Colin Ian King <colin.i.king@gmail.com>: lib: remove redundant assignment to variable ret Documentation/accounting/delay-accounting.rst | 63 +- arch/Kconfig | 4 arch/arm64/Kconfig | 20 arch/ia64/Kconfig | 9 arch/mips/Kconfig | 10 arch/mips/mm/init.c | 28 - arch/powerpc/Kconfig | 17 arch/powerpc/kernel/setup_64.c | 113 ---- arch/riscv/Kconfig | 10 arch/sparc/Kconfig | 12 arch/sparc/kernel/led.c | 8 arch/sparc/kernel/smp_64.c | 119 ----- arch/x86/Kconfig | 19 arch/x86/kernel/setup_percpu.c | 82 --- drivers/base/arch_numa.c | 78 --- drivers/infiniband/hw/qib/qib.h | 2 drivers/infiniband/hw/qib/qib_file_ops.c | 2 drivers/infiniband/sw/rxe/rxe_qp.c | 3 drivers/net/wireless/broadcom/brcm80211/brcmfmac/xtlv.c | 2 fs/adfs/inode.c | 4 fs/binfmt_elf.c | 6 fs/btrfs/Kconfig | 3 fs/exec.c | 5 fs/fat/file.c | 5 fs/hfsplus/hfsplus_raw.h | 12 fs/hfsplus/xattr.c | 4 fs/nilfs2/page.c | 4 fs/proc/array.c | 3 fs/proc/base.c | 4 fs/proc/proc_sysctl.c | 9 fs/proc/vmcore.c | 10 include/kunit/assert.h | 2 include/linux/delayacct.h | 107 ++-- include/linux/elfcore-compat.h | 5 include/linux/elfcore.h | 5 include/linux/hash.h | 5 include/linux/kernel.h | 9 include/linux/kthread.h | 1 include/linux/list.h | 36 - include/linux/percpu.h | 21 include/linux/proc_fs.h | 12 include/linux/sched.h | 9 include/linux/unaligned/packed_struct.h | 2 include/trace/events/error_report.h | 8 include/uapi/linux/taskstats.h | 6 include/uapi/linux/uuid.h | 10 kernel/configs/debug.config | 105 ++++ kernel/delayacct.c | 49 +- kernel/kthread.c | 32 + kernel/panic.c | 21 kernel/sys.c | 16 lib/Kconfig.debug | 45 + lib/Kconfig.ubsan | 13 lib/Makefile | 5 lib/asn1_encoder.c | 2 lib/kstrtox.c | 12 lib/list_debug.c | 8 lib/lz4/lz4defs.h | 2 lib/test_hash.c | 375 +++++++--------- lib/test_meminit.c | 1 lib/test_ubsan.c | 22 mm/Kconfig | 12 mm/memory.c | 4 mm/page_alloc.c | 3 mm/page_io.c | 3 mm/percpu.c | 168 +++++-- samples/bpf/offwaketime_kern.c | 4 samples/bpf/test_overhead_kprobe_kern.c | 11 samples/bpf/test_overhead_tp_kern.c | 5 scripts/Makefile.ubsan | 1 scripts/checkpatch.pl | 54 +- scripts/const_structs.checkpatch | 23 scripts/get_maintainer.pl | 2 tools/accounting/getdelays.c | 8 tools/bpf/bpftool/skeleton/pid_iter.bpf.c | 4 tools/include/linux/hash.h | 5 tools/testing/selftests/bpf/progs/test_stacktrace_map.c | 6 tools/testing/selftests/bpf/progs/test_tracepoint.c | 6 78 files changed, 943 insertions(+), 992 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2022-01-14 22:02 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2022-01-14 22:02 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 146 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16") Subsystems affected by this patch series: kthread ia64 scripts ntfs squashfs ocfs2 vfs mm/slab-generic mm/slab mm/kmemleak mm/dax mm/kasan mm/debug mm/pagecache mm/gup mm/shmem mm/frontswap mm/memremap mm/memcg mm/selftests mm/pagemap mm/dma mm/vmalloc mm/memory-failure mm/hugetlb mm/userfaultfd mm/vmscan mm/mempolicy mm/oom-kill mm/hugetlbfs mm/migration mm/thp mm/ksm mm/page-poison mm/percpu mm/rmap mm/zswap mm/zram mm/cleanups mm/hmm mm/damon Subsystem: kthread Cai Huoqing <caihuoqing@baidu.com>: kthread: add the helper function kthread_run_on_cpu() RDMA/siw: make use of the helper function kthread_run_on_cpu() ring-buffer: make use of the helper function kthread_run_on_cpu() rcutorture: make use of the helper function kthread_run_on_cpu() trace/osnoise: make use of the helper function kthread_run_on_cpu() trace/hwlat: make use of the helper function kthread_run_on_cpu() Subsystem: ia64 Yang Guang <yang.guang5@zte.com.cn>: ia64: module: use swap() to make code cleaner arch/ia64/kernel/setup.c: use swap() to make code cleaner Jason Wang <wangborong@cdjrlc.com>: ia64: fix typo in a comment Greg Kroah-Hartman <gregkh@linuxfoundation.org>: ia64: topology: use default_groups in kobj_type Subsystem: scripts Drew Fustini <dfustini@baylibre.com>: scripts/spelling.txt: add "oveflow" Subsystem: ntfs Yang Li <yang.lee@linux.alibaba.com>: fs/ntfs/attrib.c: fix one kernel-doc comment Subsystem: squashfs Zheng Liang <zhengliang6@huawei.com>: squashfs: provide backing_dev_info in order to disable read-ahead Subsystem: ocfs2 Zhang Mingyu <zhang.mingyu@zte.com.cn>: ocfs2: use BUG_ON instead of if condition followed by BUG. Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: clearly handle ocfs2_grab_pages_for_write() return value Greg Kroah-Hartman <gregkh@linuxfoundation.org>: ocfs2: use default_groups in kobj_type Colin Ian King <colin.i.king@gmail.com>: ocfs2: remove redundant assignment to pointer root_bh Greg Kroah-Hartman <gregkh@linuxfoundation.org>: ocfs2: cluster: use default_groups in kobj_type Colin Ian King <colin.i.king@gmail.com>: ocfs2: remove redundant assignment to variable free_space Subsystem: vfs Amit Daniel Kachhap <amit.kachhap@arm.com>: fs/ioctl: remove unnecessary __user annotation Subsystem: mm/slab-generic Marco Elver <elver@google.com>: mm/slab_common: use WARN() if cache still has objects on destroy Subsystem: mm/slab Muchun Song <songmuchun@bytedance.com>: mm: slab: make slab iterator functions static Subsystem: mm/kmemleak Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: kmemleak: fix kmemleak false positive report with HW tag-based kasan enable Calvin Zhang <calvinzhang.cool@gmail.com>: mm: kmemleak: alloc gray object for reserved region with direct map Kefeng Wang <wangkefeng.wang@huawei.com>: mm: defer kmemleak object creation of module_alloc() Subsystem: mm/dax Joao Martins <joao.m.martins@oracle.com>: Patch series "mm, device-dax: Introduce compound pages in devmap", v7: mm/page_alloc: split prep_compound_page into head and tail subparts mm/page_alloc: refactor memmap_init_zone_device() page init mm/memremap: add ZONE_DEVICE support for compound pages device-dax: use ALIGN() for determining pgoff device-dax: use struct_size() device-dax: ensure dev_dax->pgmap is valid for dynamic devices device-dax: factor out page mapping initialization device-dax: set mapping prior to vmf_insert_pfn{,_pmd,pud}() device-dax: remove pfn from __dev_dax_{pte,pmd,pud}_fault() device-dax: compound devmap support Subsystem: mm/kasan Marco Elver <elver@google.com>: kasan: test: add globals left-out-of-bounds test kasan: add ability to detect double-kmem_cache_destroy() kasan: test: add test case for double-kmem_cache_destroy() Andrey Konovalov <andreyknvl@google.com>: kasan: fix quarantine conflicting with init_on_free Subsystem: mm/debug "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm,fs: split dump_mapping() out from dump_page() Anshuman Khandual <anshuman.khandual@arm.com>: mm/debug_vm_pgtable: update comments regarding migration swap entries Subsystem: mm/pagecache chiminghao <chi.minghao@zte.com.cn>: mm/truncate.c: remove unneeded variable Subsystem: mm/gup Christophe Leroy <christophe.leroy@csgroup.eu>: gup: avoid multiple user access locking/unlocking in fault_in_{read/write}able Li Xinhai <lixinhai.lxh@gmail.com>: mm/gup.c: stricter check on THP migration entry during follow_pmd_mask Subsystem: mm/shmem Yang Shi <shy828301@gmail.com>: mm: shmem: don't truncate page if memory failure happens Gang Li <ligang.bdlg@bytedance.com>: shmem: fix a race between shmem_unused_huge_shrink and shmem_evict_inode Subsystem: mm/frontswap Christophe JAILLET <christophe.jaillet@wanadoo.fr>: mm/frontswap.c: use non-atomic '__set_bit()' when possible Subsystem: mm/memremap Subsystem: mm/memcg Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: make cgroup_memory_nokmem static Donghai Qiao <dqiao@redhat.com>: mm/page_counter: remove an incorrect call to propagate_protected_usage() Dan Schatzberg <schatzberg.dan@gmail.com>: mm/memcg: add oom_group_kill memory event Shakeel Butt <shakeelb@google.com>: memcg: better bounds on the memcg stats updates Wang Weiyang <wangweiyang2@huawei.com>: mm/memcg: use struct_size() helper in kzalloc() Shakeel Butt <shakeelb@google.com>: memcg: add per-memcg vmalloc stat Subsystem: mm/selftests chiminghao <chi.minghao@zte.com.cn>: tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner Subsystem: mm/pagemap Qi Zheng <zhengqi.arch@bytedance.com>: mm: remove redundant check about FAULT_FLAG_ALLOW_RETRY bit Colin Cross <ccross@google.com>: Patch series "mm: rearrange madvise code to allow for reuse", v11: mm: rearrange madvise code to allow for reuse mm: add a field to store names for private anonymous memory Suren Baghdasaryan <surenb@google.com>: mm: add anonymous vma name refcounting Arnd Bergmann <arnd@arndb.de>: mm: move anon_vma declarations to linux/mm_inline.h mm: move tlb_flush_pending inline helpers to mm_inline.h Suren Baghdasaryan <surenb@google.com>: mm: protect free_pgtables with mmap_lock write lock in exit_mmap mm: document locking restrictions for vm_operations_struct::close mm/oom_kill: allow process_mrelease to run under mmap_lock protection Shuah Khan <skhan@linuxfoundation.org>: docs/vm: add vmalloced-kernel-stacks document Pasha Tatashin <pasha.tatashin@soleen.com>: Patch series "page table check", v3: mm: change page type prior to adding page table entry mm: ptep_clear() page table helper mm: page table check x86: mm: add x86_64 support for page table check "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: remove last argument of reuse_swap_page() mm: remove the total_mapcount argument from page_trans_huge_map_swapcount() mm: remove the total_mapcount argument from page_trans_huge_mapcount() Subsystem: mm/dma Christian König <christian.koenig@amd.com>: mm/dmapool.c: revert "make dma pool to use kmalloc_node" Subsystem: mm/vmalloc Michal Hocko <mhocko@suse.com>: Patch series "extend vmalloc support for constrained allocations", v2: mm/vmalloc: alloc GFP_NO{FS,IO} for vmalloc mm/vmalloc: add support for __GFP_NOFAIL mm/vmalloc: be more explicit about supported gfp flags. mm: allow !GFP_KERNEL allocations for kvmalloc mm: make slab and vmalloc allocators __GFP_NOLOCKDEP aware "NeilBrown" <neilb@suse.de>: mm: introduce memalloc_retry_wait() Suren Baghdasaryan <surenb@google.com>: mm/pagealloc: sysctl: change watermark_scale_factor max limit to 30% Changcheng Deng <deng.changcheng@zte.com.cn>: mm: fix boolreturn.cocci warning Xiongwei Song <sxwjean@gmail.com>: mm: page_alloc: fix building error on -Werror=array-compare Michal Hocko <mhocko@suse.com>: mm: drop node from alloc_pages_vma Miles Chen <miles.chen@mediatek.com>: include/linux/gfp.h: further document GFP_DMA32 Anshuman Khandual <anshuman.khandual@arm.com>: mm/page_alloc.c: modify the comment section for alloc_contig_pages() Baoquan He <bhe@redhat.com>: Patch series "Handle warning of allocation failure on DMA zone w/o managed pages", v4: mm_zone: add function to check if managed dma zone exists dma/pool: create dma atomic pool only if dma zone has managed pages mm/page_alloc.c: do not warn allocation failure on zone DMA if no managed pages Subsystem: mm/memory-failure Subsystem: mm/hugetlb Mina Almasry <almasrymina@google.com>: hugetlb: add hugetlb.*.numa_stat file Yosry Ahmed <yosryahmed@google.com>: mm, hugepages: make memory size variable in hugepage-mremap selftest Yang Yang <yang.yang29@zte.com.cn>: mm/vmstat: add events for THP max_ptes_* exceeds Waiman Long <longman@redhat.com>: selftests/vm: make charge_reserved_hugetlb.sh work with existing cgroup setting Subsystem: mm/userfaultfd Peter Xu <peterx@redhat.com>: selftests/uffd: allow EINTR/EAGAIN Mike Kravetz <mike.kravetz@oracle.com>: userfaultfd/selftests: clean up hugetlb allocation code Subsystem: mm/vmscan Gang Li <ligang.bdlg@bytedance.com>: vmscan: make drop_slab_node static Chen Wandun <chenwandun@huawei.com>: mm/page_isolation: unset migratetype directly for non Buddy page Subsystem: mm/mempolicy "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "mm: add new syscall set_mempolicy_home_node", v6: mm/mempolicy: use policy_node helper with MPOL_PREFERRED_MANY mm/mempolicy: add set_mempolicy_home_node syscall mm/mempolicy: wire up syscall set_mempolicy_home_node Randy Dunlap <rdunlap@infradead.org>: mm/mempolicy: fix all kernel-doc warnings Subsystem: mm/oom-kill Jann Horn <jannh@google.com>: mm, oom: OOM sysrq should always kill a process Subsystem: mm/hugetlbfs Sean Christopherson <seanjc@google.com>: hugetlbfs: fix off-by-one error in hugetlb_vmdelete_list() Subsystem: mm/migration Baolin Wang <baolin.wang@linux.alibaba.com>: Patch series "Improve the migration stats": mm: migrate: fix the return value of migrate_pages() mm: migrate: correct the hugetlb migration stats mm: compaction: fix the migration stats in trace_mm_compaction_migratepages() mm: migrate: support multiple target nodes demotion mm: migrate: add more comments for selecting target node randomly Huang Ying <ying.huang@intel.com>: mm/migrate: move node demotion code to near its user Colin Ian King <colin.i.king@gmail.com>: mm/migrate: remove redundant variables used in a for-loop Subsystem: mm/thp Anshuman Khandual <anshuman.khandual@arm.com>: mm/thp: drop unused trace events hugepage_[invalidate|splitting] Subsystem: mm/ksm Nanyong Sun <sunnanyong@huawei.com>: mm: ksm: fix use-after-free kasan report in ksm_might_need_to_copy Subsystem: mm/page-poison Naoya Horiguchi <naoya.horiguchi@nec.com>: Patch series "mm/hwpoison: fix unpoison_memory()", v4: mm/hwpoison: mf_mutex for soft offline and unpoison mm/hwpoison: remove MF_MSG_BUDDY_2ND and MF_MSG_POISONED_HUGE mm/hwpoison: fix unpoison_memory() Subsystem: mm/percpu Qi Zheng <zhengqi.arch@bytedance.com>: mm: memcg/percpu: account extra objcg space to memory cgroups Subsystem: mm/rmap Huang Ying <ying.huang@intel.com>: mm/rmap: fix potential batched TLB flush race Subsystem: mm/zswap Zhaoyu Liu <zackary.liu.pro@gmail.com>: zpool: remove the list of pools_head Subsystem: mm/zram Luis Chamberlain <mcgrof@kernel.org>: zram: use ATTRIBUTE_GROUPS Subsystem: mm/cleanups Quanfa Fu <fuqf0919@gmail.com>: mm: fix some comment errors Ting Liu <liuting.0x7c00@bytedance.com>: mm: make some vars and functions static or __init Subsystem: mm/hmm Alistair Popple <apopple@nvidia.com>: mm/hmm.c: allow VM_MIXEDMAP to work with hmm_range_fault Subsystem: mm/damon Xin Hao <xhao@linux.alibaba.com>: Patch series "mm/damon: Do some small changes", v4: mm/damon: unified access_check function naming rules mm/damon: add 'age' of region tracepoint support mm/damon/core: use abs() instead of diff_of() mm/damon: remove some unneeded function definitions in damon.h Yihao Han <hanyihao@vivo.com>: mm/damon/vaddr: remove swap_ranges() and replace it with swap() Xin Hao <xhao@linux.alibaba.com>: mm/damon/schemes: add the validity judgment of thresholds mm/damon: move damon_rand() definition into damon.h mm/damon: modify damon_rand() macro to static inline function SeongJae Park <sj@kernel.org>: Patch series "mm/damon: Misc cleanups": mm/damon: convert macro functions to static inline functions Docs/admin-guide/mm/damon/usage: update for scheme quotas and watermarks Docs/admin-guide/mm/damon/usage: remove redundant information Docs/admin-guide/mm/damon/usage: mention tracepoint at the beginning Docs/admin-guide/mm/damon/usage: update for kdamond_pid and (mk|rm)_contexts mm/damon: remove a mistakenly added comment for a future feature Patch series "mm/damon/schemes: Extend stats for better online analysis and tuning": mm/damon/schemes: account scheme actions that successfully applied mm/damon/schemes: account how many times quota limit has exceeded mm/damon/reclaim: provide reclamation statistics Docs/admin-guide/mm/damon/reclaim: document statistics parameters mm/damon/dbgfs: support all DAMOS stats Docs/admin-guide/mm/damon/usage: update for schemes statistics Baolin Wang <baolin.wang@linux.alibaba.com>: mm/damon: add access checking for hugetlb pages Guoqing Jiang <guoqing.jiang@linux.dev>: mm/damon: move the implementation of damon_insert_region to damon.h SeongJae Park <sj@kernel.org>: Patch series "mm/damon: Hide unnecessary information disclosures": mm/damon/dbgfs: remove an unnecessary variable mm/damon/vaddr: use pr_debug() for damon_va_three_regions() failure logging mm/damon/vaddr: hide kernel pointer from damon_va_three_regions() failure log mm/damon: hide kernel pointer from tracepoint event Documentation/admin-guide/cgroup-v1/hugetlb.rst | 4 Documentation/admin-guide/cgroup-v2.rst | 11 Documentation/admin-guide/mm/damon/reclaim.rst | 25 Documentation/admin-guide/mm/damon/usage.rst | 235 +++++-- Documentation/admin-guide/mm/numa_memory_policy.rst | 16 Documentation/admin-guide/sysctl/vm.rst | 2 Documentation/filesystems/proc.rst | 6 Documentation/vm/arch_pgtable_helpers.rst | 20 Documentation/vm/index.rst | 2 Documentation/vm/page_migration.rst | 12 Documentation/vm/page_table_check.rst | 56 + Documentation/vm/vmalloced-kernel-stacks.rst | 153 ++++ MAINTAINERS | 9 arch/Kconfig | 3 arch/alpha/kernel/syscalls/syscall.tbl | 1 arch/alpha/mm/fault.c | 16 arch/arc/mm/fault.c | 3 arch/arm/mm/fault.c | 2 arch/arm/tools/syscall.tbl | 1 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 2 arch/arm64/kernel/module.c | 4 arch/arm64/mm/fault.c | 6 arch/hexagon/mm/vm_fault.c | 8 arch/ia64/kernel/module.c | 6 arch/ia64/kernel/setup.c | 5 arch/ia64/kernel/syscalls/syscall.tbl | 1 arch/ia64/kernel/topology.c | 3 arch/ia64/kernel/uncached.c | 2 arch/ia64/mm/fault.c | 16 arch/m68k/kernel/syscalls/syscall.tbl | 1 arch/m68k/mm/fault.c | 18 arch/microblaze/kernel/syscalls/syscall.tbl | 1 arch/microblaze/mm/fault.c | 18 arch/mips/kernel/syscalls/syscall_n32.tbl | 1 arch/mips/kernel/syscalls/syscall_n64.tbl | 1 arch/mips/kernel/syscalls/syscall_o32.tbl | 1 arch/mips/mm/fault.c | 19 arch/nds32/mm/fault.c | 16 arch/nios2/mm/fault.c | 18 arch/openrisc/mm/fault.c | 18 arch/parisc/kernel/syscalls/syscall.tbl | 1 arch/parisc/mm/fault.c | 18 arch/powerpc/kernel/syscalls/syscall.tbl | 1 arch/powerpc/mm/fault.c | 6 arch/riscv/mm/fault.c | 2 arch/s390/kernel/module.c | 5 arch/s390/kernel/syscalls/syscall.tbl | 1 arch/s390/mm/fault.c | 28 arch/sh/kernel/syscalls/syscall.tbl | 1 arch/sh/mm/fault.c | 18 arch/sparc/kernel/syscalls/syscall.tbl | 1 arch/sparc/mm/fault_32.c | 16 arch/sparc/mm/fault_64.c | 16 arch/um/kernel/trap.c | 8 arch/x86/Kconfig | 1 arch/x86/entry/syscalls/syscall_32.tbl | 1 arch/x86/entry/syscalls/syscall_64.tbl | 1 arch/x86/include/asm/pgtable.h | 31 - arch/x86/kernel/module.c | 7 arch/x86/mm/fault.c | 3 arch/xtensa/kernel/syscalls/syscall.tbl | 1 arch/xtensa/mm/fault.c | 17 drivers/block/zram/zram_drv.c | 11 drivers/dax/bus.c | 32 + drivers/dax/bus.h | 1 drivers/dax/device.c | 140 ++-- drivers/infiniband/sw/siw/siw_main.c | 7 drivers/of/fdt.c | 6 fs/ext4/extents.c | 8 fs/ext4/inline.c | 5 fs/ext4/page-io.c | 9 fs/f2fs/data.c | 4 fs/f2fs/gc.c | 5 fs/f2fs/inode.c | 4 fs/f2fs/node.c | 4 fs/f2fs/recovery.c | 6 fs/f2fs/segment.c | 9 fs/f2fs/super.c | 5 fs/hugetlbfs/inode.c | 7 fs/inode.c | 49 + fs/ioctl.c | 2 fs/ntfs/attrib.c | 2 fs/ocfs2/alloc.c | 2 fs/ocfs2/aops.c | 26 fs/ocfs2/cluster/masklog.c | 11 fs/ocfs2/dir.c | 2 fs/ocfs2/filecheck.c | 3 fs/ocfs2/journal.c | 6 fs/proc/task_mmu.c | 13 fs/squashfs/super.c | 33 + fs/userfaultfd.c | 8 fs/xfs/kmem.c | 3 fs/xfs/xfs_buf.c | 2 include/linux/ceph/libceph.h | 1 include/linux/damon.h | 93 +-- include/linux/fs.h | 1 include/linux/gfp.h | 12 include/linux/hugetlb.h | 4 include/linux/hugetlb_cgroup.h | 7 include/linux/kasan.h | 4 include/linux/kthread.h | 25 include/linux/memcontrol.h | 22 include/linux/mempolicy.h | 1 include/linux/memremap.h | 11 include/linux/mm.h | 76 -- include/linux/mm_inline.h | 136 ++++ include/linux/mm_types.h | 252 +++----- include/linux/mmzone.h | 9 include/linux/page-flags.h | 6 include/linux/page_idle.h | 1 include/linux/page_table_check.h | 147 ++++ include/linux/pgtable.h | 8 include/linux/sched/mm.h | 26 include/linux/swap.h | 8 include/linux/syscalls.h | 3 include/linux/vm_event_item.h | 3 include/linux/vmalloc.h | 7 include/ras/ras_event.h | 2 include/trace/events/compaction.h | 24 include/trace/events/damon.h | 15 include/trace/events/thp.h | 35 - include/uapi/asm-generic/unistd.h | 5 include/uapi/linux/prctl.h | 3 kernel/dma/pool.c | 4 kernel/fork.c | 3 kernel/kthread.c | 1 kernel/rcu/rcutorture.c | 7 kernel/sys.c | 63 ++ kernel/sys_ni.c | 1 kernel/sysctl.c | 3 kernel/trace/ring_buffer.c | 7 kernel/trace/trace_hwlat.c | 6 kernel/trace/trace_osnoise.c | 3 lib/test_hmm.c | 24 lib/test_kasan.c | 30 mm/Kconfig | 14 mm/Kconfig.debug | 24 mm/Makefile | 1 mm/compaction.c | 7 mm/damon/core.c | 45 - mm/damon/dbgfs.c | 20 mm/damon/paddr.c | 24 mm/damon/prmtv-common.h | 4 mm/damon/reclaim.c | 46 + mm/damon/vaddr.c | 186 ++++-- mm/debug.c | 52 - mm/debug_vm_pgtable.c | 6 mm/dmapool.c | 2 mm/frontswap.c | 4 mm/gup.c | 31 - mm/hmm.c | 5 mm/huge_memory.c | 32 - mm/hugetlb.c | 6 mm/hugetlb_cgroup.c | 133 +++- mm/internal.h | 7 mm/kasan/quarantine.c | 11 mm/kasan/shadow.c | 9 mm/khugepaged.c | 23 mm/kmemleak.c | 21 mm/ksm.c | 5 mm/madvise.c | 510 ++++++++++------ mm/mapping_dirty_helpers.c | 1 mm/memcontrol.c | 44 - mm/memory-failure.c | 189 +++--- mm/memory.c | 12 mm/mempolicy.c | 95 ++- mm/memremap.c | 18 mm/migrate.c | 527 ++++++++++------- mm/mlock.c | 2 mm/mmap.c | 55 + mm/mmu_gather.c | 1 mm/mprotect.c | 2 mm/oom_kill.c | 30 mm/page_alloc.c | 198 ++++-- mm/page_counter.c | 1 mm/page_ext.c | 8 mm/page_isolation.c | 2 mm/page_owner.c | 4 mm/page_table_check.c | 270 ++++++++ mm/percpu-internal.h | 18 mm/percpu.c | 10 mm/pgtable-generic.c | 1 mm/rmap.c | 43 + mm/shmem.c | 91 ++ mm/slab.h | 5 mm/slab_common.c | 34 - mm/swap.c | 2 mm/swapfile.c | 46 - mm/truncate.c | 5 mm/userfaultfd.c | 5 mm/util.c | 15 mm/vmalloc.c | 75 +- mm/vmscan.c | 2 mm/vmstat.c | 3 mm/zpool.c | 12 net/ceph/buffer.c | 4 net/ceph/ceph_common.c | 27 net/ceph/crypto.c | 2 net/ceph/messenger.c | 2 net/ceph/messenger_v2.c | 2 net/ceph/osdmap.c | 12 net/sunrpc/svc_xprt.c | 3 scripts/spelling.txt | 1 tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 34 - tools/testing/selftests/vm/hmm-tests.c | 42 + tools/testing/selftests/vm/hugepage-mremap.c | 46 - tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 21 tools/testing/selftests/vm/run_vmtests.sh | 2 tools/testing/selftests/vm/userfaultfd.c | 33 - tools/testing/selftests/vm/write_hugetlb_memory.sh | 2 211 files changed, 3980 insertions(+), 1759 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-12-31 4:12 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-12-31 4:12 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 2 patches, based on 4f3d93c6eaff6b84e43b63e0d7a119c5920e1020. Subsystems affected by this patch series: mm/userfaultfd mm/damon Subsystem: mm/userfaultfd Mike Kravetz <mike.kravetz@oracle.com>: userfaultfd/selftests: fix hugetlb area allocations Subsystem: mm/damon SeongJae Park <sj@kernel.org>: mm/damon/dbgfs: fix 'struct pid' leaks in 'dbgfs_target_ids_write()' mm/damon/dbgfs.c | 9 +++++++-- tools/testing/selftests/vm/userfaultfd.c | 16 ++++++++++------ 2 files changed, 17 insertions(+), 8 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-12-25 5:11 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-12-25 5:11 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 9 patches, based on bc491fb12513e79702c6f936c838f792b5389129. Subsystems affected by this patch series: mm/kfence mm/mempolicy core-kernel MAINTAINERS mm/memory-failure mm/pagemap mm/pagealloc mm/damon mm/memory-failure Subsystem: mm/kfence Baokun Li <libaokun1@huawei.com>: kfence: fix memory leak when cat kfence objects Subsystem: mm/mempolicy Andrey Ryabinin <arbn@yandex-team.com>: mm: mempolicy: fix THP allocations escaping mempolicy restrictions Subsystem: core-kernel Philipp Rudo <prudo@redhat.com>: kernel/crash_core: suppress unknown crashkernel parameter warning Subsystem: MAINTAINERS Randy Dunlap <rdunlap@infradead.org>: MAINTAINERS: mark more list instances as moderated Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm, hwpoison: fix condition in free hugetlb page path Subsystem: mm/pagemap Hugh Dickins <hughd@google.com>: mm: delete unsafe BUG from page_cache_add_speculative() Subsystem: mm/pagealloc Thibaut Sautereau <thibaut.sautereau@ssi.gouv.fr>: mm/page_alloc: fix __alloc_size attribute for alloc_pages_exact_nid Subsystem: mm/damon SeongJae Park <sj@kernel.org>: mm/damon/dbgfs: protect targets destructions with kdamond_lock Subsystem: mm/memory-failure Liu Shixin <liushixin2@huawei.com>: mm/hwpoison: clear MF_COUNT_INCREASED before retrying get_any_page() MAINTAINERS | 4 ++-- include/linux/gfp.h | 2 +- include/linux/pagemap.h | 1 - kernel/crash_core.c | 11 +++++++++++ mm/damon/dbgfs.c | 2 ++ mm/kfence/core.c | 1 + mm/memory-failure.c | 14 +++++--------- mm/mempolicy.c | 3 +-- 8 files changed, 23 insertions(+), 15 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-12-10 22:45 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-12-10 22:45 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 21 patches, based on c741e49150dbb0c0aebe234389f4aa8b47958fa8. Subsystems affected by this patch series: mm/mlock MAINTAINERS mailmap mm/pagecache mm/damon mm/slub mm/memcg mm/hugetlb mm/pagecache Subsystem: mm/mlock Drew DeVault <sir@cmpwn.com>: Increase default MLOCK_LIMIT to 8 MiB Subsystem: MAINTAINERS Dave Young <dyoung@redhat.com>: MAINTAINERS: update kdump maintainers Subsystem: mailmap Guo Ren <guoren@linux.alibaba.com>: mailmap: update email address for Guo Ren Subsystem: mm/pagecache "Matthew Wilcox (Oracle)" <willy@infradead.org>: filemap: remove PageHWPoison check from next_uptodate_page() Subsystem: mm/damon SeongJae Park <sj@kernel.org>: Patch series "mm/damon: Fix fake /proc/loadavg reports", v3: timers: implement usleep_idle_range() mm/damon/core: fix fake load reports due to uninterruptible sleeps Patch series "mm/damon: Trivial fixups and improvements": mm/damon/core: use better timer mechanisms selection threshold mm/damon/dbgfs: remove an unnecessary error message mm/damon/core: remove unnecessary error messages mm/damon/vaddr: remove an unnecessary warning message mm/damon/vaddr-test: split a test function having >1024 bytes frame size mm/damon/vaddr-test: remove unnecessary variables selftests/damon: skip test if DAMON is running selftests/damon: test DAMON enabling with empty target_ids case selftests/damon: test wrong DAMOS condition ranges input selftests/damon: test debugfs file reads/writes with huge count selftests/damon: split test cases Subsystem: mm/slub Gerald Schaefer <gerald.schaefer@linux.ibm.com>: mm/slub: fix endianness bug for alloc/free_traces attributes Subsystem: mm/memcg Waiman Long <longman@redhat.com>: mm/memcg: relocate mod_objcg_mlstate(), get_obj_stock() and put_obj_stock() Subsystem: mm/hugetlb Zhenguo Yao <yaozhenguo1@gmail.com>: hugetlbfs: fix issue of preallocation of gigantic pages can't work Subsystem: mm/pagecache Manjong Lee <mj0123.lee@samsung.com>: mm: bdi: initialize bdi_min_ratio when bdi is unregistered .mailmap | 2 MAINTAINERS | 2 include/linux/delay.h | 14 include/uapi/linux/resource.h | 13 kernel/time/timer.c | 16 - mm/backing-dev.c | 7 mm/damon/core.c | 20 - mm/damon/dbgfs.c | 4 mm/damon/vaddr-test.h | 85 ++--- mm/damon/vaddr.c | 1 mm/filemap.c | 2 mm/hugetlb.c | 2 mm/memcontrol.c | 106 +++---- mm/slub.c | 15 - tools/testing/selftests/damon/.gitignore | 2 tools/testing/selftests/damon/Makefile | 7 tools/testing/selftests/damon/_debugfs_common.sh | 52 +++ tools/testing/selftests/damon/debugfs_attrs.sh | 149 ++-------- tools/testing/selftests/damon/debugfs_empty_targets.sh | 13 tools/testing/selftests/damon/debugfs_huge_count_read_write.sh | 22 + tools/testing/selftests/damon/debugfs_schemes.sh | 19 + tools/testing/selftests/damon/debugfs_target_ids.sh | 19 + tools/testing/selftests/damon/huge_count_read_write.c | 39 ++ 23 files changed, 363 insertions(+), 248 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-11-20 0:42 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-11-20 0:42 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 15 patches, based on a90af8f15bdc9449ee2d24e1d73fa3f7e8633f81. Subsystems affected by this patch series: mm/swap ipc mm/slab-generic hexagon mm/kmemleak mm/hugetlb mm/kasan mm/damon mm/highmem proc Subsystem: mm/swap Matthew Wilcox <willy@infradead.org>: mm/swap.c:put_pages_list(): reinitialise the page list Subsystem: ipc Alexander Mikhalitsyn <alexander.mikhalitsyn@virtuozzo.com>: Patch series "shm: shm_rmid_forced feature fixes": ipc: WARN if trying to remove ipc object which is absent shm: extend forced shm destroy to support objects from several IPC nses Subsystem: mm/slab-generic Yunfeng Ye <yeyunfeng@huawei.com>: mm: emit the "free" trace report before freeing memory in kmem_cache_free() Subsystem: hexagon Nathan Chancellor <nathan@kernel.org>: Patch series "Fixes for ARCH=hexagon allmodconfig", v2: hexagon: export raw I/O routines for modules hexagon: clean up timer-regs.h hexagon: ignore vmlinux.lds Subsystem: mm/kmemleak Rustam Kovhaev <rkovhaev@gmail.com>: mm: kmemleak: slob: respect SLAB_NOLEAKTRACE flag Subsystem: mm/hugetlb Bui Quang Minh <minhquangbui99@gmail.com>: hugetlb: fix hugetlb cgroup refcounting during mremap Mina Almasry <almasrymina@google.com>: hugetlb, userfaultfd: fix reservation restore on userfaultfd error Subsystem: mm/kasan Kees Cook <keescook@chromium.org>: kasan: test: silence intentional read overflow warnings Subsystem: mm/damon SeongJae Park <sj@kernel.org>: Patch series "DAMON fixes": mm/damon/dbgfs: use '__GFP_NOWARN' for user-specified size buffer allocation mm/damon/dbgfs: fix missed use of damon_dbgfs_lock Subsystem: mm/highmem Ard Biesheuvel <ardb@kernel.org>: kmap_local: don't assume kmap PTEs are linear arrays in memory Subsystem: proc David Hildenbrand <david@redhat.com>: proc/vmcore: fix clearing user buffer by properly using clear_user() arch/arm/Kconfig | 1 arch/hexagon/include/asm/timer-regs.h | 26 ---- arch/hexagon/include/asm/timex.h | 3 arch/hexagon/kernel/.gitignore | 1 arch/hexagon/kernel/time.c | 12 +- arch/hexagon/lib/io.c | 4 fs/proc/vmcore.c | 20 ++- include/linux/hugetlb_cgroup.h | 12 ++ include/linux/ipc_namespace.h | 15 ++ include/linux/sched/task.h | 2 ipc/shm.c | 189 +++++++++++++++++++++++++--------- ipc/util.c | 6 - lib/test_kasan.c | 2 mm/Kconfig | 3 mm/damon/dbgfs.c | 20 ++- mm/highmem.c | 32 +++-- mm/hugetlb.c | 11 + mm/slab.c | 3 mm/slab.h | 2 mm/slob.c | 3 mm/slub.c | 2 mm/swap.c | 1 22 files changed, 254 insertions(+), 116 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-11-11 4:32 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-11-11 4:32 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits The post-linux-next material. 7 patches, based on debe436e77c72fcee804fb867f275e6d31aa999c. Subsystems affected by this patch series: mm/debug mm/slab-generic mm/migration mm/memcg mm/kasan Subsystem: mm/debug Yixuan Cao <caoyixuan2019@email.szu.edu.cn>: mm/page_owner.c: modify the type of argument "order" in some functions Subsystem: mm/slab-generic Ingo Molnar <mingo@kernel.org>: mm: allow only SLUB on PREEMPT_RT Subsystem: mm/migration Baolin Wang <baolin.wang@linux.alibaba.com>: mm: migrate: simplify the file-backed pages validation when migrating its mapping Alistair Popple <apopple@nvidia.com>: mm/migrate.c: remove MIGRATE_PFN_LOCKED Subsystem: mm/memcg Christoph Hellwig <hch@lst.de>: Patch series "unexport memcg locking helpers": mm: unexport folio_memcg_{,un}lock mm: unexport {,un}lock_page_memcg Subsystem: mm/kasan Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: kasan: add kasan mode messages when kasan init Documentation/vm/hmm.rst | 2 arch/arm64/mm/kasan_init.c | 2 arch/powerpc/kvm/book3s_hv_uvmem.c | 4 drivers/gpu/drm/amd/amdkfd/kfd_migrate.c | 2 drivers/gpu/drm/nouveau/nouveau_dmem.c | 4 include/linux/migrate.h | 1 include/linux/page_owner.h | 12 +- init/Kconfig | 2 lib/test_hmm.c | 5 - mm/kasan/hw_tags.c | 14 ++ mm/kasan/sw_tags.c | 2 mm/memcontrol.c | 4 mm/migrate.c | 151 +++++-------------------------- mm/page_owner.c | 6 - 14 files changed, 61 insertions(+), 150 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-11-09 2:30 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-11-09 2:30 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 87 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813, plus previously sent material. Subsystems affected by this patch series: mm/pagecache mm/hugetlb procfs misc MAINTAINERS lib checkpatch binfmt kallsyms ramfs init codafs nilfs2 hfs crash_dump signals seq_file fork sysvfs kcov gdb resource selftests ipc Subsystem: mm/pagecache Johannes Weiner <hannes@cmpxchg.org>: vfs: keep inodes with page cache off the inode shrinker LRU Subsystem: mm/hugetlb zhangyiru <zhangyiru3@huawei.com>: mm,hugetlb: remove mlock ulimit for SHM_HUGETLB Subsystem: procfs Florian Weimer <fweimer@redhat.com>: procfs: do not list TID 0 in /proc/<pid>/task David Hildenbrand <david@redhat.com>: x86/xen: update xen_oldmem_pfn_is_ram() documentation x86/xen: simplify xen_oldmem_pfn_is_ram() x86/xen: print a warning when HVMOP_get_mem_type fails proc/vmcore: let pfn_is_ram() return a bool proc/vmcore: convert oldmem_pfn_is_ram callback to more generic vmcore callbacks virtio-mem: factor out hotplug specifics from virtio_mem_init() into virtio_mem_init_hotplug() virtio-mem: factor out hotplug specifics from virtio_mem_probe() into virtio_mem_init_hotplug() virtio-mem: factor out hotplug specifics from virtio_mem_remove() into virtio_mem_deinit_hotplug() virtio-mem: kdump mode to sanitize /proc/vmcore access Stephen Brennan <stephen.s.brennan@oracle.com>: proc: allow pid_revalidate() during LOOKUP_RCU Subsystem: misc Andy Shevchenko <andriy.shevchenko@linux.intel.com>: Patch series "kernel.h further split", v5: kernel.h: drop unneeded <linux/kernel.h> inclusion from other headers kernel.h: split out container_of() and typeof_member() macros include/kunit/test.h: replace kernel.h with the necessary inclusions include/linux/list.h: replace kernel.h with the necessary inclusions include/linux/llist.h: replace kernel.h with the necessary inclusions include/linux/plist.h: replace kernel.h with the necessary inclusions include/media/media-entity.h: replace kernel.h with the necessary inclusions include/linux/delay.h: replace kernel.h with the necessary inclusions include/linux/sbitmap.h: replace kernel.h with the necessary inclusions include/linux/radix-tree.h: replace kernel.h with the necessary inclusions include/linux/generic-radix-tree.h: replace kernel.h with the necessary inclusions Stephen Rothwell <sfr@canb.auug.org.au>: kernel.h: split out instruction pointer accessors Rasmus Villemoes <linux@rasmusvillemoes.dk>: linux/container_of.h: switch to static_assert Colin Ian King <colin.i.king@googlemail.com>: mailmap: update email address for Colin King Subsystem: MAINTAINERS Kees Cook <keescook@chromium.org>: MAINTAINERS: add "exec & binfmt" section with myself and Eric Lukas Bulwahn <lukas.bulwahn@gmail.com>: Patch series "Rectify file references for dt-bindings in MAINTAINERS", v5: MAINTAINERS: rectify entry for ARM/TOSHIBA VISCONTI ARCHITECTURE MAINTAINERS: rectify entry for HIKEY960 ONBOARD USB GPIO HUB DRIVER MAINTAINERS: rectify entry for INTEL KEEM BAY DRM DRIVER MAINTAINERS: rectify entry for ALLWINNER HARDWARE SPINLOCK SUPPORT Subsystem: lib Imran Khan <imran.f.khan@oracle.com>: Patch series "lib, stackdepot: check stackdepot handle before accessing slabs", v2: lib, stackdepot: check stackdepot handle before accessing slabs lib, stackdepot: add helper to print stack entries lib, stackdepot: add helper to print stack entries into buffer Lucas De Marchi <lucas.demarchi@intel.com>: include/linux/string_helpers.h: add linux/string.h for strlen() Alexey Dobriyan <adobriyan@gmail.com>: lib: uninline simple_strntoull() as well Thomas Gleixner <tglx@linutronix.de>: mm/scatterlist: replace the !preemptible warning in sg_miter_stop() Subsystem: checkpatch Rikard Falkeborn <rikard.falkeborn@gmail.com>: const_structs.checkpatch: add a few sound ops structs Joe Perches <joe@perches.com>: checkpatch: improve EXPORT_SYMBOL test for EXPORT_SYMBOL_NS uses Peter Ujfalusi <peter.ujfalusi@linux.intel.com>: checkpatch: get default codespell dictionary path from package location Subsystem: binfmt Kees Cook <keescook@chromium.org>: binfmt_elf: reintroduce using MAP_FIXED_NOREPLACE Alexey Dobriyan <adobriyan@gmail.com>: ELF: simplify STACK_ALLOC macro Subsystem: kallsyms Kefeng Wang <wangkefeng.wang@huawei.com>: Patch series "sections: Unify kernel sections range check and use", v4: kallsyms: remove arch specific text and data check kallsyms: fix address-checks for kernel related range sections: move and rename core_kernel_data() to is_kernel_core_data() sections: move is_kernel_inittext() into sections.h x86: mm: rename __is_kernel_text() to is_x86_32_kernel_text() sections: provide internal __is_kernel() and __is_kernel_text() helper mm: kasan: use is_kernel() helper extable: use is_kernel_text() helper powerpc/mm: use core_kernel_text() helper microblaze: use is_kernel_text() helper alpha: use is_kernel_text() helper Subsystem: ramfs yangerkun <yangerkun@huawei.com>: ramfs: fix mount source show for ramfs Subsystem: init Andrew Halaney <ahalaney@redhat.com>: init: make unknown command line param message clearer Subsystem: codafs Jan Harkes <jaharkes@cs.cmu.edu>: Patch series "Coda updates for -next": coda: avoid NULL pointer dereference from a bad inode coda: check for async upcall request using local state Alex Shi <alex.shi@linux.alibaba.com>: coda: remove err which no one care Jan Harkes <jaharkes@cs.cmu.edu>: coda: avoid flagging NULL inodes coda: avoid hidden code duplication in rename coda: avoid doing bad things on inode type changes during revalidation Xiyu Yang <xiyuyang19@fudan.edu.cn>: coda: convert from atomic_t to refcount_t on coda_vm_ops->refcnt Jing Yangyang <jing.yangyang@zte.com.cn>: coda: use vmemdup_user to replace the open code Jan Harkes <jaharkes@cs.cmu.edu>: coda: bump module version to 7.2 Subsystem: nilfs2 Qing Wang <wangqing@vivo.com>: Patch series "nilfs2 updates": nilfs2: replace snprintf in show functions with sysfs_emit Ryusuke Konishi <konishi.ryusuke@gmail.com>: nilfs2: remove filenames from file comments Subsystem: hfs Arnd Bergmann <arnd@arndb.de>: hfs/hfsplus: use WARN_ON for sanity check Subsystem: crash_dump Changcheng Deng <deng.changcheng@zte.com.cn>: crash_dump: fix boolreturn.cocci warning Ye Guojin <ye.guojin@zte.com.cn>: crash_dump: remove duplicate include in crash_dump.h Subsystem: signals Ye Guojin <ye.guojin@zte.com.cn>: signal: remove duplicate include in signal.h Subsystem: seq_file Andy Shevchenko <andriy.shevchenko@linux.intel.com>: seq_file: move seq_escape() to a header Muchun Song <songmuchun@bytedance.com>: seq_file: fix passing wrong private data Subsystem: fork Ran Xiaokai <ran.xiaokai@zte.com.cn>: kernel/fork.c: unshare(): use swap() to make code cleaner Subsystem: sysvfs Pavel Skripkin <paskripkin@gmail.com>: sysv: use BUILD_BUG_ON instead of runtime check Subsystem: kcov Sebastian Andrzej Siewior <bigeasy@linutronix.de>: Patch series "kcov: PREEMPT_RT fixup + misc", v2: Documentation/kcov: include types.h in the example Documentation/kcov: define `ip' in the example kcov: allocate per-CPU memory on the relevant node kcov: avoid enable+disable interrupts if !in_task() kcov: replace local_irq_save() with a local_lock_t Subsystem: gdb Douglas Anderson <dianders@chromium.org>: scripts/gdb: handle split debug for vmlinux Subsystem: resource David Hildenbrand <david@redhat.com>: Patch series "virtio-mem: disallow mapping virtio-mem memory via /dev/mem", v5: kernel/resource: clean up and optimize iomem_is_exclusive() kernel/resource: disallow access to exclusive system RAM regions virtio-mem: disallow mapping virtio-mem memory via /dev/mem Subsystem: selftests SeongJae Park <sjpark@amazon.de>: selftests/kselftest/runner/run_one(): allow running non-executable files Subsystem: ipc Michal Clapinski <mclapinski@google.com>: ipc: check checkpoint_restore_ns_capable() to modify C/R proc files Manfred Spraul <manfred@colorfullife.com>: ipc/ipc_sysctl.c: remove fallback for !CONFIG_PROC_SYSCTL .mailmap | 2 Documentation/dev-tools/kcov.rst | 5 MAINTAINERS | 21 + arch/alpha/kernel/traps.c | 4 arch/microblaze/mm/pgtable.c | 3 arch/powerpc/mm/pgtable_32.c | 7 arch/riscv/lib/delay.c | 4 arch/s390/include/asm/facility.h | 4 arch/x86/kernel/aperture_64.c | 13 arch/x86/kernel/unwind_orc.c | 2 arch/x86/mm/init_32.c | 14 arch/x86/xen/mmu_hvm.c | 39 -- drivers/gpu/drm/drm_dp_mst_topology.c | 5 drivers/gpu/drm/drm_mm.c | 5 drivers/gpu/drm/i915/i915_vma.c | 5 drivers/gpu/drm/i915/intel_runtime_pm.c | 20 - drivers/media/dvb-frontends/cxd2880/cxd2880_common.h | 1 drivers/virtio/Kconfig | 1 drivers/virtio/virtio_mem.c | 321 +++++++++++++------ fs/binfmt_elf.c | 33 + fs/coda/cnode.c | 13 fs/coda/coda_linux.c | 39 +- fs/coda/coda_linux.h | 6 fs/coda/dir.c | 20 - fs/coda/file.c | 12 fs/coda/psdev.c | 14 fs/coda/upcall.c | 3 fs/hfs/inode.c | 6 fs/hfsplus/inode.c | 12 fs/hugetlbfs/inode.c | 23 - fs/inode.c | 46 +- fs/internal.h | 1 fs/nilfs2/alloc.c | 2 fs/nilfs2/alloc.h | 2 fs/nilfs2/bmap.c | 2 fs/nilfs2/bmap.h | 2 fs/nilfs2/btnode.c | 2 fs/nilfs2/btnode.h | 2 fs/nilfs2/btree.c | 2 fs/nilfs2/btree.h | 2 fs/nilfs2/cpfile.c | 2 fs/nilfs2/cpfile.h | 2 fs/nilfs2/dat.c | 2 fs/nilfs2/dat.h | 2 fs/nilfs2/dir.c | 2 fs/nilfs2/direct.c | 2 fs/nilfs2/direct.h | 2 fs/nilfs2/file.c | 2 fs/nilfs2/gcinode.c | 2 fs/nilfs2/ifile.c | 2 fs/nilfs2/ifile.h | 2 fs/nilfs2/inode.c | 2 fs/nilfs2/ioctl.c | 2 fs/nilfs2/mdt.c | 2 fs/nilfs2/mdt.h | 2 fs/nilfs2/namei.c | 2 fs/nilfs2/nilfs.h | 2 fs/nilfs2/page.c | 2 fs/nilfs2/page.h | 2 fs/nilfs2/recovery.c | 2 fs/nilfs2/segbuf.c | 2 fs/nilfs2/segbuf.h | 2 fs/nilfs2/segment.c | 2 fs/nilfs2/segment.h | 2 fs/nilfs2/sufile.c | 2 fs/nilfs2/sufile.h | 2 fs/nilfs2/super.c | 2 fs/nilfs2/sysfs.c | 78 ++-- fs/nilfs2/sysfs.h | 2 fs/nilfs2/the_nilfs.c | 2 fs/nilfs2/the_nilfs.h | 2 fs/proc/base.c | 21 - fs/proc/vmcore.c | 109 ++++-- fs/ramfs/inode.c | 11 fs/seq_file.c | 16 fs/sysv/super.c | 6 include/asm-generic/sections.h | 75 +++- include/kunit/test.h | 13 include/linux/bottom_half.h | 3 include/linux/container_of.h | 52 ++- include/linux/crash_dump.h | 30 + include/linux/delay.h | 2 include/linux/fs.h | 1 include/linux/fwnode.h | 1 include/linux/generic-radix-tree.h | 3 include/linux/hugetlb.h | 6 include/linux/instruction_pointer.h | 8 include/linux/kallsyms.h | 21 - include/linux/kernel.h | 39 -- include/linux/list.h | 4 include/linux/llist.h | 4 include/linux/pagemap.h | 50 ++ include/linux/plist.h | 5 include/linux/radix-tree.h | 4 include/linux/rwsem.h | 1 include/linux/sbitmap.h | 11 include/linux/seq_file.h | 19 + include/linux/signal.h | 1 include/linux/smp.h | 1 include/linux/spinlock.h | 1 include/linux/stackdepot.h | 5 include/linux/string_helpers.h | 1 include/media/media-entity.h | 3 init/main.c | 4 ipc/ipc_sysctl.c | 42 +- ipc/shm.c | 8 kernel/extable.c | 33 - kernel/fork.c | 9 kernel/kcov.c | 40 +- kernel/locking/lockdep.c | 3 kernel/resource.c | 54 ++- kernel/trace/ftrace.c | 2 lib/scatterlist.c | 11 lib/stackdepot.c | 46 ++ lib/vsprintf.c | 3 mm/Kconfig | 7 mm/filemap.c | 8 mm/kasan/report.c | 17 - mm/memfd.c | 4 mm/mmap.c | 3 mm/page_owner.c | 18 - mm/truncate.c | 19 + mm/vmscan.c | 7 mm/workingset.c | 10 net/sysctl_net.c | 2 scripts/checkpatch.pl | 33 + scripts/const_structs.checkpatch | 4 scripts/gdb/linux/symbols.py | 3 tools/testing/selftests/kselftest/runner.sh | 28 + tools/testing/selftests/proc/.gitignore | 1 tools/testing/selftests/proc/Makefile | 2 tools/testing/selftests/proc/proc-tid0.c | 81 ++++ 132 files changed, 1206 insertions(+), 681 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-11-05 20:34 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-11-05 20:34 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 262 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813 Subsystems affected by this patch series: scripts ocfs2 vfs mm/slab-generic mm/slab mm/slub mm/kconfig mm/dax mm/kasan mm/debug mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/mprotect mm/mremap mm/iomap mm/tracing mm/vmalloc mm/pagealloc mm/memory-failure mm/hugetlb mm/userfaultfd mm/vmscan mm/tools mm/memblock mm/oom-kill mm/hugetlbfs mm/migration mm/thp mm/readahead mm/nommu mm/ksm mm/vmstat mm/madvise mm/memory-hotplug mm/rmap mm/zsmalloc mm/highmem mm/zram mm/cleanups mm/kfence mm/damon Subsystem: scripts Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Sven Eckelmann <sven@narfation.org>: scripts/spelling.txt: fix "mistake" version of "synchronization" weidonghui <weidonghui@allwinnertech.com>: scripts/decodecode: fix faulting instruction no print when opps.file is DOS format Subsystem: ocfs2 Chenyuan Mi <cymi20@fudan.edu.cn>: ocfs2: fix handle refcount leak in two exception handling paths Valentin Vidic <vvidic@valentin-vidic.from.hr>: ocfs2: cleanup journal init and shutdown Colin Ian King <colin.king@canonical.com>: ocfs2/dlm: remove redundant assignment of variable ret Jan Kara <jack@suse.cz>: Patch series "ocfs2: Truncate data corruption fix": ocfs2: fix data corruption on truncate ocfs2: do not zero pages beyond i_size Subsystem: vfs Arnd Bergmann <arnd@arndb.de>: fs/posix_acl.c: avoid -Wempty-body warning Jia He <justin.he@arm.com>: d_path: fix Kernel doc validator complaining Subsystem: mm/slab-generic "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: move kvmalloc-related functions to slab.h Subsystem: mm/slab Shi Lei <shi_lei@massclouds.com>: mm/slab.c: remove useless lines in enable_cpucache() Subsystem: mm/slub Kefeng Wang <wangkefeng.wang@huawei.com>: slub: add back check for free nonslab objects Vlastimil Babka <vbabka@suse.cz>: mm, slub: change percpu partial accounting from objects to pages mm/slub: increase default cpu partial list sizes Hyeonggon Yoo <42.hyeyoo@gmail.com>: mm, slub: use prefetchw instead of prefetch Subsystem: mm/kconfig Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm: disable NUMA_BALANCING_DEFAULT_ENABLED and TRANSPARENT_HUGEPAGE on PREEMPT_RT Subsystem: mm/dax Christoph Hellwig <hch@lst.de>: mm: don't include <linux/dax.h> in <linux/mempolicy.h> Subsystem: mm/kasan Marco Elver <elver@google.com>: Patch series "stackdepot, kasan, workqueue: Avoid expanding stackdepot slabs when holding raw_spin_lock", v2: lib/stackdepot: include gfp.h lib/stackdepot: remove unused function argument lib/stackdepot: introduce __stack_depot_save() kasan: common: provide can_alloc in kasan_save_stack() kasan: generic: introduce kasan_record_aux_stack_noalloc() workqueue, kasan: avoid alloc_pages() when recording stack "Matthew Wilcox (Oracle)" <willy@infradead.org>: kasan: fix tag for large allocations when using CONFIG_SLAB Peter Collingbourne <pcc@google.com>: kasan: test: add memcpy test that avoids out-of-bounds write Subsystem: mm/debug Peter Xu <peterx@redhat.com>: Patch series "mm/smaps: Fixes and optimizations on shmem swap handling": mm/smaps: fix shmem pte hole swap calculation mm/smaps: use vma->vm_pgoff directly when counting partial swap mm/smaps: simplify shmem handling of pte holes Guo Ren <guoren@linux.alibaba.com>: mm: debug_vm_pgtable: don't use __P000 directly Kees Cook <keescook@chromium.org>: kasan: test: bypass __alloc_size checks Patch series "Add __alloc_size()", v3: rapidio: avoid bogus __alloc_size warning Compiler Attributes: add __alloc_size() for better bounds checking slab: clean up function prototypes slab: add __alloc_size attributes for better bounds checking mm/kvmalloc: add __alloc_size attributes for better bounds checking mm/vmalloc: add __alloc_size attributes for better bounds checking mm/page_alloc: add __alloc_size attributes for better bounds checking percpu: add __alloc_size attributes for better bounds checking Yinan Zhang <zhangyinan2019@email.szu.edu.cn>: mm/page_ext.c: fix a comment Subsystem: mm/pagecache David Howells <dhowells@redhat.com>: mm: stop filemap_read() from grabbing a superfluous page Christoph Hellwig <hch@lst.de>: Patch series "simplify bdi unregistation": mm: export bdi_unregister mtd: call bdi_unregister explicitly fs: explicitly unregister per-superblock BDIs mm: don't automatically unregister bdis mm: simplify bdi refcounting Jens Axboe <axboe@kernel.dk>: mm: don't read i_size of inode unless we need it "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap.c: remove bogus VM_BUG_ON Jens Axboe <axboe@kernel.dk>: mm: move more expensive part of XA setup out of mapping check Subsystem: mm/gup John Hubbard <jhubbard@nvidia.com>: mm/gup: further simplify __gup_device_huge() Subsystem: mm/swap Xu Wang <vulab@iscas.ac.cn>: mm/swapfile: remove needless request_queue NULL pointer check Rafael Aquini <aquini@redhat.com>: mm/swapfile: fix an integer overflow in swap_show() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: optimise put_pages_list() Subsystem: mm/memcg Peter Xu <peterx@redhat.com>: mm/memcg: drop swp_entry_t* in mc_handle_file_pte() Shakeel Butt <shakeelb@google.com>: memcg: flush stats only if updated memcg: unify memcg stat flushing Waiman Long <longman@redhat.com>: mm/memcg: remove obsolete memcg_free_kmem() Len Baker <len.baker@gmx.com>: mm/list_lru.c: prefer struct_size over open coded arithmetic Shakeel Butt <shakeelb@google.com>: memcg, kmem: further deprecate kmem.limit_in_bytes Muchun Song <songmuchun@bytedance.com>: mm: list_lru: remove holding lru lock mm: list_lru: fix the return value of list_lru_count_one() mm: memcontrol: remove kmemcg_id reparenting mm: memcontrol: remove the kmem states mm: list_lru: only add memcg-aware lrus to the global lru list Vasily Averin <vvs@virtuozzo.com>: Patch series "memcg: prohibit unconditional exceeding the limit of dying tasks", v3: mm, oom: pagefault_out_of_memory: don't force global OOM for dying tasks Michal Hocko <mhocko@suse.com>: mm, oom: do not trigger out_of_memory from the #PF Vasily Averin <vvs@virtuozzo.com>: memcg: prohibit unconditional exceeding the limit of dying tasks Subsystem: mm/pagemap Peng Liu <liupeng256@huawei.com>: mm/mmap.c: fix a data race of mm->total_vm Rolf Eike Beer <eb@emlix.com>: mm: use __pfn_to_section() instead of open coding it Amit Daniel Kachhap <amit.kachhap@arm.com>: mm/memory.c: avoid unnecessary kernel/user pointer conversion Nadav Amit <namit@vmware.com>: mm/memory.c: use correct VMA flags when freeing page-tables Peter Xu <peterx@redhat.com>: Patch series "mm: A few cleanup patches around zap, shmem and uffd", v4: mm/shmem: unconditionally set pte dirty in mfill_atomic_install_pte mm: clear vmf->pte after pte_unmap_same() returns mm: drop first_index/last_index in zap_details mm: add zap_skip_check_mapping() helper Qi Zheng <zhengqi.arch@bytedance.com>: Patch series "Do some code cleanups related to mm", v3: mm: introduce pmd_install() helper mm: remove redundant smp_wmb() Tiberiu A Georgescu <tiberiu.georgescu@nutanix.com>: Documentation: update pagemap with shmem exceptions Nicholas Piggin <npiggin@gmail.com>: Patch series "shoot lazy tlbs", v4: lazy tlb: introduce lazy mm refcount helper functions lazy tlb: allow lazy tlb mm refcounting to be configurable lazy tlb: shoot lazies, a non-refcounting lazy tlb option powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN Lukas Bulwahn <lukas.bulwahn@gmail.com>: memory: remove unused CONFIG_MEM_BLOCK_SIZE Subsystem: mm/mprotect Liu Song <liu.song11@zte.com.cn>: mm/mprotect.c: avoid repeated assignment in do_mprotect_pkey() Subsystem: mm/mremap Dmitry Safonov <dima@arista.com>: mm/mremap: don't account pages in vma_to_resize() Subsystem: mm/iomap Lucas De Marchi <lucas.demarchi@intel.com>: include/linux/io-mapping.h: remove fallback for writecombine Subsystem: mm/tracing Gang Li <ligang.bdlg@bytedance.com>: mm: mmap_lock: remove redundant newline in TP_printk mm: mmap_lock: use DECLARE_EVENT_CLASS and DEFINE_EVENT_FN Subsystem: mm/vmalloc Vasily Averin <vvs@virtuozzo.com>: mm/vmalloc: repair warn_alloc()s in __vmalloc_area_node() Peter Zijlstra <peterz@infradead.org>: mm/vmalloc: don't allow VM_NO_GUARD on vmap() Eric Dumazet <edumazet@google.com>: mm/vmalloc: make show_numa_info() aware of hugepage mappings mm/vmalloc: make sure to dump unpurged areas in /proc/vmallocinfo "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: do not adjust the search size for alignment overhead mm/vmalloc: check various alignments when debugging Vasily Averin <vvs@virtuozzo.com>: vmalloc: back off when the current task is OOM-killed Kefeng Wang <wangkefeng.wang@huawei.com>: vmalloc: choose a better start address in vm_area_register_early() arm64: support page mapping percpu first chunk allocator kasan: arm64: fix pcpu_page_first_chunk crash with KASAN_VMALLOC Michal Hocko <mhocko@suse.com>: mm/vmalloc: be more explicit about supported gfp flags Chen Wandun <chenwandun@huawei.com>: mm/vmalloc: introduce alloc_pages_bulk_array_mempolicy to accelerate memory allocation Changcheng Deng <deng.changcheng@zte.com.cn>: lib/test_vmalloc.c: use swap() to make code cleaner Subsystem: mm/pagealloc Eric Dumazet <edumazet@google.com>: mm/large system hash: avoid possible NULL deref in alloc_large_system_hash Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups and fixup for page_alloc", v2: mm/page_alloc.c: remove meaningless VM_BUG_ON() in pindex_to_order() mm/page_alloc.c: simplify the code by using macro K() mm/page_alloc.c: fix obsolete comment in free_pcppages_bulk() mm/page_alloc.c: use helper function zone_spans_pfn() mm/page_alloc.c: avoid allocating highmem pages via alloc_pages_exact[_nid] Bharata B Rao <bharata@amd.com>: Patch series "Fix NUMA nodes fallback list ordering": mm/page_alloc: print node fallback order Krupa Ramakrishnan <krupa.ramakrishnan@amd.com>: mm/page_alloc: use accumulated load when building node fallback list Geert Uytterhoeven <geert+renesas@glider.be>: Patch series "Fix NUMA without SMP": mm: move node_reclaim_distance to fix NUMA without SMP mm: move fold_vm_numa_events() to fix NUMA without SMP Eric Dumazet <edumazet@google.com>: mm/page_alloc.c: do not acquire zone lock in is_free_buddy_page() Feng Tang <feng.tang@intel.com>: mm/page_alloc: detect allocation forbidden by cpuset and bail out early Liangcai Fan <liangcaifan19@gmail.com>: mm/page_alloc.c: show watermark_boost of zone in zoneinfo Christophe Leroy <christophe.leroy@csgroup.eu>: mm: create a new system state and fix core_kernel_text() mm: make generic arch_is_kernel_initmem_freed() do what it says powerpc: use generic version of arch_is_kernel_initmem_freed() s390: use generic version of arch_is_kernel_initmem_freed() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm: page_alloc: use migrate_disable() in drain_local_pages_wq() Wang ShaoBo <bobo.shaobowang@huawei.com>: mm/page_alloc: use clamp() to simplify code Subsystem: mm/memory-failure Marco Elver <elver@google.com>: mm: fix data race in PagePoisoned() Rikard Falkeborn <rikard.falkeborn@gmail.com>: mm/memory_failure: constify static mm_walk_ops Yang Shi <shy828301@gmail.com>: Patch series "Solve silent data loss caused by poisoned page cache (shmem/tmpfs)", v5: mm: filemap: coding style cleanup for filemap_map_pmd() mm: hwpoison: refactor refcount check handling mm: shmem: don't truncate page if memory failure happens mm: hwpoison: handle non-anonymous THP correctly Subsystem: mm/hugetlb Peter Xu <peterx@redhat.com>: mm/hugetlb: drop __unmap_hugepage_range definition from hugetlb.h Mike Kravetz <mike.kravetz@oracle.com>: Patch series "hugetlb: add demote/split page functionality", v4: hugetlb: add demote hugetlb page sysfs interfaces mm/cma: add cma_pages_valid to determine if pages are in CMA hugetlb: be sure to free demoted CMA pages to CMA hugetlb: add demote bool to gigantic page routines hugetlb: add hugetlb demote page support Liangcai Fan <liangcaifan19@gmail.com>: mm: khugepaged: recalculate min_free_kbytes after stopping khugepaged Mina Almasry <almasrymina@google.com>: mm, hugepages: add mremap() support for hugepage backed vma mm, hugepages: add hugetlb vma mremap() test Baolin Wang <baolin.wang@linux.alibaba.com>: hugetlb: support node specified when using cma for gigantic hugepages Ran Jianping <ran.jianping@zte.com.cn>: mm: remove duplicate include in hugepage-mremap.c Baolin Wang <baolin.wang@linux.alibaba.com>: Patch series "Some cleanups and improvements for hugetlb": hugetlb_cgroup: remove unused hugetlb_cgroup_from_counter macro hugetlb: replace the obsolete hugetlb_instantiation_mutex in the comments hugetlb: remove redundant validation in has_same_uncharge_info() hugetlb: remove redundant VM_BUG_ON() in add_reservation_in_range() Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: remove unnecessary set_page_count in prep_compound_gigantic_page Subsystem: mm/userfaultfd Axel Rasmussen <axelrasmussen@google.com>: Patch series "Small userfaultfd selftest fixups", v2: userfaultfd/selftests: don't rely on GNU extensions for random numbers userfaultfd/selftests: fix feature support detection userfaultfd/selftests: fix calculation of expected ioctls Subsystem: mm/vmscan Miaohe Lin <linmiaohe@huawei.com>: mm/page_isolation: fix potential missing call to unset_migratetype_isolate() mm/page_isolation: guard against possible putback unisolated page Kai Song <songkai01@inspur.com>: mm/vmscan.c: fix -Wunused-but-set-variable warning Mel Gorman <mgorman@techsingularity.net>: Patch series "Remove dependency on congestion_wait in mm/", v5. Patch series: mm/vmscan: throttle reclaim until some writeback completes if congested mm/vmscan: throttle reclaim and compaction when too may pages are isolated mm/vmscan: throttle reclaim when no progress is being made mm/writeback: throttle based on page writeback instead of congestion mm/page_alloc: remove the throttling logic from the page allocator mm/vmscan: centralise timeout values for reclaim_throttle mm/vmscan: increase the timeout if page reclaim is not making progress mm/vmscan: delay waking of tasks throttled on NOPROGRESS Yuanzheng Song <songyuanzheng@huawei.com>: mm/vmpressure: fix data-race with memcg->socket_pressure Subsystem: mm/tools Zhenliang Wei <weizhenliang@huawei.com>: tools/vm/page_owner_sort.c: count and sort by mem Naoya Horiguchi <naoya.horiguchi@nec.com>: Patch series "tools/vm/page-types.c: a few improvements": tools/vm/page-types.c: make walk_file() aware of address range option tools/vm/page-types.c: move show_file() to summary output tools/vm/page-types.c: print file offset in hexadecimal Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: Patch series "memblock: cleanup memblock_free interface", v2: arch_numa: simplify numa_distance allocation xen/x86: free_p2m_page: use memblock_free_ptr() to free a virtual pointer memblock: drop memblock_free_early_nid() and memblock_free_early() memblock: stop aliasing __memblock_free_late with memblock_free_late memblock: rename memblock_free to memblock_phys_free memblock: use memblock_free for freeing virtual pointers Subsystem: mm/oom-kill Sultan Alsawaf <sultan@kerneltoast.com>: mm: mark the OOM reaper thread as freezable Subsystem: mm/hugetlbfs Zhenguo Yao <yaozhenguo1@gmail.com>: hugetlbfs: extend the definition of hugepages parameter to support node allocation Subsystem: mm/migration John Hubbard <jhubbard@nvidia.com>: mm/migrate: de-duplicate migrate_reason strings Yang Shi <shy828301@gmail.com>: mm: migrate: make demotion knob depend on migration Subsystem: mm/thp "George G. Davis" <davis.george@siemens.com>: selftests/vm/transhuge-stress: fix ram size thinko Rongwei Wang <rongwei.wang@linux.alibaba.com>: Patch series "fix two bugs for file THP": mm, thp: lock filemap when truncating page cache mm, thp: fix incorrect unmap behavior for private pages Subsystem: mm/readahead Lin Feng <linf@wangsu.com>: mm/readahead.c: fix incorrect comments for get_init_ra_size Subsystem: mm/nommu Kefeng Wang <wangkefeng.wang@huawei.com>: mm: nommu: kill arch_get_unmapped_area() Subsystem: mm/ksm "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: selftest/vm: fix ksm selftest to run with different NUMA topologies Pedro Demarchi Gomes <pedrodemargomes@gmail.com>: selftests: vm: add KSM huge pages merging time test Subsystem: mm/vmstat Liu Shixin <liushixin2@huawei.com>: mm/vmstat: annotate data race for zone->free_area[order].nr_free Lin Feng <linf@wangsu.com>: mm: vmstat.c: make extfrag_index show more pretty Subsystem: mm/madvise David Hildenbrand <david@redhat.com>: selftests/vm: make MADV_POPULATE_(READ|WRITE) use in-tree headers Subsystem: mm/memory-hotplug Tang Yizhou <tangyizhou@huawei.com>: mm/memory_hotplug: add static qualifier for online_policy_to_str() David Hildenbrand <david@redhat.com>: Patch series "memory-hotplug.rst: document the "auto-movable" online policy": memory-hotplug.rst: fix two instances of "movablecore" that should be "movable_node" memory-hotplug.rst: fix wrong /sys/module/memory_hotplug/parameters/ path memory-hotplug.rst: document the "auto-movable" online policy Patch series "mm/memory_hotplug: Kconfig and 32 bit cleanups": mm/memory_hotplug: remove CONFIG_X86_64_ACPI_NUMA dependency from CONFIG_MEMORY_HOTPLUG mm/memory_hotplug: remove CONFIG_MEMORY_HOTPLUG_SPARSE mm/memory_hotplug: restrict CONFIG_MEMORY_HOTPLUG to 64 bit mm/memory_hotplug: remove HIGHMEM leftovers mm/memory_hotplug: remove stale function declarations x86: remove memory hotplug support on X86_32 Patch series "mm/memory_hotplug: full support for add_memory_driver_managed() with CONFIG_ARCH_KEEP_MEMBLOCK", v2: mm/memory_hotplug: handle memblock_add_node() failures in add_memory_resource() memblock: improve MEMBLOCK_HOTPLUG documentation memblock: allow to specify flags with memblock_add_node() memblock: add MEMBLOCK_DRIVER_MANAGED to mimic IORESOURCE_SYSRAM_DRIVER_MANAGED mm/memory_hotplug: indicate MEMBLOCK_DRIVER_MANAGED with IORESOURCE_SYSRAM_DRIVER_MANAGED Subsystem: mm/rmap Alistair Popple <apopple@nvidia.com>: mm/rmap.c: avoid double faults migrating device private pages Subsystem: mm/zsmalloc Miaohe Lin <linmiaohe@huawei.com>: mm/zsmalloc.c: close race window between zs_pool_dec_isolated() and zs_unregister_migration() Subsystem: mm/highmem Ira Weiny <ira.weiny@intel.com>: mm/highmem: remove deprecated kmap_atomic Subsystem: mm/zram Jaewon Kim <jaewon31.kim@samsung.com>: zram_drv: allow reclaim on bio_alloc Dan Carpenter <dan.carpenter@oracle.com>: zram: off by one in read_block_state() Brian Geffon <bgeffon@google.com>: zram: introduce an aged idle interface Subsystem: mm/cleanups Stephen Kitt <steve@sk2.org>: mm: remove HARDENED_USERCOPY_FALLBACK Mianhan Liu <liumh1@shanghaitech.edu.cn>: include/linux/mm.h: move nr_free_buffer_pages from swap.h to mm.h Subsystem: mm/kfence Marco Elver <elver@google.com>: stacktrace: move filter_irq_stacks() to kernel/stacktrace.c kfence: count unexpectedly skipped allocations kfence: move saving stack trace of allocations into __kfence_alloc() kfence: limit currently covered allocations when pool nearly full kfence: add note to documentation about skipping covered allocations kfence: test: use kunit_skip() to skip tests kfence: shorten critical sections of alloc/free kfence: always use static branches to guard kfence_alloc() kfence: default to dynamic branch instead of static keys mode Subsystem: mm/damon Geert Uytterhoeven <geert@linux-m68k.org>: mm/damon: grammar s/works/work/ SeongJae Park <sjpark@amazon.de>: Documentation/vm: move user guides to admin-guide/mm/ SeongJae Park <sj@kernel.org>: MAINTAINERS: update SeongJae's email address SeongJae Park <sjpark@amazon.de>: docs/vm/damon: remove broken reference include/linux/damon.h: fix kernel-doc comments for 'damon_callback' SeongJae Park <sj@kernel.org>: mm/damon/core: print kdamond start log in debug mode only Changbin Du <changbin.du@gmail.com>: mm/damon: remove unnecessary do_exit() from kdamond mm/damon: needn't hold kdamond_lock to print pid of kdamond Colin Ian King <colin.king@canonical.com>: mm/damon/core: nullify pointer ctx->kdamond with a NULL SeongJae Park <sj@kernel.org>: Patch series "Implement Data Access Monitoring-based Memory Operation Schemes": mm/damon/core: account age of target regions mm/damon/core: implement DAMON-based Operation Schemes (DAMOS) mm/damon/vaddr: support DAMON-based Operation Schemes mm/damon/dbgfs: support DAMON-based Operation Schemes mm/damon/schemes: implement statistics feature selftests/damon: add 'schemes' debugfs tests Docs/admin-guide/mm/damon: document DAMON-based Operation Schemes Patch series "DAMON: Support Physical Memory Address Space Monitoring:: mm/damon/dbgfs: allow users to set initial monitoring target regions mm/damon/dbgfs-test: add a unit test case for 'init_regions' Docs/admin-guide/mm/damon: document 'init_regions' feature mm/damon/vaddr: separate commonly usable functions mm/damon: implement primitives for physical address space monitoring mm/damon/dbgfs: support physical memory monitoring Docs/DAMON: document physical memory monitoring support Rikard Falkeborn <rikard.falkeborn@gmail.com>: mm/damon/vaddr: constify static mm_walk_ops Rongwei Wang <rongwei.wang@linux.alibaba.com>: mm/damon/dbgfs: remove unnecessary variables SeongJae Park <sj@kernel.org>: mm/damon/paddr: support the pageout scheme mm/damon/schemes: implement size quota for schemes application speed control mm/damon/schemes: skip already charged targets and regions mm/damon/schemes: implement time quota mm/damon/dbgfs: support quotas of schemes mm/damon/selftests: support schemes quotas mm/damon/schemes: prioritize regions within the quotas mm/damon/vaddr,paddr: support pageout prioritization mm/damon/dbgfs: support prioritization weights tools/selftests/damon: update for regions prioritization of schemes mm/damon/schemes: activate schemes based on a watermarks mechanism mm/damon/dbgfs: support watermarks selftests/damon: support watermarks mm/damon: introduce DAMON-based Reclamation (DAMON_RECLAIM) Documentation/admin-guide/mm/damon: add a document for DAMON_RECLAIM Xin Hao <xhao@linux.alibaba.com>: Patch series "mm/damon: Fix some small bugs", v4: mm/damon: remove unnecessary variable initialization mm/damon/dbgfs: add adaptive_targets list check before enable monitor_on SeongJae Park <sj@kernel.org>: Patch series "Fix trivial nits in Documentation/admin-guide/mm": Docs/admin-guide/mm/damon/start: fix wrong example commands Docs/admin-guide/mm/damon/start: fix a wrong link Docs/admin-guide/mm/damon/start: simplify the content Docs/admin-guide/mm/pagemap: wordsmith page flags descriptions Changbin Du <changbin.du@gmail.com>: mm/damon: simplify stop mechanism Colin Ian King <colin.i.king@googlemail.com>: mm/damon: fix a few spelling mistakes in comments and a pr_debug message Changbin Du <changbin.du@gmail.com>: mm/damon: remove return value from before_terminate callback a/Documentation/admin-guide/blockdev/zram.rst | 8 a/Documentation/admin-guide/cgroup-v1/memory.rst | 11 a/Documentation/admin-guide/kernel-parameters.txt | 14 a/Documentation/admin-guide/mm/damon/index.rst | 1 a/Documentation/admin-guide/mm/damon/reclaim.rst | 235 +++ a/Documentation/admin-guide/mm/damon/start.rst | 140 + a/Documentation/admin-guide/mm/damon/usage.rst | 117 + a/Documentation/admin-guide/mm/hugetlbpage.rst | 42 a/Documentation/admin-guide/mm/memory-hotplug.rst | 147 +- a/Documentation/admin-guide/mm/pagemap.rst | 75 - a/Documentation/core-api/memory-hotplug.rst | 3 a/Documentation/dev-tools/kfence.rst | 23 a/Documentation/translations/zh_CN/core-api/memory-hotplug.rst | 4 a/Documentation/vm/damon/design.rst | 29 a/Documentation/vm/damon/faq.rst | 5 a/Documentation/vm/damon/index.rst | 1 a/Documentation/vm/page_owner.rst | 23 a/MAINTAINERS | 2 a/Makefile | 15 a/arch/Kconfig | 28 a/arch/alpha/kernel/core_irongate.c | 6 a/arch/arc/mm/init.c | 6 a/arch/arm/mach-hisi/platmcpm.c | 2 a/arch/arm/mach-rpc/ecard.c | 2 a/arch/arm/mm/init.c | 2 a/arch/arm64/Kconfig | 4 a/arch/arm64/mm/kasan_init.c | 16 a/arch/arm64/mm/mmu.c | 4 a/arch/ia64/mm/contig.c | 2 a/arch/ia64/mm/init.c | 2 a/arch/m68k/mm/mcfmmu.c | 3 a/arch/m68k/mm/motorola.c | 6 a/arch/mips/loongson64/init.c | 4 a/arch/mips/mm/init.c | 6 a/arch/mips/sgi-ip27/ip27-memory.c | 3 a/arch/mips/sgi-ip30/ip30-setup.c | 6 a/arch/powerpc/Kconfig | 1 a/arch/powerpc/configs/skiroot_defconfig | 1 a/arch/powerpc/include/asm/machdep.h | 2 a/arch/powerpc/include/asm/sections.h | 13 a/arch/powerpc/kernel/dt_cpu_ftrs.c | 8 a/arch/powerpc/kernel/paca.c | 8 a/arch/powerpc/kernel/setup-common.c | 4 a/arch/powerpc/kernel/setup_64.c | 6 a/arch/powerpc/kernel/smp.c | 2 a/arch/powerpc/mm/book3s64/radix_tlb.c | 4 a/arch/powerpc/mm/hugetlbpage.c | 9 a/arch/powerpc/platforms/powernv/pci-ioda.c | 4 a/arch/powerpc/platforms/powernv/setup.c | 4 a/arch/powerpc/platforms/pseries/setup.c | 2 a/arch/powerpc/platforms/pseries/svm.c | 9 a/arch/riscv/kernel/setup.c | 10 a/arch/s390/include/asm/sections.h | 12 a/arch/s390/kernel/setup.c | 11 a/arch/s390/kernel/smp.c | 6 a/arch/s390/kernel/uv.c | 2 a/arch/s390/mm/init.c | 3 a/arch/s390/mm/kasan_init.c | 2 a/arch/sh/boards/mach-ap325rxa/setup.c | 2 a/arch/sh/boards/mach-ecovec24/setup.c | 4 a/arch/sh/boards/mach-kfr2r09/setup.c | 2 a/arch/sh/boards/mach-migor/setup.c | 2 a/arch/sh/boards/mach-se/7724/setup.c | 4 a/arch/sparc/kernel/smp_64.c | 4 a/arch/um/kernel/mem.c | 4 a/arch/x86/Kconfig | 6 a/arch/x86/kernel/setup.c | 4 a/arch/x86/kernel/setup_percpu.c | 2 a/arch/x86/mm/init.c | 2 a/arch/x86/mm/init_32.c | 31 a/arch/x86/mm/kasan_init_64.c | 4 a/arch/x86/mm/numa.c | 2 a/arch/x86/mm/numa_emulation.c | 2 a/arch/x86/xen/mmu_pv.c | 8 a/arch/x86/xen/p2m.c | 4 a/arch/x86/xen/setup.c | 6 a/drivers/base/Makefile | 2 a/drivers/base/arch_numa.c | 96 + a/drivers/base/node.c | 9 a/drivers/block/zram/zram_drv.c | 66 a/drivers/firmware/efi/memmap.c | 2 a/drivers/hwmon/occ/p9_sbe.c | 1 a/drivers/macintosh/smu.c | 2 a/drivers/mmc/core/mmc_test.c | 1 a/drivers/mtd/mtdcore.c | 1 a/drivers/of/kexec.c | 4 a/drivers/of/of_reserved_mem.c | 5 a/drivers/rapidio/devices/rio_mport_cdev.c | 9 a/drivers/s390/char/sclp_early.c | 4 a/drivers/usb/early/xhci-dbc.c | 10 a/drivers/virtio/Kconfig | 2 a/drivers/xen/swiotlb-xen.c | 4 a/fs/d_path.c | 8 a/fs/exec.c | 4 a/fs/ocfs2/alloc.c | 21 a/fs/ocfs2/dlm/dlmrecovery.c | 1 a/fs/ocfs2/file.c | 8 a/fs/ocfs2/inode.c | 4 a/fs/ocfs2/journal.c | 28 a/fs/ocfs2/journal.h | 3 a/fs/ocfs2/super.c | 40 a/fs/open.c | 16 a/fs/posix_acl.c | 3 a/fs/proc/task_mmu.c | 28 a/fs/super.c | 3 a/include/asm-generic/sections.h | 14 a/include/linux/backing-dev-defs.h | 3 a/include/linux/backing-dev.h | 1 a/include/linux/cma.h | 1 a/include/linux/compiler-gcc.h | 8 a/include/linux/compiler_attributes.h | 10 a/include/linux/compiler_types.h | 12 a/include/linux/cpuset.h | 17 a/include/linux/damon.h | 258 +++ a/include/linux/fs.h | 1 a/include/linux/gfp.h | 8 a/include/linux/highmem.h | 28 a/include/linux/hugetlb.h | 36 a/include/linux/io-mapping.h | 6 a/include/linux/kasan.h | 8 a/include/linux/kernel.h | 1 a/include/linux/kfence.h | 21 a/include/linux/memblock.h | 48 a/include/linux/memcontrol.h | 9 a/include/linux/memory.h | 26 a/include/linux/memory_hotplug.h | 3 a/include/linux/mempolicy.h | 5 a/include/linux/migrate.h | 23 a/include/linux/migrate_mode.h | 13 a/include/linux/mm.h | 57 a/include/linux/mm_types.h | 2 a/include/linux/mmzone.h | 41 a/include/linux/node.h | 4 a/include/linux/page-flags.h | 2 a/include/linux/percpu.h | 6 a/include/linux/sched/mm.h | 25 a/include/linux/slab.h | 181 +- a/include/linux/slub_def.h | 13 a/include/linux/stackdepot.h | 8 a/include/linux/stacktrace.h | 1 a/include/linux/swap.h | 1 a/include/linux/vmalloc.h | 24 a/include/trace/events/mmap_lock.h | 50 a/include/trace/events/vmscan.h | 42 a/include/trace/events/writeback.h | 7 a/init/Kconfig | 2 a/init/initramfs.c | 4 a/init/main.c | 6 a/kernel/cgroup/cpuset.c | 23 a/kernel/cpu.c | 2 a/kernel/dma/swiotlb.c | 6 a/kernel/exit.c | 2 a/kernel/extable.c | 2 a/kernel/fork.c | 51 a/kernel/kexec_file.c | 5 a/kernel/kthread.c | 21 a/kernel/locking/lockdep.c | 15 a/kernel/printk/printk.c | 4 a/kernel/sched/core.c | 37 a/kernel/sched/sched.h | 4 a/kernel/sched/topology.c | 1 a/kernel/stacktrace.c | 30 a/kernel/tsacct.c | 2 a/kernel/workqueue.c | 2 a/lib/Kconfig.debug | 2 a/lib/Kconfig.kfence | 26 a/lib/bootconfig.c | 2 a/lib/cpumask.c | 6 a/lib/stackdepot.c | 76 - a/lib/test_kasan.c | 26 a/lib/test_kasan_module.c | 2 a/lib/test_vmalloc.c | 6 a/mm/Kconfig | 10 a/mm/backing-dev.c | 65 a/mm/cma.c | 26 a/mm/compaction.c | 12 a/mm/damon/Kconfig | 24 a/mm/damon/Makefile | 4 a/mm/damon/core.c | 500 ++++++- a/mm/damon/dbgfs-test.h | 56 a/mm/damon/dbgfs.c | 486 +++++- a/mm/damon/paddr.c | 275 +++ a/mm/damon/prmtv-common.c | 133 + a/mm/damon/prmtv-common.h | 20 a/mm/damon/reclaim.c | 356 ++++ a/mm/damon/vaddr-test.h | 2 a/mm/damon/vaddr.c | 167 +- a/mm/debug.c | 20 a/mm/debug_vm_pgtable.c | 7 a/mm/filemap.c | 78 - a/mm/gup.c | 5 a/mm/highmem.c | 6 a/mm/hugetlb.c | 713 +++++++++- a/mm/hugetlb_cgroup.c | 3 a/mm/internal.h | 26 a/mm/kasan/common.c | 8 a/mm/kasan/generic.c | 16 a/mm/kasan/kasan.h | 2 a/mm/kasan/shadow.c | 5 a/mm/kfence/core.c | 214 ++- a/mm/kfence/kfence.h | 2 a/mm/kfence/kfence_test.c | 14 a/mm/khugepaged.c | 10 a/mm/list_lru.c | 58 a/mm/memblock.c | 35 a/mm/memcontrol.c | 217 +-- a/mm/memory-failure.c | 117 + a/mm/memory.c | 166 +- a/mm/memory_hotplug.c | 57 a/mm/mempolicy.c | 143 +- a/mm/migrate.c | 61 a/mm/mmap.c | 2 a/mm/mprotect.c | 5 a/mm/mremap.c | 86 - a/mm/nommu.c | 6 a/mm/oom_kill.c | 27 a/mm/page-writeback.c | 13 a/mm/page_alloc.c | 119 - a/mm/page_ext.c | 2 a/mm/page_isolation.c | 29 a/mm/percpu.c | 24 a/mm/readahead.c | 2 a/mm/rmap.c | 8 a/mm/shmem.c | 44 a/mm/slab.c | 16 a/mm/slab_common.c | 8 a/mm/slub.c | 117 - a/mm/sparse-vmemmap.c | 2 a/mm/sparse.c | 6 a/mm/swap.c | 23 a/mm/swapfile.c | 6 a/mm/userfaultfd.c | 8 a/mm/vmalloc.c | 107 + a/mm/vmpressure.c | 2 a/mm/vmscan.c | 194 ++ a/mm/vmstat.c | 76 - a/mm/zsmalloc.c | 7 a/net/ipv4/tcp.c | 1 a/net/ipv4/udp.c | 1 a/net/netfilter/ipvs/ip_vs_ctl.c | 1 a/net/openvswitch/meter.c | 1 a/net/sctp/protocol.c | 1 a/scripts/checkpatch.pl | 3 a/scripts/decodecode | 2 a/scripts/spelling.txt | 18 a/security/Kconfig | 14 a/tools/testing/selftests/damon/debugfs_attrs.sh | 25 a/tools/testing/selftests/memory-hotplug/config | 1 a/tools/testing/selftests/vm/.gitignore | 1 a/tools/testing/selftests/vm/Makefile | 1 a/tools/testing/selftests/vm/hugepage-mremap.c | 161 ++ a/tools/testing/selftests/vm/ksm_tests.c | 154 ++ a/tools/testing/selftests/vm/madv_populate.c | 15 a/tools/testing/selftests/vm/run_vmtests.sh | 11 a/tools/testing/selftests/vm/transhuge-stress.c | 2 a/tools/testing/selftests/vm/userfaultfd.c | 157 +- a/tools/vm/page-types.c | 38 a/tools/vm/page_owner_sort.c | 94 + b/Documentation/admin-guide/mm/index.rst | 2 b/Documentation/vm/index.rst | 26 260 files changed, 6448 insertions(+), 2327 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-10-28 21:35 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-10-28 21:35 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 11 patches, based on 411a44c24a561e449b592ff631b7ae321f1eb559. Subsystems affected by this patch series: mm/memcg mm/memory-failure mm/oom-kill ocfs2 mm/secretmem mm/vmalloc mm/hugetlb mm/damon mm/tools Subsystem: mm/memcg Shakeel Butt <shakeelb@google.com>: memcg: page_alloc: skip bulk allocator for __GFP_ACCOUNT Subsystem: mm/memory-failure Yang Shi <shy828301@gmail.com>: mm: hwpoison: remove the unnecessary THP check mm: filemap: check if THP has hwpoisoned subpage for PMD page fault Subsystem: mm/oom-kill Suren Baghdasaryan <surenb@google.com>: mm/oom_kill.c: prevent a race between process_mrelease and exit_mmap Subsystem: ocfs2 Gautham Ananthakrishna <gautham.ananthakrishna@oracle.com>: ocfs2: fix race between searching chunks and release journal_head from buffer_head Subsystem: mm/secretmem Kees Cook <keescook@chromium.org>: mm/secretmem: avoid letting secretmem_users drop to zero Subsystem: mm/vmalloc Chen Wandun <chenwandun@huawei.com>: mm/vmalloc: fix numa spreading for large hash tables Subsystem: mm/hugetlb Rongwei Wang <rongwei.wang@linux.alibaba.com>: mm, thp: bail out early in collapse_file for writeback page Yang Shi <shy828301@gmail.com>: mm: khugepaged: skip huge page collapse for special files Subsystem: mm/damon SeongJae Park <sj@kernel.org>: mm/damon/core-test: fix wrong expectations for 'damon_split_regions_of()' Subsystem: mm/tools David Yang <davidcomponentone@gmail.com>: tools/testing/selftests/vm/split_huge_page_test.c: fix application of sizeof to pointer fs/ocfs2/suballoc.c | 22 ++++++++++------- include/linux/page-flags.h | 23 ++++++++++++++++++ mm/damon/core-test.h | 4 +-- mm/huge_memory.c | 2 + mm/khugepaged.c | 26 +++++++++++++------- mm/memory-failure.c | 28 +++++++++++----------- mm/memory.c | 9 +++++++ mm/oom_kill.c | 23 +++++++++--------- mm/page_alloc.c | 8 +++++- mm/secretmem.c | 2 - mm/vmalloc.c | 15 +++++++---- tools/testing/selftests/vm/split_huge_page_test.c | 2 - 12 files changed, 110 insertions(+), 54 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-10-18 22:14 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-10-18 22:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 19 patches, based on 519d81956ee277b4419c723adfb154603c2565ba. Subsystems affected by this patch series: mm/userfaultfd mm/migration ocfs2 mm/memblock mm/mempolicy mm/slub binfmt vfs mm/secretmem mm/thp misc Subsystem: mm/userfaultfd Peter Xu <peterx@redhat.com>: mm/userfaultfd: selftests: fix memory corruption with thp enabled Nadav Amit <namit@vmware.com>: userfaultfd: fix a race between writeprotect and exit_mmap() Subsystem: mm/migration Dave Hansen <dave.hansen@linux.intel.com>: Patch series "mm/migrate: 5.15 fixes for automatic demotion", v2: mm/migrate: optimize hotplug-time demotion order updates mm/migrate: add CPU hotplug to demotion #ifdef Huang Ying <ying.huang@intel.com>: mm/migrate: fix CPUHP state to update node demotion order Subsystem: ocfs2 Jan Kara <jack@suse.cz>: ocfs2: fix data corruption after conversion from inline format Valentin Vidic <vvidic@valentin-vidic.from.hr>: ocfs2: mount fails with buffer overflow in strlen Subsystem: mm/memblock Peng Fan <peng.fan@nxp.com>: memblock: check memory total_size Subsystem: mm/mempolicy Eric Dumazet <edumazet@google.com>: mm/mempolicy: do not allow illegal MPOL_F_NUMA_BALANCING | MPOL_LOCAL in mbind() Subsystem: mm/slub Miaohe Lin <linmiaohe@huawei.com>: Patch series "Fixups for slub": mm, slub: fix two bugs in slab_debug_trace_open() mm, slub: fix mismatch between reconstructed freelist depth and cnt mm, slub: fix potential memoryleak in kmem_cache_open() mm, slub: fix potential use-after-free in slab_debugfs_fops mm, slub: fix incorrect memcg slab count for bulk free Subsystem: binfmt Lukas Bulwahn <lukas.bulwahn@gmail.com>: elfcore: correct reference to CONFIG_UML Subsystem: vfs "Matthew Wilcox (Oracle)" <willy@infradead.org>: vfs: check fd has read access in kernel_read_file_from_fd() Subsystem: mm/secretmem Sean Christopherson <seanjc@google.com>: mm/secretmem: fix NULL page->mapping dereference in page_is_secretmem() Subsystem: mm/thp Marek Szyprowski <m.szyprowski@samsung.com>: mm/thp: decrease nr_thps in file's mapping on THP split Subsystem: misc Andrej Shadura <andrew.shadura@collabora.co.uk>: mailmap: add Andrej Shadura .mailmap | 2 + fs/kernel_read_file.c | 2 - fs/ocfs2/alloc.c | 46 ++++++----------------- fs/ocfs2/super.c | 14 +++++-- fs/userfaultfd.c | 12 ++++-- include/linux/cpuhotplug.h | 4 ++ include/linux/elfcore.h | 2 - include/linux/memory.h | 5 ++ include/linux/secretmem.h | 2 - mm/huge_memory.c | 6 ++- mm/memblock.c | 2 - mm/mempolicy.c | 16 ++------ mm/migrate.c | 62 ++++++++++++++++++------------- mm/page_ext.c | 4 -- mm/slab.c | 4 +- mm/slub.c | 31 ++++++++++++--- tools/testing/selftests/vm/userfaultfd.c | 23 ++++++++++- 17 files changed, 138 insertions(+), 99 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-09-24 22:42 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-09-24 22:42 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 16 patches, based on 7d42e98182586f57f376406d033f05fe135edb75. Subsystems affected by this patch series: mm/memory-failure mm/kasan mm/damon xtensa mm/shmem ocfs2 scripts mm/tools lib mm/pagecache mm/debug sh mm/kasan mm/memory-failure mm/pagemap Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm, hwpoison: add is_free_buddy_page() in HWPoisonHandlable() Subsystem: mm/kasan Marco Elver <elver@google.com>: kasan: fix Kconfig check of CC_HAS_WORKING_NOSANITIZE_ADDRESS Subsystem: mm/damon Adam Borowski <kilobyte@angband.pl>: mm/damon: don't use strnlen() with known-bogus source length Subsystem: xtensa Guenter Roeck <linux@roeck-us.net>: xtensa: increase size of gcc stack frame check Subsystem: mm/shmem Liu Yuntao <liuyuntao10@huawei.com>: mm/shmem.c: fix judgment error in shmem_is_huge() Subsystem: ocfs2 Wengang Wang <wen.gang.wang@oracle.com>: ocfs2: drop acl cache for directories too Subsystem: scripts Miles Chen <miles.chen@mediatek.com>: scripts/sorttable: riscv: fix undeclared identifier 'EM_RISCV' error Subsystem: mm/tools Changbin Du <changbin.du@gmail.com>: tools/vm/page-types: remove dependency on opt_file for idle page tracking Subsystem: lib Paul Menzel <pmenzel@molgen.mpg.de>: lib/zlib_inflate/inffast: check config in C to avoid unused function warning Subsystem: mm/pagecache Minchan Kim <minchan@kernel.org>: mm: fs: invalidate bh_lrus for only cold path Subsystem: mm/debug Weizhao Ouyang <o451686892@gmail.com>: mm/debug: sync up MR_CONTIG_RANGE and MR_LONGTERM_PIN mm/debug: sync up latest migrate_reason to migrate_reason_names Subsystem: sh Geert Uytterhoeven <geert+renesas@glider.be>: sh: pgtable-3level: fix cast to pointer from integer of different size Subsystem: mm/kasan Nathan Chancellor <nathan@kernel.org>: kasan: always respect CONFIG_KASAN_STACK Subsystem: mm/memory-failure Qi Zheng <zhengqi.arch@bytedance.com>: mm/memory_failure: fix the missing pte_unmap() call Subsystem: mm/pagemap Chen Jun <chenjun102@huawei.com>: mm: fix uninitialized use in overcommit_policy_handler arch/sh/include/asm/pgtable-3level.h | 2 +- fs/buffer.c | 8 ++++++-- fs/ocfs2/dlmglue.c | 3 ++- include/linux/buffer_head.h | 4 ++-- include/linux/migrate.h | 6 +++++- lib/Kconfig.debug | 2 +- lib/Kconfig.kasan | 2 ++ lib/zlib_inflate/inffast.c | 13 ++++++------- mm/damon/dbgfs-test.h | 16 ++++++++-------- mm/debug.c | 4 +++- mm/memory-failure.c | 12 ++++++------ mm/shmem.c | 4 ++-- mm/swap.c | 19 ++++++++++++++++--- mm/util.c | 4 ++-- scripts/Makefile.kasan | 3 ++- scripts/sorttable.c | 4 ++++ tools/vm/page-types.c | 2 +- 17 files changed, 69 insertions(+), 39 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-09-10 3:09 Andrew Morton 2021-09-10 17:11 ` incoming Kees Cook 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2021-09-10 3:09 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits More post linux-next material. 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6. Subsystems affected by this patch series: mm/slab-generic rapidio mm/debug Subsystem: mm/slab-generic "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: move kvmalloc-related functions to slab.h Subsystem: rapidio Kees Cook <keescook@chromium.org>: rapidio: avoid bogus __alloc_size warning Subsystem: mm/debug Kees Cook <keescook@chromium.org>: Patch series "Add __alloc_size() for better bounds checking", v2: Compiler Attributes: add __alloc_size() for better bounds checking checkpatch: add __alloc_size() to known $Attribute slab: clean up function declarations slab: add __alloc_size attributes for better bounds checking mm/page_alloc: add __alloc_size attributes for better bounds checking percpu: add __alloc_size attributes for better bounds checking mm/vmalloc: add __alloc_size attributes for better bounds checking Makefile | 15 +++ drivers/of/kexec.c | 1 drivers/rapidio/devices/rio_mport_cdev.c | 9 +- include/linux/compiler_attributes.h | 6 + include/linux/gfp.h | 2 include/linux/mm.h | 34 -------- include/linux/percpu.h | 3 include/linux/slab.h | 122 ++++++++++++++++++++++--------- include/linux/vmalloc.h | 11 ++ scripts/checkpatch.pl | 3 10 files changed, 132 insertions(+), 74 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-09-10 3:09 incoming Andrew Morton @ 2021-09-10 17:11 ` Kees Cook 2021-09-10 20:13 ` incoming Kees Cook 0 siblings, 1 reply; 348+ messages in thread From: Kees Cook @ 2021-09-10 17:11 UTC (permalink / raw) To: Linus Torvalds, Andrew Morton; +Cc: linux-mm, mm-commits On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote: > > More post linux-next material. > > 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6. > > Subsystems affected by this patch series: > > mm/slab-generic > rapidio > mm/debug > > Subsystem: mm/slab-generic > > "Matthew Wilcox (Oracle)" <willy@infradead.org>: > mm: move kvmalloc-related functions to slab.h > > Subsystem: rapidio > > Kees Cook <keescook@chromium.org>: > rapidio: avoid bogus __alloc_size warning > > Subsystem: mm/debug > > Kees Cook <keescook@chromium.org>: > Patch series "Add __alloc_size() for better bounds checking", v2: > Compiler Attributes: add __alloc_size() for better bounds checking > checkpatch: add __alloc_size() to known $Attribute > slab: clean up function declarations > slab: add __alloc_size attributes for better bounds checking > mm/page_alloc: add __alloc_size attributes for better bounds checking > percpu: add __alloc_size attributes for better bounds checking > mm/vmalloc: add __alloc_size attributes for better bounds checking Hi, FYI, in overnight build testing I found yet another corner case in GCC's handling of the __alloc_size attribute. It's the gift that keeps on giving. The fix is here: https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/ > > Makefile | 15 +++ > drivers/of/kexec.c | 1 > drivers/rapidio/devices/rio_mport_cdev.c | 9 +- > include/linux/compiler_attributes.h | 6 + > include/linux/gfp.h | 2 > include/linux/mm.h | 34 -------- > include/linux/percpu.h | 3 > include/linux/slab.h | 122 ++++++++++++++++++++++--------- > include/linux/vmalloc.h | 11 ++ > scripts/checkpatch.pl | 3 > 10 files changed, 132 insertions(+), 74 deletions(-) > -- Kees Cook ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-09-10 17:11 ` incoming Kees Cook @ 2021-09-10 20:13 ` Kees Cook 0 siblings, 0 replies; 348+ messages in thread From: Kees Cook @ 2021-09-10 20:13 UTC (permalink / raw) To: linux-kernel; +Cc: Linus Torvalds, Andrew Morton, linux-mm, mm-commits On Fri, Sep 10, 2021 at 10:11:53AM -0700, Kees Cook wrote: > On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote: > > > > More post linux-next material. > > > > 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6. > > > > Subsystems affected by this patch series: > > > > mm/slab-generic > > rapidio > > mm/debug > > > > Subsystem: mm/slab-generic > > > > "Matthew Wilcox (Oracle)" <willy@infradead.org>: > > mm: move kvmalloc-related functions to slab.h > > > > Subsystem: rapidio > > > > Kees Cook <keescook@chromium.org>: > > rapidio: avoid bogus __alloc_size warning > > > > Subsystem: mm/debug > > > > Kees Cook <keescook@chromium.org>: > > Patch series "Add __alloc_size() for better bounds checking", v2: > > Compiler Attributes: add __alloc_size() for better bounds checking > > checkpatch: add __alloc_size() to known $Attribute > > slab: clean up function declarations > > slab: add __alloc_size attributes for better bounds checking > > mm/page_alloc: add __alloc_size attributes for better bounds checking > > percpu: add __alloc_size attributes for better bounds checking > > mm/vmalloc: add __alloc_size attributes for better bounds checking > > Hi, > > FYI, in overnight build testing I found yet another corner case in > GCC's handling of the __alloc_size attribute. It's the gift that keeps > on giving. The fix is here: > > https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/ I'm so glad it's Friday. Here's the v2 fix... *sigh* https://lore.kernel.org/lkml/20210910201132.3809437-1-keescook@chromium.org/ -Kees > > > > > Makefile | 15 +++ > > drivers/of/kexec.c | 1 > > drivers/rapidio/devices/rio_mport_cdev.c | 9 +- > > include/linux/compiler_attributes.h | 6 + > > include/linux/gfp.h | 2 > > include/linux/mm.h | 34 -------- > > include/linux/percpu.h | 3 > > include/linux/slab.h | 122 ++++++++++++++++++++++--------- > > include/linux/vmalloc.h | 11 ++ > > scripts/checkpatch.pl | 3 > > 10 files changed, 132 insertions(+), 74 deletions(-) > > > > -- > Kees Cook -- Kees Cook ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-09-09 1:08 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-09-09 1:08 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm A bunch of hotfixes, mostly cc:stable. 8 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c. Subsystems affected by this patch series: mm/hmm mm/hugetlb mm/vmscan mm/pagealloc mm/pagemap mm/kmemleak mm/mempolicy mm/memblock Subsystem: mm/hmm Li Zhijian <lizhijian@cn.fujitsu.com>: mm/hmm: bypass devmap pte when all pfn requested flags are fulfilled Subsystem: mm/hugetlb Liu Zixian <liuzixian4@huawei.com>: mm/hugetlb: initialize hugetlb_usage in mm_init Subsystem: mm/vmscan Rik van Riel <riel@surriel.com>: mm,vmscan: fix divide by zero in get_scan_count Subsystem: mm/pagealloc Miaohe Lin <linmiaohe@huawei.com>: mm/page_alloc.c: avoid accessing uninitialized pcp page migratetype Subsystem: mm/pagemap Liam Howlett <liam.howlett@oracle.com>: mmap_lock: change trace and locking order Subsystem: mm/kmemleak Naohiro Aota <naohiro.aota@wdc.com>: mm/kmemleak: allow __GFP_NOLOCKDEP passed to kmemleak's gfp Subsystem: mm/mempolicy yanghui <yanghui.def@bytedance.com>: mm/mempolicy: fix a race between offset_il_node and mpol_rebind_task Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: nds32/setup: remove unused memblock_region variable in setup_memory() arch/nds32/kernel/setup.c | 1 - include/linux/hugetlb.h | 9 +++++++++ include/linux/mmap_lock.h | 8 ++++---- kernel/fork.c | 1 + mm/hmm.c | 5 ++++- mm/kmemleak.c | 3 ++- mm/mempolicy.c | 17 +++++++++++++---- mm/page_alloc.c | 4 +++- mm/vmscan.c | 2 +- 9 files changed, 37 insertions(+), 13 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-09-08 22:17 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-09-08 22:17 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits This is the post-linux-next material, so it is based upon latest upstream to catch the now-merged dependencies. 10 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c. Subsystems affected by this patch series: mm/vmstat mm/migration compat Subsystem: mm/vmstat Ingo Molnar <mingo@elte.hu>: mm/vmstat: protect per cpu variables with preempt disable on RT Subsystem: mm/migration Baolin Wang <baolin.wang@linux.alibaba.com>: mm: migrate: introduce a local variable to get the number of pages mm: migrate: fix the incorrect function name in comments mm: migrate: change to use bool type for 'page_was_mapped' Subsystem: compat Arnd Bergmann <arnd@arndb.de>: Patch series "compat: remove compat_alloc_user_space", v5: kexec: move locking into do_kexec_load kexec: avoid compat_alloc_user_space mm: simplify compat_sys_move_pages mm: simplify compat numa syscalls compat: remove some compat entry points arch: remove compat_alloc_user_space arch/arm64/include/asm/compat.h | 5 arch/arm64/include/asm/uaccess.h | 11 - arch/arm64/include/asm/unistd32.h | 10 - arch/arm64/lib/Makefile | 2 arch/arm64/lib/copy_in_user.S | 77 ---------- arch/mips/cavium-octeon/octeon-memcpy.S | 2 arch/mips/include/asm/compat.h | 8 - arch/mips/include/asm/uaccess.h | 26 --- arch/mips/kernel/syscalls/syscall_n32.tbl | 10 - arch/mips/kernel/syscalls/syscall_o32.tbl | 10 - arch/mips/lib/memcpy.S | 11 - arch/parisc/include/asm/compat.h | 6 arch/parisc/include/asm/uaccess.h | 2 arch/parisc/kernel/syscalls/syscall.tbl | 8 - arch/parisc/lib/memcpy.c | 9 - arch/powerpc/include/asm/compat.h | 16 -- arch/powerpc/kernel/syscalls/syscall.tbl | 10 - arch/s390/include/asm/compat.h | 10 - arch/s390/include/asm/uaccess.h | 3 arch/s390/kernel/syscalls/syscall.tbl | 10 - arch/s390/lib/uaccess.c | 63 -------- arch/sparc/include/asm/compat.h | 19 -- arch/sparc/kernel/process_64.c | 2 arch/sparc/kernel/signal32.c | 12 - arch/sparc/kernel/signal_64.c | 8 - arch/sparc/kernel/syscalls/syscall.tbl | 10 - arch/x86/entry/syscalls/syscall_32.tbl | 4 arch/x86/entry/syscalls/syscall_64.tbl | 2 arch/x86/include/asm/compat.h | 13 - arch/x86/include/asm/uaccess_64.h | 7 include/linux/compat.h | 39 +---- include/linux/uaccess.h | 10 - include/uapi/asm-generic/unistd.h | 10 - kernel/compat.c | 21 -- kernel/kexec.c | 105 +++++--------- kernel/sys_ni.c | 5 mm/mempolicy.c | 213 +++++++----------------------- mm/migrate.c | 69 +++++---- mm/vmstat.c | 48 ++++++ 39 files changed, 243 insertions(+), 663 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-09-08 2:52 Andrew Morton 2021-09-08 8:57 ` incoming Vlastimil Babka 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2021-09-08 2:52 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 147 patches, based on 7d2a07b769330c34b4deabeed939325c77a7ec2f. Subsystems affected by this patch series: mm/slub mm/memory-hotplug mm/rmap mm/ioremap mm/highmem mm/cleanups mm/secretmem mm/kfence mm/damon alpha percpu procfs misc core-kernel MAINTAINERS lib bitops checkpatch epoll init nilfs2 coredump fork pids criu kconfig selftests ipc mm/vmscan scripts Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6: mm, slub: don't call flush_all() from slab_debug_trace_open() mm, slub: allocate private object map for debugfs listings mm, slub: allocate private object map for validate_slab_cache() mm, slub: don't disable irq for debug_check_no_locks_freed() mm, slub: remove redundant unfreeze_partials() from put_cpu_partial() mm, slub: extract get_partial() from new_slab_objects() mm, slub: dissolve new_slab_objects() into ___slab_alloc() mm, slub: return slab page from get_partial() and set c->page afterwards mm, slub: restructure new page checks in ___slab_alloc() mm, slub: simplify kmem_cache_cpu and tid setup mm, slub: move disabling/enabling irqs to ___slab_alloc() mm, slub: do initial checks in ___slab_alloc() with irqs enabled mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc() mm, slub: restore irqs around calling new_slab() mm, slub: validate slab from partial list or page allocator before making it cpu slab mm, slub: check new pages with restored irqs mm, slub: stop disabling irqs around get_partial() mm, slub: move reset of c->page and freelist out of deactivate_slab() mm, slub: make locking in deactivate_slab() irq-safe mm, slub: call deactivate_slab() without disabling irqs mm, slub: move irq control into unfreeze_partials() mm, slub: discard slabs in unfreeze_partials() without irqs disabled mm, slub: detach whole partial list at once in unfreeze_partials() mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing mm, slub: only disable irq with spin_lock in __unfreeze_partials() mm, slub: don't disable irqs in slub_cpu_dead() mm, slab: split out the cpu offline variant of flush_slab() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context mm: slub: make object_map_lock a raw_spinlock_t Vlastimil Babka <vbabka@suse.cz>: mm, slub: make slab_lock() disable irqs with PREEMPT_RT mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg mm, slub: use migrate_disable() on PREEMPT_RT mm, slub: convert kmem_cpu_slab protection to local_lock Subsystem: mm/memory-hotplug David Hildenbrand <david@redhat.com>: Patch series "memory-hotplug.rst: complete admin-guide overhaul", v3: memory-hotplug.rst: remove locking details from admin-guide memory-hotplug.rst: complete admin-guide overhaul Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE": mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE mm: memory_hotplug: cleanup after removal of pfn_valid_within() David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: preparatory patches for new online policy and memory": mm/memory_hotplug: use "unsigned long" for PFN in zone_for_pfn_range() mm/memory_hotplug: remove nid parameter from arch_remove_memory() mm/memory_hotplug: remove nid parameter from remove_memory() and friends ACPI: memhotplug: memory resources cannot be enabled yet Patch series "mm/memory_hotplug: "auto-movable" online policy and memory groups", v3: mm: track present early pages per zone mm/memory_hotplug: introduce "auto-movable" online policy drivers/base/memory: introduce "memory groups" to logically group memory blocks mm/memory_hotplug: track present pages in memory groups ACPI: memhotplug: use a single static memory group for a single memory device dax/kmem: use a single static memory group for a single probed unit virtio-mem: use a single dynamic memory group for a single virtio-mem device mm/memory_hotplug: memory group aware "auto-movable" online policy mm/memory_hotplug: improved dynamic memory group aware "auto-movable" online policy Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixups for memory hotplug": mm/memory_hotplug: use helper zone_is_zone_device() to simplify the code Subsystem: mm/rmap Muchun Song <songmuchun@bytedance.com>: mm: remove redundant compound_head() calling Subsystem: mm/ioremap Christoph Hellwig <hch@lst.de>: riscv: only select GENERIC_IOREMAP if MMU support is enabled Patch series "small ioremap cleanups": mm: move ioremap_page_range to vmalloc.c mm: don't allow executable ioremap mappings Weizhao Ouyang <o451686892@gmail.com>: mm/early_ioremap.c: remove redundant early_ioremap_shutdown() Subsystem: mm/highmem Sebastian Andrzej Siewior <bigeasy@linutronix.de>: highmem: don't disable preemption on RT in kmap_atomic() Subsystem: mm/cleanups Changbin Du <changbin.du@gmail.com>: mm: in_irq() cleanup Muchun Song <songmuchun@bytedance.com>: mm: introduce PAGEFLAGS_MASK to replace ((1UL << NR_PAGEFLAGS) - 1) Subsystem: mm/secretmem Jordy Zomer <jordy@jordyzomer.github.io>: mm/secretmem: use refcount_t instead of atomic_t Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: show cpu and timestamp in alloc/free info kfence: test: fail fast if disabled at boot Subsystem: mm/damon SeongJae Park <sjpark@amazon.de>: Patch series "Introduce Data Access MONitor (DAMON)", v34: mm: introduce Data Access MONitor (DAMON) mm/damon/core: implement region-based sampling mm/damon: adaptively adjust regions mm/idle_page_tracking: make PG_idle reusable mm/damon: implement primitives for the virtual memory address spaces mm/damon: add a tracepoint mm/damon: implement a debugfs-based user space interface mm/damon/dbgfs: export kdamond pid to the user space mm/damon/dbgfs: support multiple contexts Documentation: add documents for DAMON mm/damon: add kunit tests mm/damon: add user space selftests MAINTAINERS: update for DAMON Subsystem: alpha Randy Dunlap <rdunlap@infradead.org>: alpha: agp: make empty macros use do-while-0 style alpha: pci-sysfs: fix all kernel-doc warnings Subsystem: percpu Greg Kroah-Hartman <gregkh@linuxfoundation.org>: percpu: remove export of pcpu_base_addr Subsystem: procfs Feng Zhou <zhoufeng.zf@bytedance.com>: fs/proc/kcore.c: add mmap interface Christoph Hellwig <hch@lst.de>: proc: stop using seq_get_buf in proc_task_name Ohhoon Kwon <ohoono.kwon@samsung.com>: connector: send event on write to /proc/[pid]/comm Subsystem: misc Colin Ian King <colin.king@canonical.com>: arch: Kconfig: fix spelling mistake "seperate" -> "separate" Andy Shevchenko <andriy.shevchenko@linux.intel.com>: include/linux/once.h: fix trivia typo Not -> Note Daniel Lezcano <daniel.lezcano@linaro.org>: Patch series "Add Hz macros", v3: units: change from 'L' to 'UL' units: add the HZ macros thermal/drivers/devfreq_cooling: use HZ macros devfreq: use HZ macros iio/drivers/as73211: use HZ macros hwmon/drivers/mr75203: use HZ macros iio/drivers/hid-sensor: use HZ macros i2c/drivers/ov02q10: use HZ macros mtd/drivers/nand: use HZ macros phy/drivers/stm32: use HZ macros Subsystem: core-kernel Yang Yang <yang.yang29@zte.com.cn>: kernel/acct.c: use dedicated helper to access rlimit values Pavel Skripkin <paskripkin@gmail.com>: profiling: fix shift-out-of-bounds bugs Subsystem: MAINTAINERS Nathan Chancellor <nathan@kernel.org>: MAINTAINERS: update ClangBuiltLinux mailing list Documentation/llvm: update mailing list Documentation/llvm: update IRC location Subsystem: lib Geert Uytterhoeven <geert@linux-m68k.org>: Patch series "math: RATIONAL and RATIONAL_KUNIT_TEST improvements": math: make RATIONAL tristate math: RATIONAL_KUNIT_TEST should depend on RATIONAL instead of selecting it Matteo Croce <mcroce@microsoft.com>: Patch series "lib/string: optimized mem* functions", v2: lib/string: optimized memcpy lib/string: optimized memmove lib/string: optimized memset Daniel Latypov <dlatypov@google.com>: lib/test: convert test_sort.c to use KUnit Randy Dunlap <rdunlap@infradead.org>: lib/dump_stack: correct kernel-doc notation lib/iov_iter.c: fix kernel-doc warnings Subsystem: bitops Yury Norov <yury.norov@gmail.com>: Patch series "Resend bitmap patches": bitops: protect find_first_{,zero}_bit properly bitops: move find_bit_*_le functions from le.h to find.h include: move find.h from asm_generic to linux arch: remove GENERIC_FIND_FIRST_BIT entirely lib: add find_first_and_bit() cpumask: use find_first_and_bit() all: replace find_next{,_zero}_bit with find_first{,_zero}_bit where appropriate tools: sync tools/bitmap with mother linux cpumask: replace cpumask_next_* with cpumask_first_* where appropriate include/linux: move for_each_bit() macros from bitops.h to find.h find: micro-optimize for_each_{set,clear}_bit() bitops: replace for_each_*_bit_from() with for_each_*_bit() where appropriate Andy Shevchenko <andriy.shevchenko@linux.intel.com>: tools: rename bitmap_alloc() to bitmap_zalloc() Yury Norov <yury.norov@gmail.com>: mm/percpu: micro-optimize pcpu_is_populated() bitmap: unify find_bit operations lib: bitmap: add performance test for bitmap_print_to_pagebuf vsprintf: rework bitmap_list_string Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: support wide strings Mimi Zohar <zohar@linux.ibm.com>: checkpatch: make email address check case insensitive Joe Perches <joe@perches.com>: checkpatch: improve GIT_COMMIT_ID test Subsystem: epoll Nicholas Piggin <npiggin@gmail.com>: fs/epoll: use a per-cpu counter for user's watches count Subsystem: init Rasmus Villemoes <linux@rasmusvillemoes.dk>: init: move usermodehelper_enable() to populate_rootfs() Kefeng Wang <wangkefeng.wang@huawei.com>: trap: cleanup trap_init() Subsystem: nilfs2 Nanyong Sun <sunnanyong@huawei.com>: Patch series "nilfs2: fix incorrect usage of kobject": nilfs2: fix memory leak in nilfs_sysfs_create_device_group nilfs2: fix NULL pointer in nilfs_##name##_attr_release nilfs2: fix memory leak in nilfs_sysfs_create_##name##_group nilfs2: fix memory leak in nilfs_sysfs_delete_##name##_group nilfs2: fix memory leak in nilfs_sysfs_create_snapshot_group nilfs2: fix memory leak in nilfs_sysfs_delete_snapshot_group Zhen Lei <thunder.leizhen@huawei.com>: nilfs2: use refcount_dec_and_lock() to fix potential UAF Subsystem: coredump David Oberhollenzer <david.oberhollenzer@sigma-star.at>: fs/coredump.c: log if a core dump is aborted due to changed file permissions QiuXi <qiuxi1@huawei.com>: coredump: fix memleak in dump_vma_snapshot() Subsystem: fork Christoph Hellwig <hch@lst.de>: kernel/fork.c: unexport get_{mm,task}_exe_file Subsystem: pids Takahiro Itazuri <itazur@amazon.com>: pid: cleanup the stale comment mentioning pidmap_init(). Subsystem: criu Cyrill Gorcunov <gorcunov@gmail.com>: prctl: allow to setup brk for et_dyn executables Subsystem: kconfig Zenghui Yu <yuzenghui@huawei.com>: configs: remove the obsolete CONFIG_INPUT_POLLDEV Lukas Bulwahn <lukas.bulwahn@gmail.com>: Kconfig.debug: drop selecting non-existing HARDLOCKUP_DETECTOR_ARCH Subsystem: selftests Greg Thelen <gthelen@google.com>: selftests/memfd: remove unused variable Subsystem: ipc Rafael Aquini <aquini@redhat.com>: ipc: replace costly bailout check in sysvipc_find_ipc() Subsystem: mm/vmscan Randy Dunlap <rdunlap@infradead.org>: mm/workingset: correct kernel-doc notations Subsystem: scripts Randy Dunlap <rdunlap@infradead.org>: scripts: check_extable: fix typo in user error message a/Documentation/admin-guide/mm/damon/index.rst | 15 a/Documentation/admin-guide/mm/damon/start.rst | 114 + a/Documentation/admin-guide/mm/damon/usage.rst | 112 + a/Documentation/admin-guide/mm/index.rst | 1 a/Documentation/admin-guide/mm/memory-hotplug.rst | 842 ++++++----- a/Documentation/dev-tools/kfence.rst | 98 - a/Documentation/kbuild/llvm.rst | 5 a/Documentation/vm/damon/api.rst | 20 a/Documentation/vm/damon/design.rst | 166 ++ a/Documentation/vm/damon/faq.rst | 51 a/Documentation/vm/damon/index.rst | 30 a/Documentation/vm/index.rst | 1 a/MAINTAINERS | 17 a/arch/Kconfig | 2 a/arch/alpha/include/asm/agp.h | 4 a/arch/alpha/include/asm/bitops.h | 2 a/arch/alpha/kernel/pci-sysfs.c | 12 a/arch/arc/Kconfig | 1 a/arch/arc/include/asm/bitops.h | 1 a/arch/arc/kernel/traps.c | 5 a/arch/arm/configs/dove_defconfig | 1 a/arch/arm/configs/pxa_defconfig | 1 a/arch/arm/include/asm/bitops.h | 1 a/arch/arm/kernel/traps.c | 5 a/arch/arm64/Kconfig | 1 a/arch/arm64/include/asm/bitops.h | 1 a/arch/arm64/mm/mmu.c | 3 a/arch/csky/include/asm/bitops.h | 1 a/arch/h8300/include/asm/bitops.h | 1 a/arch/h8300/kernel/traps.c | 4 a/arch/hexagon/include/asm/bitops.h | 1 a/arch/hexagon/kernel/traps.c | 4 a/arch/ia64/include/asm/bitops.h | 2 a/arch/ia64/mm/init.c | 3 a/arch/m68k/include/asm/bitops.h | 2 a/arch/mips/Kconfig | 1 a/arch/mips/configs/lemote2f_defconfig | 1 a/arch/mips/configs/pic32mzda_defconfig | 1 a/arch/mips/configs/rt305x_defconfig | 1 a/arch/mips/configs/xway_defconfig | 1 a/arch/mips/include/asm/bitops.h | 1 a/arch/nds32/kernel/traps.c | 5 a/arch/nios2/kernel/traps.c | 5 a/arch/openrisc/include/asm/bitops.h | 1 a/arch/openrisc/kernel/traps.c | 5 a/arch/parisc/configs/generic-32bit_defconfig | 1 a/arch/parisc/include/asm/bitops.h | 2 a/arch/parisc/kernel/traps.c | 4 a/arch/powerpc/include/asm/bitops.h | 2 a/arch/powerpc/include/asm/cputhreads.h | 2 a/arch/powerpc/kernel/traps.c | 5 a/arch/powerpc/mm/mem.c | 3 a/arch/powerpc/platforms/pasemi/dma_lib.c | 4 a/arch/powerpc/platforms/pseries/hotplug-memory.c | 9 a/arch/riscv/Kconfig | 2 a/arch/riscv/include/asm/bitops.h | 1 a/arch/riscv/kernel/traps.c | 5 a/arch/s390/Kconfig | 1 a/arch/s390/include/asm/bitops.h | 1 a/arch/s390/kvm/kvm-s390.c | 2 a/arch/s390/mm/init.c | 3 a/arch/sh/include/asm/bitops.h | 1 a/arch/sh/mm/init.c | 3 a/arch/sparc/include/asm/bitops_32.h | 1 a/arch/sparc/include/asm/bitops_64.h | 2 a/arch/um/kernel/trap.c | 4 a/arch/x86/Kconfig | 1 a/arch/x86/configs/i386_defconfig | 1 a/arch/x86/configs/x86_64_defconfig | 1 a/arch/x86/include/asm/bitops.h | 2 a/arch/x86/kernel/apic/vector.c | 4 a/arch/x86/mm/init_32.c | 3 a/arch/x86/mm/init_64.c | 3 a/arch/x86/um/Kconfig | 1 a/arch/xtensa/include/asm/bitops.h | 1 a/block/blk-mq.c | 2 a/drivers/acpi/acpi_memhotplug.c | 46 a/drivers/base/memory.c | 231 ++- a/drivers/base/node.c | 2 a/drivers/block/rnbd/rnbd-clt.c | 2 a/drivers/dax/kmem.c | 43 a/drivers/devfreq/devfreq.c | 2 a/drivers/dma/ti/edma.c | 2 a/drivers/gpu/drm/etnaviv/etnaviv_gpu.c | 4 a/drivers/hwmon/ltc2992.c | 3 a/drivers/hwmon/mr75203.c | 2 a/drivers/iio/adc/ad7124.c | 2 a/drivers/iio/common/hid-sensors/hid-sensor-attributes.c | 3 a/drivers/iio/light/as73211.c | 3 a/drivers/infiniband/hw/irdma/hw.c | 16 a/drivers/media/cec/core/cec-core.c | 2 a/drivers/media/i2c/ov02a10.c | 2 a/drivers/media/mc/mc-devnode.c | 2 a/drivers/mmc/host/renesas_sdhi_core.c | 2 a/drivers/mtd/nand/raw/intel-nand-controller.c | 2 a/drivers/net/virtio_net.c | 2 a/drivers/pci/controller/dwc/pci-dra7xx.c | 2 a/drivers/phy/st/phy-stm32-usbphyc.c | 2 a/drivers/scsi/lpfc/lpfc_sli.c | 10 a/drivers/soc/fsl/qbman/bman_portal.c | 2 a/drivers/soc/fsl/qbman/qman_portal.c | 2 a/drivers/soc/ti/k3-ringacc.c | 4 a/drivers/thermal/devfreq_cooling.c | 2 a/drivers/tty/n_tty.c | 2 a/drivers/virt/acrn/ioreq.c | 3 a/drivers/virtio/virtio_mem.c | 26 a/fs/coredump.c | 15 a/fs/eventpoll.c | 18 a/fs/f2fs/segment.c | 8 a/fs/nilfs2/sysfs.c | 26 a/fs/nilfs2/the_nilfs.c | 9 a/fs/ocfs2/cluster/heartbeat.c | 2 a/fs/ocfs2/dlm/dlmdomain.c | 4 a/fs/ocfs2/dlm/dlmmaster.c | 18 a/fs/ocfs2/dlm/dlmrecovery.c | 2 a/fs/ocfs2/dlm/dlmthread.c | 2 a/fs/proc/array.c | 18 a/fs/proc/base.c | 5 a/fs/proc/kcore.c | 73 a/include/asm-generic/bitops.h | 1 a/include/asm-generic/bitops/find.h | 198 -- a/include/asm-generic/bitops/le.h | 64 a/include/asm-generic/early_ioremap.h | 6 a/include/linux/bitmap.h | 34 a/include/linux/bitops.h | 34 a/include/linux/cpumask.h | 46 a/include/linux/damon.h | 290 +++ a/include/linux/find.h | 134 + a/include/linux/highmem-internal.h | 27 a/include/linux/memory.h | 55 a/include/linux/memory_hotplug.h | 40 a/include/linux/mmzone.h | 19 a/include/linux/once.h | 2 a/include/linux/page-flags.h | 17 a/include/linux/page_ext.h | 2 a/include/linux/page_idle.h | 6 a/include/linux/pagemap.h | 7 a/include/linux/sched/user.h | 3 a/include/linux/slub_def.h | 6 a/include/linux/threads.h | 2 a/include/linux/units.h | 10 a/include/linux/vmalloc.h | 3 a/include/trace/events/damon.h | 43 a/include/trace/events/mmflags.h | 2 a/include/trace/events/page_ref.h | 4 a/init/initramfs.c | 2 a/init/main.c | 3 a/init/noinitramfs.c | 2 a/ipc/util.c | 16 a/kernel/acct.c | 2 a/kernel/fork.c | 2 a/kernel/profile.c | 21 a/kernel/sys.c | 7 a/kernel/time/clocksource.c | 4 a/kernel/user.c | 25 a/lib/Kconfig | 3 a/lib/Kconfig.debug | 9 a/lib/dump_stack.c | 3 a/lib/find_bit.c | 21 a/lib/find_bit_benchmark.c | 21 a/lib/genalloc.c | 2 a/lib/iov_iter.c | 8 a/lib/math/Kconfig | 2 a/lib/math/rational.c | 3 a/lib/string.c | 130 + a/lib/test_bitmap.c | 37 a/lib/test_printf.c | 2 a/lib/test_sort.c | 40 a/lib/vsprintf.c | 26 a/mm/Kconfig | 15 a/mm/Makefile | 4 a/mm/compaction.c | 20 a/mm/damon/Kconfig | 68 a/mm/damon/Makefile | 5 a/mm/damon/core-test.h | 253 +++ a/mm/damon/core.c | 748 ++++++++++ a/mm/damon/dbgfs-test.h | 126 + a/mm/damon/dbgfs.c | 631 ++++++++ a/mm/damon/vaddr-test.h | 329 ++++ a/mm/damon/vaddr.c | 672 +++++++++ a/mm/early_ioremap.c | 5 a/mm/highmem.c | 2 a/mm/ioremap.c | 25 a/mm/kfence/core.c | 3 a/mm/kfence/kfence.h | 2 a/mm/kfence/kfence_test.c | 3 a/mm/kfence/report.c | 19 a/mm/kmemleak.c | 2 a/mm/memory_hotplug.c | 396 ++++- a/mm/memremap.c | 5 a/mm/page_alloc.c | 27 a/mm/page_ext.c | 12 a/mm/page_idle.c | 10 a/mm/page_isolation.c | 7 a/mm/page_owner.c | 14 a/mm/percpu.c | 36 a/mm/rmap.c | 6 a/mm/secretmem.c | 9 a/mm/slab_common.c | 2 a/mm/slub.c | 1023 +++++++++----- a/mm/vmalloc.c | 24 a/mm/workingset.c | 2 a/net/ncsi/ncsi-manage.c | 4 a/scripts/check_extable.sh | 2 a/scripts/checkpatch.pl | 93 - a/tools/include/linux/bitmap.h | 4 a/tools/perf/bench/find-bit-bench.c | 2 a/tools/perf/builtin-c2c.c | 6 a/tools/perf/builtin-record.c | 2 a/tools/perf/tests/bitmap.c | 2 a/tools/perf/tests/mem2node.c | 2 a/tools/perf/util/affinity.c | 4 a/tools/perf/util/header.c | 4 a/tools/perf/util/metricgroup.c | 2 a/tools/perf/util/mmap.c | 4 a/tools/testing/selftests/damon/Makefile | 7 a/tools/testing/selftests/damon/_chk_dependency.sh | 28 a/tools/testing/selftests/damon/debugfs_attrs.sh | 75 + a/tools/testing/selftests/kvm/dirty_log_perf_test.c | 2 a/tools/testing/selftests/kvm/dirty_log_test.c | 4 a/tools/testing/selftests/kvm/x86_64/vmx_dirty_log_test.c | 2 a/tools/testing/selftests/memfd/memfd_test.c | 2 b/MAINTAINERS | 2 b/tools/include/asm-generic/bitops.h | 1 b/tools/include/linux/bitmap.h | 7 b/tools/include/linux/find.h | 81 + b/tools/lib/find_bit.c | 20 227 files changed, 6695 insertions(+), 1875 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-09-08 2:52 incoming Andrew Morton @ 2021-09-08 8:57 ` Vlastimil Babka 0 siblings, 0 replies; 348+ messages in thread From: Vlastimil Babka @ 2021-09-08 8:57 UTC (permalink / raw) To: Andrew Morton, Linus Torvalds Cc: linux-mm, mm-commits, Mike Galbraith, Mel Gorman On 9/8/21 04:52, Andrew Morton wrote: > Subsystem: mm/slub > > Vlastimil Babka <vbabka@suse.cz>: > Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6: > mm, slub: don't call flush_all() from slab_debug_trace_open() > mm, slub: allocate private object map for debugfs listings > mm, slub: allocate private object map for validate_slab_cache() > mm, slub: don't disable irq for debug_check_no_locks_freed() > mm, slub: remove redundant unfreeze_partials() from put_cpu_partial() > mm, slub: extract get_partial() from new_slab_objects() > mm, slub: dissolve new_slab_objects() into ___slab_alloc() > mm, slub: return slab page from get_partial() and set c->page afterwards > mm, slub: restructure new page checks in ___slab_alloc() > mm, slub: simplify kmem_cache_cpu and tid setup > mm, slub: move disabling/enabling irqs to ___slab_alloc() > mm, slub: do initial checks in ___slab_alloc() with irqs enabled > mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc() > mm, slub: restore irqs around calling new_slab() > mm, slub: validate slab from partial list or page allocator before making it cpu slab > mm, slub: check new pages with restored irqs > mm, slub: stop disabling irqs around get_partial() > mm, slub: move reset of c->page and freelist out of deactivate_slab() > mm, slub: make locking in deactivate_slab() irq-safe > mm, slub: call deactivate_slab() without disabling irqs > mm, slub: move irq control into unfreeze_partials() > mm, slub: discard slabs in unfreeze_partials() without irqs disabled > mm, slub: detach whole partial list at once in unfreeze_partials() > mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing > mm, slub: only disable irq with spin_lock in __unfreeze_partials() > mm, slub: don't disable irqs in slub_cpu_dead() > mm, slab: split out the cpu offline variant of flush_slab() > > Sebastian Andrzej Siewior <bigeasy@linutronix.de>: > mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context > mm: slub: make object_map_lock a raw_spinlock_t > > Vlastimil Babka <vbabka@suse.cz>: > mm, slub: make slab_lock() disable irqs with PREEMPT_RT > mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg > mm, slub: use migrate_disable() on PREEMPT_RT > mm, slub: convert kmem_cpu_slab protection to local_lock For my own piece of mind, I've checked that this part (patches 1 to 33) are identical to the v6 posting [1] and git version [2] that Mel and Mike tested (replies to [1]). [1] https://lore.kernel.org/all/20210904105003.11688-1-vbabka@suse.cz/ [2] git://git.kernel.org/pub/scm/linux/kernel/git/vbabka/linux.git tags/mm-slub-5.15-rc1 ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-09-02 21:48 Andrew Morton 2021-09-02 21:49 ` incoming Andrew Morton 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2021-09-02 21:48 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b. Subsystems affected by this patch series: ia64 ocfs2 block mm/slub mm/debug mm/pagecache mm/gup mm/swap mm/shmem mm/memcg mm/selftests mm/pagemap mm/mremap mm/bootmem mm/sparsemem mm/vmalloc mm/kasan mm/pagealloc mm/memory-failure mm/hugetlb mm/userfaultfd mm/vmscan mm/compaction mm/mempolicy mm/memblock mm/oom-kill mm/migration mm/ksm mm/percpu mm/vmstat mm/madvise Subsystem: ia64 Jason Wang <wangborong@cdjrlc.com>: ia64: fix typo in a comment Geert Uytterhoeven <geert+renesas@glider.be>: Patch series "ia64: Miscellaneous fixes and cleanups": ia64: fix #endif comment for reserve_elfcorehdr() ia64: make reserve_elfcorehdr() static ia64: make num_rsvd_regions static Subsystem: ocfs2 Dan Carpenter <dan.carpenter@oracle.com>: ocfs2: remove an unnecessary condition Tuo Li <islituo@gmail.com>: ocfs2: quota_local: fix possible uninitialized-variable access in ocfs2_local_read_info() Gang He <ghe@suse.com>: ocfs2: ocfs2_downconvert_lock failure results in deadlock Subsystem: block kernel test robot <lkp@intel.com>: arch/csky/kernel/probes/kprobes.c: fix bugon.cocci warnings Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v4: mm, slub: don't call flush_all() from slab_debug_trace_open() mm, slub: allocate private object map for debugfs listings mm, slub: allocate private object map for validate_slab_cache() mm, slub: don't disable irq for debug_check_no_locks_freed() mm, slub: remove redundant unfreeze_partials() from put_cpu_partial() mm, slub: unify cmpxchg_double_slab() and __cmpxchg_double_slab() mm, slub: extract get_partial() from new_slab_objects() mm, slub: dissolve new_slab_objects() into ___slab_alloc() mm, slub: return slab page from get_partial() and set c->page afterwards mm, slub: restructure new page checks in ___slab_alloc() mm, slub: simplify kmem_cache_cpu and tid setup mm, slub: move disabling/enabling irqs to ___slab_alloc() mm, slub: do initial checks in ___slab_alloc() with irqs enabled mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc() mm, slub: restore irqs around calling new_slab() mm, slub: validate slab from partial list or page allocator before making it cpu slab mm, slub: check new pages with restored irqs mm, slub: stop disabling irqs around get_partial() mm, slub: move reset of c->page and freelist out of deactivate_slab() mm, slub: make locking in deactivate_slab() irq-safe mm, slub: call deactivate_slab() without disabling irqs mm, slub: move irq control into unfreeze_partials() mm, slub: discard slabs in unfreeze_partials() without irqs disabled mm, slub: detach whole partial list at once in unfreeze_partials() mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing mm, slub: only disable irq with spin_lock in __unfreeze_partials() mm, slub: don't disable irqs in slub_cpu_dead() mm, slab: make flush_slab() possible to call with irqs enabled Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context mm: slub: make object_map_lock a raw_spinlock_t Vlastimil Babka <vbabka@suse.cz>: mm, slub: optionally save/restore irqs in slab_[un]lock()/ mm, slub: make slab_lock() disable irqs with PREEMPT_RT mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg mm, slub: use migrate_disable() on PREEMPT_RT mm, slub: convert kmem_cpu_slab protection to local_lock Subsystem: mm/debug Gavin Shan <gshan@redhat.com>: Patch series "mm/debug_vm_pgtable: Enhancements", v6: mm/debug_vm_pgtable: introduce struct pgtable_debug_args mm/debug_vm_pgtable: use struct pgtable_debug_args in basic tests mm/debug_vm_pgtable: use struct pgtable_debug_args in leaf and savewrite tests mm/debug_vm_pgtable: use struct pgtable_debug_args in protnone and devmap tests mm/debug_vm_pgtable: use struct pgtable_debug_args in soft_dirty and swap tests mm/debug_vm_pgtable: use struct pgtable_debug_args in migration and thp tests mm/debug_vm_pgtable: use struct pgtable_debug_args in PTE modifying tests mm/debug_vm_pgtable: use struct pgtable_debug_args in PMD modifying tests mm/debug_vm_pgtable: use struct pgtable_debug_args in PUD modifying tests mm/debug_vm_pgtable: use struct pgtable_debug_args in PGD and P4D modifying tests mm/debug_vm_pgtable: remove unused code mm/debug_vm_pgtable: fix corrupted page flag "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: report a more useful address for reclaim acquisition liuhailong <liuhailong@oppo.com>: mm: add kernel_misc_reclaimable in show_free_areas Subsystem: mm/pagecache Jan Kara <jack@suse.cz>: Patch series "writeback: Fix bandwidth estimates", v4: writeback: track number of inodes under writeback writeback: reliably update bandwidth estimation writeback: fix bandwidth estimate for spiky workload writeback: rename domain_update_bandwidth() writeback: use READ_ONCE for unlocked reads of writeback stats Johannes Weiner <hannes@cmpxchg.org>: mm: remove irqsave/restore locking from contexts with irqs enabled fs: drop_caches: fix skipping over shadow cache inodes fs: inode: count invalidated shadow pages in pginodesteal Shakeel Butt <shakeelb@google.com>: writeback: memcg: simplify cgroup_writeback_by_id Jing Yangyang <jing.yangyang@zte.com.cn>: include/linux/buffer_head.h: fix boolreturn.cocci warnings Subsystem: mm/gup Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups and fixup for gup": mm: gup: remove set but unused local variable major mm: gup: remove unneed local variable orig_refs mm: gup: remove useless BUG_ON in __get_user_pages() mm: gup: fix potential pgmap refcnt leak in __gup_device_huge() mm: gup: use helper PAGE_ALIGNED in populate_vma_page_range() John Hubbard <jhubbard@nvidia.com>: Patch series "A few gup refactorings and documentation updates", v3: mm/gup: documentation corrections for gup/pup mm/gup: small refactoring: simplify try_grab_page() mm/gup: remove try_get_page(), call try_get_compound_head() directly Subsystem: mm/swap Hugh Dickins <hughd@google.com>: fs, mm: fix race in unlinking swapfile John Hubbard <jhubbard@nvidia.com>: mm: delete unused get_kernel_page() Subsystem: mm/shmem Sebastian Andrzej Siewior <bigeasy@linutronix.de>: shmem: use raw_spinlock_t for ->stat_lock Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups for shmem": shmem: remove unneeded variable ret shmem: remove unneeded header file shmem: remove unneeded function forward declaration shmem: include header file to declare swap_info Hugh Dickins <hughd@google.com>: Patch series "huge tmpfs: shmem_is_huge() fixes and cleanups": huge tmpfs: fix fallocate(vanilla) advance over huge pages huge tmpfs: fix split_huge_page() after FALLOC_FL_KEEP_SIZE huge tmpfs: remove shrinklist addition from shmem_setattr() huge tmpfs: revert shmem's use of transhuge_vma_enabled() huge tmpfs: move shmem_huge_enabled() upwards huge tmpfs: SGP_NOALLOC to stop collapse_file() on race huge tmpfs: shmem_is_huge(vma, inode, index) huge tmpfs: decide stat.st_blksize by shmem_is_huge() shmem: shmem_writepage() split unlikely i915 THP Subsystem: mm/memcg Suren Baghdasaryan <surenb@google.com>: mm, memcg: add mem_cgroup_disabled checks in vmpressure and swap-related functions mm, memcg: inline mem_cgroup_{charge/uncharge} to improve disabled memcg config mm, memcg: inline swap-related functions to improve disabled memcg config Vasily Averin <vvs@virtuozzo.com>: memcg: enable accounting for pids in nested pid namespaces Shakeel Butt <shakeelb@google.com>: memcg: switch lruvec stats to rstat memcg: infrastructure to flush memcg stats Yutian Yang <nglaive@gmail.com>: memcg: charge fs_context and legacy_fs_context Vasily Averin <vvs@virtuozzo.com>: Patch series "memcg accounting from OpenVZ", v7: memcg: enable accounting for mnt_cache entries memcg: enable accounting for pollfd and select bits arrays memcg: enable accounting for file lock caches memcg: enable accounting for fasync_cache memcg: enable accounting for new namesapces and struct nsproxy memcg: enable accounting of ipc resources memcg: enable accounting for signals memcg: enable accounting for posix_timers_cache slab memcg: enable accounting for ldt_struct objects Shakeel Butt <shakeelb@google.com>: memcg: cleanup racy sum avoidance code Vasily Averin <vvs@virtuozzo.com>: memcg: replace in_interrupt() by !in_task() in active_memcg() Baolin Wang <baolin.wang@linux.alibaba.com>: mm: memcontrol: set the correct memcg swappiness restriction Miaohe Lin <linmiaohe@huawei.com>: mm, memcg: remove unused functions mm, memcg: save some atomic ops when flush is already true Michal Hocko <mhocko@suse.com>: memcg: fix up drain_local_stock comment Shakeel Butt <shakeelb@google.com>: memcg: make memcg->event_list_lock irqsafe Subsystem: mm/selftests Po-Hsu Lin <po-hsu.lin@canonical.com>: selftests/vm: use kselftest skip code for skipped tests Colin Ian King <colin.king@canonical.com>: selftests: Fix spelling mistake "cann't" -> "cannot" Subsystem: mm/pagemap Nicholas Piggin <npiggin@gmail.com>: Patch series "shoot lazy tlbs", v4: lazy tlb: introduce lazy mm refcount helper functions lazy tlb: allow lazy tlb mm refcounting to be configurable lazy tlb: shoot lazies, a non-refcounting lazy tlb option powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN Christoph Hellwig <hch@lst.de>: Patch series "_kernel_dcache_page fixes and removal": mmc: JZ4740: remove the flush_kernel_dcache_page call in jz4740_mmc_read_data mmc: mmc_spi: replace flush_kernel_dcache_page with flush_dcache_page scatterlist: replace flush_kernel_dcache_page with flush_dcache_page mm: remove flush_kernel_dcache_page Huang Ying <ying.huang@intel.com>: mm,do_huge_pmd_numa_page: remove unnecessary TLB flushing code Greg Kroah-Hartman <gregkh@linuxfoundation.org>: mm: change fault_in_pages_* to have an unsigned size parameter Luigi Rizzo <lrizzo@google.com>: mm/pagemap: add mmap_assert_locked() annotations to find_vma*() "Liam R. Howlett" <Liam.Howlett@Oracle.com>: remap_file_pages: Use vma_lookup() instead of find_vma() Subsystem: mm/mremap Chen Wandun <chenwandun@huawei.com>: mm/mremap: fix memory account on do_munmap() failure Subsystem: mm/bootmem Muchun Song <songmuchun@bytedance.com>: mm/bootmem_info.c: mark __init on register_page_bootmem_info_section Subsystem: mm/sparsemem Ohhoon Kwon <ohoono.kwon@samsung.com>: Patch series "mm: sparse: remove __section_nr() function", v4: mm: sparse: pass section_nr to section_mark_present mm: sparse: pass section_nr to find_memory_block mm: sparse: remove __section_nr() function Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/sparse: set SECTION_NID_SHIFT to 6 Matthew Wilcox <willy@infradead.org>: include/linux/mmzone.h: avoid a warning in sparse memory support Miles Chen <miles.chen@mediatek.com>: mm/sparse: clarify pgdat_to_phys Subsystem: mm/vmalloc "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: use batched page requests in bulk-allocator mm/vmalloc: remove gfpflags_allow_blocking() check lib/test_vmalloc.c: add a new 'nr_pages' parameter Chen Wandun <chenwandun@huawei.com>: mm/vmalloc: fix wrong behavior in vread Subsystem: mm/kasan Woody Lin <woodylin@google.com>: mm/kasan: move kasan.fault to mm/kasan/report.c Andrey Konovalov <andreyknvl@gmail.com>: Patch series "kasan: test: avoid crashing the kernel with HW_TAGS", v2: kasan: test: rework kmalloc_oob_right kasan: test: avoid writing invalid memory kasan: test: avoid corrupting memory via memset kasan: test: disable kmalloc_memmove_invalid_size for HW_TAGS kasan: test: only do kmalloc_uaf_memset for generic mode kasan: test: clean up ksize_uaf kasan: test: avoid corrupting memory in copy_user_test kasan: test: avoid corrupting memory in kasan_rcu_uaf Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: ensure consistency of memory map poisoning": mm/page_alloc: always initialize memory map for the holes microblaze: simplify pte_alloc_one_kernel() mm: introduce memmap_alloc() to unify memory map allocation memblock: stop poisoning raw allocations Nico Pache <npache@redhat.com>: mm/page_alloc.c: fix 'zone_id' may be used uninitialized in this function warning Mike Rapoport <rppt@linux.ibm.com>: mm/page_alloc: make alloc_node_mem_map() __init rather than __ref Vasily Averin <vvs@virtuozzo.com>: mm/page_alloc.c: use in_task() "George G. Davis" <davis.george@siemens.com>: mm/page_isolation: tracing: trace all test_pages_isolated failures Subsystem: mm/memory-failure Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups and fixup for hwpoison": mm/hwpoison: remove unneeded variable unmap_success mm/hwpoison: fix potential pte_unmap_unlock pte error mm/hwpoison: change argument struct page **hpagep to *hpage mm/hwpoison: fix some obsolete comments Yang Shi <shy828301@gmail.com>: mm: hwpoison: don't drop slab caches for offlining non-LRU page doc: hwpoison: correct the support for hugepage mm: hwpoison: dump page for unhandlable page Michael Wang <yun.wang@linux.alibaba.com>: mm: fix panic caused by __page_handle_poison() Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: simplify prep_compound_gigantic_page ref count racing code hugetlb: drop ref count earlier after page allocation hugetlb: before freeing hugetlb page set dtor to appropriate value hugetlb: fix hugetlb cgroup refcounting during vma split Subsystem: mm/userfaultfd Nadav Amit <namit@vmware.com>: Patch series "userfaultfd: minor bug fixes": userfaultfd: change mmap_changing to atomic userfaultfd: prevent concurrent API initialization selftests/vm/userfaultfd: wake after copy failure Subsystem: mm/vmscan Dave Hansen <dave.hansen@linux.intel.com>: Patch series "Migrate Pages in lieu of discard", v11: mm/numa: automatically generate node migration order mm/migrate: update node demotion order on hotplug events Yang Shi <yang.shi@linux.alibaba.com>: mm/migrate: enable returning precise migrate_pages() success count Dave Hansen <dave.hansen@linux.intel.com>: mm/migrate: demote pages during reclaim Yang Shi <yang.shi@linux.alibaba.com>: mm/vmscan: add page demotion counter Dave Hansen <dave.hansen@linux.intel.com>: mm/vmscan: add helper for querying ability to age anonymous pages Keith Busch <kbusch@kernel.org>: mm/vmscan: Consider anonymous pages without swap Dave Hansen <dave.hansen@linux.intel.com>: mm/vmscan: never demote for memcg reclaim Huang Ying <ying.huang@intel.com>: mm/migrate: add sysfs interface to enable reclaim migration Hui Su <suhui@zeku.com>: mm/vmpressure: replace vmpressure_to_css() with vmpressure_to_memcg() Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups for vmscan", v2: mm/vmscan: remove the PageDirty check after MADV_FREE pages are page_ref_freezed mm/vmscan: remove misleading setting to sc->priority mm/vmscan: remove unneeded return value of kswapd_run() mm/vmscan: add 'else' to remove check_pending label Vlastimil Babka <vbabka@suse.cz>: mm, vmscan: guarantee drop_slab_node() termination Subsystem: mm/compaction Charan Teja Reddy <charante@codeaurora.org>: mm: compaction: optimize proactive compaction deferrals mm: compaction: support triggering of proactive compaction by user Subsystem: mm/mempolicy Baolin Wang <baolin.wang@linux.alibaba.com>: mm/mempolicy: use readable NUMA_NO_NODE macro instead of magic number Dave Hansen <dave.hansen@linux.intel.com>: Patch series "Introduce multi-preference mempolicy", v7: mm/mempolicy: add MPOL_PREFERRED_MANY for multiple preferred nodes Feng Tang <feng.tang@intel.com>: mm/memplicy: add page allocation function for MPOL_PREFERRED_MANY policy Ben Widawsky <ben.widawsky@intel.com>: mm/hugetlb: add support for mempolicy MPOL_PREFERRED_MANY mm/mempolicy: advertise new MPOL_PREFERRED_MANY Feng Tang <feng.tang@intel.com>: mm/mempolicy: unify the create() func for bind/interleave/prefer-many policies Vasily Averin <vvs@virtuozzo.com>: mm/mempolicy.c: use in_task() in mempolicy_slab_node() Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: memblock: make memblock_find_in_range method private Subsystem: mm/oom-kill Suren Baghdasaryan <surenb@google.com>: mm: introduce process_mrelease system call mm: wire up syscall process_mrelease Subsystem: mm/migration Randy Dunlap <rdunlap@infradead.org>: mm/migrate: correct kernel-doc notation Subsystem: mm/ksm Zhansaya Bagdauletkyzy <zhansayabagdaulet@gmail.com>: Patch series "add KSM selftests": selftests: vm: add KSM merge test selftests: vm: add KSM unmerge test selftests: vm: add KSM zero page merging test selftests: vm: add KSM merging across nodes test mm: KSM: fix data type Patch series "add KSM performance tests", v3: selftests: vm: add KSM merging time test selftests: vm: add COW time test for KSM pages Subsystem: mm/percpu Jing Xiangfeng <jingxiangfeng@huawei.com>: mm/percpu,c: remove obsolete comments of pcpu_chunk_populated() Subsystem: mm/vmstat Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup for vmstat": mm/vmstat: correct some wrong comments mm/vmstat: simplify the array size calculation mm/vmstat: remove unneeded return value Subsystem: mm/madvise zhangkui <zhangkui@oppo.com>: mm/madvise: add MADV_WILLNEED to process_madvise() Documentation/ABI/testing/sysfs-kernel-mm-numa | 24 Documentation/admin-guide/mm/numa_memory_policy.rst | 15 Documentation/admin-guide/sysctl/vm.rst | 3 Documentation/core-api/cachetlb.rst | 86 - Documentation/dev-tools/kasan.rst | 13 Documentation/translations/zh_CN/core-api/cachetlb.rst | 9 Documentation/vm/hwpoison.rst | 1 arch/Kconfig | 28 arch/alpha/kernel/syscalls/syscall.tbl | 2 arch/arm/include/asm/cacheflush.h | 4 arch/arm/kernel/setup.c | 20 arch/arm/mach-rpc/ecard.c | 2 arch/arm/mm/flush.c | 33 arch/arm/mm/nommu.c | 6 arch/arm/tools/syscall.tbl | 2 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 2 arch/arm64/kvm/hyp/reserved_mem.c | 9 arch/arm64/mm/init.c | 38 arch/csky/abiv1/cacheflush.c | 11 arch/csky/abiv1/inc/abi/cacheflush.h | 4 arch/csky/kernel/probes/kprobes.c | 3 arch/ia64/include/asm/meminit.h | 2 arch/ia64/kernel/acpi.c | 2 arch/ia64/kernel/setup.c | 55 arch/ia64/kernel/syscalls/syscall.tbl | 2 arch/m68k/kernel/syscalls/syscall.tbl | 2 arch/microblaze/include/asm/page.h | 3 arch/microblaze/include/asm/pgtable.h | 2 arch/microblaze/kernel/syscalls/syscall.tbl | 2 arch/microblaze/mm/init.c | 12 arch/microblaze/mm/pgtable.c | 17 arch/mips/include/asm/cacheflush.h | 8 arch/mips/kernel/setup.c | 14 arch/mips/kernel/syscalls/syscall_n32.tbl | 2 arch/mips/kernel/syscalls/syscall_n64.tbl | 2 arch/mips/kernel/syscalls/syscall_o32.tbl | 2 arch/nds32/include/asm/cacheflush.h | 3 arch/nds32/mm/cacheflush.c | 9 arch/parisc/include/asm/cacheflush.h | 8 arch/parisc/kernel/cache.c | 3 arch/parisc/kernel/syscalls/syscall.tbl | 2 arch/powerpc/Kconfig | 1 arch/powerpc/kernel/smp.c | 2 arch/powerpc/kernel/syscalls/syscall.tbl | 2 arch/powerpc/mm/book3s64/radix_tlb.c | 4 arch/powerpc/platforms/pseries/hotplug-memory.c | 4 arch/riscv/mm/init.c | 44 arch/s390/kernel/setup.c | 9 arch/s390/kernel/syscalls/syscall.tbl | 2 arch/s390/mm/fault.c | 2 arch/sh/include/asm/cacheflush.h | 8 arch/sh/kernel/syscalls/syscall.tbl | 2 arch/sparc/kernel/syscalls/syscall.tbl | 2 arch/x86/entry/syscalls/syscall_32.tbl | 1 arch/x86/entry/syscalls/syscall_64.tbl | 1 arch/x86/kernel/aperture_64.c | 5 arch/x86/kernel/ldt.c | 6 arch/x86/mm/init.c | 23 arch/x86/mm/numa.c | 5 arch/x86/mm/numa_emulation.c | 5 arch/x86/realmode/init.c | 2 arch/xtensa/kernel/syscalls/syscall.tbl | 2 block/blk-map.c | 2 drivers/acpi/tables.c | 5 drivers/base/arch_numa.c | 5 drivers/base/memory.c | 4 drivers/mmc/host/jz4740_mmc.c | 4 drivers/mmc/host/mmc_spi.c | 2 drivers/of/of_reserved_mem.c | 12 fs/drop_caches.c | 3 fs/exec.c | 12 fs/fcntl.c | 3 fs/fs-writeback.c | 28 fs/fs_context.c | 4 fs/inode.c | 2 fs/locks.c | 6 fs/namei.c | 8 fs/namespace.c | 7 fs/ocfs2/dlmglue.c | 14 fs/ocfs2/quota_global.c | 1 fs/ocfs2/quota_local.c | 2 fs/pipe.c | 2 fs/select.c | 4 fs/userfaultfd.c | 116 - include/linux/backing-dev-defs.h | 2 include/linux/backing-dev.h | 19 include/linux/buffer_head.h | 2 include/linux/compaction.h | 2 include/linux/highmem.h | 5 include/linux/hugetlb_cgroup.h | 12 include/linux/memblock.h | 2 include/linux/memcontrol.h | 118 + include/linux/memory.h | 2 include/linux/mempolicy.h | 16 include/linux/migrate.h | 14 include/linux/mm.h | 17 include/linux/mmzone.h | 4 include/linux/page-flags.h | 9 include/linux/pagemap.h | 4 include/linux/sched/mm.h | 35 include/linux/shmem_fs.h | 25 include/linux/slub_def.h | 6 include/linux/swap.h | 28 include/linux/syscalls.h | 1 include/linux/userfaultfd_k.h | 8 include/linux/vm_event_item.h | 2 include/linux/vmpressure.h | 2 include/linux/writeback.h | 4 include/trace/events/migrate.h | 3 include/uapi/asm-generic/unistd.h | 4 include/uapi/linux/mempolicy.h | 1 ipc/msg.c | 2 ipc/namespace.c | 2 ipc/sem.c | 9 ipc/shm.c | 2 kernel/cgroup/namespace.c | 2 kernel/cpu.c | 2 kernel/exit.c | 2 kernel/fork.c | 51 kernel/kthread.c | 21 kernel/nsproxy.c | 2 kernel/pid_namespace.c | 5 kernel/sched/core.c | 37 kernel/sched/sched.h | 4 kernel/signal.c | 2 kernel/sys_ni.c | 1 kernel/sysctl.c | 2 kernel/time/namespace.c | 4 kernel/time/posix-timers.c | 4 kernel/user_namespace.c | 2 lib/scatterlist.c | 5 lib/test_kasan.c | 80 - lib/test_kasan_module.c | 20 lib/test_vmalloc.c | 5 mm/backing-dev.c | 11 mm/bootmem_info.c | 4 mm/compaction.c | 69 - mm/debug_vm_pgtable.c | 982 +++++++++------ mm/filemap.c | 15 mm/gup.c | 109 - mm/huge_memory.c | 32 mm/hugetlb.c | 173 ++ mm/hwpoison-inject.c | 2 mm/internal.h | 9 mm/kasan/hw_tags.c | 43 mm/kasan/kasan.h | 1 mm/kasan/report.c | 29 mm/khugepaged.c | 2 mm/ksm.c | 8 mm/madvise.c | 1 mm/memblock.c | 22 mm/memcontrol.c | 234 +-- mm/memory-failure.c | 53 mm/memory_hotplug.c | 2 mm/mempolicy.c | 207 ++- mm/migrate.c | 319 ++++ mm/mmap.c | 7 mm/mremap.c | 2 mm/oom_kill.c | 70 + mm/page-writeback.c | 133 +- mm/page_alloc.c | 62 mm/page_isolation.c | 13 mm/percpu.c | 3 mm/shmem.c | 309 ++-- mm/slab_common.c | 2 mm/slub.c | 1085 ++++++++++------- mm/sparse.c | 46 mm/swap.c | 22 mm/swapfile.c | 14 mm/truncate.c | 28 mm/userfaultfd.c | 15 mm/vmalloc.c | 79 - mm/vmpressure.c | 10 mm/vmscan.c | 220 ++- mm/vmstat.c | 25 security/tomoyo/domain.c | 13 tools/testing/scatterlist/linux/mm.h | 1 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 3 tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 5 tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 5 tools/testing/selftests/vm/ksm_tests.c | 696 ++++++++++ tools/testing/selftests/vm/mlock-random-test.c | 2 tools/testing/selftests/vm/run_vmtests.sh | 98 + tools/testing/selftests/vm/userfaultfd.c | 13 186 files changed, 4488 insertions(+), 2281 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-09-02 21:48 incoming Andrew Morton @ 2021-09-02 21:49 ` Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-09-02 21:49 UTC (permalink / raw) To: Linus Torvalds, linux-mm, mm-commits On Thu, 2 Sep 2021 14:48:20 -0700 Andrew Morton <akpm@linux-foundation.org> wrote: > 212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b. Make that "based on 7d2a07b769330c34b4deabeed939325c77a7ec2f". ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-08-25 19:17 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-08-25 19:17 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 2 patches, based on 6e764bcd1cf72a2846c0e53d3975a09b242c04c9. Subsystems affected by this patch series: mm/memory-hotplug MAINTAINERS Subsystem: mm/memory-hotplug Miaohe Lin <linmiaohe@huawei.com>: mm/memory_hotplug: fix potential permanent lru cache disable Subsystem: MAINTAINERS Namjae Jeon <namjae.jeon@samsung.com>: MAINTAINERS: exfat: update my email address MAINTAINERS | 2 +- mm/memory_hotplug.c | 1 + 2 files changed, 2 insertions(+), 1 deletion(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-08-20 2:03 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-08-20 2:03 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 10 patches, based on 614cb2751d3150850d459bee596c397f344a7936. Subsystems affected by this patch series: mm/shmem mm/pagealloc mm/tracing MAINTAINERS mm/memcg mm/memory-failure mm/vmscan mm/kfence mm/hugetlb Subsystem: mm/shmem Yang Shi <shy828301@gmail.com>: Revert "mm/shmem: fix shmem_swapin() race with swapoff" Revert "mm: swap: check if swap backing device is congested or not" Subsystem: mm/pagealloc Doug Berger <opendmb@gmail.com>: mm/page_alloc: don't corrupt pcppage_migratetype Subsystem: mm/tracing Mike Rapoport <rppt@linux.ibm.com>: mmflags.h: add missing __GFP_ZEROTAGS and __GFP_SKIP_KASAN_POISON names Subsystem: MAINTAINERS Nathan Chancellor <nathan@kernel.org>: MAINTAINERS: update ClangBuiltLinux IRC chat Subsystem: mm/memcg Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: fix occasional OOMs due to proportional memory.low reclaim Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/hwpoison: retry with shake_page() for unhandlable pages Subsystem: mm/vmscan Johannes Weiner <hannes@cmpxchg.org>: mm: vmscan: fix missing psi annotation for node_reclaim() Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: fix is_kfence_address() for addresses below KFENCE_POOL_SIZE Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: don't pass page cache pages to restore_reserve_on_error MAINTAINERS | 2 +- include/linux/kfence.h | 7 ++++--- include/linux/memcontrol.h | 29 +++++++++++++++-------------- include/trace/events/mmflags.h | 4 +++- mm/hugetlb.c | 19 ++++++++++++++----- mm/memory-failure.c | 12 +++++++++--- mm/page_alloc.c | 25 ++++++++++++------------- mm/shmem.c | 14 +------------- mm/swap_state.c | 7 ------- mm/vmscan.c | 30 ++++++++++++++++++++++-------- 10 files changed, 81 insertions(+), 68 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-08-13 23:53 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-08-13 23:53 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 7 patches, based on f8e6dfc64f6135d1b6c5215c14cd30b9b60a0008. Subsystems affected by this patch series: mm/kasan mm/slub mm/madvise mm/memcg lib Subsystem: mm/kasan Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: Patch series "kasan, slub: reset tag when printing address", v3: kasan, kmemleak: reset tags when scanning block kasan, slub: reset tag when printing address Subsystem: mm/slub Shakeel Butt <shakeelb@google.com>: slub: fix kmalloc_pagealloc_invalid_free unit test Vlastimil Babka <vbabka@suse.cz>: mm: slub: fix slub_debug disabling for list of slabs Subsystem: mm/madvise David Hildenbrand <david@redhat.com>: mm/madvise: report SIGBUS as -EFAULT for MADV_POPULATE_(READ|WRITE) Subsystem: mm/memcg Waiman Long <longman@redhat.com>: mm/memcg: fix incorrect flushing of lruvec data in obj_stock Subsystem: lib Liang Wang <wangliang101@huawei.com>: lib: use PFN_PHYS() in devmem_is_allowed() lib/devmem_is_allowed.c | 2 +- mm/gup.c | 7 +++++-- mm/kmemleak.c | 6 +++--- mm/madvise.c | 4 +++- mm/memcontrol.c | 6 ++++-- mm/slub.c | 25 ++++++++++++++----------- 6 files changed, 30 insertions(+), 20 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-07-29 21:52 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-07-29 21:52 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 7 patches, based on 7e96bf476270aecea66740a083e51b38c1371cd2. Subsystems affected by this patch series: lib ocfs2 mm/memcg mm/migration mm/slub mm/memcg Subsystem: lib Matteo Croce <mcroce@microsoft.com>: lib/test_string.c: move string selftest in the Runtime Testing menu Subsystem: ocfs2 Junxiao Bi <junxiao.bi@oracle.com>: ocfs2: fix zero out valid data ocfs2: issue zeroout to EOF blocks Subsystem: mm/memcg Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: fix blocking rstat function called from atomic cgroup1 thresholding code Subsystem: mm/migration "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/migrate: fix NR_ISOLATED corruption on 64-bit Subsystem: mm/slub Shakeel Butt <shakeelb@google.com>: slub: fix unreclaimable slab stat for bulk free Subsystem: mm/memcg Wang Hai <wanghai38@huawei.com>: mm/memcg: fix NULL pointer dereference in memcg_slab_free_hook() fs/ocfs2/file.c | 103 ++++++++++++++++++++++++++++++++---------------------- lib/Kconfig | 3 - lib/Kconfig.debug | 3 + mm/memcontrol.c | 3 + mm/migrate.c | 2 - mm/slab.h | 2 - mm/slub.c | 22 ++++++----- 7 files changed, 81 insertions(+), 57 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-07-23 22:49 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-07-23 22:49 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 15 patches, based on 704f4cba43d4ed31ef4beb422313f1263d87bc55. Subsystems affected by this patch series: mm/userfaultfd mm/kfence mm/highmem mm/pagealloc mm/memblock mm/pagecache mm/secretmem mm/pagemap mm/hugetlbfs Subsystem: mm/userfaultfd Peter Collingbourne <pcc@google.com>: Patch series "userfaultfd: do not untag user pointers", v5: userfaultfd: do not untag user pointers selftest: use mmap instead of posix_memalign to allocate memory Subsystem: mm/kfence Weizhao Ouyang <o451686892@gmail.com>: kfence: defer kfence_test_init to ensure that kunit debugfs is created Alexander Potapenko <glider@google.com>: kfence: move the size check to the beginning of __kfence_alloc() kfence: skip all GFP_ZONEMASK allocations Subsystem: mm/highmem Christoph Hellwig <hch@lst.de>: mm: call flush_dcache_page() in memcpy_to_page() and memzero_page() mm: use kmap_local_page in memzero_page Subsystem: mm/pagealloc Sergei Trofimovich <slyfox@gentoo.org>: mm: page_alloc: fix page_poison=1 / INIT_ON_ALLOC_DEFAULT_ON interaction Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: memblock: make for_each_mem_range() traverse MEMBLOCK_HOTPLUG regions Subsystem: mm/pagecache Roman Gushchin <guro@fb.com>: writeback, cgroup: remove wb from offline list before releasing refcnt writeback, cgroup: do not reparent dax inodes Subsystem: mm/secretmem Mike Rapoport <rppt@linux.ibm.com>: mm/secretmem: wire up ->set_page_dirty Subsystem: mm/pagemap Muchun Song <songmuchun@bytedance.com>: mm: mmap_lock: fix disabling preemption directly Qi Zheng <zhengqi.arch@bytedance.com>: mm: fix the deadlock in finish_fault() Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: hugetlbfs: fix mount mode command line processing Documentation/arm64/tagged-address-abi.rst | 26 ++++++++++++++++++-------- fs/fs-writeback.c | 3 +++ fs/hugetlbfs/inode.c | 2 +- fs/userfaultfd.c | 26 ++++++++++++-------------- include/linux/highmem.h | 6 ++++-- include/linux/memblock.h | 4 ++-- mm/backing-dev.c | 2 +- mm/kfence/core.c | 19 ++++++++++++++++--- mm/kfence/kfence_test.c | 2 +- mm/memblock.c | 3 ++- mm/memory.c | 11 ++++++++++- mm/mmap_lock.c | 4 ++-- mm/page_alloc.c | 29 ++++++++++++++++------------- mm/secretmem.c | 1 + tools/testing/selftests/vm/userfaultfd.c | 6 ++++-- 15 files changed, 93 insertions(+), 51 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-07-15 4:26 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-07-15 4:26 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 13 patches, based on 40226a3d96ef8ab8980f032681c8bfd46d63874e. Subsystems affected by this patch series: mm/kasan mm/pagealloc mm/rmap mm/hmm hfs mm/hugetlb Subsystem: mm/kasan Marco Elver <elver@google.com>: mm: move helper to check slub_debug_enabled Yee Lee <yee.lee@mediatek.com>: kasan: add memzero init for unaligned size at DEBUG Marco Elver <elver@google.com>: kasan: fix build by including kernel.h Subsystem: mm/pagealloc Matteo Croce <mcroce@microsoft.com>: Revert "mm/page_alloc: make should_fail_alloc_page() static" Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: avoid page allocator recursion with pagesets.lock held Yanfei Xu <yanfei.xu@windriver.com>: mm/page_alloc: correct return value when failing at preparing Chuck Lever <chuck.lever@oracle.com>: mm/page_alloc: further fix __alloc_pages_bulk() return value Subsystem: mm/rmap Christoph Hellwig <hch@lst.de>: mm: fix the try_to_unmap prototype for !CONFIG_MMU Subsystem: mm/hmm Alistair Popple <apopple@nvidia.com>: lib/test_hmm: remove set but unused page variable Subsystem: hfs Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>: Patch series "hfs: fix various errors", v2: hfs: add missing clean-up in hfs_fill_super hfs: fix high memory mapping in hfs_bnode_read hfs: add lock nesting notation to hfs_find_init Subsystem: mm/hugetlb Joao Martins <joao.m.martins@oracle.com>: mm/hugetlb: fix refs calculation from unaligned @vaddr fs/hfs/bfind.c | 14 +++++++++++++- fs/hfs/bnode.c | 25 ++++++++++++++++++++----- fs/hfs/btree.h | 7 +++++++ fs/hfs/super.c | 10 +++++----- include/linux/kasan.h | 1 + include/linux/rmap.h | 4 +++- lib/test_hmm.c | 2 -- mm/hugetlb.c | 5 +++-- mm/kasan/kasan.h | 12 ++++++++++++ mm/page_alloc.c | 30 ++++++++++++++++++++++-------- mm/slab.h | 15 +++++++++++---- mm/slub.c | 14 -------------- 12 files changed, 97 insertions(+), 42 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-07-08 0:59 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-07-08 0:59 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 54 patches, based on a931dd33d370896a683236bba67c0d6f3d01144d. Subsystems affected by this patch series: lib mm/slub mm/secretmem mm/cleanups mm/init debug mm/pagemap mm/mremap Subsystem: lib Zhen Lei <thunder.leizhen@huawei.com>: lib/test: fix spelling mistakes lib: fix spelling mistakes lib: fix spelling mistakes in header files Subsystem: mm/slub Nathan Chancellor <nathan@kernel.org>: Patch series "hexagon: Fix build error with CONFIG_STACKDEPOT and select CONFIG_ARCH_WANT_LD_ORPHAN_WARN": hexagon: handle {,SOFT}IRQENTRY_TEXT in linker script hexagon: use common DISCARDS macro hexagon: select ARCH_WANT_LD_ORPHAN_WARN Oliver Glitta <glittao@gmail.com>: mm/slub: use stackdepot to save stack trace in objects Subsystem: mm/secretmem Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: introduce memfd_secret system call to create "secret" memory areas", v20: mmap: make mlock_future_check() global riscv/Kconfig: make direct map manipulation options depend on MMU set_memory: allow querying whether set_direct_map_*() is actually enabled mm: introduce memfd_secret system call to create "secret" memory areas PM: hibernate: disable when there are active secretmem users arch, mm: wire up memfd_secret system call where relevant secretmem: test: add basic selftest for memfd_secret(2) Subsystem: mm/cleanups Zhen Lei <thunder.leizhen@huawei.com>: mm: fix spelling mistakes in header files Subsystem: mm/init Kefeng Wang <wangkefeng.wang@huawei.com>: Patch series "init_mm: cleanup ARCH's text/data/brk setup code", v3: mm: add setup_initial_init_mm() helper arc: convert to setup_initial_init_mm() arm: convert to setup_initial_init_mm() arm64: convert to setup_initial_init_mm() csky: convert to setup_initial_init_mm() h8300: convert to setup_initial_init_mm() m68k: convert to setup_initial_init_mm() nds32: convert to setup_initial_init_mm() nios2: convert to setup_initial_init_mm() openrisc: convert to setup_initial_init_mm() powerpc: convert to setup_initial_init_mm() riscv: convert to setup_initial_init_mm() s390: convert to setup_initial_init_mm() sh: convert to setup_initial_init_mm() x86: convert to setup_initial_init_mm() Subsystem: debug Stephen Boyd <swboyd@chromium.org>: Patch series "Add build ID to stacktraces", v6: buildid: only consider GNU notes for build ID parsing buildid: add API to parse build ID out of buffer buildid: stash away kernels build ID on init dump_stack: add vmlinux build ID to stack traces module: add printk formats to add module build ID to stacktraces arm64: stacktrace: use %pSb for backtrace printing x86/dumpstack: use %pSb/%pBb for backtrace printing scripts/decode_stacktrace.sh: support debuginfod scripts/decode_stacktrace.sh: silence stderr messages from addr2line/nm scripts/decode_stacktrace.sh: indicate 'auto' can be used for base path buildid: mark some arguments const buildid: fix kernel-doc notation kdump: use vmlinux_build_id to simplify Subsystem: mm/pagemap "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm: rename pud_page_vaddr to pud_pgtable and make it return pmd_t * mm: rename p4d_page_vaddr to p4d_pgtable and make it return pud_t * Subsystem: mm/mremap "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "mrermap fixes", v2: selftest/mremap_test: update the test to handle pagesize other than 4K selftest/mremap_test: avoid crash with static build mm/mremap: convert huge PUD move to separate helper mm/mremap: don't enable optimized PUD move if page table levels is 2 mm/mremap: use pmd/pud_poplulate to update page table entries mm/mremap: hold the rmap lock in write mode when moving page table entries. Patch series "Speedup mremap on ppc64", v8: mm/mremap: allow arch runtime override powerpc/book3s64/mm: update flush_tlb_range to flush page walk cache powerpc/mm: enable HAVE_MOVE_PMD support Documentation/core-api/printk-formats.rst | 11 arch/alpha/include/asm/pgtable.h | 8 arch/arc/mm/init.c | 5 arch/arm/include/asm/pgtable-3level.h | 2 arch/arm/kernel/setup.c | 5 arch/arm64/include/asm/Kbuild | 1 arch/arm64/include/asm/cacheflush.h | 6 arch/arm64/include/asm/kfence.h | 2 arch/arm64/include/asm/pgtable.h | 8 arch/arm64/include/asm/set_memory.h | 17 + arch/arm64/include/uapi/asm/unistd.h | 1 arch/arm64/kernel/machine_kexec.c | 1 arch/arm64/kernel/setup.c | 5 arch/arm64/kernel/stacktrace.c | 2 arch/arm64/mm/mmu.c | 7 arch/arm64/mm/pageattr.c | 13 arch/csky/kernel/setup.c | 5 arch/h8300/kernel/setup.c | 5 arch/hexagon/Kconfig | 1 arch/hexagon/kernel/vmlinux.lds.S | 9 arch/ia64/include/asm/pgtable.h | 4 arch/m68k/include/asm/motorola_pgtable.h | 2 arch/m68k/kernel/setup_mm.c | 5 arch/m68k/kernel/setup_no.c | 5 arch/mips/include/asm/pgtable-64.h | 8 arch/nds32/kernel/setup.c | 5 arch/nios2/kernel/setup.c | 5 arch/openrisc/kernel/setup.c | 5 arch/parisc/include/asm/pgtable.h | 4 arch/powerpc/include/asm/book3s/64/pgtable.h | 11 arch/powerpc/include/asm/book3s/64/tlbflush-radix.h | 2 arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 6 arch/powerpc/include/asm/nohash/64/pgtable.h | 6 arch/powerpc/include/asm/tlb.h | 6 arch/powerpc/kernel/setup-common.c | 5 arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 8 arch/powerpc/mm/book3s64/radix_pgtable.c | 6 arch/powerpc/mm/book3s64/radix_tlb.c | 44 +- arch/powerpc/mm/pgtable_64.c | 4 arch/powerpc/platforms/Kconfig.cputype | 2 arch/riscv/Kconfig | 4 arch/riscv/include/asm/pgtable-64.h | 4 arch/riscv/include/asm/unistd.h | 1 arch/riscv/kernel/setup.c | 5 arch/s390/kernel/setup.c | 5 arch/sh/include/asm/pgtable-3level.h | 4 arch/sh/kernel/setup.c | 5 arch/sparc/include/asm/pgtable_32.h | 6 arch/sparc/include/asm/pgtable_64.h | 10 arch/um/include/asm/pgtable-3level.h | 2 arch/x86/entry/syscalls/syscall_32.tbl | 1 arch/x86/entry/syscalls/syscall_64.tbl | 1 arch/x86/include/asm/pgtable.h | 8 arch/x86/kernel/dumpstack.c | 2 arch/x86/kernel/setup.c | 5 arch/x86/mm/init_64.c | 4 arch/x86/mm/pat/set_memory.c | 4 arch/x86/mm/pgtable.c | 2 include/asm-generic/pgtable-nop4d.h | 2 include/asm-generic/pgtable-nopmd.h | 2 include/asm-generic/pgtable-nopud.h | 4 include/linux/bootconfig.h | 4 include/linux/buildid.h | 10 include/linux/compaction.h | 4 include/linux/cpumask.h | 2 include/linux/crash_core.h | 12 include/linux/debugobjects.h | 2 include/linux/hmm.h | 2 include/linux/hugetlb.h | 6 include/linux/kallsyms.h | 21 + include/linux/list_lru.h | 4 include/linux/lru_cache.h | 8 include/linux/mm.h | 3 include/linux/mmu_notifier.h | 8 include/linux/module.h | 9 include/linux/nodemask.h | 6 include/linux/percpu-defs.h | 2 include/linux/percpu-refcount.h | 2 include/linux/pgtable.h | 4 include/linux/scatterlist.h | 2 include/linux/secretmem.h | 54 +++ include/linux/set_memory.h | 12 include/linux/shrinker.h | 2 include/linux/syscalls.h | 1 include/linux/vmalloc.h | 4 include/uapi/asm-generic/unistd.h | 7 include/uapi/linux/magic.h | 1 init/Kconfig | 1 init/main.c | 2 kernel/crash_core.c | 50 --- kernel/kallsyms.c | 104 +++++-- kernel/module.c | 42 ++ kernel/power/hibernate.c | 5 kernel/sys_ni.c | 2 lib/Kconfig.debug | 17 - lib/asn1_encoder.c | 2 lib/buildid.c | 80 ++++- lib/devres.c | 2 lib/dump_stack.c | 13 lib/dynamic_debug.c | 2 lib/fonts/font_pearl_8x8.c | 2 lib/kfifo.c | 2 lib/list_sort.c | 2 lib/nlattr.c | 4 lib/oid_registry.c | 2 lib/pldmfw/pldmfw.c | 2 lib/reed_solomon/test_rslib.c | 2 lib/refcount.c | 2 lib/rhashtable.c | 2 lib/sbitmap.c | 2 lib/scatterlist.c | 4 lib/seq_buf.c | 2 lib/sort.c | 2 lib/stackdepot.c | 2 lib/test_bitops.c | 2 lib/test_bpf.c | 2 lib/test_kasan.c | 2 lib/test_kmod.c | 6 lib/test_scanf.c | 2 lib/vsprintf.c | 10 mm/Kconfig | 4 mm/Makefile | 1 mm/gup.c | 12 mm/init-mm.c | 9 mm/internal.h | 3 mm/mlock.c | 3 mm/mmap.c | 5 mm/mremap.c | 108 ++++++- mm/secretmem.c | 254 +++++++++++++++++ mm/slub.c | 79 +++-- scripts/checksyscalls.sh | 4 scripts/decode_stacktrace.sh | 89 +++++- tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 3 tools/testing/selftests/vm/memfd_secret.c | 296 ++++++++++++++++++++ tools/testing/selftests/vm/mremap_test.c | 116 ++++--- tools/testing/selftests/vm/run_vmtests.sh | 17 + 137 files changed, 1470 insertions(+), 442 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-07-01 1:46 Andrew Morton 2021-07-03 0:28 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2021-07-01 1:46 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits This is the rest of the -mm tree, less 66 patches which are dependent on things which are (or were recently) in linux-next. I'll trickle that material over next week. 192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2 plus the June 28 sendings. Subsystems affected by this patch series: mm/hugetlb mm/userfaultfd mm/vmscan mm/kconfig mm/proc mm/z3fold mm/zbud mm/ras mm/mempolicy mm/memblock mm/migration mm/thp mm/nommu mm/kconfig mm/madvise mm/memory-hotplug mm/zswap mm/zsmalloc mm/zram mm/cleanups mm/kfence mm/hmm procfs sysctl misc core-kernel lib lz4 checkpatch init kprobes nilfs2 hfs signals exec kcov selftests compress/decompress ipc Subsystem: mm/hugetlb Muchun Song <songmuchun@bytedance.com>: Patch series "Free some vmemmap pages of HugeTLB page", v23: mm: memory_hotplug: factor out bootmem core functions to bootmem_info.c mm: hugetlb: introduce a new config HUGETLB_PAGE_FREE_VMEMMAP mm: hugetlb: gather discrete indexes of tail page mm: hugetlb: free the vmemmap pages associated with each HugeTLB page mm: hugetlb: defer freeing of HugeTLB pages mm: hugetlb: alloc the vmemmap pages associated with each HugeTLB page mm: hugetlb: add a kernel parameter hugetlb_free_vmemmap mm: memory_hotplug: disable memmap_on_memory when hugetlb_free_vmemmap enabled mm: hugetlb: introduce nr_free_vmemmap_pages in the struct hstate Shixin Liu <liushixin2@huawei.com>: mm/debug_vm_pgtable: move {pmd/pud}_huge_tests out of CONFIG_TRANSPARENT_HUGEPAGE mm/debug_vm_pgtable: remove redundant pfn_{pmd/pte}() and fix one comment mistake Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for huge_memory:, v3: mm/huge_memory.c: remove dedicated macro HPAGE_CACHE_INDEX_MASK mm/huge_memory.c: use page->deferred_list mm/huge_memory.c: add missing read-only THP checking in transparent_hugepage_enabled() mm/huge_memory.c: remove unnecessary tlb_remove_page_size() for huge zero pmd mm/huge_memory.c: don't discard hugepage if other processes are mapping it Christophe Leroy <christophe.leroy@csgroup.eu>: Patch series "Subject: [PATCH v2 0/5] Implement huge VMAP and VMALLOC on powerpc 8xx", v2: mm/hugetlb: change parameters of arch_make_huge_pte() mm/pgtable: add stubs for {pmd/pub}_{set/clear}_huge mm/vmalloc: enable mapping of huge pages at pte level in vmap mm/vmalloc: enable mapping of huge pages at pte level in vmalloc powerpc/8xx: add support for huge pages on VMAP and VMALLOC Nanyong Sun <sunnanyong@huawei.com>: khugepaged: selftests: remove debug_cow Mina Almasry <almasrymina@google.com>: mm, hugetlb: fix racy resv_huge_pages underflow on UFFDIO_COPY Muchun Song <songmuchun@bytedance.com>: Patch series "Split huge PMD mapping of vmemmap pages", v4: mm: sparsemem: split the huge PMD mapping of vmemmap pages mm: sparsemem: use huge PMD mapping for vmemmap pages mm: hugetlb: introduce CONFIG_HUGETLB_PAGE_FREE_VMEMMAP_DEFAULT_ON Mike Kravetz <mike.kravetz@oracle.com>: Patch series "Fix prep_compound_gigantic_page ref count adjustment": hugetlb: remove prep_compound_huge_page cleanup hugetlb: address ref count racing in prep_compound_gigantic_page Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/hwpoison: disable pcp for page_handle_poison() Subsystem: mm/userfaultfd Peter Xu <peterx@redhat.com>: Patch series "userfaultfd/selftests: A few cleanups", v2: userfaultfd/selftests: use user mode only userfaultfd/selftests: remove the time() check on delayed uffd userfaultfd/selftests: dropping VERIFY check in locking_thread userfaultfd/selftests: only dump counts if mode enabled userfaultfd/selftests: unify error handling Patch series "mm/uffd: Misc fix for uffd-wp and one more test": mm/thp: simplify copying of huge zero page pmd when fork mm/userfaultfd: fix uffd-wp special cases for fork() mm/userfaultfd: fail uffd-wp registration if not supported mm/pagemap: export uffd-wp protection information userfaultfd/selftests: add pagemap uffd-wp test Axel Rasmussen <axelrasmussen@google.com>: Patch series "userfaultfd: add minor fault handling for shmem", v6: userfaultfd/shmem: combine shmem_{mcopy_atomic,mfill_zeropage}_pte userfaultfd/shmem: support minor fault registration for shmem userfaultfd/shmem: support UFFDIO_CONTINUE for shmem userfaultfd/shmem: advertise shmem minor fault support userfaultfd/shmem: modify shmem_mfill_atomic_pte to use install_pte() userfaultfd/selftests: use memfd_create for shmem test type userfaultfd/selftests: create alias mappings in the shmem test userfaultfd/selftests: reinitialize test context in each test userfaultfd/selftests: exercise minor fault handling shmem support Subsystem: mm/vmscan Yu Zhao <yuzhao@google.com>: mm/vmscan.c: fix potential deadlock in reclaim_pages() include/trace/events/vmscan.h: remove mm_vmscan_inactive_list_is_low Miaohe Lin <linmiaohe@huawei.com>: mm: workingset: define macro WORKINGSET_SHIFT Subsystem: mm/kconfig Kefeng Wang <wangkefeng.wang@huawei.com>: mm/kconfig: move HOLES_IN_ZONE into mm Subsystem: mm/proc Mike Rapoport <rppt@linux.ibm.com>: docs: proc.rst: meminfo: briefly describe gaps in memory accounting David Hildenbrand <david@redhat.com>: Patch series "fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages", v3: fs/proc/kcore: drop KCORE_REMAP and KCORE_OTHER fs/proc/kcore: pfn_is_ram check only applies to KCORE_RAM fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages mm: introduce page_offline_(begin|end|freeze|thaw) to synchronize setting PageOffline() virtio-mem: use page_offline_(start|end) when setting PageOffline() fs/proc/kcore: use page_offline_(freeze|thaw) Subsystem: mm/z3fold Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for z3fold": mm/z3fold: define macro NCHUNKS as TOTAL_CHUNKS - ZHDR_CHUNKS mm/z3fold: avoid possible underflow in z3fold_alloc() mm/z3fold: remove magic number in z3fold_create_pool() mm/z3fold: remove unused function handle_to_z3fold_header() mm/z3fold: fix potential memory leak in z3fold_destroy_pool() mm/z3fold: use release_z3fold_page_locked() to release locked z3fold page Subsystem: mm/zbud Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups for zbud", v2: mm/zbud: reuse unbuddied[0] as buddied in zbud_pool mm/zbud: don't export any zbud API Subsystem: mm/ras YueHaibing <yuehaibing@huawei.com>: mm/compaction: use DEVICE_ATTR_WO macro Liu Xiang <liu.xiang@zlingsmart.com>: mm: compaction: remove duplicate !list_empty(&sublist) check Wonhyuk Yang <vvghjk1234@gmail.com>: mm/compaction: fix 'limit' in fast_isolate_freepages Subsystem: mm/mempolicy Feng Tang <feng.tang@intel.com>: Patch series "mm/mempolicy: some fix and semantics cleanup", v4: mm/mempolicy: cleanup nodemask intersection check for oom mm/mempolicy: don't handle MPOL_LOCAL like a fake MPOL_PREFERRED policy mm/mempolicy: unify the parameter sanity check for mbind and set_mempolicy Yang Shi <shy828301@gmail.com>: mm: mempolicy: don't have to split pmd for huge zero page Ben Widawsky <ben.widawsky@intel.com>: mm/mempolicy: use unified 'nodes' for bind/interleave/prefer policies Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: Patch series "arm64: drop pfn_valid_within() and simplify pfn_valid()", v4: include/linux/mmzone.h: add documentation for pfn_valid() memblock: update initialization of reserved pages arm64: decouple check whether pfn is in linear map from pfn_valid() arm64: drop pfn_valid_within() and simplify pfn_valid() Anshuman Khandual <anshuman.khandual@arm.com>: arm64/mm: drop HAVE_ARCH_PFN_VALID Subsystem: mm/migration Muchun Song <songmuchun@bytedance.com>: mm: migrate: fix missing update page_private to hugetlb_page_subpool Subsystem: mm/thp Collin Fijalkovich <cfijalkovich@google.com>: mm, thp: relax the VM_DENYWRITE constraint on file-backed THPs Yang Shi <shy828301@gmail.com>: mm: memory: add orig_pmd to struct vm_fault mm: memory: make numa_migrate_prep() non-static mm: thp: refactor NUMA fault handling mm: migrate: account THP NUMA migration counters correctly mm: migrate: don't split THP for misplaced NUMA page mm: migrate: check mapcount for THP instead of refcount mm: thp: skip make PMD PROT_NONE if THP migration is not supported Anshuman Khandual <anshuman.khandual@arm.com>: mm/thp: make ARCH_ENABLE_SPLIT_PMD_PTLOCK dependent on PGTABLE_LEVELS > 2 Yang Shi <shy828301@gmail.com>: mm: rmap: make try_to_unmap() void function Hugh Dickins <hughd@google.com>: mm/thp: remap_page() is only needed on anonymous THP mm: hwpoison_user_mappings() try_to_unmap() with TTU_SYNC "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/thp: fix strncpy warning Subsystem: mm/nommu Chen Li <chenli@uniontech.com>: nommu: remove __GFP_HIGHMEM in vmalloc/vzalloc Liam Howlett <liam.howlett@oracle.com>: mm/nommu: unexport do_munmap() Subsystem: mm/kconfig Kefeng Wang <wangkefeng.wang@huawei.com>: mm: generalize ZONE_[DMA|DMA32] Subsystem: mm/madvise David Hildenbrand <david@redhat.com>: Patch series "mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables", v2: mm: make variable names for populate_vma_page_range() consistent mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables MAINTAINERS: add tools/testing/selftests/vm/ to MEMORY MANAGEMENT selftests/vm: add protection_keys_32 / protection_keys_64 to gitignore selftests/vm: add test for MADV_POPULATE_(READ|WRITE) Subsystem: mm/memory-hotplug Liam Mark <lmark@codeaurora.org>: mm/memory_hotplug: rate limit page migration warnings Oscar Salvador <osalvador@suse.de>: mm,memory_hotplug: drop unneeded locking Subsystem: mm/zswap Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for zswap": mm/zswap.c: remove unused function zswap_debugfs_exit() mm/zswap.c: avoid unnecessary copy-in at map time mm/zswap.c: fix two bugs in zswap_writeback_entry() Subsystem: mm/zsmalloc Zhaoyang Huang <zhaoyang.huang@unisoc.com>: mm: zram: amend SLAB_RECLAIM_ACCOUNT on zspage_cachep Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup for zsmalloc": mm/zsmalloc.c: remove confusing code in obj_free() mm/zsmalloc.c: improve readability for async_free_zspage() Subsystem: mm/zram Yue Hu <huyue2@yulong.com>: zram: move backing_dev under macro CONFIG_ZRAM_WRITEBACK Subsystem: mm/cleanups Hyeonggon Yoo <42.hyeyoo@gmail.com>: mm: fix typos and grammar error in comments Anshuman Khandual <anshuman.khandual@arm.com>: mm: define default value for FIRST_USER_ADDRESS Zhen Lei <thunder.leizhen@huawei.com>: mm: fix spelling mistakes Mel Gorman <mgorman@techsingularity.net>: Patch series "Clean W=1 build warnings for mm/": mm/vmscan: remove kerneldoc-like comment from isolate_lru_pages mm/vmalloc: include header for prototype of set_iounmap_nonlazy mm/page_alloc: make should_fail_alloc_page() static mm/mapping_dirty_helpers: remove double Note in kerneldoc mm/memcontrol.c: fix kerneldoc comment for mem_cgroup_calculate_protection mm/memory_hotplug: fix kerneldoc comment for __try_online_node mm/memory_hotplug: fix kerneldoc comment for __remove_memory mm/zbud: add kerneldoc fields for zbud_pool mm/z3fold: add kerneldoc fields for z3fold_pool mm/swap: make swap_address_space an inline function mm/mmap_lock: remove dead code for !CONFIG_TRACING configurations mm/page_alloc: move prototype for find_suitable_fallback mm/swap: make NODE_DATA an inline function on CONFIG_FLATMEM Anshuman Khandual <anshuman.khandual@arm.com>: mm/thp: define default pmd_pgtable() Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: unconditionally use unbound work queue Subsystem: mm/hmm Alistair Popple <apopple@nvidia.com>: Patch series "Add support for SVM atomics in Nouveau", v11: mm: remove special swap entry functions mm/swapops: rework swap entry manipulation code mm/rmap: split try_to_munlock from try_to_unmap mm/rmap: split migration into its own function mm: rename migrate_pgmap_owner mm/memory.c: allow different return codes for copy_nonpresent_pte() mm: device exclusive memory access mm: selftests for exclusive device memory nouveau/svm: refactor nouveau_range_fault nouveau/svm: implement atomic SVM access Subsystem: procfs Marcelo Henrique Cerri <marcelo.cerri@canonical.com>: proc: Avoid mixing integer types in mem_rw() ZHOUFENG <zhoufeng.zf@bytedance.com>: fs/proc/kcore.c: add mmap interface Kalesh Singh <kaleshsingh@google.com>: procfs: allow reading fdinfo with PTRACE_MODE_READ procfs/dmabuf: add inode number to /proc/*/fdinfo Subsystem: sysctl Jiapeng Chong <jiapeng.chong@linux.alibaba.com>: sysctl: remove redundant assignment to first Subsystem: misc Andy Shevchenko <andriy.shevchenko@linux.intel.com>: drm: include only needed headers in ascii85.h Subsystem: core-kernel Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: split out panic and oops helpers Subsystem: lib Zhen Lei <thunder.leizhen@huawei.com>: lib: decompress_bunzip2: remove an unneeded semicolon Andy Shevchenko <andriy.shevchenko@linux.intel.com>: Patch series "lib/string_helpers: get rid of ugly *_escape_mem_ascii()", v3: lib/string_helpers: switch to use BIT() macro lib/string_helpers: move ESCAPE_NP check inside 'else' branch in a loop lib/string_helpers: drop indentation level in string_escape_mem() lib/string_helpers: introduce ESCAPE_NA for escaping non-ASCII lib/string_helpers: introduce ESCAPE_NAP to escape non-ASCII and non-printable lib/string_helpers: allow to append additional characters to be escaped lib/test-string_helpers: print flags in hexadecimal format lib/test-string_helpers: get rid of trailing comma in terminators lib/test-string_helpers: add test cases for new features MAINTAINERS: add myself as designated reviewer for generic string library seq_file: introduce seq_escape_mem() seq_file: add seq_escape_str() as replica of string_escape_str() seq_file: convert seq_escape() to use seq_escape_str() nfsd: avoid non-flexible API in seq_quote_mem() seq_file: drop unused *_escape_mem_ascii() Trent Piepho <tpiepho@gmail.com>: lib/math/rational.c: fix divide by zero lib/math/rational: add Kunit test cases Zhen Lei <thunder.leizhen@huawei.com>: lib/decompressors: fix spelling mistakes lib/mpi: fix spelling mistakes Alexey Dobriyan <adobriyan@gmail.com>: lib: memscan() fixlet lib: uninline simple_strtoull() Matteo Croce <mcroce@microsoft.com>: lib/test_string.c: allow module removal Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: split out kstrtox() and simple_strtox() to a separate header Subsystem: lz4 Rajat Asthana <thisisrast7@gmail.com>: lz4_decompress: declare LZ4_decompress_safe_withPrefix64k static Dimitri John Ledkov <dimitri.ledkov@canonical.com>: lib/decompress_unlz4.c: correctly handle zero-padding around initrds. Subsystem: checkpatch Guenter Roeck <linux@roeck-us.net>: checkpatch: scripts/spdxcheck.py now requires python3 Joe Perches <joe@perches.com>: checkpatch: improve the indented label test Guenter Roeck <linux@roeck-us.net>: checkpatch: do not complain about positive return values starting with EPOLL Subsystem: init Andrew Halaney <ahalaney@redhat.com>: init: print out unknown kernel parameters Subsystem: kprobes Barry Song <song.bao.hua@hisilicon.com>: kprobes: remove duplicated strong free_insn_page in x86 and s390 Subsystem: nilfs2 Colin Ian King <colin.king@canonical.com>: nilfs2: remove redundant continue statement in a while-loop Subsystem: hfs Zhen Lei <thunder.leizhen@huawei.com>: hfsplus: remove unnecessary oom message Chung-Chiang Cheng <shepjeng@gmail.com>: hfsplus: report create_date to kstat.btime Subsystem: signals Al Viro <viro@zeniv.linux.org.uk>: x86: signal: don't do sas_ss_reset() until we are certain that sigframe won't be abandoned Subsystem: exec Alexey Dobriyan <adobriyan@gmail.com>: exec: remove checks in __register_bimfmt() Subsystem: kcov Marco Elver <elver@google.com>: kcov: add __no_sanitize_coverage to fix noinstr for all architectures Subsystem: selftests Dave Hansen <dave.hansen@linux.intel.com>: Patch series "selftests/vm/pkeys: Bug fixes and a new test": selftests/vm/pkeys: fix alloc_random_pkey() to make it really, really random selftests/vm/pkeys: handle negative sys_pkey_alloc() return code selftests/vm/pkeys: refill shadow register after implicit kernel write selftests/vm/pkeys: exercise x86 XSAVE init state Subsystem: compress/decompress Yu Kuai <yukuai3@huawei.com>: lib/decompressors: remove set but not used variabled 'level' Subsystem: ipc Vasily Averin <vvs@virtuozzo.com>: Patch series "ipc: allocations cleanup", v2: ipc sem: use kvmalloc for sem_undo allocation ipc: use kmalloc for msg_queue and shmid_kernel Manfred Spraul <manfred@colorfullife.com>: ipc/sem.c: use READ_ONCE()/WRITE_ONCE() for use_global_lock ipc/util.c: use binary search for max_idx Documentation/admin-guide/kernel-parameters.txt | 35 Documentation/admin-guide/mm/hugetlbpage.rst | 11 Documentation/admin-guide/mm/memory-hotplug.rst | 13 Documentation/admin-guide/mm/pagemap.rst | 2 Documentation/admin-guide/mm/userfaultfd.rst | 3 Documentation/core-api/kernel-api.rst | 7 Documentation/filesystems/proc.rst | 48 Documentation/vm/hmm.rst | 19 Documentation/vm/unevictable-lru.rst | 33 MAINTAINERS | 10 arch/alpha/Kconfig | 5 arch/alpha/include/asm/pgalloc.h | 1 arch/alpha/include/asm/pgtable.h | 1 arch/alpha/include/uapi/asm/mman.h | 3 arch/alpha/kernel/setup.c | 2 arch/arc/include/asm/pgalloc.h | 2 arch/arc/include/asm/pgtable.h | 8 arch/arm/Kconfig | 3 arch/arm/include/asm/pgalloc.h | 1 arch/arm64/Kconfig | 15 arch/arm64/include/asm/hugetlb.h | 3 arch/arm64/include/asm/memory.h | 2 arch/arm64/include/asm/page.h | 4 arch/arm64/include/asm/pgalloc.h | 1 arch/arm64/include/asm/pgtable.h | 2 arch/arm64/kernel/setup.c | 1 arch/arm64/kvm/mmu.c | 2 arch/arm64/mm/hugetlbpage.c | 5 arch/arm64/mm/init.c | 51 arch/arm64/mm/ioremap.c | 4 arch/arm64/mm/mmu.c | 22 arch/csky/include/asm/pgalloc.h | 2 arch/csky/include/asm/pgtable.h | 1 arch/hexagon/include/asm/pgtable.h | 4 arch/ia64/Kconfig | 7 arch/ia64/include/asm/pal.h | 1 arch/ia64/include/asm/pgalloc.h | 1 arch/ia64/include/asm/pgtable.h | 1 arch/m68k/Kconfig | 5 arch/m68k/include/asm/mcf_pgalloc.h | 2 arch/m68k/include/asm/mcf_pgtable.h | 2 arch/m68k/include/asm/motorola_pgalloc.h | 1 arch/m68k/include/asm/motorola_pgtable.h | 2 arch/m68k/include/asm/pgtable_mm.h | 1 arch/m68k/include/asm/sun3_pgalloc.h | 1 arch/microblaze/Kconfig | 4 arch/microblaze/include/asm/pgalloc.h | 2 arch/microblaze/include/asm/pgtable.h | 2 arch/mips/Kconfig | 10 arch/mips/include/asm/pgalloc.h | 1 arch/mips/include/asm/pgtable-32.h | 1 arch/mips/include/asm/pgtable-64.h | 1 arch/mips/include/uapi/asm/mman.h | 3 arch/mips/kernel/relocate.c | 1 arch/mips/sgi-ip22/ip22-reset.c | 1 arch/mips/sgi-ip32/ip32-reset.c | 1 arch/nds32/include/asm/pgalloc.h | 5 arch/nios2/include/asm/pgalloc.h | 1 arch/nios2/include/asm/pgtable.h | 2 arch/openrisc/include/asm/pgalloc.h | 2 arch/openrisc/include/asm/pgtable.h | 1 arch/parisc/include/asm/pgalloc.h | 1 arch/parisc/include/asm/pgtable.h | 2 arch/parisc/include/uapi/asm/mman.h | 3 arch/parisc/kernel/pdc_chassis.c | 1 arch/powerpc/Kconfig | 6 arch/powerpc/include/asm/book3s/pgtable.h | 1 arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h | 5 arch/powerpc/include/asm/nohash/32/mmu-8xx.h | 43 arch/powerpc/include/asm/nohash/32/pgtable.h | 1 arch/powerpc/include/asm/nohash/64/pgtable.h | 2 arch/powerpc/include/asm/pgalloc.h | 5 arch/powerpc/include/asm/pgtable.h | 6 arch/powerpc/kernel/setup-common.c | 1 arch/powerpc/platforms/Kconfig.cputype | 1 arch/riscv/Kconfig | 5 arch/riscv/include/asm/pgalloc.h | 2 arch/riscv/include/asm/pgtable.h | 2 arch/s390/Kconfig | 6 arch/s390/include/asm/pgalloc.h | 3 arch/s390/include/asm/pgtable.h | 5 arch/s390/kernel/ipl.c | 1 arch/s390/kernel/kprobes.c | 5 arch/s390/mm/pgtable.c | 2 arch/sh/include/asm/pgalloc.h | 1 arch/sh/include/asm/pgtable.h | 2 arch/sparc/Kconfig | 5 arch/sparc/include/asm/pgalloc_32.h | 1 arch/sparc/include/asm/pgalloc_64.h | 1 arch/sparc/include/asm/pgtable_32.h | 3 arch/sparc/include/asm/pgtable_64.h | 8 arch/sparc/kernel/sstate.c | 1 arch/sparc/mm/hugetlbpage.c | 6 arch/sparc/mm/init_64.c | 1 arch/um/drivers/mconsole_kern.c | 1 arch/um/include/asm/pgalloc.h | 1 arch/um/include/asm/pgtable-2level.h | 1 arch/um/include/asm/pgtable-3level.h | 1 arch/um/kernel/um_arch.c | 1 arch/x86/Kconfig | 17 arch/x86/include/asm/desc.h | 1 arch/x86/include/asm/pgalloc.h | 2 arch/x86/include/asm/pgtable_types.h | 2 arch/x86/kernel/cpu/mshyperv.c | 1 arch/x86/kernel/kprobes/core.c | 6 arch/x86/kernel/setup.c | 1 arch/x86/mm/init_64.c | 21 arch/x86/mm/pgtable.c | 34 arch/x86/purgatory/purgatory.c | 2 arch/x86/xen/enlighten.c | 1 arch/xtensa/include/asm/pgalloc.h | 2 arch/xtensa/include/asm/pgtable.h | 1 arch/xtensa/include/uapi/asm/mman.h | 3 arch/xtensa/platforms/iss/setup.c | 1 drivers/block/zram/zram_drv.h | 2 drivers/bus/brcmstb_gisb.c | 1 drivers/char/ipmi/ipmi_msghandler.c | 1 drivers/clk/analogbits/wrpll-cln28hpc.c | 4 drivers/edac/altera_edac.c | 1 drivers/firmware/google/gsmi.c | 1 drivers/gpu/drm/nouveau/include/nvif/if000c.h | 1 drivers/gpu/drm/nouveau/nouveau_svm.c | 162 ++- drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmm.h | 1 drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmmgp100.c | 6 drivers/hv/vmbus_drv.c | 1 drivers/hwtracing/coresight/coresight-cpu-debug.c | 1 drivers/leds/trigger/ledtrig-activity.c | 1 drivers/leds/trigger/ledtrig-heartbeat.c | 1 drivers/leds/trigger/ledtrig-panic.c | 1 drivers/misc/bcm-vk/bcm_vk_dev.c | 1 drivers/misc/ibmasm/heartbeat.c | 1 drivers/misc/pvpanic/pvpanic.c | 1 drivers/net/ipa/ipa_smp2p.c | 1 drivers/parisc/power.c | 1 drivers/power/reset/ltc2952-poweroff.c | 1 drivers/remoteproc/remoteproc_core.c | 1 drivers/s390/char/con3215.c | 1 drivers/s390/char/con3270.c | 1 drivers/s390/char/sclp.c | 1 drivers/s390/char/sclp_con.c | 1 drivers/s390/char/sclp_vt220.c | 1 drivers/s390/char/zcore.c | 1 drivers/soc/bcm/brcmstb/pm/pm-arm.c | 1 drivers/staging/olpc_dcon/olpc_dcon.c | 1 drivers/video/fbdev/hyperv_fb.c | 1 drivers/virtio/virtio_mem.c | 2 fs/Kconfig | 15 fs/exec.c | 3 fs/hfsplus/inode.c | 5 fs/hfsplus/xattr.c | 1 fs/nfsd/nfs4state.c | 2 fs/nilfs2/btree.c | 1 fs/open.c | 13 fs/proc/base.c | 6 fs/proc/fd.c | 20 fs/proc/kcore.c | 136 ++ fs/proc/task_mmu.c | 34 fs/seq_file.c | 43 fs/userfaultfd.c | 15 include/asm-generic/bug.h | 3 include/linux/ascii85.h | 3 include/linux/bootmem_info.h | 68 + include/linux/compat.h | 2 include/linux/compiler-clang.h | 17 include/linux/compiler-gcc.h | 6 include/linux/compiler_types.h | 2 include/linux/huge_mm.h | 74 - include/linux/hugetlb.h | 80 + include/linux/hugetlb_cgroup.h | 19 include/linux/kcore.h | 3 include/linux/kernel.h | 227 ---- include/linux/kprobes.h | 1 include/linux/kstrtox.h | 155 ++ include/linux/memblock.h | 4 include/linux/memory_hotplug.h | 27 include/linux/mempolicy.h | 9 include/linux/memremap.h | 2 include/linux/migrate.h | 27 include/linux/mm.h | 18 include/linux/mm_types.h | 2 include/linux/mmu_notifier.h | 26 include/linux/mmzone.h | 27 include/linux/mpi.h | 4 include/linux/page-flags.h | 22 include/linux/panic.h | 98 + include/linux/panic_notifier.h | 12 include/linux/pgtable.h | 44 include/linux/rmap.h | 13 include/linux/seq_file.h | 10 include/linux/shmem_fs.h | 19 include/linux/signal.h | 2 include/linux/string.h | 7 include/linux/string_helpers.h | 31 include/linux/sunrpc/cache.h | 1 include/linux/swap.h | 19 include/linux/swapops.h | 171 +-- include/linux/thread_info.h | 1 include/linux/userfaultfd_k.h | 5 include/linux/vmalloc.h | 15 include/linux/zbud.h | 23 include/trace/events/vmscan.h | 41 include/uapi/asm-generic/mman-common.h | 3 include/uapi/linux/mempolicy.h | 1 include/uapi/linux/userfaultfd.h | 7 init/main.c | 42 ipc/msg.c | 6 ipc/sem.c | 25 ipc/shm.c | 6 ipc/util.c | 44 ipc/util.h | 3 kernel/hung_task.c | 1 kernel/kexec_core.c | 1 kernel/kprobes.c | 2 kernel/panic.c | 1 kernel/rcu/tree.c | 2 kernel/signal.c | 14 kernel/sysctl.c | 4 kernel/trace/trace.c | 1 lib/Kconfig.debug | 12 lib/decompress_bunzip2.c | 6 lib/decompress_unlz4.c | 8 lib/decompress_unlzo.c | 3 lib/decompress_unxz.c | 2 lib/decompress_unzstd.c | 4 lib/kstrtox.c | 5 lib/lz4/lz4_decompress.c | 2 lib/math/Makefile | 1 lib/math/rational-test.c | 56 + lib/math/rational.c | 16 lib/mpi/longlong.h | 4 lib/mpi/mpicoder.c | 6 lib/mpi/mpiutil.c | 2 lib/parser.c | 1 lib/string.c | 2 lib/string_helpers.c | 142 +- lib/test-string_helpers.c | 157 ++- lib/test_hmm.c | 127 ++ lib/test_hmm_uapi.h | 2 lib/test_string.c | 5 lib/vsprintf.c | 1 lib/xz/xz_dec_bcj.c | 2 lib/xz/xz_dec_lzma2.c | 8 lib/zlib_inflate/inffast.c | 2 lib/zstd/huf.h | 2 mm/Kconfig | 16 mm/Makefile | 2 mm/bootmem_info.c | 127 ++ mm/compaction.c | 20 mm/debug_vm_pgtable.c | 109 -- mm/gup.c | 58 + mm/hmm.c | 12 mm/huge_memory.c | 269 ++--- mm/hugetlb.c | 369 +++++-- mm/hugetlb_vmemmap.c | 332 ++++++ mm/hugetlb_vmemmap.h | 53 - mm/internal.h | 29 mm/kfence/core.c | 4 mm/khugepaged.c | 20 mm/madvise.c | 66 + mm/mapping_dirty_helpers.c | 2 mm/memblock.c | 28 mm/memcontrol.c | 4 mm/memory-failure.c | 38 mm/memory.c | 239 +++- mm/memory_hotplug.c | 161 --- mm/mempolicy.c | 323 ++---- mm/migrate.c | 268 +---- mm/mlock.c | 12 mm/mmap_lock.c | 59 - mm/mprotect.c | 18 mm/nommu.c | 5 mm/oom_kill.c | 2 mm/page_alloc.c | 5 mm/page_vma_mapped.c | 15 mm/rmap.c | 644 +++++++++--- mm/shmem.c | 125 -- mm/sparse-vmemmap.c | 432 +++++++- mm/sparse.c | 1 mm/swap.c | 2 mm/swapfile.c | 2 mm/userfaultfd.c | 249 ++-- mm/util.c | 40 mm/vmalloc.c | 37 mm/vmscan.c | 20 mm/workingset.c | 10 mm/z3fold.c | 39 mm/zbud.c | 235 ++-- mm/zsmalloc.c | 5 mm/zswap.c | 26 scripts/checkpatch.pl | 16 tools/testing/selftests/vm/.gitignore | 3 tools/testing/selftests/vm/Makefile | 5 tools/testing/selftests/vm/hmm-tests.c | 158 +++ tools/testing/selftests/vm/khugepaged.c | 4 tools/testing/selftests/vm/madv_populate.c | 342 ++++++ tools/testing/selftests/vm/pkey-x86.h | 1 tools/testing/selftests/vm/protection_keys.c | 85 + tools/testing/selftests/vm/run_vmtests.sh | 16 tools/testing/selftests/vm/userfaultfd.c | 1094 ++++++++++----------- 299 files changed, 6277 insertions(+), 3183 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-07-01 1:46 incoming Andrew Morton @ 2021-07-03 0:28 ` Linus Torvalds 2021-07-03 1:06 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2021-07-03 0:28 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Wed, Jun 30, 2021 at 6:46 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > This is the rest of the -mm tree, less 66 patches which are dependent on > things which are (or were recently) in linux-next. I'll trickle that > material over next week. I haven't bisected this yet, but with the current -git I'm getting watchdog: BUG: soft lockup - CPU#41 stuck for 49s! and the common call chain seems to be in flush_tlb_mm_range -> on_each_cpu_cond_mask. Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking at the pulls and merges I've done since, this -mm series looks like the obvious culprit. I'll go start bisection, but I thought I'd give a heads-up in case somebody else has seen TLB-flush-related lockups and already figured out the guilty party.. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-07-03 0:28 ` incoming Linus Torvalds @ 2021-07-03 1:06 ` Linus Torvalds 0 siblings, 0 replies; 348+ messages in thread From: Linus Torvalds @ 2021-07-03 1:06 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Fri, Jul 2, 2021 at 5:28 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking > at the pulls and merges I've done since, this -mm series looks like > the obvious culprit. No, unless my bisection is wrong, the -mm branch is innocent, and was discarded from the suspects on the very first bisection trial. So never mind. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-06-29 2:32 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-06-29 2:32 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2. Subsystems affected by this patch series: mm/gup mm/pagealloc kthread ia64 scripts ntfs squashfs ocfs2 z kernel/watchdog mm/slab mm/slub mm/kmemleak mm/dax mm/debug mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/mprotect mm/bootmem mm/dma mm/tracing mm/vmalloc mm/kasan mm/initialization mm/pagealloc mm/memory-failure Subsystem: mm/gup Jann Horn <jannh@google.com>: mm/gup: fix try_grab_compound_head() race with split_huge_page() Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: mm/page_alloc: fix memory map initialization for descending nodes Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: correct return value of populated elements if bulk array is populated Subsystem: kthread Jonathan Neuschäfer <j.neuschaefer@gmx.net>: kthread: switch to new kerneldoc syntax for named variable macro argument Petr Mladek <pmladek@suse.com>: kthread_worker: fix return value when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync() Subsystem: ia64 Randy Dunlap <rdunlap@infradead.org>: ia64: headers: drop duplicated words Arnd Bergmann <arnd@arndb.de>: ia64: mca_drv: fix incorrect array size calculation Subsystem: scripts "Steven Rostedt (VMware)" <rostedt@goodmis.org>: Patch series "streamline_config.pl: Fix Perl spacing": streamline_config.pl: make spacing consistent streamline_config.pl: add softtabstop=4 for vim users Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ntfs Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>: ntfs: fix validity check for file name attribute Subsystem: squashfs Vincent Whitchurch <vincent.whitchurch@axis.com>: squashfs: add option to panic on errors Subsystem: ocfs2 Yang Yingliang <yangyingliang@huawei.com>: ocfs2: remove unnecessary INIT_LIST_HEAD() Subsystem: z Dan Carpenter <dan.carpenter@oracle.com>: ocfs2: fix snprintf() checking Colin Ian King <colin.king@canonical.com>: ocfs2: remove redundant assignment to pointer queue Wan Jiabing <wanjiabing@vivo.com>: ocfs2: remove repeated uptodate check for buffer Chen Huang <chenhuang5@huawei.com>: ocfs2: replace simple_strtoull() with kstrtoull() Colin Ian King <colin.king@canonical.com>: ocfs2: remove redundant initialization of variable ret Subsystem: kernel/watchdog Wang Qing <wangqing@vivo.com>: kernel: watchdog: modify the explanation related to watchdog thread doc: watchdog: modify the explanation related to watchdog thread doc: watchdog: modify the doc related to "watchdog/%u" Subsystem: mm/slab gumingtao <gumingtao1225@gmail.com>: slab: use __func__ to trace function name Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: kunit: make test->lock irq safe Oliver Glitta <glittao@gmail.com>: mm/slub, kunit: add a KUnit test for SLUB debugging functionality slub: remove resiliency_test() function Hyeonggon Yoo <42.hyeyoo@gmail.com>: mm, slub: change run-time assertion in kmalloc_index() to compile-time Stephen Boyd <swboyd@chromium.org>: slub: restore slub_debug=- behavior slub: actually use 'message' in restore_bytes() Joe Perches <joe@perches.com>: slub: indicate slab_fix() uses printf formats Stephen Boyd <swboyd@chromium.org>: slub: force on no_hash_pointers when slub_debug is enabled Faiyaz Mohammed <faiyazm@codeaurora.org>: mm: slub: move sysfs slab alloc/free interfaces to debugfs Georgi Djakov <quic_c_gdjako@quicinc.com>: mm/slub: add taint after the errors are printed Subsystem: mm/kmemleak Yanfei Xu <yanfei.xu@windriver.com>: mm/kmemleak: fix possible wrong memory scanning period Subsystem: mm/dax Jan Kara <jack@suse.cz>: dax: fix ENOMEM handling in grab_mapping_entry() Subsystem: mm/debug Tang Bin <tangbin@cmss.chinamobile.com>: tools/vm/page_owner_sort.c: check malloc() return Anshuman Khandual <anshuman.khandual@arm.com>: mm/debug_vm_pgtable: ensure THP availability via has_transparent_hugepage() Nicolas Saenz Julienne <nsaenzju@redhat.com>: mm: mmap_lock: use local locks instead of disabling preemption Gavin Shan <gshan@redhat.com>: Patch series "mm/page_reporting: Make page reporting work on arm64 with 64KB page size", v4: mm/page_reporting: fix code style in __page_reporting_request() mm/page_reporting: export reporting order as module parameter mm/page_reporting: allow driver to specify reporting order virtio_balloon: specify page reporting order if needed Subsystem: mm/pagecache Kefeng Wang <wangkefeng.wang@huawei.com>: mm: page-writeback: kill get_writeback_state() comments Chi Wu <wuchi.zero@gmail.com>: mm/page-writeback: Fix performance when BDI's share of ratio is 0. mm/page-writeback: update the comment of Dirty position control mm/page-writeback: use __this_cpu_inc() in account_page_dirtied() Roman Gushchin <guro@fb.com>: Patch series "cgroup, blkcg: prevent dirty inodes to pin dying memory cgroups", v9: writeback, cgroup: do not switch inodes with I_WILL_FREE flag writeback, cgroup: add smp_mb() to cgroup_writeback_umount() writeback, cgroup: increment isw_nr_in_flight before grabbing an inode writeback, cgroup: switch to rcu_work API in inode_switch_wbs() writeback, cgroup: keep list of inodes attached to bdi_writeback writeback, cgroup: split out the functional part of inode_switch_wbs_work_fn() writeback, cgroup: support switching multiple inodes at once writeback, cgroup: release dying cgwbs by switching attached inodes Christoph Hellwig <hch@lst.de>: Patch series "remove the implicit .set_page_dirty default": fs: unexport __set_page_dirty fs: move ramfs_aops to libfs mm: require ->set_page_dirty to be explicitly wired up "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Further set_page_dirty cleanups": mm/writeback: move __set_page_dirty() to core mm mm/writeback: use __set_page_dirty in __set_page_dirty_nobuffers iomap: use __set_page_dirty_nobuffers fs: remove anon_set_page_dirty() fs: remove noop_set_page_dirty() mm: move page dirtying prototypes from mm.h Subsystem: mm/gup Peter Xu <peterx@redhat.com>: Patch series "mm/gup: Fix pin page write cache bouncing on has_pinned", v2: mm/gup_benchmark: support threading Andrea Arcangeli <aarcange@redhat.com>: mm: gup: allow FOLL_PIN to scale in SMP mm: gup: pack has_pinned in MMF_HAS_PINNED Christophe Leroy <christophe.leroy@csgroup.eu>: mm: pagewalk: fix walk for hugepage tables Subsystem: mm/swap Miaohe Lin <linmiaohe@huawei.com>: Patch series "close various race windows for swap", v6: mm/swapfile: use percpu_ref to serialize against concurrent swapoff swap: fix do_swap_page() race with swapoff mm/swap: remove confusing checking for non_swap_entry() in swap_ra_info() mm/shmem: fix shmem_swapin() race with swapoff Patch series "Cleanups for swap", v2: mm/swapfile: move get_swap_page_of_type() under CONFIG_HIBERNATION mm/swap: remove unused local variable nr_shadows mm/swap_slots.c: delete meaningless forward declarations Huang Ying <ying.huang@intel.com>: mm, swap: remove unnecessary smp_rmb() in swap_type_to_swap_info() mm: free idle swap cache page after COW swap: check mapping_empty() for swap cache before being freed Subsystem: mm/memcg Waiman Long <longman@redhat.com>: Patch series "mm/memcg: Reduce kmemcache memory accounting overhead", v6: mm/memcg: move mod_objcg_state() to memcontrol.c mm/memcg: cache vmstat data in percpu memcg_stock_pcp mm/memcg: improve refill_obj_stock() performance mm/memcg: optimize user context object stock access Patch series "mm: memcg/slab: Fix objcg pointer array handling problem", v4: mm: memcg/slab: properly set up gfp flags for objcg pointer array mm: memcg/slab: create a new set of kmalloc-cg-<n> caches mm: memcg/slab: disable cache merging for KMALLOC_NORMAL caches Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: fix root_mem_cgroup charging Patch series "memcontrol code cleanup and simplification", v3: mm: memcontrol: fix page charging in page replacement mm: memcontrol: bail out early when !mm in get_mem_cgroup_from_mm mm: memcontrol: remove the pgdata parameter of mem_cgroup_page_lruvec mm: memcontrol: simplify lruvec_holds_page_lru_lock mm: memcontrol: rename lruvec_holds_page_lru_lock to page_matches_lruvec mm: memcontrol: simplify the logic of objcg pinning memcg mm: memcontrol: move obj_cgroup_uncharge_pages() out of css_set_lock mm: vmscan: remove noinline_for_stack wenhuizhang <wenhui@gwmail.gwu.edu>: memcontrol: use flexible-array member Dan Schatzberg <schatzberg.dan@gmail.com>: Patch series "Charge loop device i/o to issuing cgroup", v14: loop: use worker per cgroup instead of kworker mm: charge active memcg when no mm is set loop: charge i/o to mem and blk cg Huilong Deng <denghuilong@cdjrlc.com>: mm: memcontrol: remove trailing semicolon in macros Subsystem: mm/pagemap David Hildenbrand <david@redhat.com>: Patch series "perf/binfmt/mm: remove in-tree usage of MAP_EXECUTABLE": perf: MAP_EXECUTABLE does not indicate VM_MAYEXEC binfmt: remove in-tree usage of MAP_EXECUTABLE mm: ignore MAP_EXECUTABLE in ksys_mmap_pgoff() Gonzalo Matias Juarez Tello <gmjuareztello@gmail.com>: mm/mmap.c: logic of find_vma_intersection repeated in __do_munmap Liam Howlett <liam.howlett@oracle.com>: mm/mmap: introduce unlock_range() for code cleanup mm/mmap: use find_vma_intersection() in do_mmap() for overlap Liu Xiang <liu.xiang@zlingsmart.com>: mm/memory.c: fix comment of finish_mkwrite_fault() Liam Howlett <liam.howlett@oracle.com>: Patch series "mm: Add vma_lookup()", v2: mm: add vma_lookup(), update find_vma_intersection() comments drm/i915/selftests: use vma_lookup() in __igt_mmap() arch/arc/kernel/troubleshoot: use vma_lookup() instead of find_vma() arch/arm64/kvm: use vma_lookup() instead of find_vma_intersection() arch/powerpc/kvm/book3s_hv_uvmem: use vma_lookup() instead of find_vma_intersection() arch/powerpc/kvm/book3s: use vma_lookup() in kvmppc_hv_setup_htab_rma() arch/mips/kernel/traps: use vma_lookup() instead of find_vma() arch/m68k/kernel/sys_m68k: use vma_lookup() in sys_cacheflush() x86/sgx: use vma_lookup() in sgx_encl_find() virt/kvm: use vma_lookup() instead of find_vma_intersection() vfio: use vma_lookup() instead of find_vma_intersection() net/ipv5/tcp: use vma_lookup() in tcp_zerocopy_receive() drm/amdgpu: use vma_lookup() in amdgpu_ttm_tt_get_user_pages() media: videobuf2: use vma_lookup() in get_vaddr_frames() misc/sgi-gru/grufault: use vma_lookup() in gru_find_vma() kernel/events/uprobes: use vma_lookup() in find_active_uprobe() lib/test_hmm: use vma_lookup() in dmirror_migrate() mm/ksm: use vma_lookup() in find_mergeable_vma() mm/migrate: use vma_lookup() in do_pages_stat_array() mm/mremap: use vma_lookup() in vma_to_resize() mm/memory.c: use vma_lookup() in __access_remote_vm() mm/mempolicy: use vma_lookup() in __access_remote_vm() Chen Li <chenli@uniontech.com>: mm: update legacy flush_tlb_* to use vma Subsystem: mm/mprotect Peter Collingbourne <pcc@google.com>: mm: improve mprotect(R|W) efficiency on pages referenced once Subsystem: mm/bootmem Souptick Joarder <jrdr.linux@gmail.com>: h8300: remove unused variable Subsystem: mm/dma YueHaibing <yuehaibing@huawei.com>: mm/dmapool: use DEVICE_ATTR_RO macro Subsystem: mm/tracing Vincent Whitchurch <vincent.whitchurch@axis.com>: mm, tracing: unify PFN format strings Subsystem: mm/vmalloc "Uladzislau Rezki (Sony)" <urezki@gmail.com>: Patch series "vmalloc() vs bulk allocator", v2: mm/page_alloc: add an alloc_pages_bulk_array_node() helper mm/vmalloc: switch to bulk allocator in __vmalloc_area_node() mm/vmalloc: print a warning message first on failure mm/vmalloc: remove quoted strings split across lines Uladzislau Rezki <urezki@gmail.com>: mm/vmalloc: fallback to a single page allocator Rafael Aquini <aquini@redhat.com>: mm: vmalloc: add cond_resched() in __vunmap() Subsystem: mm/kasan Alexander Potapenko <glider@google.com>: printk: introduce dump_stack_lvl() kasan: use dump_stack_lvl(KERN_ERR) to print stacks David Gow <davidgow@google.com>: kasan: test: improve failure message in KUNIT_EXPECT_KASAN_FAIL() Daniel Axtens <dja@axtens.net>: Patch series "KASAN core changes for ppc64 radix KASAN", v16: kasan: allow an architecture to disable inline instrumentation kasan: allow architectures to provide an outline readiness check mm: define default MAX_PTRS_PER_* in include/pgtable.h kasan: use MAX_PTRS_PER_* for early shadow tables Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: Patch series "kasan: add memory corruption identification support for hw tag-based kasan", v4: kasan: rename CONFIG_KASAN_SW_TAGS_IDENTIFY to CONFIG_KASAN_TAGS_IDENTIFY kasan: integrate the common part of two KASAN tag-based modes kasan: add memory corruption identification support for hardware tag-based mode Subsystem: mm/initialization Jungseung Lee <js07.lee@samsung.com>: mm: report which part of mem is being freed on initmem case Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: mm/mmzone.h: simplify is_highmem_idx() "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Constify struct page arguments": mm: make __dump_page static Aaron Tomlin <atomlin@redhat.com>: mm/page_alloc: bail out on fatal signal during reclaim/compaction retry attempt "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/debug: factor PagePoisoned out of __dump_page mm/page_owner: constify dump_page_owner mm: make compound_head const-preserving mm: constify get_pfnblock_flags_mask and get_pfnblock_migratetype mm: constify page_count and page_ref_count mm: optimise nth_page for contiguous memmap Heiner Kallweit <hkallweit1@gmail.com>: mm/page_alloc: switch to pr_debug Andrii Nakryiko <andrii@kernel.org>: kbuild: skip per-CPU BTF generation for pahole v1.18-v1.21 Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: split per cpu page lists and zone stats mm/page_alloc: convert per-cpu list protection to local_lock mm/vmstat: convert NUMA statistics to basic NUMA counters mm/vmstat: inline NUMA event counter updates mm/page_alloc: batch the accounting updates in the bulk allocator mm/page_alloc: reduce duration that IRQs are disabled for VM counters mm/page_alloc: explicitly acquire the zone lock in __free_pages_ok mm/page_alloc: avoid conflating IRQs disabled with zone->lock mm/page_alloc: update PGFREE outside the zone lock in __free_pages_ok Minchan Kim <minchan@kernel.org>: mm: page_alloc: dump migrate-failed pages only at -EBUSY Mel Gorman <mgorman@techsingularity.net>: Patch series "Calculate pcp->high based on zone sizes and active CPUs", v2: mm/page_alloc: delete vm.percpu_pagelist_fraction mm/page_alloc: disassociate the pcp->high from pcp->batch mm/page_alloc: adjust pcp->high after CPU hotplug events mm/page_alloc: scale the number of pages that are batch freed mm/page_alloc: limit the number of pages on PCP lists when reclaim is active mm/page_alloc: introduce vm.percpu_pagelist_high_fraction Dong Aisheng <aisheng.dong@nxp.com>: mm: drop SECTION_SHIFT in code comments mm/page_alloc: improve memmap_pages dbg msg Liu Shixin <liushixin2@huawei.com>: mm/page_alloc: fix counting of managed_pages Mel Gorman <mgorman@techsingularity.net>: Patch series "Allow high order pages to be stored on PCP", v2: mm/page_alloc: move free_the_page Mike Rapoport <rppt@linux.ibm.com>: Patch series "Remove DISCONTIGMEM memory model", v3: alpha: remove DISCONTIGMEM and NUMA arc: update comment about HIGHMEM implementation arc: remove support for DISCONTIGMEM m68k: remove support for DISCONTIGMEM mm: remove CONFIG_DISCONTIGMEM arch, mm: remove stale mentions of DISCONIGMEM docs: remove description of DISCONTIGMEM mm: replace CONFIG_NEED_MULTIPLE_NODES with CONFIG_NUMA mm: replace CONFIG_FLAT_NODE_MEM_MAP with CONFIG_FLATMEM Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: allow high-order pages to be stored on the per-cpu lists mm/page_alloc: split pcp->high across all online CPUs for cpuless nodes Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm,hwpoison: send SIGBUS with error virutal address mm,hwpoison: make get_hwpoison_page() call get_any_page() Documentation/admin-guide/kernel-parameters.txt | 6 Documentation/admin-guide/lockup-watchdogs.rst | 4 Documentation/admin-guide/sysctl/kernel.rst | 10 Documentation/admin-guide/sysctl/vm.rst | 52 - Documentation/dev-tools/kasan.rst | 9 Documentation/vm/memory-model.rst | 45 arch/alpha/Kconfig | 22 arch/alpha/include/asm/machvec.h | 6 arch/alpha/include/asm/mmzone.h | 100 -- arch/alpha/include/asm/pgtable.h | 4 arch/alpha/include/asm/topology.h | 39 arch/alpha/kernel/core_marvel.c | 53 - arch/alpha/kernel/core_wildfire.c | 29 arch/alpha/kernel/pci_iommu.c | 29 arch/alpha/kernel/proto.h | 8 arch/alpha/kernel/setup.c | 16 arch/alpha/kernel/sys_marvel.c | 5 arch/alpha/kernel/sys_wildfire.c | 5 arch/alpha/mm/Makefile | 2 arch/alpha/mm/init.c | 3 arch/alpha/mm/numa.c | 223 ---- arch/arc/Kconfig | 13 arch/arc/include/asm/mmzone.h | 40 arch/arc/kernel/troubleshoot.c | 8 arch/arc/mm/init.c | 21 arch/arm/include/asm/tlbflush.h | 13 arch/arm/mm/tlb-v6.S | 2 arch/arm/mm/tlb-v7.S | 2 arch/arm64/Kconfig | 2 arch/arm64/kvm/mmu.c | 2 arch/h8300/kernel/setup.c | 2 arch/ia64/Kconfig | 2 arch/ia64/include/asm/pal.h | 2 arch/ia64/include/asm/spinlock.h | 2 arch/ia64/include/asm/uv/uv_hub.h | 2 arch/ia64/kernel/efi_stub.S | 2 arch/ia64/kernel/mca_drv.c | 2 arch/ia64/kernel/topology.c | 5 arch/ia64/mm/numa.c | 5 arch/m68k/Kconfig.cpu | 10 arch/m68k/include/asm/mmzone.h | 10 arch/m68k/include/asm/page.h | 2 arch/m68k/include/asm/page_mm.h | 35 arch/m68k/include/asm/tlbflush.h | 2 arch/m68k/kernel/sys_m68k.c | 4 arch/m68k/mm/init.c | 20 arch/mips/Kconfig | 2 arch/mips/include/asm/mmzone.h | 8 arch/mips/include/asm/page.h | 2 arch/mips/kernel/traps.c | 4 arch/mips/mm/init.c | 7 arch/nds32/include/asm/memory.h | 6 arch/openrisc/include/asm/tlbflush.h | 2 arch/powerpc/Kconfig | 2 arch/powerpc/include/asm/mmzone.h | 4 arch/powerpc/kernel/setup_64.c | 2 arch/powerpc/kernel/smp.c | 2 arch/powerpc/kexec/core.c | 4 arch/powerpc/kvm/book3s_hv.c | 4 arch/powerpc/kvm/book3s_hv_uvmem.c | 2 arch/powerpc/mm/Makefile | 2 arch/powerpc/mm/mem.c | 4 arch/riscv/Kconfig | 2 arch/s390/Kconfig | 2 arch/s390/include/asm/pgtable.h | 2 arch/sh/include/asm/mmzone.h | 4 arch/sh/kernel/topology.c | 2 arch/sh/mm/Kconfig | 2 arch/sh/mm/init.c | 2 arch/sparc/Kconfig | 2 arch/sparc/include/asm/mmzone.h | 4 arch/sparc/kernel/smp_64.c | 2 arch/sparc/mm/init_64.c | 12 arch/x86/Kconfig | 2 arch/x86/ia32/ia32_aout.c | 4 arch/x86/kernel/cpu/mce/core.c | 13 arch/x86/kernel/cpu/sgx/encl.h | 4 arch/x86/kernel/setup_percpu.c | 6 arch/x86/mm/init_32.c | 4 arch/xtensa/include/asm/page.h | 4 arch/xtensa/include/asm/tlbflush.h | 4 drivers/base/node.c | 18 drivers/block/loop.c | 270 ++++- drivers/block/loop.h | 15 drivers/dax/device.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c | 4 drivers/gpu/drm/i915/gem/selftests/i915_gem_mman.c | 2 drivers/media/common/videobuf2/frame_vector.c | 2 drivers/misc/sgi-gru/grufault.c | 4 drivers/vfio/vfio_iommu_type1.c | 2 drivers/virtio/virtio_balloon.c | 17 fs/adfs/inode.c | 1 fs/affs/file.c | 2 fs/bfs/file.c | 1 fs/binfmt_aout.c | 4 fs/binfmt_elf.c | 2 fs/binfmt_elf_fdpic.c | 11 fs/binfmt_flat.c | 2 fs/block_dev.c | 1 fs/buffer.c | 25 fs/configfs/inode.c | 8 fs/dax.c | 3 fs/ecryptfs/mmap.c | 13 fs/exfat/inode.c | 1 fs/ext2/inode.c | 4 fs/ext4/inode.c | 2 fs/fat/inode.c | 1 fs/fs-writeback.c | 366 +++++--- fs/fuse/dax.c | 3 fs/gfs2/aops.c | 2 fs/gfs2/meta_io.c | 2 fs/hfs/inode.c | 2 fs/hfsplus/inode.c | 2 fs/hpfs/file.c | 1 fs/iomap/buffered-io.c | 27 fs/jfs/inode.c | 1 fs/kernfs/inode.c | 8 fs/libfs.c | 44 fs/minix/inode.c | 1 fs/nilfs2/mdt.c | 1 fs/ntfs/inode.c | 2 fs/ocfs2/aops.c | 4 fs/ocfs2/cluster/heartbeat.c | 7 fs/ocfs2/cluster/nodemanager.c | 2 fs/ocfs2/dlm/dlmmaster.c | 2 fs/ocfs2/filecheck.c | 6 fs/ocfs2/stackglue.c | 8 fs/omfs/file.c | 1 fs/proc/task_mmu.c | 2 fs/ramfs/inode.c | 9 fs/squashfs/block.c | 5 fs/squashfs/squashfs_fs_sb.h | 1 fs/squashfs/super.c | 86 + fs/sysv/itree.c | 1 fs/udf/file.c | 1 fs/udf/inode.c | 1 fs/ufs/inode.c | 1 fs/xfs/xfs_aops.c | 4 fs/zonefs/super.c | 4 include/asm-generic/memory_model.h | 37 include/asm-generic/pgtable-nop4d.h | 1 include/asm-generic/topology.h | 2 include/kunit/test.h | 5 include/linux/backing-dev-defs.h | 20 include/linux/cpuhotplug.h | 2 include/linux/fs.h | 6 include/linux/gfp.h | 13 include/linux/iomap.h | 1 include/linux/kasan.h | 7 include/linux/kernel.h | 2 include/linux/kthread.h | 2 include/linux/memblock.h | 6 include/linux/memcontrol.h | 60 - include/linux/mm.h | 53 - include/linux/mm_types.h | 10 include/linux/mman.h | 2 include/linux/mmdebug.h | 3 include/linux/mmzone.h | 96 +- include/linux/page-flags.h | 10 include/linux/page_owner.h | 6 include/linux/page_ref.h | 4 include/linux/page_reporting.h | 3 include/linux/pageblock-flags.h | 2 include/linux/pagemap.h | 4 include/linux/pgtable.h | 22 include/linux/printk.h | 5 include/linux/sched/coredump.h | 8 include/linux/slab.h | 59 + include/linux/swap.h | 19 include/linux/swapops.h | 5 include/linux/vmstat.h | 69 - include/linux/writeback.h | 1 include/trace/events/cma.h | 4 include/trace/events/filemap.h | 2 include/trace/events/kmem.h | 12 include/trace/events/page_pool.h | 4 include/trace/events/pagemap.h | 4 include/trace/events/vmscan.h | 2 kernel/cgroup/cgroup.c | 1 kernel/crash_core.c | 4 kernel/events/core.c | 2 kernel/events/uprobes.c | 4 kernel/fork.c | 1 kernel/kthread.c | 19 kernel/sysctl.c | 16 kernel/watchdog.c | 12 lib/Kconfig.debug | 15 lib/Kconfig.kasan | 16 lib/Makefile | 1 lib/dump_stack.c | 20 lib/kunit/test.c | 18 lib/slub_kunit.c | 152 +++ lib/test_hmm.c | 5 lib/test_kasan.c | 11 lib/vsprintf.c | 2 mm/Kconfig | 38 mm/backing-dev.c | 66 + mm/compaction.c | 2 mm/debug.c | 27 mm/debug_vm_pgtable.c | 63 + mm/dmapool.c | 5 mm/filemap.c | 2 mm/gup.c | 81 + mm/hugetlb.c | 2 mm/internal.h | 9 mm/kasan/Makefile | 4 mm/kasan/common.c | 6 mm/kasan/generic.c | 3 mm/kasan/hw_tags.c | 22 mm/kasan/init.c | 6 mm/kasan/kasan.h | 12 mm/kasan/report.c | 6 mm/kasan/report_hw_tags.c | 5 mm/kasan/report_sw_tags.c | 45 mm/kasan/report_tags.c | 51 + mm/kasan/shadow.c | 6 mm/kasan/sw_tags.c | 45 mm/kasan/tags.c | 59 + mm/kfence/kfence_test.c | 5 mm/kmemleak.c | 18 mm/ksm.c | 6 mm/memblock.c | 8 mm/memcontrol.c | 385 ++++++-- mm/memory-failure.c | 344 +++++-- mm/memory.c | 22 mm/memory_hotplug.c | 6 mm/mempolicy.c | 4 mm/migrate.c | 4 mm/mmap.c | 54 - mm/mmap_lock.c | 33 mm/mprotect.c | 52 + mm/mremap.c | 5 mm/nommu.c | 2 mm/page-writeback.c | 89 + mm/page_alloc.c | 950 +++++++++++++-------- mm/page_ext.c | 2 mm/page_owner.c | 2 mm/page_reporting.c | 19 mm/page_reporting.h | 5 mm/pagewalk.c | 58 + mm/shmem.c | 18 mm/slab.h | 24 mm/slab_common.c | 60 - mm/slub.c | 420 +++++---- mm/sparse.c | 2 mm/swap.c | 4 mm/swap_slots.c | 2 mm/swap_state.c | 20 mm/swapfile.c | 177 +-- mm/vmalloc.c | 181 ++-- mm/vmscan.c | 43 mm/vmstat.c | 282 ++---- mm/workingset.c | 2 net/ipv4/tcp.c | 4 scripts/kconfig/streamline_config.pl | 76 - scripts/link-vmlinux.sh | 4 scripts/spelling.txt | 16 tools/testing/selftests/vm/gup_test.c | 96 +- tools/vm/page_owner_sort.c | 4 virt/kvm/kvm_main.c | 2 260 files changed, 3989 insertions(+), 2996 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-06-25 1:38 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-06-25 1:38 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 24 patches, based on 4a09d388f2ab382f217a764e6a152b3f614246f6. Subsystems affected by this patch series: mm/thp nilfs2 mm/vmalloc kthread mm/hugetlb mm/memory-failure mm/pagealloc MAINTAINERS mailmap Subsystem: mm/thp Hugh Dickins <hughd@google.com>: Patch series "mm: page_vma_mapped_walk() cleanup and THP fixes": mm: page_vma_mapped_walk(): use page for pvmw->page mm: page_vma_mapped_walk(): settle PageHuge on entry mm: page_vma_mapped_walk(): use pmde for *pvmw->pmd mm: page_vma_mapped_walk(): prettify PVMW_MIGRATION block mm: page_vma_mapped_walk(): crossing page table boundary mm: page_vma_mapped_walk(): add a level of indentation mm: page_vma_mapped_walk(): use goto instead of while (1) mm: page_vma_mapped_walk(): get vma_address_end() earlier mm/thp: fix page_vma_mapped_walk() if THP mapped by ptes mm/thp: another PVMW_SYNC fix in page_vma_mapped_walk() Subsystem: nilfs2 Pavel Skripkin <paskripkin@gmail.com>: nilfs2: fix memory leak in nilfs_sysfs_delete_device_group Subsystem: mm/vmalloc Claudio Imbrenda <imbrenda@linux.ibm.com>: Patch series "mm: add vmalloc_no_huge and use it", v4: mm/vmalloc: add vmalloc_no_huge KVM: s390: prepare for hugepage vmalloc Daniel Axtens <dja@axtens.net>: mm/vmalloc: unbreak kasan vmalloc support Subsystem: kthread Petr Mladek <pmladek@suse.com>: Patch series "kthread_worker: Fix race between kthread_mod_delayed_work(): kthread_worker: split code for canceling the delayed work timer kthread: prevent deadlock when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync() Subsystem: mm/hugetlb Hugh Dickins <hughd@google.com>: mm, futex: fix shared futex pgoff on shmem huge page Subsystem: mm/memory-failure Tony Luck <tony.luck@intel.com>: Patch series "mm,hwpoison: fix sending SIGBUS for Action Required MCE", v5: mm/memory-failure: use a mutex to avoid memory_failure() races Aili Yao <yaoaili@kingsoft.com>: mm,hwpoison: return -EHWPOISON to denote that the page has already been poisoned Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/hwpoison: do not lock page again when me_huge_page() successfully recovers Subsystem: mm/pagealloc Rasmus Villemoes <linux@rasmusvillemoes.dk>: mm/page_alloc: __alloc_pages_bulk(): do bounds check before accessing array Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: do bulk array bounds check after checking populated elements Subsystem: MAINTAINERS Marek Behún <kabel@kernel.org>: MAINTAINERS: fix Marek's identity again Subsystem: mailmap Marek Behún <kabel@kernel.org>: mailmap: add Marek's other e-mail address and identity without diacritics .mailmap | 2 MAINTAINERS | 4 arch/s390/kvm/pv.c | 7 + fs/nilfs2/sysfs.c | 1 include/linux/hugetlb.h | 16 --- include/linux/pagemap.h | 13 +- include/linux/vmalloc.h | 1 kernel/futex.c | 3 kernel/kthread.c | 81 ++++++++++------ mm/hugetlb.c | 5 - mm/memory-failure.c | 83 +++++++++++------ mm/page_alloc.c | 6 + mm/page_vma_mapped.c | 233 +++++++++++++++++++++++++++--------------------- mm/vmalloc.c | 41 ++++++-- 14 files changed, 297 insertions(+), 199 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-06-16 1:22 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-06-16 1:22 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 18 patches, based on 94f0b2d4a1d0c52035aef425da5e022bd2cb1c71. Subsystems affected by this patch series: mm/memory-failure mm/swap mm/slub mm/hugetlb mm/memory-failure coredump mm/slub mm/thp mm/sparsemem Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm,hwpoison: fix race with hugetlb page allocation Subsystem: mm/swap Peter Xu <peterx@redhat.com>: mm/swap: fix pte_same_as_swp() not removing uffd-wp bit when compare Subsystem: mm/slub Kees Cook <keescook@chromium.org>: Patch series "Actually fix freelist pointer vs redzoning", v4: mm/slub: clarify verification reporting mm/slub: fix redzoning for small allocations mm/slub: actually fix freelist pointer vs redzoning Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: mm/hugetlb: expand restore_reserve_on_error functionality Subsystem: mm/memory-failure yangerkun <yangerkun@huawei.com>: mm/memory-failure: make sure wait for page writeback in memory_failure Subsystem: coredump Pingfan Liu <kernelfans@gmail.com>: crash_core, vmcoreinfo: append 'SECTION_SIZE_BITS' to vmcoreinfo Subsystem: mm/slub Andrew Morton <akpm@linux-foundation.org>: mm/slub.c: include swab.h Subsystem: mm/thp Xu Yu <xuyu@linux.alibaba.com>: mm, thp: use head page in __migration_entry_wait() Hugh Dickins <hughd@google.com>: Patch series "mm/thp: fix THP splitting unmap BUGs and related", v10: mm/thp: fix __split_huge_pmd_locked() on shmem migration entry mm/thp: make is_huge_zero_pmd() safe and quicker mm/thp: try_to_unmap() use TTU_SYNC for safe splitting mm/thp: fix vma_address() if virtual address below file offset Jue Wang <juew@google.com>: mm/thp: fix page_address_in_vma() on file THP tails Hugh Dickins <hughd@google.com>: mm/thp: unmap_mapping_page() to fix THP truncate_cleanup_page() Yang Shi <shy828301@gmail.com>: mm: thp: replace DEBUG_VM BUG with VM_WARN when unmap fails for split Subsystem: mm/sparsemem Miles Chen <miles.chen@mediatek.com>: mm/sparse: fix check_usemap_section_nr warnings Documentation/vm/slub.rst | 10 +-- fs/hugetlbfs/inode.c | 1 include/linux/huge_mm.h | 8 ++ include/linux/hugetlb.h | 8 ++ include/linux/mm.h | 3 + include/linux/rmap.h | 1 include/linux/swapops.h | 15 +++-- kernel/crash_core.c | 1 mm/huge_memory.c | 58 ++++++++++--------- mm/hugetlb.c | 137 +++++++++++++++++++++++++++++++++++++--------- mm/internal.h | 51 ++++++++++++----- mm/memory-failure.c | 36 +++++++++++- mm/memory.c | 41 +++++++++++++ mm/migrate.c | 1 mm/page_vma_mapped.c | 27 +++++---- mm/pgtable-generic.c | 5 - mm/rmap.c | 41 +++++++++---- mm/slab_common.c | 3 - mm/slub.c | 37 +++++------- mm/sparse.c | 13 +++- mm/swapfile.c | 2 mm/truncate.c | 43 ++++++-------- 22 files changed, 388 insertions(+), 154 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-06-05 3:00 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-06-05 3:00 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 13 patches, based on 16f0596fc1d78a1f3ae4628cff962bb297dc908c. Subsystems affected by this patch series: mips mm/kfence init mm/debug mm/pagealloc mm/memory-hotplug mm/hugetlb proc mm/kasan mm/hugetlb lib ocfs2 mailmap Subsystem: mips Thomas Bogendoerfer <tsbogend@alpha.franken.de>: Revert "MIPS: make userspace mapping young by default" Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: use TASK_IDLE when awaiting allocation Subsystem: init Mark Rutland <mark.rutland@arm.com>: pid: take a reference when initializing `cad_pid` Subsystem: mm/debug Gerald Schaefer <gerald.schaefer@linux.ibm.com>: mm/debug_vm_pgtable: fix alignment for pmd/pud_advanced_tests() Subsystem: mm/pagealloc Ding Hui <dinghui@sangfor.com.cn>: mm/page_alloc: fix counting of free pages after take off from buddy Subsystem: mm/memory-hotplug David Hildenbrand <david@redhat.com>: drivers/base/memory: fix trying offlining memory blocks with memory holes on aarch64 Subsystem: mm/hugetlb Naoya Horiguchi <naoya.horiguchi@nec.com>: hugetlb: pass head page to remove_hugetlb_page() Subsystem: proc David Matlack <dmatlack@google.com>: proc: add .gitignore for proc-subset-pid selftest Subsystem: mm/kasan Yu Kuai <yukuai3@huawei.com>: mm/kasan/init.c: fix doc warning Subsystem: mm/hugetlb Mina Almasry <almasrymina@google.com>: mm, hugetlb: fix simple resv_huge_pages underflow on UFFDIO_COPY Subsystem: lib YueHaibing <yuehaibing@huawei.com>: lib: crc64: fix kernel-doc warning Subsystem: ocfs2 Junxiao Bi <junxiao.bi@oracle.com>: ocfs2: fix data corruption by fallocate Subsystem: mailmap Michel Lespinasse <michel@lespinasse.org>: mailmap: use private address for Michel Lespinasse .mailmap | 3 + arch/mips/mm/cache.c | 30 ++++++++--------- drivers/base/memory.c | 6 +-- fs/ocfs2/file.c | 55 +++++++++++++++++++++++++++++--- include/linux/pgtable.h | 8 ++++ init/main.c | 2 - lib/crc64.c | 2 - mm/debug_vm_pgtable.c | 4 +- mm/hugetlb.c | 16 +++++++-- mm/kasan/init.c | 4 +- mm/kfence/core.c | 6 +-- mm/memory.c | 4 ++ mm/page_alloc.c | 2 + tools/testing/selftests/proc/.gitignore | 1 14 files changed, 107 insertions(+), 36 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-05-23 0:41 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-23 0:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 10 patches, based on 4ff2473bdb4cf2bb7d208ccf4418d3d7e6b1652c. Subsystems affected by this patch series: mm/pagealloc mm/gup ipc selftests mm/kasan kernel/watchdog bitmap procfs lib mm/userfaultfd Subsystem: mm/pagealloc Arnd Bergmann <arnd@arndb.de>: mm/shuffle: fix section mismatch warning Subsystem: mm/gup Michal Hocko <mhocko@suse.com>: Revert "mm/gup: check page posion status for coredump." Subsystem: ipc Varad Gautam <varad.gautam@suse.com>: ipc/mqueue, msg, sem: avoid relying on a stack reference past its expiry Subsystem: selftests Yang Yingliang <yangyingliang@huawei.com>: tools/testing/selftests/exec: fix link error Subsystem: mm/kasan Alexander Potapenko <glider@google.com>: kasan: slab: always reset the tag in get_freepointer_safe() Subsystem: kernel/watchdog Petr Mladek <pmladek@suse.com>: watchdog: reliable handling of timestamps Subsystem: bitmap Rikard Falkeborn <rikard.falkeborn@gmail.com>: linux/bits.h: fix compilation error with GENMASK Subsystem: procfs Alexey Dobriyan <adobriyan@gmail.com>: proc: remove Alexey from MAINTAINERS Subsystem: lib Zhen Lei <thunder.leizhen@huawei.com>: lib: kunit: suppress a compilation warning of frame size Subsystem: mm/userfaultfd Mike Kravetz <mike.kravetz@oracle.com>: userfaultfd: hugetlbfs: fix new flag usage in error path MAINTAINERS | 1 - fs/hugetlbfs/inode.c | 2 +- include/linux/bits.h | 2 +- include/linux/const.h | 8 ++++++++ include/linux/minmax.h | 10 ++-------- ipc/mqueue.c | 6 ++++-- ipc/msg.c | 6 ++++-- ipc/sem.c | 6 ++++-- kernel/watchdog.c | 34 ++++++++++++++++++++-------------- lib/Makefile | 1 + mm/gup.c | 4 ---- mm/internal.h | 20 -------------------- mm/shuffle.h | 4 ++-- mm/slub.c | 1 + mm/userfaultfd.c | 28 ++++++++++++++-------------- tools/include/linux/bits.h | 2 +- tools/include/linux/const.h | 8 ++++++++ tools/testing/selftests/exec/Makefile | 6 +++--- 18 files changed, 74 insertions(+), 75 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-05-15 0:26 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-05-15 0:26 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 13 patches, based on bd3c9cdb21a2674dd0db70199df884828e37abd4. Subsystems affected by this patch series: mm/hugetlb mm/slub resource squashfs mm/userfaultfd mm/ksm mm/pagealloc mm/kasan mm/pagemap hfsplus modprobe mm/ioremap Subsystem: mm/hugetlb Peter Xu <peterx@redhat.com>: Patch series "mm/hugetlb: Fix issues on file sealing and fork", v2: mm/hugetlb: fix F_SEAL_FUTURE_WRITE mm/hugetlb: fix cow where page writtable in child Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: mm, slub: move slub_debug static key enabling outside slab_mutex Subsystem: resource Alistair Popple <apopple@nvidia.com>: kernel/resource: fix return code check in __request_free_mem_region Subsystem: squashfs Phillip Lougher <phillip@squashfs.org.uk>: squashfs: fix divide error in calculate_skip() Subsystem: mm/userfaultfd Axel Rasmussen <axelrasmussen@google.com>: userfaultfd: release page in error path to avoid BUG_ON Subsystem: mm/ksm Hugh Dickins <hughd@google.com>: ksm: revert "use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()" Subsystem: mm/pagealloc "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: fix struct page layout on 32-bit systems Subsystem: mm/kasan Peter Collingbourne <pcc@google.com>: kasan: fix unit tests with CONFIG_UBSAN_LOCAL_BOUNDS enabled Subsystem: mm/pagemap "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap: fix readahead return types Subsystem: hfsplus Jouni Roivas <jouni.roivas@tuxera.com>: hfsplus: prevent corruption in shrinking truncate Subsystem: modprobe Rasmus Villemoes <linux@rasmusvillemoes.dk>: docs: admin-guide: update description for kernel.modprobe sysctl Subsystem: mm/ioremap Christophe Leroy <christophe.leroy@csgroup.eu>: mm/ioremap: fix iomap_max_page_shift Documentation/admin-guide/sysctl/kernel.rst | 9 ++++--- fs/hfsplus/extents.c | 7 +++-- fs/hugetlbfs/inode.c | 5 ++++ fs/iomap/buffered-io.c | 4 +-- fs/squashfs/file.c | 6 ++-- include/linux/mm.h | 32 ++++++++++++++++++++++++++ include/linux/mm_types.h | 4 +-- include/linux/pagemap.h | 6 ++-- include/net/page_pool.h | 12 +++++++++ kernel/resource.c | 2 - lib/test_kasan.c | 29 ++++++++++++++++++----- mm/hugetlb.c | 1 mm/ioremap.c | 6 ++-- mm/ksm.c | 3 +- mm/shmem.c | 34 ++++++++++++---------------- mm/slab_common.c | 10 ++++++++ mm/slub.c | 9 ------- net/core/page_pool.c | 12 +++++---- 18 files changed, 129 insertions(+), 62 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-05-07 1:01 Andrew Morton 2021-05-07 7:12 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2021-05-07 1:01 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm This is everything else from -mm for this merge window, with the possible exception of Mike Rapoport's "secretmem" syscall patch series (https://lkml.kernel.org/r/20210303162209.8609-1-rppt@kernel.org). I've been wobbly about the secretmem patches due to doubts about whether the feature is sufficiently useful to justify inclusion, but developers are now weighing in with helpful information and I've asked Mike for an extensively updated [0/n] changelog. This will take a few days to play out so it is possible that I will prevail upon you for a post-rc1 merge. If that's a problem, there's always 5.13-rc1. 91 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus previously sent patches. Thanks. Subsystems affected by this patch series: alpha procfs sysctl misc core-kernel bitmap lib compat checkpatch epoll isofs nilfs2 hpfs exit fork kexec gcov panic delayacct gdb resource selftests async initramfs ipc mm/cleanups drivers/char mm/slub spelling Subsystem: alpha Randy Dunlap <rdunlap@infradead.org>: alpha: eliminate old-style function definitions alpha: csum_partial_copy.c: add function prototypes from <net/checksum.h> Subsystem: procfs Colin Ian King <colin.king@canonical.com>: fs/proc/generic.c: fix incorrect pde_is_permanent check Alexey Dobriyan <adobriyan@gmail.com>: proc: save LOC in __xlate_proc_name() proc: mandate ->proc_lseek in "struct proc_ops" proc: delete redundant subset=pid check selftests: proc: test subset=pid Subsystem: sysctl zhouchuangao <zhouchuangao@vivo.com>: proc/sysctl: fix function name error in comments Subsystem: misc "Matthew Wilcox (Oracle)" <willy@infradead.org>: include: remove pagemap.h from blkdev.h Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: drop inclusion in bitmap.h Wan Jiabing <wanjiabing@vivo.com>: linux/profile.h: remove unnecessary declaration Subsystem: core-kernel Rasmus Villemoes <linux@rasmusvillemoes.dk>: kernel/async.c: fix pr_debug statement kernel/cred.c: make init_groups static Subsystem: bitmap Yury Norov <yury.norov@gmail.com>: Patch series "lib/find_bit: fast path for small bitmaps", v6: tools: disable -Wno-type-limits tools: bitmap: sync function declarations with the kernel tools: sync BITMAP_LAST_WORD_MASK() macro with the kernel arch: rearrange headers inclusion order in asm/bitops for m68k, sh and h8300 lib: extend the scope of small_const_nbits() macro tools: sync small_const_nbits() macro with the kernel lib: inline _find_next_bit() wrappers tools: sync find_next_bit implementation lib: add fast path for find_next_*_bit() lib: add fast path for find_first_*_bit() and find_last_bit() tools: sync lib/find_bit implementation MAINTAINERS: add entry for the bitmap API Subsystem: lib Bhaskar Chowdhury <unixbhaskar@gmail.com>: lib/bch.c: fix a typo in the file bch.c Wang Qing <wangqing@vivo.com>: lib: fix inconsistent indenting in process_bit1() ToastC <mrtoastcheng@gmail.com>: lib/list_sort.c: fix typo in function description Bhaskar Chowdhury <unixbhaskar@gmail.com>: lib/genalloc.c: Fix a typo Richard Fitzgerald <rf@opensource.cirrus.com>: lib: crc8: pointer to data block should be const Zqiang <qiang.zhang@windriver.com>: lib: stackdepot: turn depot_lock spinlock to raw_spinlock Alex Shi <alexs@kernel.org>: lib/percpu_counter: tame kernel-doc compile warning lib/genalloc: add parameter description to fix doc compile warning Randy Dunlap <rdunlap@infradead.org>: lib: parser: clean up kernel-doc Subsystem: compat Masahiro Yamada <masahiroy@kernel.org>: include/linux/compat.h: remove unneeded declaration from COMPAT_SYSCALL_DEFINEx() Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: warn when missing newline in return sysfs_emit() formats Vincent Mailhol <mailhol.vincent@wanadoo.fr>: checkpatch: exclude four preprocessor sub-expressions from MACRO_ARG_REUSE Christophe JAILLET <christophe.jaillet@wanadoo.fr>: checkpatch: improve ALLOC_ARRAY_ARGS test Subsystem: epoll Davidlohr Bueso <dave@stgolabs.net>: Patch series "fs/epoll: restore user-visible behavior upon event ready": kselftest: introduce new epoll test case fs/epoll: restore waking from ep_done_scan() Subsystem: isofs "Gustavo A. R. Silva" <gustavoars@kernel.org>: isofs: fix fall-through warnings for Clang Subsystem: nilfs2 Liu xuzhi <liu.xuzhi@zte.com.cn>: fs/nilfs2: fix misspellings using codespell tool Lu Jialin <lujialin4@huawei.com>: nilfs2: fix typos in comments Subsystem: hpfs "Gustavo A. R. Silva" <gustavoars@kernel.org>: hpfs: replace one-element array with flexible-array member Subsystem: exit Jim Newsome <jnewsome@torproject.org>: do_wait: make PIDTYPE_PID case O(1) instead of O(n) Subsystem: fork Rolf Eike Beer <eb@emlix.com>: kernel/fork.c: simplify copy_mm() Xiaofeng Cao <cxfcosmos@gmail.com>: kernel/fork.c: fix typos Subsystem: kexec Saeed Mirzamohammadi <saeed.mirzamohammadi@oracle.com>: kernel/crash_core: add crashkernel=auto for vmcore creation Joe LeVeque <jolevequ@microsoft.com>: kexec: Add kexec reboot string Jia-Ju Bai <baijiaju1990@gmail.com>: kernel: kexec_file: fix error return code of kexec_calculate_store_digests() Pavel Tatashin <pasha.tatashin@soleen.com>: kexec: dump kmessage before machine_kexec Subsystem: gcov Johannes Berg <johannes.berg@intel.com>: gcov: combine common code gcov: simplify buffer allocation gcov: use kvmalloc() Nick Desaulniers <ndesaulniers@google.com>: gcov: clang: drop support for clang-10 and older Subsystem: panic He Ying <heying24@huawei.com>: smp: kernel/panic.c - silence warnings Subsystem: delayacct Yafang Shao <laoar.shao@gmail.com>: delayacct: clear right task's flag after blkio completes Subsystem: gdb Johannes Berg <johannes.berg@intel.com>: gdb: lx-symbols: store the abspath() Barry Song <song.bao.hua@hisilicon.com>: Patch series "scripts/gdb: clarify the platforms supporting lx_current and add arm64 support", v2: scripts/gdb: document lx_current is only supported by x86 scripts/gdb: add lx_current support for arm64 Subsystem: resource David Hildenbrand <david@redhat.com>: Patch series "kernel/resource: make walk_system_ram_res() and walk_mem_res() search the whole tree", v2: kernel/resource: make walk_system_ram_res() find all busy IORESOURCE_SYSTEM_RAM resources kernel/resource: make walk_mem_res() find all busy IORESOURCE_MEM resources kernel/resource: remove first_lvl / siblings_only logic Alistair Popple <apopple@nvidia.com>: kernel/resource: allow region_intersects users to hold resource_lock kernel/resource: refactor __request_region to allow external locking kernel/resource: fix locking in request_free_mem_region Subsystem: selftests Zhang Yunkai <zhang.yunkai@zte.com.cn>: selftests: remove duplicate include Subsystem: async Rasmus Villemoes <linux@rasmusvillemoes.dk>: kernel/async.c: stop guarding pr_debug() statements kernel/async.c: remove async_unregister_domain() Subsystem: initramfs Rasmus Villemoes <linux@rasmusvillemoes.dk>: Patch series "background initramfs unpacking, and CONFIG_MODPROBE_PATH", v3: init/initramfs.c: do unpacking asynchronously modules: add CONFIG_MODPROBE_PATH Subsystem: ipc Bhaskar Chowdhury <unixbhaskar@gmail.com>: ipc/sem.c: mundane typo fixes Subsystem: mm/cleanups Shijie Luo <luoshijie1@huawei.com>: mm: fix some typos and code style problems Subsystem: drivers/char David Hildenbrand <david@redhat.com>: Patch series "drivers/char: remove /dev/kmem for good": drivers/char: remove /dev/kmem for good mm: remove xlate_dev_kmem_ptr() mm/vmalloc: remove vwrite() Subsystem: mm/slub Maninder Singh <maninder1.s@samsung.com>: arm: print alloc free paths for address in registers Subsystem: spelling Drew Fustini <drew@beagleboard.org>: scripts/spelling.txt: add "overlfow" zuoqilin <zuoqilin@yulong.com>: scripts/spelling.txt: Add "diabled" typo Drew Fustini <drew@beagleboard.org>: scripts/spelling.txt: add "overflw" Colin Ian King <colin.king@canonical.com>: mm/slab.c: fix spelling mistake "disired" -> "desired" Bhaskar Chowdhury <unixbhaskar@gmail.com>: include/linux/pgtable.h: few spelling fixes zhouchuangao <zhouchuangao@vivo.com>: kernel/umh.c: fix some spelling mistakes Xiaofeng Cao <cxfcosmos@gmail.com>: kernel/user_namespace.c: fix typos Bhaskar Chowdhury <unixbhaskar@gmail.com>: kernel/up.c: fix typo Xiaofeng Cao <caoxiaofeng@yulong.com>: kernel/sys.c: fix typo dingsenjie <dingsenjie@yulong.com>: fs: fat: fix spelling typo of values Bhaskar Chowdhury <unixbhaskar@gmail.com>: ipc/sem.c: spelling fix Masahiro Yamada <masahiroy@kernel.org>: treewide: remove editor modelines and cruft Ingo Molnar <mingo@kernel.org>: mm: fix typos in comments Lu Jialin <lujialin4@huawei.com>: mm: fix typos in comments Documentation/admin-guide/devices.txt | 2 Documentation/admin-guide/kdump/kdump.rst | 3 Documentation/admin-guide/kernel-parameters.txt | 18 Documentation/dev-tools/gdb-kernel-debugging.rst | 4 MAINTAINERS | 16 arch/Kconfig | 20 arch/alpha/include/asm/io.h | 5 arch/alpha/kernel/pc873xx.c | 4 arch/alpha/lib/csum_partial_copy.c | 1 arch/arm/configs/dove_defconfig | 1 arch/arm/configs/magician_defconfig | 1 arch/arm/configs/moxart_defconfig | 1 arch/arm/configs/mps2_defconfig | 1 arch/arm/configs/mvebu_v5_defconfig | 1 arch/arm/configs/xcep_defconfig | 1 arch/arm/include/asm/bug.h | 1 arch/arm/include/asm/io.h | 5 arch/arm/kernel/process.c | 11 arch/arm/kernel/traps.c | 1 arch/h8300/include/asm/bitops.h | 8 arch/hexagon/configs/comet_defconfig | 1 arch/hexagon/include/asm/io.h | 1 arch/ia64/include/asm/io.h | 1 arch/ia64/include/asm/uaccess.h | 18 arch/m68k/atari/time.c | 7 arch/m68k/configs/amcore_defconfig | 1 arch/m68k/include/asm/bitops.h | 6 arch/m68k/include/asm/io_mm.h | 5 arch/mips/include/asm/io.h | 5 arch/openrisc/configs/or1ksim_defconfig | 1 arch/parisc/include/asm/io.h | 5 arch/parisc/include/asm/pdc_chassis.h | 1 arch/powerpc/include/asm/io.h | 5 arch/s390/include/asm/io.h | 5 arch/sh/configs/edosk7705_defconfig | 1 arch/sh/configs/se7206_defconfig | 1 arch/sh/configs/sh2007_defconfig | 1 arch/sh/configs/sh7724_generic_defconfig | 1 arch/sh/configs/sh7770_generic_defconfig | 1 arch/sh/configs/sh7785lcr_32bit_defconfig | 1 arch/sh/include/asm/bitops.h | 5 arch/sh/include/asm/io.h | 5 arch/sparc/configs/sparc64_defconfig | 1 arch/sparc/include/asm/io_64.h | 5 arch/um/drivers/cow.h | 7 arch/xtensa/configs/xip_kc705_defconfig | 1 block/blk-settings.c | 1 drivers/auxdisplay/panel.c | 7 drivers/base/firmware_loader/main.c | 2 drivers/block/brd.c | 1 drivers/block/loop.c | 1 drivers/char/Kconfig | 10 drivers/char/mem.c | 231 -------- drivers/gpu/drm/qxl/qxl_drv.c | 1 drivers/isdn/capi/kcapi_proc.c | 1 drivers/md/bcache/super.c | 1 drivers/media/usb/pwc/pwc-uncompress.c | 3 drivers/net/ethernet/adaptec/starfire.c | 8 drivers/net/ethernet/amd/atarilance.c | 8 drivers/net/ethernet/amd/pcnet32.c | 7 drivers/net/wireless/intersil/hostap/hostap_proc.c | 1 drivers/net/wireless/intersil/orinoco/orinoco_nortel.c | 8 drivers/net/wireless/intersil/orinoco/orinoco_pci.c | 8 drivers/net/wireless/intersil/orinoco/orinoco_plx.c | 8 drivers/net/wireless/intersil/orinoco/orinoco_tmd.c | 8 drivers/nvdimm/btt.c | 1 drivers/nvdimm/pmem.c | 1 drivers/parport/parport_ip32.c | 12 drivers/platform/x86/dell/dell_rbu.c | 3 drivers/scsi/53c700.c | 1 drivers/scsi/53c700.h | 1 drivers/scsi/ch.c | 6 drivers/scsi/esas2r/esas2r_main.c | 1 drivers/scsi/ips.c | 20 drivers/scsi/ips.h | 20 drivers/scsi/lasi700.c | 1 drivers/scsi/megaraid/mbox_defs.h | 2 drivers/scsi/megaraid/mega_common.h | 2 drivers/scsi/megaraid/megaraid_mbox.c | 2 drivers/scsi/megaraid/megaraid_mbox.h | 2 drivers/scsi/qla1280.c | 12 drivers/scsi/scsicam.c | 1 drivers/scsi/sni_53c710.c | 1 drivers/video/fbdev/matrox/matroxfb_base.c | 9 drivers/video/fbdev/vga16fb.c | 10 fs/configfs/configfs_internal.h | 4 fs/configfs/dir.c | 4 fs/configfs/file.c | 4 fs/configfs/inode.c | 4 fs/configfs/item.c | 4 fs/configfs/mount.c | 4 fs/configfs/symlink.c | 4 fs/eventpoll.c | 6 fs/fat/fatent.c | 2 fs/hpfs/hpfs.h | 3 fs/isofs/rock.c | 1 fs/nfs/dir.c | 7 fs/nfs/nfs4proc.c | 6 fs/nfs/nfs4renewd.c | 6 fs/nfs/nfs4state.c | 6 fs/nfs/nfs4xdr.c | 6 fs/nfsd/nfs4proc.c | 6 fs/nfsd/nfs4xdr.c | 6 fs/nfsd/xdr4.h | 6 fs/nilfs2/cpfile.c | 2 fs/nilfs2/ioctl.c | 4 fs/nilfs2/segment.c | 4 fs/nilfs2/the_nilfs.c | 2 fs/ocfs2/acl.c | 4 fs/ocfs2/acl.h | 4 fs/ocfs2/alloc.c | 4 fs/ocfs2/alloc.h | 4 fs/ocfs2/aops.c | 4 fs/ocfs2/aops.h | 4 fs/ocfs2/blockcheck.c | 4 fs/ocfs2/blockcheck.h | 4 fs/ocfs2/buffer_head_io.c | 4 fs/ocfs2/buffer_head_io.h | 4 fs/ocfs2/cluster/heartbeat.c | 4 fs/ocfs2/cluster/heartbeat.h | 4 fs/ocfs2/cluster/masklog.c | 4 fs/ocfs2/cluster/masklog.h | 4 fs/ocfs2/cluster/netdebug.c | 4 fs/ocfs2/cluster/nodemanager.c | 4 fs/ocfs2/cluster/nodemanager.h | 4 fs/ocfs2/cluster/ocfs2_heartbeat.h | 4 fs/ocfs2/cluster/ocfs2_nodemanager.h | 4 fs/ocfs2/cluster/quorum.c | 4 fs/ocfs2/cluster/quorum.h | 4 fs/ocfs2/cluster/sys.c | 4 fs/ocfs2/cluster/sys.h | 4 fs/ocfs2/cluster/tcp.c | 4 fs/ocfs2/cluster/tcp.h | 4 fs/ocfs2/cluster/tcp_internal.h | 4 fs/ocfs2/dcache.c | 4 fs/ocfs2/dcache.h | 4 fs/ocfs2/dir.c | 4 fs/ocfs2/dir.h | 4 fs/ocfs2/dlm/dlmapi.h | 4 fs/ocfs2/dlm/dlmast.c | 4 fs/ocfs2/dlm/dlmcommon.h | 4 fs/ocfs2/dlm/dlmconvert.c | 4 fs/ocfs2/dlm/dlmconvert.h | 4 fs/ocfs2/dlm/dlmdebug.c | 4 fs/ocfs2/dlm/dlmdebug.h | 4 fs/ocfs2/dlm/dlmdomain.c | 4 fs/ocfs2/dlm/dlmdomain.h | 4 fs/ocfs2/dlm/dlmlock.c | 4 fs/ocfs2/dlm/dlmmaster.c | 4 fs/ocfs2/dlm/dlmrecovery.c | 4 fs/ocfs2/dlm/dlmthread.c | 4 fs/ocfs2/dlm/dlmunlock.c | 4 fs/ocfs2/dlmfs/dlmfs.c | 4 fs/ocfs2/dlmfs/userdlm.c | 4 fs/ocfs2/dlmfs/userdlm.h | 4 fs/ocfs2/dlmglue.c | 4 fs/ocfs2/dlmglue.h | 4 fs/ocfs2/export.c | 4 fs/ocfs2/export.h | 4 fs/ocfs2/extent_map.c | 4 fs/ocfs2/extent_map.h | 4 fs/ocfs2/file.c | 4 fs/ocfs2/file.h | 4 fs/ocfs2/filecheck.c | 4 fs/ocfs2/filecheck.h | 4 fs/ocfs2/heartbeat.c | 4 fs/ocfs2/heartbeat.h | 4 fs/ocfs2/inode.c | 4 fs/ocfs2/inode.h | 4 fs/ocfs2/journal.c | 4 fs/ocfs2/journal.h | 4 fs/ocfs2/localalloc.c | 4 fs/ocfs2/localalloc.h | 4 fs/ocfs2/locks.c | 4 fs/ocfs2/locks.h | 4 fs/ocfs2/mmap.c | 4 fs/ocfs2/move_extents.c | 4 fs/ocfs2/move_extents.h | 4 fs/ocfs2/namei.c | 4 fs/ocfs2/namei.h | 4 fs/ocfs2/ocfs1_fs_compat.h | 4 fs/ocfs2/ocfs2.h | 4 fs/ocfs2/ocfs2_fs.h | 4 fs/ocfs2/ocfs2_ioctl.h | 4 fs/ocfs2/ocfs2_lockid.h | 4 fs/ocfs2/ocfs2_lockingver.h | 4 fs/ocfs2/refcounttree.c | 4 fs/ocfs2/refcounttree.h | 4 fs/ocfs2/reservations.c | 4 fs/ocfs2/reservations.h | 4 fs/ocfs2/resize.c | 4 fs/ocfs2/resize.h | 4 fs/ocfs2/slot_map.c | 4 fs/ocfs2/slot_map.h | 4 fs/ocfs2/stack_o2cb.c | 4 fs/ocfs2/stack_user.c | 4 fs/ocfs2/stackglue.c | 4 fs/ocfs2/stackglue.h | 4 fs/ocfs2/suballoc.c | 4 fs/ocfs2/suballoc.h | 4 fs/ocfs2/super.c | 4 fs/ocfs2/super.h | 4 fs/ocfs2/symlink.c | 4 fs/ocfs2/symlink.h | 4 fs/ocfs2/sysfile.c | 4 fs/ocfs2/sysfile.h | 4 fs/ocfs2/uptodate.c | 4 fs/ocfs2/uptodate.h | 4 fs/ocfs2/xattr.c | 4 fs/ocfs2/xattr.h | 4 fs/proc/generic.c | 13 fs/proc/inode.c | 18 fs/proc/proc_sysctl.c | 2 fs/reiserfs/procfs.c | 10 include/asm-generic/bitops/find.h | 108 +++ include/asm-generic/bitops/le.h | 38 + include/asm-generic/bitsperlong.h | 12 include/asm-generic/io.h | 11 include/linux/align.h | 15 include/linux/async.h | 1 include/linux/bitmap.h | 11 include/linux/bitops.h | 12 include/linux/blkdev.h | 1 include/linux/compat.h | 1 include/linux/configfs.h | 4 include/linux/crc8.h | 2 include/linux/cred.h | 1 include/linux/delayacct.h | 20 include/linux/fs.h | 2 include/linux/genl_magic_func.h | 1 include/linux/genl_magic_struct.h | 1 include/linux/gfp.h | 2 include/linux/init_task.h | 1 include/linux/initrd.h | 2 include/linux/kernel.h | 9 include/linux/mm.h | 2 include/linux/mmzone.h | 2 include/linux/pgtable.h | 10 include/linux/proc_fs.h | 1 include/linux/profile.h | 3 include/linux/smp.h | 8 include/linux/swap.h | 1 include/linux/vmalloc.h | 7 include/uapi/linux/if_bonding.h | 11 include/uapi/linux/nfs4.h | 6 include/xen/interface/elfnote.h | 10 include/xen/interface/hvm/hvm_vcpu.h | 10 include/xen/interface/io/xenbus.h | 10 init/Kconfig | 12 init/initramfs.c | 38 + init/main.c | 1 ipc/sem.c | 12 kernel/async.c | 68 -- kernel/configs/android-base.config | 1 kernel/crash_core.c | 7 kernel/cred.c | 2 kernel/exit.c | 67 ++ kernel/fork.c | 23 kernel/gcov/Kconfig | 1 kernel/gcov/base.c | 49 + kernel/gcov/clang.c | 282 ---------- kernel/gcov/fs.c | 146 ++++- kernel/gcov/gcc_4_7.c | 173 ------ kernel/gcov/gcov.h | 14 kernel/kexec_core.c | 4 kernel/kexec_file.c | 4 kernel/kmod.c | 2 kernel/resource.c | 198 ++++--- kernel/sys.c | 14 kernel/umh.c | 8 kernel/up.c | 2 kernel/user_namespace.c | 6 lib/bch.c | 2 lib/crc8.c | 2 lib/decompress_unlzma.c | 2 lib/find_bit.c | 68 -- lib/genalloc.c | 7 lib/list_sort.c | 2 lib/parser.c | 61 +- lib/percpu_counter.c | 2 lib/stackdepot.c | 6 mm/balloon_compaction.c | 4 mm/compaction.c | 4 mm/filemap.c | 2 mm/gup.c | 2 mm/highmem.c | 2 mm/huge_memory.c | 6 mm/hugetlb.c | 6 mm/internal.h | 2 mm/kasan/kasan.h | 8 mm/kasan/quarantine.c | 4 mm/kasan/shadow.c | 4 mm/kfence/report.c | 2 mm/khugepaged.c | 2 mm/ksm.c | 6 mm/madvise.c | 4 mm/memcontrol.c | 18 mm/memory-failure.c | 2 mm/memory.c | 18 mm/mempolicy.c | 6 mm/migrate.c | 8 mm/mmap.c | 4 mm/mprotect.c | 2 mm/mremap.c | 2 mm/nommu.c | 10 mm/oom_kill.c | 2 mm/page-writeback.c | 4 mm/page_alloc.c | 16 mm/page_owner.c | 2 mm/page_vma_mapped.c | 2 mm/percpu-internal.h | 2 mm/percpu.c | 2 mm/pgalloc-track.h | 6 mm/rmap.c | 2 mm/slab.c | 8 mm/slub.c | 2 mm/swap.c | 4 mm/swap_slots.c | 2 mm/swap_state.c | 2 mm/vmalloc.c | 124 ---- mm/vmstat.c | 2 mm/z3fold.c | 2 mm/zpool.c | 2 mm/zsmalloc.c | 6 samples/configfs/configfs_sample.c | 2 scripts/checkpatch.pl | 15 scripts/gdb/linux/cpus.py | 23 scripts/gdb/linux/symbols.py | 3 scripts/spelling.txt | 3 tools/include/asm-generic/bitops/find.h | 85 ++- tools/include/asm-generic/bitsperlong.h | 3 tools/include/linux/bitmap.h | 18 tools/lib/bitmap.c | 4 tools/lib/find_bit.c | 56 - tools/scripts/Makefile.include | 1 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 44 + tools/testing/selftests/kvm/lib/sparsebit.c | 1 tools/testing/selftests/mincore/mincore_selftest.c | 1 tools/testing/selftests/powerpc/mm/tlbie_test.c | 1 tools/testing/selftests/proc/Makefile | 1 tools/testing/selftests/proc/proc-subset-pid.c | 121 ++++ tools/testing/selftests/proc/read.c | 4 tools/usb/hcd-tests.sh | 2 343 files changed, 1383 insertions(+), 2119 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-05-07 1:01 incoming Andrew Morton @ 2021-05-07 7:12 ` Linus Torvalds 0 siblings, 0 replies; 348+ messages in thread From: Linus Torvalds @ 2021-05-07 7:12 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Thu, May 6, 2021 at 6:01 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > I've been wobbly about the secretmem patches due to doubts about > whether the feature is sufficiently useful to justify inclusion, but > developers are now weighing in with helpful information and I've asked Mike > for an extensively updated [0/n] changelog. This will take a few days > to play out so it is possible that I will prevail upon you for a post-rc1 > merge. Oh, much too late for this release by now. > If that's a problem, there's always 5.13-rc1. 5.13-rc1 is two days from now, it would be for 5.14-rc1.. How time - and version numbers - fly. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-04-30 5:52 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-04-30 5:52 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits A few misc subsystems and some of MM. 178 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0. Subsystems affected by this patch series: ia64 kbuild scripts sh ocfs2 kfifo vfs kernel/watchdog mm/slab-generic mm/slub mm/kmemleak mm/debug mm/pagecache mm/msync mm/gup mm/memremap mm/memcg mm/pagemap mm/mremap mm/dma mm/sparsemem mm/vmalloc mm/documentation mm/kasan mm/initialization mm/pagealloc mm/memory-failure Subsystem: ia64 Zhang Yunkai <zhang.yunkai@zte.com.cn>: arch/ia64/kernel/head.S: remove duplicate include Bhaskar Chowdhury <unixbhaskar@gmail.com>: arch/ia64/kernel/fsys.S: fix typos arch/ia64/include/asm/pgtable.h: minor typo fixes Valentin Schneider <valentin.schneider@arm.com>: ia64: ensure proper NUMA distance and possible map initialization Sergei Trofimovich <slyfox@gentoo.org>: ia64: drop unused IA64_FW_EMU ifdef ia64: simplify code flow around swiotlb init Bhaskar Chowdhury <unixbhaskar@gmail.com>: ia64: trivial spelling fixes Sergei Trofimovich <slyfox@gentoo.org>: ia64: fix EFI_DEBUG build ia64: mca: always make IA64_MCA_DEBUG an expression ia64: drop marked broken DISCONTIGMEM and VIRTUAL_MEM_MAP ia64: module: fix symbolizer crash on fdescr Subsystem: kbuild Luc Van Oostenryck <luc.vanoostenryck@gmail.com>: include/linux/compiler-gcc.h: sparse can do constant folding of __builtin_bswap*() Subsystem: scripts Tom Saeger <tom.saeger@oracle.com>: scripts/spelling.txt: add entries for recent discoveries Wan Jiabing <wanjiabing@vivo.com>: scripts: a new script for checking duplicate struct declaration Subsystem: sh Zhang Yunkai <zhang.yunkai@zte.com.cn>: arch/sh/include/asm/tlb.h: remove duplicate include Subsystem: ocfs2 Yang Li <yang.lee@linux.alibaba.com>: ocfs2: replace DEFINE_SIMPLE_ATTRIBUTE with DEFINE_DEBUGFS_ATTRIBUTE Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: map flags directly in flags_to_o2dlm() Bhaskar Chowdhury <unixbhaskar@gmail.com>: ocfs2: fix a typo Jiapeng Chong <jiapeng.chong@linux.alibaba.com>: ocfs2/dlm: remove unused function Subsystem: kfifo Dan Carpenter <dan.carpenter@oracle.com>: kfifo: fix ternary sign extension bugs Subsystem: vfs Randy Dunlap <rdunlap@infradead.org>: vfs: fs_parser: clean up kernel-doc warnings Subsystem: kernel/watchdog Petr Mladek <pmladek@suse.com>: Patch series "watchdog/softlockup: Report overall time and some cleanup", v2: watchdog: rename __touch_watchdog() to a better descriptive name watchdog: explicitly update timestamp when reporting softlockup watchdog/softlockup: report the overall time of softlockups watchdog/softlockup: remove logic that tried to prevent repeated reports watchdog: fix barriers when printing backtraces from all CPUs watchdog: cleanup handling of false positives Subsystem: mm/slab-generic Rafael Aquini <aquini@redhat.com>: mm/slab_common: provide "slab_merge" option for !IS_ENABLED(CONFIG_SLAB_MERGE_DEFAULT) builds Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: mm, slub: enable slub_debug static key when creating cache with explicit debug flags Oliver Glitta <glittao@gmail.com>: kunit: add a KUnit test for SLUB debugging functionality slub: remove resiliency_test() function Bhaskar Chowdhury <unixbhaskar@gmail.com>: mm/slub.c: trivial typo fixes Subsystem: mm/kmemleak Bhaskar Chowdhury <unixbhaskar@gmail.com>: mm/kmemleak.c: fix a typo Subsystem: mm/debug Georgi Djakov <georgi.djakov@linaro.org>: mm/page_owner: record the timestamp of all pages during free zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>: mm, page_owner: remove unused parameter in __set_page_owner_handle Sergei Trofimovich <slyfox@gentoo.org>: mm: page_owner: fetch backtrace only for tracked pages mm: page_owner: use kstrtobool() to parse bool option mm: page_owner: detect page_owner recursion via task_struct mm: page_poison: print page info when corruption is caught Anshuman Khandual <anshuman.khandual@arm.com>: mm/memtest: add ARCH_USE_MEMTEST Subsystem: mm/pagecache Jens Axboe <axboe@kernel.dk>: Patch series "Improve IOCB_NOWAIT O_DIRECT reads", v3: mm: provide filemap_range_needs_writeback() helper mm: use filemap_range_needs_writeback() for O_DIRECT reads iomap: use filemap_range_needs_writeback() for O_DIRECT reads "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap: use filemap_read_page in filemap_fault mm/filemap: drop check for truncated page after I/O Johannes Weiner <hannes@cmpxchg.org>: mm: page-writeback: simplify memcg handling in test_clear_page_writeback() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: move page_mapping_file to pagemap.h Rui Sun <sunrui26@huawei.com>: mm/filemap: update stale comment Subsystem: mm/msync Nikita Ermakov <sh1r4s3@mail.si-head.nl>: mm/msync: exit early when the flags is an MS_ASYNC and start < vm_start Subsystem: mm/gup Joao Martins <joao.m.martins@oracle.com>: Patch series "mm/gup: page unpining improvements", v4: mm/gup: add compound page list iterator mm/gup: decrement head page once for group of subpages mm/gup: add a range variant of unpin_user_pages_dirty_lock() RDMA/umem: batch page unpin in __ib_umem_release() Yang Shi <shy828301@gmail.com>: mm: gup: remove FOLL_SPLIT Subsystem: mm/memremap Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/memremap.c: fix improper SPDX comment style Subsystem: mm/memcg Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: fix kernel stack account Shakeel Butt <shakeelb@google.com>: memcg: cleanup root memcg checks memcg: enable memcg oom-kill for __GFP_NOFAIL Johannes Weiner <hannes@cmpxchg.org>: Patch series "mm: memcontrol: switch to rstat", v3: mm: memcontrol: fix cpuhotplug statistics flushing mm: memcontrol: kill mem_cgroup_nodeinfo() mm: memcontrol: privatize memcg_page_state query functions cgroup: rstat: support cgroup1 cgroup: rstat: punt root-level optimization to individual controllers mm: memcontrol: switch to rstat mm: memcontrol: consolidate lruvec stat flushing kselftests: cgroup: update kmem test for new vmstat implementation Shakeel Butt <shakeelb@google.com>: memcg: charge before adding to swapcache on swapin Muchun Song <songmuchun@bytedance.com>: Patch series "Use obj_cgroup APIs to charge kmem pages", v5: mm: memcontrol: slab: fix obtain a reference to a freeing memcg mm: memcontrol: introduce obj_cgroup_{un}charge_pages mm: memcontrol: directly access page->memcg_data in mm/page_alloc.c mm: memcontrol: change ug->dummy_page only if memcg changed mm: memcontrol: use obj_cgroup APIs to charge kmem pages mm: memcontrol: inline __memcg_kmem_{un}charge() into obj_cgroup_{un}charge_pages() mm: memcontrol: move PageMemcgKmem to the scope of CONFIG_MEMCG_KMEM Wan Jiabing <wanjiabing@vivo.com>: linux/memcontrol.h: remove duplicate struct declaration Johannes Weiner <hannes@cmpxchg.org>: mm: page_counter: mitigate consequences of a page_counter underflow Subsystem: mm/pagemap Wang Qing <wangqing@vivo.com>: mm/memory.c: do_numa_page(): delete bool "migrated" Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/interval_tree: add comments to improve code readability Oscar Salvador <osalvador@suse.de>: Patch series "Cleanup and fixups for vmemmap handling", v6: x86/vmemmap: drop handling of 4K unaligned vmemmap range x86/vmemmap: drop handling of 1GB vmemmap ranges x86/vmemmap: handle unpopulated sub-pmd ranges x86/vmemmap: optimize for consecutive sections in partial populated PMDs Ovidiu Panait <ovidiu.panait@windriver.com>: mm, tracing: improve rss_stat tracepoint message Christoph Hellwig <hch@lst.de>: Patch series "add remap_pfn_range_notrack instead of reinventing it in i915", v2: mm: add remap_pfn_range_notrack mm: add a io_mapping_map_user helper i915: use io_mapping_map_user i915: fix remap_io_sg to verify the pgprot Huang Ying <ying.huang@intel.com>: NUMA balancing: reduce TLB flush via delaying mapping on hint page fault Subsystem: mm/mremap Brian Geffon <bgeffon@google.com>: Patch series "mm: Extend MREMAP_DONTUNMAP to non-anonymous mappings", v5: mm: extend MREMAP_DONTUNMAP to non-anonymous mappings Revert "mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio" selftests: add a MREMAP_DONTUNMAP selftest for shmem Subsystem: mm/dma Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/dmapool: switch from strlcpy to strscpy Subsystem: mm/sparsemem Wang Wensheng <wangwensheng4@huawei.com>: mm/sparse: add the missing sparse_buffer_fini() in error branch Subsystem: mm/vmalloc Christoph Hellwig <hch@lst.de>: Patch series "remap_vmalloc_range cleanups": samples/vfio-mdev/mdpy: use remap_vmalloc_range mm: unexport remap_vmalloc_range_partial Serapheim Dimitropoulos <serapheim.dimitro@delphix.com>: mm/vmalloc: use rb_tree instead of list for vread() lookups Nicholas Piggin <npiggin@gmail.com>: Patch series "huge vmalloc mappings", v13: ARM: mm: add missing pud_page define to 2-level page tables mm/vmalloc: fix HUGE_VMAP regression by enabling huge pages in vmalloc_to_page mm: apply_to_pte_range warn and fail if a large pte is encountered mm/vmalloc: rename vmap_*_range vmap_pages_*_range mm/ioremap: rename ioremap_*_range to vmap_*_range mm: HUGE_VMAP arch support cleanup powerpc: inline huge vmap supported functions arm64: inline huge vmap supported functions x86: inline huge vmap supported functions mm/vmalloc: provide fallback arch huge vmap support functions mm: move vmap_range from mm/ioremap.c to mm/vmalloc.c mm/vmalloc: add vmap_range_noflush variant mm/vmalloc: hugepage vmalloc mappings Patch series "mm/vmalloc: cleanup after hugepage series", v2: mm/vmalloc: remove map_kernel_range kernel/dma: remove unnecessary unmap_kernel_range powerpc/xive: remove unnecessary unmap_kernel_range mm/vmalloc: remove unmap_kernel_range mm/vmalloc: improve allocation failure error messages Vijayanand Jitta <vjitta@codeaurora.org>: mm: vmalloc: prevent use after free in _vm_unmap_aliases "Uladzislau Rezki (Sony)" <urezki@gmail.com>: lib/test_vmalloc.c: remove two kvfree_rcu() tests lib/test_vmalloc.c: add a new 'nr_threads' parameter vm/test_vmalloc.sh: adapt for updated driver interface mm/vmalloc: refactor the preloading loagic mm/vmalloc: remove an empty line Subsystem: mm/documentation "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/doc: fix fault_flag_allow_retry_first kerneldoc mm/doc: fix page_maybe_dma_pinned kerneldoc mm/doc: turn fault flags into an enum mm/doc: add mm.h and mm_types.h to the mm-api document Lukas Bulwahn <lukas.bulwahn@gmail.com>: Patch series "kernel-doc and MAINTAINERS clean-up": MAINTAINERS: assign pagewalk.h to MEMORY MANAGEMENT pagewalk: prefix struct kernel-doc descriptions Subsystem: mm/kasan Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/kasan: switch from strlcpy to strscpy Peter Collingbourne <pcc@google.com>: kasan: fix kasan_byte_accessible() to be consistent with actual checks Andrey Konovalov <andreyknvl@google.com>: kasan: initialize shadow to TAG_INVALID for SW_TAGS mm, kasan: don't poison boot memory with tag-based modes Patch series "kasan: integrate with init_on_alloc/free", v3: arm64: kasan: allow to init memory when setting tags kasan: init memory in kasan_(un)poison for HW_TAGS kasan, mm: integrate page_alloc init with HW_TAGS kasan, mm: integrate slab init_on_alloc with HW_TAGS kasan, mm: integrate slab init_on_free with HW_TAGS kasan: docs: clean up sections kasan: docs: update overview section kasan: docs: update usage section kasan: docs: update error reports section kasan: docs: update boot parameters section kasan: docs: update GENERIC implementation details section kasan: docs: update SW_TAGS implementation details section kasan: docs: update HW_TAGS implementation details section kasan: docs: update shadow memory section kasan: docs: update ignoring accesses section kasan: docs: update tests section Walter Wu <walter-zh.wu@mediatek.com>: kasan: record task_work_add() call stack Andrey Konovalov <andreyknvl@google.com>: kasan: detect false-positives in tests Zqiang <qiang.zhang@windriver.com>: irq_work: record irq_work_queue() call stack Subsystem: mm/initialization Kefeng Wang <wangkefeng.wang@huawei.com>: mm: move mem_init_print_info() into mm_init() Subsystem: mm/pagealloc David Hildenbrand <david@redhat.com>: mm/page_alloc: drop pr_info_ratelimited() in alloc_contig_range() Minchan Kim <minchan@kernel.org>: mm: remove lru_add_drain_all in alloc_contig_range Yu Zhao <yuzhao@google.com>: include/linux/page-flags-layout.h: correctly determine LAST_CPUPID_WIDTH include/linux/page-flags-layout.h: cleanups "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Rationalise __alloc_pages wrappers", v3: mm/page_alloc: rename alloc_mask to alloc_gfp mm/page_alloc: rename gfp_mask to gfp mm/page_alloc: combine __alloc_pages and __alloc_pages_nodemask mm/mempolicy: rename alloc_pages_current to alloc_pages mm/mempolicy: rewrite alloc_pages documentation mm/mempolicy: rewrite alloc_pages_vma documentation mm/mempolicy: fix mpol_misplaced kernel-doc Minchan Kim <minchan@kernel.org>: mm: page_alloc: dump migrate-failed pages Geert Uytterhoeven <geert@linux-m68k.org>: mm/Kconfig: remove default DISCONTIGMEM_MANUAL Kefeng Wang <wangkefeng.wang@huawei.com>: mm, page_alloc: avoid page_to_pfn() in move_freepages() zhouchuangao <zhouchuangao@vivo.com>: mm/page_alloc: duplicate include linux/vmalloc.h Mel Gorman <mgorman@techsingularity.net>: Patch series "Introduce a bulk order-0 page allocator with two in-tree users", v6: mm/page_alloc: rename alloced to allocated mm/page_alloc: add a bulk page allocator mm/page_alloc: add an array-based interface to the bulk page allocator Jesper Dangaard Brouer <brouer@redhat.com>: mm/page_alloc: optimize code layout for __alloc_pages_bulk mm/page_alloc: inline __rmqueue_pcplist Chuck Lever <chuck.lever@oracle.com>: Patch series "SUNRPC consumer for the bulk page allocator": SUNRPC: set rq_page_end differently SUNRPC: refresh rq_pages using a bulk page allocator Jesper Dangaard Brouer <brouer@redhat.com>: net: page_pool: refactor dma_map into own function page_pool_dma_map net: page_pool: use alloc_pages_bulk in refill code path Sergei Trofimovich <slyfox@gentoo.org>: mm: page_alloc: ignore init_on_free=1 for debug_pagealloc=1 huxiang <huxiang@uniontech.com>: mm/page_alloc: redundant definition variables of pfn in for loop Mike Rapoport <rppt@linux.ibm.com>: mm/mmzone.h: fix existing kernel-doc comments and link them to core-api Subsystem: mm/memory-failure Jane Chu <jane.chu@oracle.com>: mm/memory-failure: unnecessary amount of unmapping Documentation/admin-guide/kernel-parameters.txt | 7 Documentation/admin-guide/mm/transhuge.rst | 2 Documentation/core-api/cachetlb.rst | 4 Documentation/core-api/mm-api.rst | 6 Documentation/dev-tools/kasan.rst | 355 +++++----- Documentation/vm/page_owner.rst | 2 Documentation/vm/transhuge.rst | 5 MAINTAINERS | 1 arch/Kconfig | 11 arch/alpha/mm/init.c | 1 arch/arc/mm/init.c | 1 arch/arm/Kconfig | 1 arch/arm/include/asm/pgtable-3level.h | 2 arch/arm/include/asm/pgtable.h | 3 arch/arm/mm/copypage-v4mc.c | 1 arch/arm/mm/copypage-v6.c | 1 arch/arm/mm/copypage-xscale.c | 1 arch/arm/mm/init.c | 2 arch/arm64/Kconfig | 1 arch/arm64/include/asm/memory.h | 4 arch/arm64/include/asm/mte-kasan.h | 39 - arch/arm64/include/asm/vmalloc.h | 38 - arch/arm64/mm/init.c | 4 arch/arm64/mm/mmu.c | 36 - arch/csky/abiv1/cacheflush.c | 1 arch/csky/mm/init.c | 1 arch/h8300/mm/init.c | 2 arch/hexagon/mm/init.c | 1 arch/ia64/Kconfig | 23 arch/ia64/configs/bigsur_defconfig | 1 arch/ia64/include/asm/meminit.h | 11 arch/ia64/include/asm/module.h | 6 arch/ia64/include/asm/page.h | 25 arch/ia64/include/asm/pgtable.h | 7 arch/ia64/kernel/Makefile | 2 arch/ia64/kernel/acpi.c | 7 arch/ia64/kernel/efi.c | 11 arch/ia64/kernel/fsys.S | 4 arch/ia64/kernel/head.S | 6 arch/ia64/kernel/ia64_ksyms.c | 12 arch/ia64/kernel/machine_kexec.c | 2 arch/ia64/kernel/mca.c | 4 arch/ia64/kernel/module.c | 29 arch/ia64/kernel/pal.S | 6 arch/ia64/mm/Makefile | 1 arch/ia64/mm/contig.c | 4 arch/ia64/mm/discontig.c | 21 arch/ia64/mm/fault.c | 15 arch/ia64/mm/init.c | 221 ------ arch/m68k/mm/init.c | 1 arch/microblaze/mm/init.c | 1 arch/mips/Kconfig | 1 arch/mips/loongson64/numa.c | 1 arch/mips/mm/cache.c | 1 arch/mips/mm/init.c | 1 arch/mips/sgi-ip27/ip27-memory.c | 1 arch/nds32/mm/init.c | 1 arch/nios2/mm/cacheflush.c | 1 arch/nios2/mm/init.c | 1 arch/openrisc/mm/init.c | 2 arch/parisc/mm/init.c | 2 arch/powerpc/Kconfig | 1 arch/powerpc/include/asm/vmalloc.h | 34 - arch/powerpc/kernel/isa-bridge.c | 4 arch/powerpc/kernel/pci_64.c | 2 arch/powerpc/mm/book3s64/radix_pgtable.c | 29 arch/powerpc/mm/ioremap.c | 2 arch/powerpc/mm/mem.c | 1 arch/powerpc/sysdev/xive/common.c | 4 arch/riscv/mm/init.c | 1 arch/s390/mm/init.c | 2 arch/sh/include/asm/tlb.h | 10 arch/sh/mm/cache-sh4.c | 1 arch/sh/mm/cache-sh7705.c | 1 arch/sh/mm/init.c | 1 arch/sparc/include/asm/pgtable_32.h | 3 arch/sparc/mm/init_32.c | 2 arch/sparc/mm/init_64.c | 1 arch/sparc/mm/tlb.c | 1 arch/um/kernel/mem.c | 1 arch/x86/Kconfig | 1 arch/x86/include/asm/vmalloc.h | 42 - arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 2 arch/x86/mm/init_32.c | 2 arch/x86/mm/init_64.c | 222 ++++-- arch/x86/mm/ioremap.c | 33 arch/x86/mm/pgtable.c | 13 arch/xtensa/Kconfig | 1 arch/xtensa/mm/init.c | 1 block/blk-cgroup.c | 17 drivers/gpu/drm/i915/Kconfig | 1 drivers/gpu/drm/i915/gem/i915_gem_mman.c | 9 drivers/gpu/drm/i915/i915_drv.h | 3 drivers/gpu/drm/i915/i915_mm.c | 117 --- drivers/infiniband/core/umem.c | 12 drivers/pci/pci.c | 2 fs/aio.c | 5 fs/fs_parser.c | 2 fs/iomap/direct-io.c | 24 fs/ocfs2/blockcheck.c | 2 fs/ocfs2/dlm/dlmrecovery.c | 7 fs/ocfs2/stack_o2cb.c | 36 - fs/ocfs2/stackglue.c | 2 include/linux/compiler-gcc.h | 8 include/linux/fs.h | 2 include/linux/gfp.h | 45 - include/linux/io-mapping.h | 3 include/linux/io.h | 9 include/linux/kasan.h | 51 + include/linux/memcontrol.h | 271 ++++---- include/linux/mm.h | 50 - include/linux/mmzone.h | 43 - include/linux/page-flags-layout.h | 64 - include/linux/pagemap.h | 10 include/linux/pagewalk.h | 4 include/linux/sched.h | 4 include/linux/slab.h | 2 include/linux/slub_def.h | 2 include/linux/vmalloc.h | 73 +- include/linux/vmstat.h | 24 include/net/page_pool.h | 2 include/trace/events/kmem.h | 24 init/main.c | 2 kernel/cgroup/cgroup.c | 34 - kernel/cgroup/rstat.c | 61 + kernel/dma/remap.c | 1 kernel/fork.c | 13 kernel/irq_work.c | 7 kernel/task_work.c | 3 kernel/watchdog.c | 102 +-- lib/Kconfig.debug | 14 lib/Makefile | 1 lib/test_kasan.c | 59 - lib/test_slub.c | 124 +++ lib/test_vmalloc.c | 128 +-- mm/Kconfig | 4 mm/Makefile | 1 mm/debug_vm_pgtable.c | 4 mm/dmapool.c | 2 mm/filemap.c | 61 + mm/gup.c | 145 +++- mm/hugetlb.c | 2 mm/internal.h | 25 mm/interval_tree.c | 2 mm/io-mapping.c | 29 mm/ioremap.c | 361 ++-------- mm/kasan/common.c | 53 - mm/kasan/generic.c | 12 mm/kasan/kasan.h | 28 mm/kasan/report_generic.c | 2 mm/kasan/shadow.c | 10 mm/kasan/sw_tags.c | 12 mm/kmemleak.c | 2 mm/memcontrol.c | 798 ++++++++++++------------ mm/memory-failure.c | 2 mm/memory.c | 191 +++-- mm/mempolicy.c | 78 -- mm/mempool.c | 4 mm/memremap.c | 2 mm/migrate.c | 2 mm/mm_init.c | 4 mm/mmap.c | 6 mm/mremap.c | 6 mm/msync.c | 6 mm/page-writeback.c | 9 mm/page_alloc.c | 430 +++++++++--- mm/page_counter.c | 8 mm/page_owner.c | 68 -- mm/page_poison.c | 6 mm/percpu-vm.c | 7 mm/slab.c | 43 - mm/slab.h | 24 mm/slab_common.c | 10 mm/slub.c | 215 ++---- mm/sparse.c | 1 mm/swap_state.c | 13 mm/util.c | 10 mm/vmalloc.c | 728 ++++++++++++++++----- net/core/page_pool.c | 127 ++- net/sunrpc/svc_xprt.c | 38 - samples/kfifo/bytestream-example.c | 8 samples/kfifo/inttype-example.c | 8 samples/kfifo/record-example.c | 8 samples/vfio-mdev/mdpy.c | 4 scripts/checkdeclares.pl | 53 + scripts/spelling.txt | 26 tools/testing/selftests/cgroup/test_kmem.c | 22 tools/testing/selftests/vm/mremap_dontunmap.c | 52 + tools/testing/selftests/vm/test_vmalloc.sh | 21 189 files changed, 3642 insertions(+), 3013 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-04-23 21:28 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-04-23 21:28 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 5 patches, based on 5bfc75d92efd494db37f5c4c173d3639d4772966. Subsystems affected by this patch series: coda overlayfs mm/pagecache mm/memcg Subsystem: coda Christian König <christian.koenig@amd.com>: coda: fix reference counting in coda_file_mmap error path Subsystem: overlayfs Christian König <christian.koenig@amd.com>: ovl: fix reference counting in ovl_mmap error path Subsystem: mm/pagecache Hugh Dickins <hughd@google.com>: mm/filemap: fix find_lock_entries hang on 32-bit THP mm/filemap: fix mapping_seek_hole_data on THP & 32-bit Subsystem: mm/memcg Vasily Averin <vvs@virtuozzo.com>: tools/cgroup/slabinfo.py: updated to work on current kernel fs/coda/file.c | 6 +++--- fs/overlayfs/file.c | 11 +---------- mm/filemap.c | 31 +++++++++++++++++++------------ tools/cgroup/memcg_slabinfo.py | 8 ++++---- 4 files changed, 27 insertions(+), 29 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-04-16 22:45 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-04-16 22:45 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 12 patches, based on 06c2aac4014c38247256fe49c61b7f55890271e7. Subsystems affected by this patch series: mm/documentation mm/kasan csky ia64 mm/pagemap gcov lib Subsystem: mm/documentation Randy Dunlap <rdunlap@infradead.org>: mm: eliminate "expecting prototype" kernel-doc warnings Subsystem: mm/kasan Arnd Bergmann <arnd@arndb.de>: kasan: fix hwasan build for gcc Walter Wu <walter-zh.wu@mediatek.com>: kasan: remove redundant config option Subsystem: csky Randy Dunlap <rdunlap@infradead.org>: csky: change a Kconfig symbol name to fix e1000 build error Subsystem: ia64 Randy Dunlap <rdunlap@infradead.org>: ia64: remove duplicate entries in generic_defconfig ia64: fix discontig.c section mismatches John Paul Adrian Glaubitz <glaubitz () physik ! fu-berlin ! de>: ia64: tools: remove inclusion of ia64-specific version of errno.h header John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>: ia64: tools: remove duplicate definition of ia64_mf() on ia64 Subsystem: mm/pagemap Zack Rusin <zackr@vmware.com>: mm/mapping_dirty_helpers: guard hugepage pud's usage Christophe Leroy <christophe.leroy@csgroup.eu>: mm: ptdump: fix build failure Subsystem: gcov Johannes Berg <johannes.berg@intel.com>: gcov: clang: fix clang-11+ build Subsystem: lib Randy Dunlap <rdunlap@infradead.org>: lib: remove "expecting prototype" kernel-doc warnings arch/arm64/kernel/sleep.S | 2 +- arch/csky/Kconfig | 2 +- arch/csky/include/asm/page.h | 2 +- arch/ia64/configs/generic_defconfig | 2 -- arch/ia64/mm/discontig.c | 6 +++--- arch/x86/kernel/acpi/wakeup_64.S | 2 +- include/linux/kasan.h | 2 +- kernel/gcov/clang.c | 2 +- lib/Kconfig.kasan | 9 ++------- lib/earlycpio.c | 4 ++-- lib/lru_cache.c | 3 ++- lib/parman.c | 4 ++-- lib/radix-tree.c | 11 ++++++----- mm/kasan/common.c | 2 +- mm/kasan/kasan.h | 2 +- mm/kasan/report_generic.c | 2 +- mm/mapping_dirty_helpers.c | 2 ++ mm/mmu_gather.c | 29 +++++++++++++++++++---------- mm/oom_kill.c | 2 +- mm/ptdump.c | 2 +- mm/shuffle.c | 4 ++-- scripts/Makefile.kasan | 22 ++++++++++++++-------- security/Kconfig.hardening | 4 ++-- tools/arch/ia64/include/asm/barrier.h | 3 --- tools/include/uapi/asm/errno.h | 2 -- 25 files changed, 67 insertions(+), 60 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-04-09 20:26 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-04-09 20:26 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 16 patches, based on 17e7124aad766b3f158943acb51467f86220afe9. Subsystems affected by this patch series: MAINTAINERS mailmap mm/kasan mm/gup nds32 gcov ocfs2 ia64 mm/pagecache mm/kasan mm/kfence lib Subsystem: MAINTAINERS Marek Behún <kabel@kernel.org>: MAINTAINERS: update CZ.NIC's Turris information treewide: change my e-mail address, fix my name Subsystem: mailmap Jordan Crouse <jordan@cosmicpenguin.net>: mailmap: update email address for Jordan Crouse Matthew Wilcox <willy@infradead.org>: .mailmap: fix old email addresses Subsystem: mm/kasan Arnd Bergmann <arnd@arndb.de>: kasan: fix hwasan build for gcc Walter Wu <walter-zh.wu@mediatek.com>: kasan: remove redundant config option Subsystem: mm/gup Aili Yao <yaoaili@kingsoft.com>: mm/gup: check page posion status for coredump. Subsystem: nds32 Mike Rapoport <rppt@linux.ibm.com>: nds32: flush_dcache_page: use page_mapping_file to avoid races with swapoff Subsystem: gcov Nick Desaulniers <ndesaulniers@google.com>: gcov: re-fix clang-11+ support Subsystem: ocfs2 Wengang Wang <wen.gang.wang@oracle.com>: ocfs2: fix deadlock between setattr and dio_end_io_write Subsystem: ia64 Sergei Trofimovich <slyfox@gentoo.org>: ia64: fix user_stack_pointer() for ptrace() Subsystem: mm/pagecache Jack Qiu <jack.qiu@huawei.com>: fs: direct-io: fix missing sdio->boundary Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: fix conflict with page poisoning Andrew Morton <akpm@linux-foundation.org>: lib/test_kasan_module.c: suppress unused var warning Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence, x86: fix preemptible warning on KPTI-enabled systems Subsystem: lib Julian Braha <julianbraha@gmail.com>: lib: fix kconfig dependency on ARCH_WANT_FRAME_POINTERS .mailmap | 7 ++ Documentation/ABI/testing/debugfs-moxtet | 4 - Documentation/ABI/testing/debugfs-turris-mox-rwtm | 2 Documentation/ABI/testing/sysfs-bus-moxtet-devices | 6 +- Documentation/ABI/testing/sysfs-class-led-driver-turris-omnia | 2 Documentation/ABI/testing/sysfs-firmware-turris-mox-rwtm | 10 +-- Documentation/devicetree/bindings/leds/cznic,turris-omnia-leds.yaml | 2 MAINTAINERS | 13 +++- arch/arm64/boot/dts/marvell/armada-3720-turris-mox.dts | 2 arch/arm64/kernel/sleep.S | 2 arch/ia64/include/asm/ptrace.h | 8 -- arch/nds32/mm/cacheflush.c | 2 arch/x86/include/asm/kfence.h | 7 ++ arch/x86/kernel/acpi/wakeup_64.S | 2 drivers/bus/moxtet.c | 4 - drivers/firmware/turris-mox-rwtm.c | 4 - drivers/gpio/gpio-moxtet.c | 4 - drivers/leds/leds-turris-omnia.c | 4 - drivers/mailbox/armada-37xx-rwtm-mailbox.c | 4 - drivers/watchdog/armada_37xx_wdt.c | 4 - fs/direct-io.c | 5 + fs/ocfs2/aops.c | 11 --- fs/ocfs2/file.c | 8 ++ include/dt-bindings/bus/moxtet.h | 2 include/linux/armada-37xx-rwtm-mailbox.h | 2 include/linux/kasan.h | 2 include/linux/moxtet.h | 2 kernel/gcov/clang.c | 29 ++++++---- lib/Kconfig.debug | 6 +- lib/Kconfig.kasan | 9 --- lib/test_kasan_module.c | 2 mm/gup.c | 4 + mm/internal.h | 20 ++++++ mm/kasan/common.c | 2 mm/kasan/kasan.h | 2 mm/kasan/report_generic.c | 2 mm/page_poison.c | 4 + scripts/Makefile.kasan | 18 ++++-- security/Kconfig.hardening | 4 - 39 files changed, 136 insertions(+), 91 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-03-25 4:36 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-03-25 4:36 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 14 patches, based on 7acac4b3196caee5e21fb5ea53f8bc124e6a16fc. Subsystems affected by this patch series: mm/hugetlb mm/kasan mm/gup mm/selftests mm/z3fold squashfs ia64 gcov mm/kfence mm/memblock mm/highmem mailmap Subsystem: mm/hugetlb Miaohe Lin <linmiaohe@huawei.com>: hugetlb_cgroup: fix imbalanced css_get and css_put pair for shared mappings Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: fix per-page tags for non-page_alloc pages Subsystem: mm/gup Sean Christopherson <seanjc@google.com>: mm/mmu_notifiers: ensure range_end() is paired with range_start() Subsystem: mm/selftests Rong Chen <rong.a.chen@intel.com>: selftests/vm: fix out-of-tree build Subsystem: mm/z3fold Thomas Hebb <tommyhebb@gmail.com>: z3fold: prevent reclaim/free race for headless pages Subsystem: squashfs Sean Nyekjaer <sean@geanix.com>: squashfs: fix inode lookup sanity checks Phillip Lougher <phillip@squashfs.org.uk>: squashfs: fix xattr id and id lookup sanity checks Subsystem: ia64 Sergei Trofimovich <slyfox@gentoo.org>: ia64: mca: allocate early mca with GFP_ATOMIC ia64: fix format strings for err_inject Subsystem: gcov Nick Desaulniers <ndesaulniers@google.com>: gcov: fix clang-11+ support Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: make compatible with kmemleak Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: mm: memblock: fix section mismatch warning again Subsystem: mm/highmem Ira Weiny <ira.weiny@intel.com>: mm/highmem: fix CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP Subsystem: mailmap Andrey Konovalov <andreyknvl@google.com>: mailmap: update Andrey Konovalov's email address .mailmap | 1 arch/ia64/kernel/err_inject.c | 22 +++++------ arch/ia64/kernel/mca.c | 2 - fs/squashfs/export.c | 8 +++- fs/squashfs/id.c | 6 ++- fs/squashfs/squashfs_fs.h | 1 fs/squashfs/xattr_id.c | 6 ++- include/linux/hugetlb_cgroup.h | 15 ++++++- include/linux/memblock.h | 4 +- include/linux/mm.h | 18 +++++++-- include/linux/mmu_notifier.h | 10 ++--- kernel/gcov/clang.c | 69 ++++++++++++++++++++++++++++++++++++ mm/highmem.c | 4 +- mm/hugetlb.c | 41 +++++++++++++++++++-- mm/hugetlb_cgroup.c | 10 ++++- mm/kfence/core.c | 9 ++++ mm/kmemleak.c | 3 + mm/mmu_notifier.c | 23 ++++++++++++ mm/z3fold.c | 16 +++++++- tools/testing/selftests/vm/Makefile | 4 +- 20 files changed, 230 insertions(+), 42 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-03-13 5:06 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-03-13 5:06 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 29 patches, based on f78d76e72a4671ea52d12752d92077788b4f5d50. Subsystems affected by this patch series: mm/memblock core-kernel kconfig mm/pagealloc fork mm/hugetlb mm/highmem binfmt MAINTAINERS kbuild mm/kfence mm/oom-kill mm/madvise mm/kasan mm/userfaultfd mm/memory-failure ia64 mm/memcg mm/zram Subsystem: mm/memblock Arnd Bergmann <arnd@arndb.de>: memblock: fix section mismatch warning Subsystem: core-kernel Arnd Bergmann <arnd@arndb.de>: stop_machine: mark helpers __always_inline Subsystem: kconfig Masahiro Yamada <masahiroy@kernel.org>: init/Kconfig: make COMPILE_TEST depend on HAS_IOMEM Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: mm/page_alloc.c: refactor initialization of struct page for holes in memory layout Subsystem: fork Fenghua Yu <fenghua.yu@intel.com>: mm/fork: clear PASID for new mm Subsystem: mm/hugetlb Peter Xu <peterx@redhat.com>: Patch series "mm/hugetlb: Early cow on fork, and a few cleanups", v5: hugetlb: dedup the code to add a new file_region hugetlb: break earlier in add_reservation_in_range() when we can mm: introduce page_needs_cow_for_dma() for deciding whether cow mm: use is_cow_mapping() across tree where proper hugetlb: do early cow when page pinned on src mm Subsystem: mm/highmem OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>: mm/highmem.c: fix zero_user_segments() with start > end Subsystem: binfmt Lior Ribak <liorribak@gmail.com>: binfmt_misc: fix possible deadlock in bm_register_write Subsystem: MAINTAINERS Vlastimil Babka <vbabka@suse.cz>: MAINTAINERS: exclude uapi directories in API/ABI section Subsystem: kbuild Arnd Bergmann <arnd@arndb.de>: linux/compiler-clang.h: define HAVE_BUILTIN_BSWAP* Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: fix printk format for ptrdiff_t kfence, slab: fix cache_alloc_debugcheck_after() for bulk allocations kfence: fix reports if constant function prefixes exist Subsystem: mm/oom-kill "Matthew Wilcox (Oracle)" <willy@infradead.org>: include/linux/sched/mm.h: use rcu_dereference in in_vfork() Subsystem: mm/madvise Suren Baghdasaryan <surenb@google.com>: mm/madvise: replace ptrace attach requirement for process_madvise Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan, mm: fix crash with HW_TAGS and DEBUG_PAGEALLOC kasan: fix KASAN_STACK dependency for HW_TAGS Subsystem: mm/userfaultfd Nadav Amit <namit@vmware.com>: mm/userfaultfd: fix memory corruption due to writeprotect Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm, hwpoison: do not lock page again when me_huge_page() successfully recovers Subsystem: ia64 Sergei Trofimovich <slyfox@gentoo.org>: ia64: fix ia64_syscall_get_set_arguments() for break-based syscalls ia64: fix ptrace(PTRACE_SYSCALL_INFO_EXIT) sign Subsystem: mm/memcg Zhou Guanghui <zhouguanghui1@huawei.com>: mm/memcg: rename mem_cgroup_split_huge_fixup to split_page_memcg and add nr_pages argument mm/memcg: set memcg when splitting page Subsystem: mm/zram Minchan Kim <minchan@kernel.org>: zram: fix return value on writeback_store zram: fix broken page writeback MAINTAINERS | 4 arch/ia64/include/asm/syscall.h | 2 arch/ia64/kernel/ptrace.c | 24 +++- drivers/block/zram/zram_drv.c | 17 +- drivers/gpu/drm/vmwgfx/vmwgfx_page_dirty.c | 4 drivers/gpu/drm/vmwgfx/vmwgfx_ttm_glue.c | 2 fs/binfmt_misc.c | 29 ++--- fs/proc/task_mmu.c | 2 include/linux/compiler-clang.h | 6 + include/linux/memblock.h | 4 include/linux/memcontrol.h | 6 - include/linux/mm.h | 21 +++ include/linux/mm_types.h | 1 include/linux/sched/mm.h | 3 include/linux/stop_machine.h | 11 + init/Kconfig | 3 kernel/fork.c | 8 + lib/Kconfig.kasan | 1 mm/highmem.c | 17 ++ mm/huge_memory.c | 10 - mm/hugetlb.c | 123 +++++++++++++++------ mm/internal.h | 5 mm/kfence/report.c | 30 +++-- mm/madvise.c | 13 ++ mm/memcontrol.c | 15 +- mm/memory-failure.c | 4 mm/memory.c | 16 +- mm/page_alloc.c | 167 ++++++++++++++--------------- mm/slab.c | 2 29 files changed, 334 insertions(+), 216 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-02-26 1:14 Andrew Morton 2021-02-26 17:55 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2021-02-26 1:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - The rest of MM. Includes kfence - another runtime memory validator. Not as thorough as KASAN, but it has unmeasurable overhead and is intended to be usable in production builds. - Everything else 118 patches, based on 6fbd6cf85a3be127454a1ad58525a3adcf8612ab. Subsystems affected by this patch series: mm/thp mm/cma mm/vmstat mm/memory-hotplug mm/mlock mm/rmap mm/zswap mm/zsmalloc mm/cleanups mm/kfence mm/kasan2 alpha procfs sysctl misc core-kernel MAINTAINERS lib bitops checkpatch init coredump seq_file gdb ubsan initramfs mm/pagemap2 Subsystem: mm/thp "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Overhaul multi-page lookups for THP", v4: mm: make pagecache tagged lookups return only head pages mm/shmem: use pagevec_lookup in shmem_unlock_mapping mm/swap: optimise get_shadow_from_swap_cache mm: add FGP_ENTRY mm/filemap: rename find_get_entry to mapping_get_entry mm/filemap: add helper for finding pages mm/filemap: add mapping_seek_hole_data iomap: use mapping_seek_hole_data mm: add and use find_lock_entries mm: add an 'end' parameter to find_get_entries mm: add an 'end' parameter to pagevec_lookup_entries mm: remove nr_entries parameter from pagevec_lookup_entries mm: pass pvec directly to find_get_entries mm: remove pagevec_lookup_entries Rik van Riel <riel@surriel.com>: Patch series "mm,thp,shm: limit shmem THP alloc gfp_mask", v6: mm,thp,shmem: limit shmem THP alloc gfp_mask mm,thp,shm: limit gfp mask to no more than specified mm,thp,shmem: make khugepaged obey tmpfs mount flags mm,shmem,thp: limit shmem THP allocations to requested zones Subsystem: mm/cma Roman Gushchin <guro@fb.com>: mm: cma: allocate cma areas bottom-up David Hildenbrand <david@redhat.com>: mm/cma: expose all pages to the buddy if activation of an area fails mm/page_alloc: count CMA pages per zone and print them in /proc/zoneinfo Patrick Daly <pdaly@codeaurora.org>: mm: cma: print region name on failure Subsystem: mm/vmstat Johannes Weiner <hannes@cmpxchg.org>: mm: vmstat: fix NOHZ wakeups for node stat changes mm: vmstat: add some comments on internal storage of byte items Jiang Biao <benbjiang@tencent.com>: mm/vmstat.c: erase latency in vmstat_shepherd Subsystem: mm/memory-hotplug Dan Williams <dan.j.williams@intel.com>: Patch series "mm: Fix pfn_to_online_page() with respect to ZONE_DEVICE", v4: mm: move pfn_to_online_page() out of line mm: teach pfn_to_online_page() to consider subsection validity mm: teach pfn_to_online_page() about ZONE_DEVICE section collisions mm: fix memory_failure() handling of dax-namespace metadata Anshuman Khandual <anshuman.khandual@arm.com>: mm/memory_hotplug: rename all existing 'memhp' into 'mhp' David Hildenbrand <david@redhat.com>: mm/memory_hotplug: MEMHP_MERGE_RESOURCE -> MHP_MERGE_RESOURCE Miaohe Lin <linmiaohe@huawei.com>: mm/memory_hotplug: use helper function zone_end_pfn() to get end_pfn David Hildenbrand <david@redhat.com>: drivers/base/memory: don't store phys_device in memory blocks Documentation: sysfs/memory: clarify some memory block device properties Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/memory_hotplug: Pre-validate the address range with platform", v5: mm/memory_hotplug: prevalidate the address range being added with platform arm64/mm: define arch_get_mappable_range() s390/mm: define arch_get_mappable_range() David Hildenbrand <david@redhat.com>: virtio-mem: check against mhp_get_pluggable_range() which memory we can hotplug Subsystem: mm/mlock Miaohe Lin <linmiaohe@huawei.com>: mm/mlock: stop counting mlocked pages when none vma is found Subsystem: mm/rmap Miaohe Lin <linmiaohe@huawei.com>: mm/rmap: correct some obsolete comments of anon_vma mm/rmap: remove unneeded semicolon in page_not_mapped() mm/rmap: fix obsolete comment in __page_check_anon_rmap() mm/rmap: use page_not_mapped in try_to_unmap() mm/rmap: correct obsolete comment of page_get_anon_vma() mm/rmap: fix potential pte_unmap on an not mapped pte Subsystem: mm/zswap Randy Dunlap <rdunlap@infradead.org>: mm: zswap: clean up confusing comment Tian Tao <tiantao6@hisilicon.com>: Patch series "Fix the compatibility of zsmalloc and zswap": mm/zswap: add the flag can_sleep_mapped mm: set the sleep_mapped to true for zbud and z3fold Subsystem: mm/zsmalloc Miaohe Lin <linmiaohe@huawei.com>: mm/zsmalloc.c: convert to use kmem_cache_zalloc in cache_alloc_zspage() Rokudo Yan <wu-yan@tcl.com>: zsmalloc: account the number of compacted pages correctly Miaohe Lin <linmiaohe@huawei.com>: mm/zsmalloc.c: use page_private() to access page->private Subsystem: mm/cleanups Guo Ren <guoren@linux.alibaba.com>: mm: page-flags.h: Typo fix (It -> If) Daniel Vetter <daniel.vetter@ffwll.ch>: mm/dmapool: use might_alloc() mm/backing-dev.c: use might_alloc() Stephen Zhang <stephenzhangzsd@gmail.com>: mm/early_ioremap.c: use __func__ instead of function name Subsystem: mm/kfence Alexander Potapenko <glider@google.com>: Patch series "KFENCE: A low-overhead sampling-based memory safety error detector", v7: mm: add Kernel Electric-Fence infrastructure x86, kfence: enable KFENCE for x86 Marco Elver <elver@google.com>: arm64, kfence: enable KFENCE for ARM64 kfence: use pt_regs to generate stack trace on faults Alexander Potapenko <glider@google.com>: mm, kfence: insert KFENCE hooks for SLAB mm, kfence: insert KFENCE hooks for SLUB kfence, kasan: make KFENCE compatible with KASAN Marco Elver <elver@google.com>: kfence, Documentation: add KFENCE documentation kfence: add test suite MAINTAINERS: add entry for KFENCE kfence: report sensitive information based on no_hash_pointers Alexander Potapenko <glider@google.com>: Patch series "Add error_report_end tracepoint to KFENCE and KASAN", v3: tracing: add error_report_end trace point kfence: use error_report_end tracepoint kasan: use error_report_end tracepoint Subsystem: mm/kasan2 Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: optimizations and fixes for HW_TAGS", v4: kasan, mm: don't save alloc stacks twice kasan, mm: optimize kmalloc poisoning kasan: optimize large kmalloc poisoning kasan: clean up setting free info in kasan_slab_free kasan: unify large kfree checks kasan: rework krealloc tests kasan, mm: fail krealloc on freed objects kasan, mm: optimize krealloc poisoning kasan: ensure poisoning size alignment arm64: kasan: simplify and inline MTE functions kasan: inline HW_TAGS helper functions kasan: clarify that only first bug is reported in HW_TAGS Subsystem: alpha Randy Dunlap <rdunlap@infradead.org>: alpha: remove CONFIG_EXPERIMENTAL from defconfigs Subsystem: procfs Helge Deller <deller@gmx.de>: proc/wchan: use printk format instead of lookup_symbol_name() Josef Bacik <josef@toxicpanda.com>: proc: use kvzalloc for our kernel buffer Subsystem: sysctl Lin Feng <linf@wangsu.com>: sysctl.c: fix underflow value setting risk in vm_table Subsystem: misc Randy Dunlap <rdunlap@infradead.org>: include/linux: remove repeated words Miguel Ojeda <ojeda@kernel.org>: treewide: Miguel has moved Subsystem: core-kernel Hubert Jasudowicz <hubert.jasudowicz@gmail.com>: groups: use flexible-array member in struct group_info groups: simplify struct group_info allocation Randy Dunlap <rdunlap@infradead.org>: kernel: delete repeated words in comments Subsystem: MAINTAINERS Vlastimil Babka <vbabka@suse.cz>: MAINTAINERS: add uapi directories to API/ABI section Subsystem: lib Huang Shijie <sjhuang@iluvatar.ai>: lib/genalloc.c: change return type to unsigned long for bitmap_set_ll Francis Laniel <laniel_francis@privacyrequired.com>: string.h: move fortified functions definitions in a dedicated header. Yogesh Lal <ylal@codeaurora.org>: lib: stackdepot: add support to configure STACK_HASH_SIZE Vijayanand Jitta <vjitta@codeaurora.org>: lib: stackdepot: add support to disable stack depot lib: stackdepot: fix ignoring return value warning Masahiro Yamada <masahiroy@kernel.org>: lib/cmdline: remove an unneeded local variable in next_arg() Subsystem: bitops Geert Uytterhoeven <geert+renesas@glider.be>: include/linux/bitops.h: spelling s/synomyn/synonym/ Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: improve blank line after declaration test Peng Wang <rocking@linux.alibaba.com>: checkpatch: ignore warning designated initializers using NR_CPUS Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: trivial style fixes Joe Perches <joe@perches.com>: checkpatch: prefer ftrace over function entry/exit printks checkpatch: improve TYPECAST_INT_CONSTANT test message Aditya Srivastava <yashsri421@gmail.com>: checkpatch: add warning for avoiding .L prefix symbols in assembly files Joe Perches <joe@perches.com>: checkpatch: add kmalloc_array_node to unnecessary OOM message check Chris Down <chris@chrisdown.name>: checkpatch: don't warn about colon termination in linker scripts Song Liu <songliubraving@fb.com>: checkpatch: do not apply "initialise globals to 0" check to BPF progs Subsystem: init Masahiro Yamada <masahiroy@kernel.org>: init/version.c: remove Version_<LINUX_VERSION_CODE> symbol init: clean up early_param_on_off() macro Bhaskar Chowdhury <unixbhaskar@gmail.com>: init/Kconfig: fix a typo in CC_VERSION_TEXT help text Subsystem: coredump Ira Weiny <ira.weiny@intel.com>: fs/coredump: use kmap_local_page() Subsystem: seq_file NeilBrown <neilb@suse.de>: Patch series "Fix some seq_file users that were recently broken": seq_file: document how per-entry resources are managed. x86: fix seq_file iteration for pat/memtype.c Subsystem: gdb George Prekas <prekageo@amazon.com>: scripts/gdb: fix list_for_each Sumit Garg <sumit.garg@linaro.org>: kgdb: fix to kill breakpoints on initmem after boot Subsystem: ubsan Andrey Ryabinin <ryabinin.a.a@gmail.com>: ubsan: remove overflow checks Subsystem: initramfs Florian Fainelli <f.fainelli@gmail.com>: initramfs: panic with memory information Subsystem: mm/pagemap2 Huang Pei <huangpei@loongson.cn>: MIPS: make userspace mapping young by default .mailmap | 1 CREDITS | 9 Documentation/ABI/testing/sysfs-devices-memory | 58 - Documentation/admin-guide/auxdisplay/cfag12864b.rst | 2 Documentation/admin-guide/auxdisplay/ks0108.rst | 2 Documentation/admin-guide/kernel-parameters.txt | 6 Documentation/admin-guide/mm/memory-hotplug.rst | 20 Documentation/dev-tools/index.rst | 1 Documentation/dev-tools/kasan.rst | 8 Documentation/dev-tools/kfence.rst | 318 +++++++ Documentation/filesystems/seq_file.rst | 6 MAINTAINERS | 26 arch/alpha/configs/defconfig | 1 arch/arm64/Kconfig | 1 arch/arm64/include/asm/cache.h | 1 arch/arm64/include/asm/kasan.h | 1 arch/arm64/include/asm/kfence.h | 26 arch/arm64/include/asm/mte-def.h | 2 arch/arm64/include/asm/mte-kasan.h | 65 + arch/arm64/include/asm/mte.h | 2 arch/arm64/kernel/mte.c | 46 - arch/arm64/lib/mte.S | 16 arch/arm64/mm/fault.c | 8 arch/arm64/mm/mmu.c | 23 arch/mips/mm/cache.c | 30 arch/s390/mm/init.c | 1 arch/s390/mm/vmem.c | 14 arch/x86/Kconfig | 1 arch/x86/include/asm/kfence.h | 76 + arch/x86/mm/fault.c | 10 arch/x86/mm/pat/memtype.c | 4 drivers/auxdisplay/cfag12864b.c | 4 drivers/auxdisplay/cfag12864bfb.c | 4 drivers/auxdisplay/ks0108.c | 4 drivers/base/memory.c | 35 drivers/block/zram/zram_drv.c | 2 drivers/hv/hv_balloon.c | 2 drivers/virtio/virtio_mem.c | 43 drivers/xen/balloon.c | 2 fs/coredump.c | 4 fs/iomap/seek.c | 125 -- fs/proc/base.c | 21 fs/proc/proc_sysctl.c | 4 include/linux/bitops.h | 2 include/linux/cfag12864b.h | 2 include/linux/cred.h | 2 include/linux/fortify-string.h | 302 ++++++ include/linux/gfp.h | 2 include/linux/init.h | 4 include/linux/kasan.h | 25 include/linux/kfence.h | 230 +++++ include/linux/kgdb.h | 2 include/linux/khugepaged.h | 2 include/linux/ks0108.h | 2 include/linux/mdev.h | 2 include/linux/memory.h | 3 include/linux/memory_hotplug.h | 33 include/linux/memremap.h | 6 include/linux/mmzone.h | 49 - include/linux/page-flags.h | 4 include/linux/pagemap.h | 10 include/linux/pagevec.h | 10 include/linux/pgtable.h | 8 include/linux/ptrace.h | 2 include/linux/rmap.h | 3 include/linux/slab_def.h | 3 include/linux/slub_def.h | 3 include/linux/stackdepot.h | 9 include/linux/string.h | 282 ------ include/linux/vmstat.h | 6 include/linux/zpool.h | 3 include/linux/zsmalloc.h | 2 include/trace/events/error_report.h | 74 + include/uapi/linux/firewire-cdev.h | 2 include/uapi/linux/input.h | 2 init/Kconfig | 2 init/initramfs.c | 19 init/main.c | 6 init/version.c | 8 kernel/debug/debug_core.c | 11 kernel/events/core.c | 8 kernel/events/uprobes.c | 2 kernel/groups.c | 7 kernel/locking/rtmutex.c | 4 kernel/locking/rwsem.c | 2 kernel/locking/semaphore.c | 2 kernel/sched/fair.c | 2 kernel/sched/membarrier.c | 2 kernel/sysctl.c | 8 kernel/trace/Makefile | 1 kernel/trace/error_report-traces.c | 12 lib/Kconfig | 9 lib/Kconfig.debug | 1 lib/Kconfig.kfence | 84 + lib/Kconfig.ubsan | 17 lib/cmdline.c | 7 lib/genalloc.c | 3 lib/stackdepot.c | 41 lib/test_kasan.c | 111 ++ lib/test_ubsan.c | 49 - lib/ubsan.c | 68 - mm/Makefile | 1 mm/backing-dev.c | 3 mm/cma.c | 64 - mm/dmapool.c | 3 mm/early_ioremap.c | 12 mm/filemap.c | 361 +++++--- mm/huge_memory.c | 6 mm/internal.h | 6 mm/kasan/common.c | 213 +++- mm/kasan/generic.c | 3 mm/kasan/hw_tags.c | 2 mm/kasan/kasan.h | 97 +- mm/kasan/report.c | 8 mm/kasan/shadow.c | 78 + mm/kfence/Makefile | 6 mm/kfence/core.c | 875 +++++++++++++++++++- mm/kfence/kfence.h | 126 ++ mm/kfence/kfence_test.c | 860 +++++++++++++++++++ mm/kfence/report.c | 350 ++++++-- mm/khugepaged.c | 22 mm/memory-failure.c | 6 mm/memory.c | 4 mm/memory_hotplug.c | 178 +++- mm/memremap.c | 23 mm/mlock.c | 2 mm/page_alloc.c | 1 mm/rmap.c | 24 mm/shmem.c | 160 +-- mm/slab.c | 38 mm/slab_common.c | 29 mm/slub.c | 63 + mm/swap.c | 54 - mm/swap_state.c | 7 mm/truncate.c | 141 --- mm/vmstat.c | 35 mm/z3fold.c | 1 mm/zbud.c | 1 mm/zpool.c | 13 mm/zsmalloc.c | 22 mm/zswap.c | 57 + samples/auxdisplay/cfag12864b-example.c | 2 scripts/Makefile.ubsan | 2 scripts/checkpatch.pl | 152 ++- scripts/gdb/linux/lists.py | 5 145 files changed, 5046 insertions(+), 1682 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-02-26 1:14 incoming Andrew Morton @ 2021-02-26 17:55 ` Linus Torvalds 2021-02-26 19:16 ` incoming Andrew Morton 0 siblings, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2021-02-26 17:55 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > - The rest of MM. > > Includes kfence - another runtime memory validator. Not as > thorough as KASAN, but it has unmeasurable overhead and is intended > to be usable in production builds. > > - Everything else Just to clarify: you have nothing else really pending? I'm hoping to just do -rc1 this weekend after all - despite my late start due to loss of power for several days. I'll allow late stragglers with good reason through, but the fewer of those there are, the better, of course. Thanks, Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-02-26 17:55 ` incoming Linus Torvalds @ 2021-02-26 19:16 ` Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-02-26 19:16 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, Linux-MM On Fri, 26 Feb 2021 09:55:27 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > - The rest of MM. > > > > Includes kfence - another runtime memory validator. Not as > > thorough as KASAN, but it has unmeasurable overhead and is intended > > to be usable in production builds. > > > > - Everything else > > Just to clarify: you have nothing else really pending? Yes, that's it from me for -rc1. ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-02-24 19:58 Andrew Morton 2021-02-24 21:30 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2021-02-24 19:58 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits A few small subsystems and some of MM. 173 patches, based on c03c21ba6f4e95e406a1a7b4c34ef334b977c194. Subsystems affected by this patch series: hexagon scripts ntfs ocfs2 vfs mm/slab-generic mm/slab mm/slub mm/debug mm/pagecache mm/swap mm/memcg mm/pagemap mm/mprotect mm/mremap mm/page-reporting mm/vmalloc mm/kasan mm/pagealloc mm/memory-failure mm/hugetlb mm/vmscan mm/z3fold mm/compaction mm/mempolicy mm/oom-kill mm/hugetlbfs mm/migration Subsystem: hexagon Randy Dunlap <rdunlap@infradead.org>: hexagon: remove CONFIG_EXPERIMENTAL from defconfigs Subsystem: scripts tangchunyou <tangchunyou@yulong.com>: scripts/spelling.txt: increase error-prone spell checking zuoqilin <zuoqilin@yulong.com>: scripts/spelling.txt: check for "exeeds" dingsenjie <dingsenjie@yulong.com>: scripts/spelling.txt: add "allocted" and "exeeds" typo Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ntfs Randy Dunlap <rdunlap@infradead.org>: ntfs: layout.h: delete duplicated words Rustam Kovhaev <rkovhaev@gmail.com>: ntfs: check for valid standard information attribute Subsystem: ocfs2 Yi Li <yili@winhong.com>: ocfs2: remove redundant conditional before iput guozh <guozh88@chinatelecom.cn>: ocfs2: clean up some definitions which are not used any more Dan Carpenter <dan.carpenter@oracle.com>: ocfs2: fix a use after free on error Jiapeng Chong <jiapeng.chong@linux.alibaba.com>: ocfs2: simplify the calculation of variables Subsystem: vfs Randy Dunlap <rdunlap@infradead.org>: fs: delete repeated words in comments Alexey Dobriyan <adobriyan@gmail.com>: ramfs: support O_TMPFILE Subsystem: mm/slab-generic Jacob Wen <jian.w.wen@oracle.com>: mm, tracing: record slab name for kmem_cache_free() Nikolay Borisov <nborisov@suse.com>: mm/sl?b.c: remove ctor argument from kmem_cache_flags Subsystem: mm/slab Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/slab: minor coding style tweaks Subsystem: mm/slub Johannes Berg <johannes.berg@intel.com>: mm/slub: disable user tracing for kmemleak caches by default Vlastimil Babka <vbabka@suse.cz>: Patch series "mm, slab, slub: remove cpu and memory hotplug locks": mm, slub: stop freeing kmem_cache_node structures on node offline mm, slab, slub: stop taking memory hotplug lock mm, slab, slub: stop taking cpu hotplug lock mm, slub: splice cpu and page freelists in deactivate_slab() mm, slub: remove slub_memcg_sysfs boot param and CONFIG_SLUB_MEMCG_SYSFS_ON Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/slub: minor coding style tweaks Subsystem: mm/debug "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/debug: improve memcg debugging Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/debug_vm_pgtable: Some minor updates", v3: mm/debug_vm_pgtable/basic: add validation for dirtiness after write protect mm/debug_vm_pgtable/basic: iterate over entire protection_map[] Miaohe Lin <linmiaohe@huawei.com>: mm/page_owner: use helper function zone_end_pfn() to get end_pfn Subsystem: mm/pagecache Baolin Wang <baolin.wang@linux.alibaba.com>: mm/filemap: remove unused parameter and change to void type for replace_page_cache_page() Pavel Begunkov <asml.silence@gmail.com>: mm/filemap: don't revert iter on -EIOCBQUEUED "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Refactor generic_file_buffered_read", v5: mm/filemap: rename generic_file_buffered_read subfunctions mm/filemap: remove dynamically allocated array from filemap_read mm/filemap: convert filemap_get_pages to take a pagevec mm/filemap: use head pages in generic_file_buffered_read mm/filemap: pass a sleep state to put_and_wait_on_page_locked mm/filemap: support readpage splitting a page mm/filemap: inline __wait_on_page_locked_async into caller mm/filemap: don't call ->readpage if IOCB_WAITQ is set mm/filemap: change filemap_read_page calling conventions mm/filemap: change filemap_create_page calling conventions mm/filemap: convert filemap_update_page to return an errno mm/filemap: move the iocb checks into filemap_update_page mm/filemap: add filemap_range_uptodate mm/filemap: split filemap_readahead out of filemap_get_pages mm/filemap: restructure filemap_get_pages mm/filemap: don't relock the page after calling readpage Christoph Hellwig <hch@lst.de>: mm/filemap: rename generic_file_buffered_read to filemap_read mm/filemap: simplify generic_file_read_iter Yang Guo <guoyang2@huawei.com>: fs/buffer.c: add checking buffer head stat before clear Baolin Wang <baolin.wang@linux.alibaba.com>: mm: backing-dev: Remove duplicated macro definition Subsystem: mm/swap Yang Li <abaci-bugfix@linux.alibaba.com>: mm/swap_slots.c: remove redundant NULL check Stephen Zhang <stephenzhangzsd@gmail.com>: mm/swapfile.c: fix debugging information problem Georgi Djakov <georgi.djakov@linaro.org>: mm/page_io: use pr_alert_ratelimited for swap read/write errors Rikard Falkeborn <rikard.falkeborn@gmail.com>: mm/swap_state: constify static struct attribute_group Yu Zhao <yuzhao@google.com>: mm/swap: don't SetPageWorkingset unconditionally during swapin Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: memcg/slab: pre-allocate obj_cgroups for slab caches with SLAB_ACCOUNT Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: optimize per-lruvec stats counter memory usage Patch series "Convert all THP vmstat counters to pages", v6: mm: memcontrol: fix NR_ANON_THPS accounting in charge moving mm: memcontrol: convert NR_ANON_THPS account to pages mm: memcontrol: convert NR_FILE_THPS account to pages mm: memcontrol: convert NR_SHMEM_THPS account to pages mm: memcontrol: convert NR_SHMEM_PMDMAPPED account to pages mm: memcontrol: convert NR_FILE_PMDMAPPED account to pages mm: memcontrol: make the slab calculation consistent Alex Shi <alex.shi@linux.alibaba.com>: mm/memcg: revise the using condition of lock_page_lruvec function series mm/memcg: remove rcu locking for lock_page_lruvec function series Shakeel Butt <shakeelb@google.com>: mm: memcg: add swapcache stat for memcg v2 Roman Gushchin <guro@fb.com>: mm: kmem: make __memcg_kmem_(un)charge static Feng Tang <feng.tang@intel.com>: mm: page_counter: re-layout structure to reduce false sharing Yang Li <abaci-bugfix@linux.alibaba.com>: mm/memcontrol: remove redundant NULL check Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: replace the loop with a list_for_each_entry() Shakeel Butt <shakeelb@google.com>: mm/list_lru.c: remove kvfree_rcu_local() Johannes Weiner <hannes@cmpxchg.org>: fs: buffer: use raw page_memcg() on locked page Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: fix swap undercounting in cgroup2 mm: memcontrol: fix get_active_memcg return value mm: memcontrol: fix slub memory accounting Subsystem: mm/pagemap Adrian Huang <ahuang12@lenovo.com>: mm/mmap.c: remove unnecessary local variable Miaohe Lin <linmiaohe@huawei.com>: mm/memory.c: fix potential pte_unmap_unlock pte error mm/pgtable-generic.c: simplify the VM_BUG_ON condition in pmdp_huge_clear_flush() mm/pgtable-generic.c: optimize the VM_BUG_ON condition in pmdp_huge_clear_flush() mm/memory.c: fix potential pte_unmap_unlock pte error Subsystem: mm/mprotect Tianjia Zhang <tianjia.zhang@linux.alibaba.com>: mm/mprotect.c: optimize error detection in do_mprotect_pkey() Subsystem: mm/mremap Li Xinhai <lixinhai.lxh@gmail.com>: mm: rmap: explicitly reset vma->anon_vma in unlink_anon_vmas() mm: mremap: unlink anon_vmas when mremap with MREMAP_DONTUNMAP success Subsystem: mm/page-reporting sh <sh_def@163.com>: mm/page_reporting: use list_entry_is_head() in page_reporting_cycle() Subsystem: mm/vmalloc Yang Li <abaci-bugfix@linux.alibaba.com>: vmalloc: remove redundant NULL check Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: HW_TAGS tests support and fixes", v4: kasan: prefix global functions with kasan_ kasan: clarify HW_TAGS impact on TBI kasan: clean up comments in tests kasan: add macros to simplify checking test constraints kasan: add match-all tag tests kasan, arm64: allow using KUnit tests with HW_TAGS mode kasan: rename CONFIG_TEST_KASAN_MODULE kasan: add compiler barriers to KUNIT_EXPECT_KASAN_FAIL kasan: adapt kmalloc_uaf2 test to HW_TAGS mode kasan: fix memory corruption in kasan_bitops_tags test kasan: move _RET_IP_ to inline wrappers kasan: fix bug detection via ksize for HW_TAGS mode kasan: add proper page allocator tests kasan: add a test for kmem_cache_alloc/free_bulk kasan: don't run tests when KASAN is not enabled Walter Wu <walter-zh.wu@mediatek.com>: kasan: remove redundant config option Subsystem: mm/pagealloc Baoquan He <bhe@redhat.com>: Patch series "mm: clean up names and parameters of memmap_init_xxxx functions", v5: mm: fix prototype warning from kernel test robot mm: rename memmap_init() and memmap_init_zone() mm: simplify parater of function memmap_init_zone() mm: simplify parameter of setup_usemap() mm: remove unneeded local variable in free_area_init_core David Hildenbrand <david@redhat.com>: Patch series "mm: simplify free_highmem_page() and free_reserved_page()": video: fbdev: acornfb: remove free_unused_pages() mm: simplify free_highmem_page() and free_reserved_page() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/gfp: add kernel-doc for gfp_t Subsystem: mm/memory-failure Aili Yao <yaoaili@kingsoft.com>: mm,hwpoison: send SIGBUS to PF_MCE_EARLY processes on action required events Subsystem: mm/hugetlb Bibo Mao <maobibo@loongson.cn>: mm/huge_memory.c: update tlb entry if pmd is changed MIPS: do not call flush_tlb_all when setting pmd entry Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: fix potential double free in hugetlb_register_node() error path Li Xinhai <lixinhai.lxh@gmail.com>: mm/hugetlb.c: fix unnecessary address expansion of pmd sharing Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: avoid unnecessary hugetlb_acct_memory() call mm/hugetlb: use helper huge_page_order and pages_per_huge_page mm/hugetlb: fix use after free when subpool max_hpages accounting is not enabled Jiapeng Zhong <abaci-bugfix@linux.alibaba.com>: mm/hugetlb: simplify the calculation of variables Joao Martins <joao.m.martins@oracle.com>: Patch series "mm/hugetlb: follow_hugetlb_page() improvements", v2: mm/hugetlb: grab head page refcount once for group of subpages mm/hugetlb: refactor subpage recording Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: fix some comment typos Yanfei Xu <yanfei.xu@windriver.com>: mm/hugetlb: remove redundant check in preparing and destroying gigantic page Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/hugetlb.c: fix typos in comments Miaohe Lin <linmiaohe@huawei.com>: mm/huge_memory.c: remove unused return value of set_huge_zero_page() "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/pmem: avoid inserting hugepage PTE entry with fsdax if hugepage support is disabled Miaohe Lin <linmiaohe@huawei.com>: hugetlb_cgroup: use helper pages_per_huge_page() in hugetlb_cgroup mm/hugetlb: use helper function range_in_vma() in page_table_shareable() mm/hugetlb: remove unnecessary VM_BUG_ON_PAGE on putback_active_hugepage() mm/hugetlb: use helper huge_page_size() to get hugepage size Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: fix update_and_free_page contig page struct assumption hugetlb: fix copy_huge_page_from_user contig page struct assumption Chen Wandun <chenwandun@huawei.com>: mm/hugetlb: suppress wrong warning info when alloc gigantic page Subsystem: mm/vmscan Alex Shi <alex.shi@linux.alibaba.com>: mm/vmscan: __isolate_lru_page_prepare() cleanup Miaohe Lin <linmiaohe@huawei.com>: mm/workingset.c: avoid unnecessary max_nodes estimation in count_shadow_nodes() Yu Zhao <yuzhao@google.com>: Patch series "mm: lru related cleanups", v2: mm/vmscan.c: use add_page_to_lru_list() include/linux/mm_inline.h: shuffle lru list addition and deletion functions mm: don't pass "enum lru_list" to lru list addition functions mm/swap.c: don't pass "enum lru_list" to trace_mm_lru_insertion() mm/swap.c: don't pass "enum lru_list" to del_page_from_lru_list() mm: add __clear_page_lru_flags() to replace page_off_lru() mm: VM_BUG_ON lru page flags include/linux/mm_inline.h: fold page_lru_base_type() into its sole caller include/linux/mm_inline.h: fold __update_lru_size() into its sole caller mm/vmscan.c: make lruvec_lru_size() static Oscar Salvador <osalvador@suse.de>: mm: workingset: clarify eviction order and distance calculation Mike Kravetz <mike.kravetz@oracle.com>: Patch series "create hugetlb flags to consolidate state", v3: hugetlb: use page.private for hugetlb specific page flags hugetlb: convert page_huge_active() HPageMigratable flag hugetlb: convert PageHugeTemporary() to HPageTemporary flag hugetlb: convert PageHugeFreed to HPageFreed flag include/linux/hugetlb.h: add synchronization information for new hugetlb specific flags hugetlb: fix uninitialized subpool pointer Dave Hansen <dave.hansen@linux.intel.com>: mm/vmscan: restore zone_reclaim_mode ABI Subsystem: mm/z3fold Miaohe Lin <linmiaohe@huawei.com>: z3fold: remove unused attribute for release_z3fold_page z3fold: simplify the zhdr initialization code in init_z3fold_page() Subsystem: mm/compaction Alex Shi <alex.shi@linux.alibaba.com>: mm/compaction: remove rcu_read_lock during page compaction Miaohe Lin <linmiaohe@huawei.com>: mm/compaction: remove duplicated VM_BUG_ON_PAGE !PageLocked Charan Teja Reddy <charante@codeaurora.org>: mm/compaction: correct deferral logic for proactive compaction Wonhyuk Yang <vvghjk1234@gmail.com>: mm/compaction: fix misbehaviors of fast_find_migrateblock() Vlastimil Babka <vbabka@suse.cz>: mm, compaction: make fast_isolate_freepages() stay within zone Subsystem: mm/mempolicy Huang Ying <ying.huang@intel.com>: numa balancing: migrate on fault among multiple bound nodes Miaohe Lin <linmiaohe@huawei.com>: mm/mempolicy: use helper range_in_vma() in queue_pages_test_walk() Subsystem: mm/oom-kill Tang Yizhou <tangyizhou@huawei.com>: mm, oom: fix a comment in dump_task() Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: mm/hugetlb: change hugetlb_reserve_pages() to type bool hugetlbfs: remove special hugetlbfs_set_page_dirty() Miaohe Lin <linmiaohe@huawei.com>: hugetlbfs: remove useless BUG_ON(!inode) in hugetlbfs_setattr() hugetlbfs: use helper macro default_hstate in init_hugetlbfs_fs hugetlbfs: correct obsolete function name in hugetlbfs_read_iter() hugetlbfs: remove meaningless variable avoid_reserve hugetlbfs: make hugepage size conversion more readable hugetlbfs: correct some obsolete comments about inode i_mutex hugetlbfs: fix some comment typos hugetlbfs: remove unneeded return value of hugetlb_vmtruncate() Subsystem: mm/migration Chengyang Fan <cy.fan@huawei.com>: mm/migrate: remove unneeded semicolons Documentation/admin-guide/cgroup-v2.rst | 4 Documentation/admin-guide/kernel-parameters.txt | 8 Documentation/admin-guide/sysctl/vm.rst | 10 Documentation/core-api/mm-api.rst | 7 Documentation/dev-tools/kasan.rst | 24 Documentation/vm/arch_pgtable_helpers.rst | 8 arch/arm64/include/asm/memory.h | 1 arch/arm64/include/asm/mte-kasan.h | 12 arch/arm64/kernel/mte.c | 12 arch/arm64/kernel/sleep.S | 2 arch/arm64/mm/fault.c | 20 arch/hexagon/configs/comet_defconfig | 1 arch/ia64/include/asm/pgtable.h | 6 arch/ia64/mm/init.c | 18 arch/mips/mm/pgtable-32.c | 1 arch/mips/mm/pgtable-64.c | 1 arch/x86/kernel/acpi/wakeup_64.S | 2 drivers/base/node.c | 33 drivers/video/fbdev/acornfb.c | 34 fs/block_dev.c | 2 fs/btrfs/file.c | 2 fs/buffer.c | 7 fs/dcache.c | 4 fs/direct-io.c | 4 fs/exec.c | 4 fs/fhandle.c | 2 fs/fuse/dev.c | 6 fs/hugetlbfs/inode.c | 72 -- fs/ntfs/inode.c | 6 fs/ntfs/layout.h | 4 fs/ocfs2/cluster/heartbeat.c | 8 fs/ocfs2/dlm/dlmast.c | 10 fs/ocfs2/dlm/dlmcommon.h | 4 fs/ocfs2/refcounttree.c | 2 fs/ocfs2/super.c | 2 fs/pipe.c | 2 fs/proc/meminfo.c | 10 fs/proc/vmcore.c | 7 fs/ramfs/inode.c | 13 include/linux/fs.h | 4 include/linux/gfp.h | 14 include/linux/highmem-internal.h | 5 include/linux/huge_mm.h | 15 include/linux/hugetlb.h | 98 ++ include/linux/kasan-checks.h | 6 include/linux/kasan.h | 39 - include/linux/memcontrol.h | 43 - include/linux/migrate.h | 2 include/linux/mm.h | 28 include/linux/mm_inline.h | 123 +-- include/linux/mmzone.h | 30 include/linux/page-flags.h | 6 include/linux/page_counter.h | 9 include/linux/pagemap.h | 5 include/linux/swap.h | 8 include/trace/events/kmem.h | 24 include/trace/events/pagemap.h | 11 include/uapi/linux/mempolicy.h | 4 init/Kconfig | 14 lib/Kconfig.kasan | 14 lib/Makefile | 2 lib/test_kasan.c | 446 ++++++++---- lib/test_kasan_module.c | 5 mm/backing-dev.c | 6 mm/compaction.c | 73 +- mm/debug.c | 10 mm/debug_vm_pgtable.c | 86 ++ mm/filemap.c | 859 +++++++++++------------- mm/gup.c | 5 mm/huge_memory.c | 28 mm/hugetlb.c | 376 ++++------ mm/hugetlb_cgroup.c | 6 mm/kasan/common.c | 60 - mm/kasan/generic.c | 40 - mm/kasan/hw_tags.c | 16 mm/kasan/kasan.h | 87 +- mm/kasan/quarantine.c | 22 mm/kasan/report.c | 15 mm/kasan/report_generic.c | 10 mm/kasan/report_hw_tags.c | 8 mm/kasan/report_sw_tags.c | 8 mm/kasan/shadow.c | 27 mm/kasan/sw_tags.c | 22 mm/khugepaged.c | 6 mm/list_lru.c | 12 mm/memcontrol.c | 309 ++++---- mm/memory-failure.c | 34 mm/memory.c | 24 mm/memory_hotplug.c | 11 mm/mempolicy.c | 18 mm/mempool.c | 2 mm/migrate.c | 10 mm/mlock.c | 3 mm/mmap.c | 4 mm/mprotect.c | 7 mm/mremap.c | 8 mm/oom_kill.c | 5 mm/page_alloc.c | 70 - mm/page_io.c | 12 mm/page_owner.c | 4 mm/page_reporting.c | 2 mm/pgtable-generic.c | 9 mm/rmap.c | 35 mm/shmem.c | 2 mm/slab.c | 21 mm/slab.h | 20 mm/slab_common.c | 40 - mm/slob.c | 2 mm/slub.c | 169 ++-- mm/swap.c | 54 - mm/swap_slots.c | 3 mm/swap_state.c | 31 mm/swapfile.c | 8 mm/vmscan.c | 100 +- mm/vmstat.c | 14 mm/workingset.c | 7 mm/z3fold.c | 11 scripts/Makefile.kasan | 10 scripts/spelling.txt | 30 tools/objtool/check.c | 2 120 files changed, 2249 insertions(+), 1954 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-02-24 19:58 incoming Andrew Morton @ 2021-02-24 21:30 ` Linus Torvalds 2021-02-24 21:37 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2021-02-24 21:30 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Wed, Feb 24, 2021 at 11:58 AM Andrew Morton <akpm@linux-foundation.org> wrote: > > A few small subsystems and some of MM. Hmm. I haven't bisected things yet, but I suspect it's something with the KASAN patches. With this all applied, I get: lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’: lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=] and lib/bitfield_kunit.c: In function ‘test_bitfields_constants’: lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is larger than 2048 bytes [-Wframe-larger-than=] which is obviously not really acceptable. A 11kB stack frame _will_ cause issues. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-02-24 21:30 ` incoming Linus Torvalds @ 2021-02-24 21:37 ` Linus Torvalds 2021-02-25 8:53 ` incoming Arnd Bergmann 0 siblings, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2021-02-24 21:37 UTC (permalink / raw) To: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor, Arnd Bergmann, Andrey Konovalov Cc: Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > Hmm. I haven't bisected things yet, but I suspect it's something with > the KASAN patches. With this all applied, I get: > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’: > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=] > > and > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’: > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is > larger than 2048 bytes [-Wframe-larger-than=] > > which is obviously not really acceptable. A 11kB stack frame _will_ > cause issues. A quick bisect shoes that this was introduced by "[patch 101/173] kasan: remove redundant config option". I didn't check what part of that patch screws up, but it's definitely doing something bad. I will drop that patch. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-02-24 21:37 ` incoming Linus Torvalds @ 2021-02-25 8:53 ` Arnd Bergmann 2021-02-25 9:12 ` incoming Andrey Ryabinin 0 siblings, 1 reply; 348+ messages in thread From: Arnd Bergmann @ 2021-02-25 8:53 UTC (permalink / raw) To: Linus Torvalds Cc: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds > <torvalds@linux-foundation.org> wrote: > > > > Hmm. I haven't bisected things yet, but I suspect it's something with > > the KASAN patches. With this all applied, I get: > > > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’: > > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=] > > > > and > > > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’: > > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is > > larger than 2048 bytes [-Wframe-larger-than=] > > > > which is obviously not really acceptable. A 11kB stack frame _will_ > > cause issues. > > A quick bisect shoes that this was introduced by "[patch 101/173] > kasan: remove redundant config option". > > I didn't check what part of that patch screws up, but it's definitely > doing something bad. I'm not sure why that patch surfaced the bug, but it's worth pointing out that the underlying problem is asan-stack in combination with the structleak plugin. This will happen for every user of kunit. I sent a series[1] out earlier this year to turn off the structleak plugin as an alternative workaround, but need to follow up on the remaining patches. Someone suggested adding a more generic way to turn off the plugin for a file instead of open-coding the CLFAGS_REMOVE_*.o Makefile bit, which would help. I am also still hoping that someone can come up with a way to make kunit work better with the structleak plugin, as there shouldn't be a fundamental reason why it can't work, just that it the code pattern triggers a particularly bad case in the compiler. Arnd [1] https://lore.kernel.org/lkml/20210125124533.101339-1-arnd@kernel.org/ ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-02-25 8:53 ` incoming Arnd Bergmann @ 2021-02-25 9:12 ` Andrey Ryabinin 2021-02-25 11:07 ` incoming Walter Wu 0 siblings, 1 reply; 348+ messages in thread From: Andrey Ryabinin @ 2021-02-25 9:12 UTC (permalink / raw) To: Arnd Bergmann Cc: Linus Torvalds, Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote: > > On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds > <torvalds@linux-foundation.org> wrote: > > > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds > > <torvalds@linux-foundation.org> wrote: > > > > > > Hmm. I haven't bisected things yet, but I suspect it's something with > > > the KASAN patches. With this all applied, I get: > > > > > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’: > > > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of > > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=] > > > > > > and > > > > > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’: > > > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is > > > larger than 2048 bytes [-Wframe-larger-than=] > > > > > > which is obviously not really acceptable. A 11kB stack frame _will_ > > > cause issues. > > > > A quick bisect shoes that this was introduced by "[patch 101/173] > > kasan: remove redundant config option". > > > > I didn't check what part of that patch screws up, but it's definitely > > doing something bad. > > I'm not sure why that patch surfaced the bug, but it's worth pointing > out that the underlying problem is asan-stack in combination > with the structleak plugin. This will happen for every user of kunit. > The patch didn't update KASAN_STACK dependency in kconfig: config GCC_PLUGIN_STRUCTLEAK_BYREF .... depends on !(KASAN && KASAN_STACK=1) This 'depends on' stopped working with the patch ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-02-25 9:12 ` incoming Andrey Ryabinin @ 2021-02-25 11:07 ` Walter Wu 0 siblings, 0 replies; 348+ messages in thread From: Walter Wu @ 2021-02-25 11:07 UTC (permalink / raw) To: Andrey Ryabinin Cc: Arnd Bergmann, Linus Torvalds, Andrew Morton, Dmitry Vyukov, Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko Hi Andrey, On Thu, 2021-02-25 at 12:12 +0300, Andrey Ryabinin wrote: > On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote: > > > > On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds > > <torvalds@linux-foundation.org> wrote: > > > > > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds > > > <torvalds@linux-foundation.org> wrote: > > > > > > > > Hmm. I haven't bisected things yet, but I suspect it's something with > > > > the KASAN patches. With this all applied, I get: > > > > > > > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’: > > > > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of > > > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=] > > > > > > > > and > > > > > > > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’: > > > > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is > > > > larger than 2048 bytes [-Wframe-larger-than=] > > > > > > > > which is obviously not really acceptable. A 11kB stack frame _will_ > > > > cause issues. > > > > > > A quick bisect shoes that this was introduced by "[patch 101/173] > > > kasan: remove redundant config option". > > > > > > I didn't check what part of that patch screws up, but it's definitely > > > doing something bad. > > > > I'm not sure why that patch surfaced the bug, but it's worth pointing > > out that the underlying problem is asan-stack in combination > > with the structleak plugin. This will happen for every user of kunit. > > > > The patch didn't update KASAN_STACK dependency in kconfig: > config GCC_PLUGIN_STRUCTLEAK_BYREF > .... > depends on !(KASAN && KASAN_STACK=1) > > This 'depends on' stopped working with the patch Thanks for pointing out this problem. I will re-send that patch. Walter ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-02-13 4:52 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-02-13 4:52 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 6 patches, based on dcc0b49040c70ad827a7f3d58a21b01fdb14e749. Subsystems affected by this patch series: mm/pagemap scripts MAINTAINERS h8300 Subsystem: mm/pagemap Mike Rapoport <rppt@linux.ibm.com>: m68k: make __pfn_to_phys() and __phys_to_pfn() available for !MMU Subsystem: scripts Rong Chen <rong.a.chen@intel.com>: scripts/recordmcount.pl: support big endian for ARCH sh Subsystem: MAINTAINERS Andrey Konovalov <andreyknvl@google.com>: MAINTAINERS: update KASAN file list MAINTAINERS: update Andrey Konovalov's email address MAINTAINERS: add Andrey Konovalov to KASAN reviewers Subsystem: h8300 Randy Dunlap <rdunlap@infradead.org>: h8300: fix PREEMPTION build, TI_PRE_COUNT undefined MAINTAINERS | 8 +++++--- arch/h8300/kernel/asm-offsets.c | 3 +++ arch/m68k/include/asm/page.h | 2 +- scripts/recordmcount.pl | 6 +++++- 4 files changed, 14 insertions(+), 5 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-02-09 21:41 Andrew Morton 2021-02-10 19:30 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2021-02-09 21:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 14 patches, based on e0756cfc7d7cd08c98a53b6009c091a3f6a50be6. Subsystems affected by this patch series: squashfs mm/kasan firmware mm/mremap mm/tmpfs mm/selftests MAINTAINERS mm/memcg mm/slub nilfs2 Subsystem: squashfs Phillip Lougher <phillip@squashfs.org.uk>: Patch series "Squashfs: fix BIO migration regression and add sanity checks": squashfs: avoid out of bounds writes in decompressors squashfs: add more sanity checks in id lookup squashfs: add more sanity checks in inode lookup squashfs: add more sanity checks in xattr id lookup Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: fix stack traces dependency for HW_TAGS Subsystem: firmware Fangrui Song <maskray@google.com>: firmware_loader: align .builtin_fw to 8 Subsystem: mm/mremap Arnd Bergmann <arnd@arndb.de>: mm/mremap: fix BUILD_BUG_ON() error in get_extent Subsystem: mm/tmpfs Seth Forshee <seth.forshee@canonical.com>: tmpfs: disallow CONFIG_TMPFS_INODE64 on s390 tmpfs: disallow CONFIG_TMPFS_INODE64 on alpha Subsystem: mm/selftests Rong Chen <rong.a.chen@intel.com>: selftests/vm: rename file run_vmtests to run_vmtests.sh Subsystem: MAINTAINERS Andrey Ryabinin <ryabinin.a.a@gmail.com>: MAINTAINERS: update Andrey Ryabinin's email address Subsystem: mm/memcg Johannes Weiner <hannes@cmpxchg.org>: Revert "mm: memcontrol: avoid workload stalls when lowering memory.high" Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: mm, slub: better heuristic for number of cpus when calculating slab order Subsystem: nilfs2 Joachim Henke <joachim.henke@t-systems.com>: nilfs2: make splice write available again .mailmap | 1 Documentation/dev-tools/kasan.rst | 3 - MAINTAINERS | 2 - fs/Kconfig | 4 +- fs/nilfs2/file.c | 1 fs/squashfs/block.c | 8 ++++ fs/squashfs/export.c | 41 +++++++++++++++++++---- fs/squashfs/id.c | 40 ++++++++++++++++++----- fs/squashfs/squashfs_fs_sb.h | 1 fs/squashfs/super.c | 6 +-- fs/squashfs/xattr.h | 10 +++++ fs/squashfs/xattr_id.c | 66 ++++++++++++++++++++++++++++++++------ include/asm-generic/vmlinux.lds.h | 2 - mm/kasan/hw_tags.c | 8 +--- mm/memcontrol.c | 5 +- mm/mremap.c | 5 +- mm/slub.c | 18 +++++++++- 17 files changed, 172 insertions(+), 49 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-02-09 21:41 incoming Andrew Morton @ 2021-02-10 19:30 ` Linus Torvalds 0 siblings, 0 replies; 348+ messages in thread From: Linus Torvalds @ 2021-02-10 19:30 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits Hah. This series shows a small deficiency in your scripting wrt the diffstat: On Tue, Feb 9, 2021 at 1:41 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > .mailmap | 1 ... > mm/slub.c | 18 +++++++++- > 17 files changed, 172 insertions(+), 49 deletions(-) It actually has 18 files changed, but one of them is a pure rename (no change to the content), and apparently your diffstat tool can't handle that case. It *should* have ended with ... mm/slub.c | 18 +++++- .../selftests/vm/{run_vmtests => run_vmtests.sh} | 0 18 files changed, 172 insertions(+), 49 deletions(-) rename tools/testing/selftests/vm/{run_vmtests => run_vmtests.sh} (100%) if you'd done a proper "git diff -M --stat --summary" of the series. [ Ok, by default git would actually have said 18 files changed, 171 insertions(+), 48 deletions(-) but it looks like you use the patience diff option, which gives that extra insertion/deletion line because it generates the diff a bit differently ] Not a big deal,, but it made me briefly wonder "why doesn't my diffstat match yours". Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-02-05 2:31 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-02-05 2:31 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 18 patches, based on 5c279c4cf206e03995e04fd3404fa95ffd243a97. Subsystems affected by this patch series: mm/hugetlb mm/compaction mm/vmalloc gcov mm/shmem mm/memblock mailmap mm/pagecache mm/kasan ubsan mm/hugetlb MAINTAINERS Subsystem: mm/hugetlb Muchun Song <songmuchun@bytedance.com>: mm: hugetlbfs: fix cannot migrate the fallocated HugeTLB page mm: hugetlb: fix a race between freeing and dissolving the page mm: hugetlb: fix a race between isolating and freeing page mm: hugetlb: remove VM_BUG_ON_PAGE from page_huge_active mm: migrate: do not migrate HugeTLB page whose refcount is one Subsystem: mm/compaction Rokudo Yan <wu-yan@tcl.com>: mm, compaction: move high_pfn to the for loop scope Subsystem: mm/vmalloc Rick Edgecombe <rick.p.edgecombe@intel.com>: mm/vmalloc: separate put pages and flush VM flags Subsystem: gcov Johannes Berg <johannes.berg@intel.com>: init/gcov: allow CONFIG_CONSTRUCTORS on UML to fix module gcov Subsystem: mm/shmem Hugh Dickins <hughd@google.com>: mm: thp: fix MADV_REMOVE deadlock on shmem THP Subsystem: mm/memblock Roman Gushchin <guro@fb.com>: memblock: do not start bottom-up allocations with kernel_end Subsystem: mailmap Viresh Kumar <viresh.kumar@linaro.org>: mailmap: fix name/email for Viresh Kumar Manivannan Sadhasivam <manivannan.sadhasivam@linaro.org>: mailmap: add entries for Manivannan Sadhasivam Subsystem: mm/pagecache Waiman Long <longman@redhat.com>: mm/filemap: add missing mem_cgroup_uncharge() to __add_to_page_cache_locked() Subsystem: mm/kasan Vincenzo Frascino <vincenzo.frascino@arm.com>: Patch series "kasan: Fix metadata detection for KASAN_HW_TAGS", v5: kasan: add explicit preconditions to kasan_report() kasan: make addr_has_metadata() return true for valid addresses Subsystem: ubsan Nathan Chancellor <nathan@kernel.org>: ubsan: implement __ubsan_handle_alignment_assumption Subsystem: mm/hugetlb Muchun Song <songmuchun@bytedance.com>: mm: hugetlb: fix missing put_page in gather_surplus_pages() Subsystem: MAINTAINERS Nathan Chancellor <nathan@kernel.org>: MAINTAINERS/.mailmap: use my @kernel.org address .mailmap | 5 ++++ MAINTAINERS | 2 - fs/hugetlbfs/inode.c | 3 +- include/linux/hugetlb.h | 2 + include/linux/kasan.h | 7 ++++++ include/linux/vmalloc.h | 9 +------- init/Kconfig | 1 init/main.c | 8 ++++++- kernel/gcov/Kconfig | 2 - lib/ubsan.c | 31 ++++++++++++++++++++++++++++ lib/ubsan.h | 6 +++++ mm/compaction.c | 3 +- mm/filemap.c | 4 +++ mm/huge_memory.c | 37 ++++++++++++++++++++------------- mm/hugetlb.c | 53 ++++++++++++++++++++++++++++++++++++++++++------ mm/kasan/kasan.h | 2 - mm/memblock.c | 49 +++++--------------------------------------- mm/migrate.c | 6 +++++ 18 files changed, 153 insertions(+), 77 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-01-24 5:00 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2021-01-24 5:00 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 19 patches, based on e1ae4b0be15891faf46d390e9f3dc9bd71a8cae1. Subsystems affected by this patch series: mm/pagealloc mm/memcg mm/kasan ubsan mm/memory-failure mm/highmem proc MAINTAINERS Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: fix initialization of struct page for holes in memory layout", v3: x86/setup: don't remove E820_TYPE_RAM for pfn 0 mm: fix initialization of struct page for holes in memory layout Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: memcg/slab: optimize objcg stock draining Shakeel Butt <shakeelb@google.com>: mm: memcg: fix memcg file_dirty numa stat mm: fix numa stats for thp migration Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: prevent starvation when writing memory.high Subsystem: mm/kasan Lecopzer Chen <lecopzer@gmail.com>: kasan: fix unaligned address is unhandled in kasan_remove_zero_shadow kasan: fix incorrect arguments passing in kasan_add_zero_shadow Andrey Konovalov <andreyknvl@google.com>: kasan: fix HW_TAGS boot parameters kasan, mm: fix conflicts with init_on_alloc/free kasan, mm: fix resetting page_alloc tags for HW_TAGS Subsystem: ubsan Arnd Bergmann <arnd@arndb.de>: ubsan: disable unsigned-overflow check for i386 Subsystem: mm/memory-failure Dan Williams <dan.j.williams@intel.com>: mm: fix page reference leak in soft_offline_page() Subsystem: mm/highmem Thomas Gleixner <tglx@linutronix.de>: Patch series "mm/highmem: Fix fallout from generic kmap_local conversions": sparc/mm/highmem: flush cache and TLB mm/highmem: prepare for overriding set_pte_at() mips/mm/highmem: use set_pte() for kmap_local() powerpc/mm/highmem: use __set_pte_at() for kmap_local() Subsystem: proc Xiaoming Ni <nixiaoming@huawei.com>: proc_sysctl: fix oops caused by incorrect command parameters Subsystem: MAINTAINERS Nathan Chancellor <natechancellor@gmail.com>: MAINTAINERS: add a couple more files to the Clang/LLVM section Documentation/dev-tools/kasan.rst | 27 ++--------- MAINTAINERS | 2 arch/mips/include/asm/highmem.h | 1 arch/powerpc/include/asm/highmem.h | 2 arch/sparc/include/asm/highmem.h | 9 ++- arch/x86/kernel/setup.c | 20 +++----- fs/proc/proc_sysctl.c | 7 ++- lib/Kconfig.ubsan | 1 mm/highmem.c | 7 ++- mm/kasan/hw_tags.c | 77 +++++++++++++-------------------- mm/kasan/init.c | 23 +++++---- mm/memcontrol.c | 11 +--- mm/memory-failure.c | 20 ++++++-- mm/migrate.c | 27 ++++++----- mm/page_alloc.c | 86 ++++++++++++++++++++++--------------- mm/slub.c | 7 +-- 16 files changed, 173 insertions(+), 154 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2021-01-12 23:48 Andrew Morton 2021-01-15 23:32 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2021-01-12 23:48 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c. Subsystems affected by this patch series: mm/slub mm/pagealloc mm/memcg mm/kasan mm/vmalloc mm/migration mm/hugetlb MAINTAINERS mm/memory-failure mm/process_vm_access Subsystem: mm/slub Jann Horn <jannh@google.com>: mm, slub: consider rest of partial list if acquire_slab() fails Subsystem: mm/pagealloc Hailong liu <liu.hailong6@zte.com.cn>: mm/page_alloc: add a missing mm_page_alloc_zone_locked() tracepoint Subsystem: mm/memcg Hugh Dickins <hughd@google.com>: mm/memcontrol: fix warning in mem_cgroup_page_lruvec() Subsystem: mm/kasan Hailong Liu <liu.hailong6@zte.com.cn>: arm/kasan: fix the array size of kasan_early_shadow_pte[] Subsystem: mm/vmalloc Miaohe Lin <linmiaohe@huawei.com>: mm/vmalloc.c: fix potential memory leak Subsystem: mm/migration Jan Stancek <jstancek@redhat.com>: mm: migrate: initialize err in do_migrate_pages Subsystem: mm/hugetlb Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: fix potential missing huge page size info Subsystem: MAINTAINERS Vlastimil Babka <vbabka@suse.cz>: MAINTAINERS: add Vlastimil as slab allocators maintainer Subsystem: mm/memory-failure Oscar Salvador <osalvador@suse.de>: mm,hwpoison: fix printing of page flags Subsystem: mm/process_vm_access Andrew Morton <akpm@linux-foundation.org>: mm/process_vm_access.c: include compat.h MAINTAINERS | 1 + include/linux/kasan.h | 6 +++++- include/linux/memcontrol.h | 2 +- mm/hugetlb.c | 2 +- mm/kasan/init.c | 3 ++- mm/memory-failure.c | 2 +- mm/mempolicy.c | 2 +- mm/page_alloc.c | 31 ++++++++++++++++--------------- mm/process_vm_access.c | 1 + mm/slub.c | 2 +- mm/vmalloc.c | 4 +++- 11 files changed, 33 insertions(+), 23 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2021-01-12 23:48 incoming Andrew Morton @ 2021-01-15 23:32 ` Linus Torvalds 0 siblings, 0 replies; 348+ messages in thread From: Linus Torvalds @ 2021-01-15 23:32 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, Jan 12, 2021 at 3:48 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c. Whee. I had completely dropped the ball on this - I had built my usual "akpm" branch with the patches, but then had completely forgotten about it after doing my basic build tests. I tend to leave it for a while to see if people send belated ACK/NAK's for the patches, but that "for a while" is typically "overnight", not several days. So if you ever notice that I haven't merged your patch submission, and you haven't seen me comment on them, feel free to ping me to remind me. Because it might just have gotten lost in the shuffle for some random reason. Admittedly it's rare - I think this is the first time I just randomly noticed three days later that I'd never done the actual merge of the patch-series). Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-12-29 23:13 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-12-29 23:13 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 16 patches, based on dea8dcf2a9fa8cc540136a6cd885c3beece16ec3. Subsystems affected by this patch series: mm/selftests mm/hugetlb kbuild checkpatch mm/pagecache mm/mremap mm/kasan misc lib mm/slub Subsystem: mm/selftests Harish <harish@linux.ibm.com>: selftests/vm: fix building protection keys test Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: mm/hugetlb: fix deadlock in hugetlb_cow error path Subsystem: kbuild Masahiro Yamada <masahiroy@kernel.org>: Revert "kbuild: avoid static_assert for genksyms" Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: prefer strscpy to strlcpy Subsystem: mm/pagecache Souptick Joarder <jrdr.linux@gmail.com>: mm: add prototype for __add_to_page_cache_locked() Baoquan He <bhe@redhat.com>: mm: memmap defer init doesn't work as expected Subsystem: mm/mremap Kalesh Singh <kaleshsingh@google.com>: mm/mremap.c: fix extent calculation Nicholas Piggin <npiggin@gmail.com>: mm: generalise COW SMC TLB flushing race comment Subsystem: mm/kasan Walter Wu <walter-zh.wu@mediatek.com>: kasan: fix null pointer dereference in kasan_record_aux_stack Subsystem: misc Randy Dunlap <rdunlap@infradead.org>: local64.h: make <asm/local64.h> mandatory Huang Shijie <sjhuang@iluvatar.ai>: sizes.h: add SZ_8G/SZ_16G/SZ_32G macros Josh Poimboeuf <jpoimboe@redhat.com>: kdev_t: always inline major/minor helper functions Subsystem: lib Huang Shijie <sjhuang@iluvatar.ai>: lib/genalloc: fix the overflow when size is too big Ilya Leoshkevich <iii@linux.ibm.com>: lib/zlib: fix inflating zlib streams on s390 Randy Dunlap <rdunlap@infradead.org>: zlib: move EXPORT_SYMBOL() and MODULE_LICENSE() out of dfltcc_syms.c Subsystem: mm/slub Roman Gushchin <guro@fb.com>: mm: slub: call account_slab_page() after slab page initialization arch/alpha/include/asm/local64.h | 1 - arch/arc/include/asm/Kbuild | 1 - arch/arm/include/asm/Kbuild | 1 - arch/arm64/include/asm/Kbuild | 1 - arch/csky/include/asm/Kbuild | 1 - arch/h8300/include/asm/Kbuild | 1 - arch/hexagon/include/asm/Kbuild | 1 - arch/ia64/include/asm/local64.h | 1 - arch/ia64/mm/init.c | 4 ++-- arch/m68k/include/asm/Kbuild | 1 - arch/microblaze/include/asm/Kbuild | 1 - arch/mips/include/asm/Kbuild | 1 - arch/nds32/include/asm/Kbuild | 1 - arch/openrisc/include/asm/Kbuild | 1 - arch/parisc/include/asm/Kbuild | 1 - arch/powerpc/include/asm/Kbuild | 1 - arch/riscv/include/asm/Kbuild | 1 - arch/s390/include/asm/Kbuild | 1 - arch/sh/include/asm/Kbuild | 1 - arch/sparc/include/asm/Kbuild | 1 - arch/x86/include/asm/local64.h | 1 - arch/xtensa/include/asm/Kbuild | 1 - include/asm-generic/Kbuild | 1 + include/linux/build_bug.h | 5 ----- include/linux/kdev_t.h | 22 +++++++++++----------- include/linux/mm.h | 12 ++++++++++-- include/linux/sizes.h | 3 +++ lib/genalloc.c | 25 +++++++++++++------------ lib/zlib_dfltcc/Makefile | 2 +- lib/zlib_dfltcc/dfltcc.c | 6 +++++- lib/zlib_dfltcc/dfltcc_deflate.c | 3 +++ lib/zlib_dfltcc/dfltcc_inflate.c | 4 ++-- lib/zlib_dfltcc/dfltcc_syms.c | 17 ----------------- mm/hugetlb.c | 22 +++++++++++++++++++++- mm/kasan/generic.c | 2 ++ mm/memory.c | 8 +++++--- mm/memory_hotplug.c | 2 +- mm/mremap.c | 4 +++- mm/page_alloc.c | 8 +++++--- mm/slub.c | 5 ++--- scripts/checkpatch.pl | 6 ++++++ tools/testing/selftests/vm/Makefile | 10 +++++----- 42 files changed, 101 insertions(+), 91 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-12-22 19:58 Andrew Morton 2020-12-22 21:43 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2020-12-22 19:58 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e. Subsystems affected by this patch series: mm/kasan Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: add hardware tag-based mode for arm64", v11: kasan: drop unnecessary GPL text from comment headers kasan: KASAN_VMALLOC depends on KASAN_GENERIC kasan: group vmalloc code kasan: shadow declarations only for software modes kasan: rename (un)poison_shadow to (un)poison_range kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_* kasan: only build init.c for software modes kasan: split out shadow.c from common.c kasan: define KASAN_MEMORY_PER_SHADOW_PAGE kasan: rename report and tags files kasan: don't duplicate config dependencies kasan: hide invalid free check implementation kasan: decode stack frame only with KASAN_STACK_ENABLE kasan, arm64: only init shadow for software modes kasan, arm64: only use kasan_depth for software modes kasan, arm64: move initialization message kasan, arm64: rename kasan_init_tags and mark as __init kasan: rename addr_has_shadow to addr_has_metadata kasan: rename print_shadow_for_address to print_memory_metadata kasan: rename SHADOW layout macros to META kasan: separate metadata_fetch_row for each mode kasan: introduce CONFIG_KASAN_HW_TAGS Vincenzo Frascino <vincenzo.frascino@arm.com>: arm64: enable armv8.5-a asm-arch option arm64: mte: add in-kernel MTE helpers arm64: mte: reset the page tag in page->flags arm64: mte: add in-kernel tag fault handler arm64: kasan: allow enabling in-kernel MTE arm64: mte: convert gcr_user into an exclude mask arm64: mte: switch GCR_EL1 in kernel entry and exit kasan, mm: untag page address in free_reserved_area Andrey Konovalov <andreyknvl@google.com>: arm64: kasan: align allocations for HW_TAGS arm64: kasan: add arch layer for memory tagging helpers kasan: define KASAN_GRANULE_SIZE for HW_TAGS kasan, x86, s390: update undef CONFIG_KASAN kasan, arm64: expand CONFIG_KASAN checks kasan, arm64: implement HW_TAGS runtime kasan, arm64: print report from tag fault handler kasan, mm: reset tags when accessing metadata kasan, arm64: enable CONFIG_KASAN_HW_TAGS kasan: add documentation for hardware tag-based mode Vincenzo Frascino <vincenzo.frascino@arm.com>: kselftest/arm64: check GCR_EL1 after context switch Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: boot parameters for hardware tag-based mode", v4: kasan: simplify quarantine_put call site kasan: rename get_alloc/free_info kasan: introduce set_alloc_info kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK kasan: allow VMAP_STACK for HW_TAGS mode kasan: remove __kasan_unpoison_stack kasan: inline kasan_reset_tag for tag-based modes kasan: inline random_tag for HW_TAGS kasan: open-code kasan_unpoison_slab kasan: inline (un)poison_range and check_invalid_free kasan: add and integrate kasan boot parameters kasan, mm: check kasan_enabled in annotations kasan, mm: rename kasan_poison_kfree kasan: don't round_up too much kasan: simplify assign_tag and set_tag calls kasan: clarify comment in __kasan_kfree_large kasan: sanitize objects when metadata doesn't fit kasan, mm: allow cache merging with no metadata kasan: update documentation Documentation/dev-tools/kasan.rst | 274 ++- arch/Kconfig | 8 arch/arm64/Kconfig | 9 arch/arm64/Makefile | 7 arch/arm64/include/asm/assembler.h | 2 arch/arm64/include/asm/cache.h | 3 arch/arm64/include/asm/esr.h | 1 arch/arm64/include/asm/kasan.h | 17 arch/arm64/include/asm/memory.h | 15 arch/arm64/include/asm/mte-def.h | 16 arch/arm64/include/asm/mte-kasan.h | 67 arch/arm64/include/asm/mte.h | 22 arch/arm64/include/asm/processor.h | 2 arch/arm64/include/asm/string.h | 5 arch/arm64/include/asm/uaccess.h | 23 arch/arm64/kernel/asm-offsets.c | 3 arch/arm64/kernel/cpufeature.c | 3 arch/arm64/kernel/entry.S | 41 arch/arm64/kernel/head.S | 2 arch/arm64/kernel/hibernate.c | 5 arch/arm64/kernel/image-vars.h | 2 arch/arm64/kernel/kaslr.c | 3 arch/arm64/kernel/module.c | 6 arch/arm64/kernel/mte.c | 124 + arch/arm64/kernel/setup.c | 2 arch/arm64/kernel/sleep.S | 2 arch/arm64/kernel/smp.c | 2 arch/arm64/lib/mte.S | 16 arch/arm64/mm/copypage.c | 9 arch/arm64/mm/fault.c | 59 arch/arm64/mm/kasan_init.c | 41 arch/arm64/mm/mteswap.c | 9 arch/arm64/mm/proc.S | 23 arch/arm64/mm/ptdump.c | 6 arch/s390/boot/string.c | 1 arch/x86/boot/compressed/misc.h | 1 arch/x86/kernel/acpi/wakeup_64.S | 2 include/linux/kasan-checks.h | 2 include/linux/kasan.h | 423 ++++- include/linux/mm.h | 24 include/linux/moduleloader.h | 3 include/linux/page-flags-layout.h | 2 include/linux/sched.h | 2 include/linux/string.h | 2 init/init_task.c | 2 kernel/fork.c | 4 lib/Kconfig.kasan | 71 lib/test_kasan.c | 2 lib/test_kasan_module.c | 2 mm/kasan/Makefile | 33 mm/kasan/common.c | 1006 +++----------- mm/kasan/generic.c | 72 - mm/kasan/generic_report.c | 13 mm/kasan/hw_tags.c | 276 +++ mm/kasan/init.c | 25 mm/kasan/kasan.h | 195 ++ mm/kasan/quarantine.c | 35 mm/kasan/report.c | 363 +---- mm/kasan/report_generic.c | 169 ++ mm/kasan/report_hw_tags.c | 44 mm/kasan/report_sw_tags.c | 22 mm/kasan/shadow.c | 528 +++++++ mm/kasan/sw_tags.c | 34 mm/kasan/tags.c | 7 mm/kasan/tags_report.c | 7 mm/mempool.c | 4 mm/page_alloc.c | 9 mm/page_poison.c | 2 mm/ptdump.c | 13 mm/slab_common.c | 5 mm/slub.c | 29 scripts/Makefile.lib | 2 tools/testing/selftests/arm64/mte/Makefile | 2 tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c | 155 ++ 74 files changed, 2869 insertions(+), 1553 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-12-22 19:58 incoming Andrew Morton @ 2020-12-22 21:43 ` Linus Torvalds 0 siblings, 0 replies; 348+ messages in thread From: Linus Torvalds @ 2020-12-22 21:43 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, Dec 22, 2020 at 11:58 AM Andrew Morton <akpm@linux-foundation.org> wrote: > > 60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e. I see that you enabled renaming in the patches. Lovely. Can you also enable it in the diffstat? > 74 files changed, 2869 insertions(+), 1553 deletions(-) With -M in the diffstat, you should have seen 72 files changed, 2775 insertions(+), 1460 deletions(-) and if you add "--summary", you'll also see the rename part ofthe file create/delete summary: rename mm/kasan/{tags_report.c => report_sw_tags.c} (78%) which is often nice to see in addition to the line stats.. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-12-18 22:00 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-12-18 22:00 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 78 patches, based on a409ed156a90093a03fe6a93721ddf4c591eac87. Subsystems affected by this patch series: mm/memcg epoll mm/kasan mm/cleanups epoll Subsystem: mm/memcg Alex Shi <alex.shi@linux.alibaba.com>: Patch series "bail out early for memcg disable": mm/memcg: bail early from swap accounting if memcg disabled mm/memcg: warning on !memcg after readahead page charged Wei Yang <richard.weiyang@gmail.com>: mm/memcg: remove unused definitions Shakeel Butt <shakeelb@google.com>: mm, kvm: account kvm_vcpu_mmap to kmemcg Hui Su <sh_def@163.com>: mm/memcontrol:rewrite mem_cgroup_page_lruvec() Subsystem: epoll Soheil Hassas Yeganeh <soheil@google.com>: Patch series "simplify ep_poll": epoll: check for events when removing a timed out thread from the wait queue epoll: simplify signal handling epoll: pull fatal signal checks into ep_send_events() epoll: move eavail next to the list_empty_careful check epoll: simplify and optimize busy loop logic epoll: pull all code between fetch_events and send_event into the loop epoll: replace gotos with a proper loop epoll: eliminate unnecessary lock for zero timeout Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: add hardware tag-based mode for arm64", v11: kasan: drop unnecessary GPL text from comment headers kasan: KASAN_VMALLOC depends on KASAN_GENERIC kasan: group vmalloc code kasan: shadow declarations only for software modes kasan: rename (un)poison_shadow to (un)poison_range kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_* kasan: only build init.c for software modes kasan: split out shadow.c from common.c kasan: define KASAN_MEMORY_PER_SHADOW_PAGE kasan: rename report and tags files kasan: don't duplicate config dependencies kasan: hide invalid free check implementation kasan: decode stack frame only with KASAN_STACK_ENABLE kasan, arm64: only init shadow for software modes kasan, arm64: only use kasan_depth for software modes kasan, arm64: move initialization message kasan, arm64: rename kasan_init_tags and mark as __init kasan: rename addr_has_shadow to addr_has_metadata kasan: rename print_shadow_for_address to print_memory_metadata kasan: rename SHADOW layout macros to META kasan: separate metadata_fetch_row for each mode kasan: introduce CONFIG_KASAN_HW_TAGS Vincenzo Frascino <vincenzo.frascino@arm.com>: arm64: enable armv8.5-a asm-arch option arm64: mte: add in-kernel MTE helpers arm64: mte: reset the page tag in page->flags arm64: mte: add in-kernel tag fault handler arm64: kasan: allow enabling in-kernel MTE arm64: mte: convert gcr_user into an exclude mask arm64: mte: switch GCR_EL1 in kernel entry and exit kasan, mm: untag page address in free_reserved_area Andrey Konovalov <andreyknvl@google.com>: arm64: kasan: align allocations for HW_TAGS arm64: kasan: add arch layer for memory tagging helpers kasan: define KASAN_GRANULE_SIZE for HW_TAGS kasan, x86, s390: update undef CONFIG_KASAN kasan, arm64: expand CONFIG_KASAN checks kasan, arm64: implement HW_TAGS runtime kasan, arm64: print report from tag fault handler kasan, mm: reset tags when accessing metadata kasan, arm64: enable CONFIG_KASAN_HW_TAGS kasan: add documentation for hardware tag-based mode Vincenzo Frascino <vincenzo.frascino@arm.com>: kselftest/arm64: check GCR_EL1 after context switch Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: boot parameters for hardware tag-based mode", v4: kasan: simplify quarantine_put call site kasan: rename get_alloc/free_info kasan: introduce set_alloc_info kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK kasan: allow VMAP_STACK for HW_TAGS mode kasan: remove __kasan_unpoison_stack kasan: inline kasan_reset_tag for tag-based modes kasan: inline random_tag for HW_TAGS kasan: open-code kasan_unpoison_slab kasan: inline (un)poison_range and check_invalid_free kasan: add and integrate kasan boot parameters kasan, mm: check kasan_enabled in annotations kasan, mm: rename kasan_poison_kfree kasan: don't round_up too much kasan: simplify assign_tag and set_tag calls kasan: clarify comment in __kasan_kfree_large kasan: sanitize objects when metadata doesn't fit kasan, mm: allow cache merging with no metadata kasan: update documentation Subsystem: mm/cleanups Colin Ian King <colin.king@canonical.com>: mm/Kconfig: fix spelling mistake "whats" -> "what's" Subsystem: epoll Willem de Bruijn <willemb@google.com>: Patch series "add epoll_pwait2 syscall", v4: epoll: convert internal api to timespec64 epoll: add syscall epoll_pwait2 epoll: wire up syscall epoll_pwait2 selftests/filesystems: expand epoll with epoll_pwait2 Documentation/dev-tools/kasan.rst | 274 +- arch/Kconfig | 8 arch/alpha/kernel/syscalls/syscall.tbl | 1 arch/arm/tools/syscall.tbl | 1 arch/arm64/Kconfig | 9 arch/arm64/Makefile | 7 arch/arm64/include/asm/assembler.h | 2 arch/arm64/include/asm/cache.h | 3 arch/arm64/include/asm/esr.h | 1 arch/arm64/include/asm/kasan.h | 17 arch/arm64/include/asm/memory.h | 15 arch/arm64/include/asm/mte-def.h | 16 arch/arm64/include/asm/mte-kasan.h | 67 arch/arm64/include/asm/mte.h | 22 arch/arm64/include/asm/processor.h | 2 arch/arm64/include/asm/string.h | 5 arch/arm64/include/asm/uaccess.h | 23 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 2 arch/arm64/kernel/asm-offsets.c | 3 arch/arm64/kernel/cpufeature.c | 3 arch/arm64/kernel/entry.S | 41 arch/arm64/kernel/head.S | 2 arch/arm64/kernel/hibernate.c | 5 arch/arm64/kernel/image-vars.h | 2 arch/arm64/kernel/kaslr.c | 3 arch/arm64/kernel/module.c | 6 arch/arm64/kernel/mte.c | 124 + arch/arm64/kernel/setup.c | 2 arch/arm64/kernel/sleep.S | 2 arch/arm64/kernel/smp.c | 2 arch/arm64/lib/mte.S | 16 arch/arm64/mm/copypage.c | 9 arch/arm64/mm/fault.c | 59 arch/arm64/mm/kasan_init.c | 41 arch/arm64/mm/mteswap.c | 9 arch/arm64/mm/proc.S | 23 arch/arm64/mm/ptdump.c | 6 arch/ia64/kernel/syscalls/syscall.tbl | 1 arch/m68k/kernel/syscalls/syscall.tbl | 1 arch/microblaze/kernel/syscalls/syscall.tbl | 1 arch/mips/kernel/syscalls/syscall_n32.tbl | 1 arch/mips/kernel/syscalls/syscall_n64.tbl | 1 arch/mips/kernel/syscalls/syscall_o32.tbl | 1 arch/parisc/kernel/syscalls/syscall.tbl | 1 arch/powerpc/kernel/syscalls/syscall.tbl | 1 arch/s390/boot/string.c | 1 arch/s390/kernel/syscalls/syscall.tbl | 1 arch/sh/kernel/syscalls/syscall.tbl | 1 arch/sparc/kernel/syscalls/syscall.tbl | 1 arch/x86/boot/compressed/misc.h | 1 arch/x86/entry/syscalls/syscall_32.tbl | 1 arch/x86/entry/syscalls/syscall_64.tbl | 1 arch/x86/kernel/acpi/wakeup_64.S | 2 arch/x86/kvm/x86.c | 2 arch/xtensa/kernel/syscalls/syscall.tbl | 1 fs/eventpoll.c | 359 ++- include/linux/compat.h | 6 include/linux/kasan-checks.h | 2 include/linux/kasan.h | 423 ++-- include/linux/memcontrol.h | 137 - include/linux/mm.h | 24 include/linux/mmdebug.h | 13 include/linux/moduleloader.h | 3 include/linux/page-flags-layout.h | 2 include/linux/sched.h | 2 include/linux/string.h | 2 include/linux/syscalls.h | 5 include/uapi/asm-generic/unistd.h | 4 init/init_task.c | 2 kernel/fork.c | 4 kernel/sys_ni.c | 2 lib/Kconfig.kasan | 71 lib/test_kasan.c | 2 lib/test_kasan_module.c | 2 mm/Kconfig | 2 mm/kasan/Makefile | 33 mm/kasan/common.c | 1006 ++-------- mm/kasan/generic.c | 72 mm/kasan/generic_report.c | 13 mm/kasan/hw_tags.c | 294 ++ mm/kasan/init.c | 25 mm/kasan/kasan.h | 204 +- mm/kasan/quarantine.c | 35 mm/kasan/report.c | 363 +-- mm/kasan/report_generic.c | 169 + mm/kasan/report_hw_tags.c | 44 mm/kasan/report_sw_tags.c | 22 mm/kasan/shadow.c | 541 +++++ mm/kasan/sw_tags.c | 34 mm/kasan/tags.c | 7 mm/kasan/tags_report.c | 7 mm/memcontrol.c | 53 mm/mempool.c | 4 mm/page_alloc.c | 9 mm/page_poison.c | 2 mm/ptdump.c | 13 mm/slab_common.c | 5 mm/slub.c | 29 scripts/Makefile.lib | 2 tools/testing/selftests/arm64/mte/Makefile | 2 tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c | 155 + tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 72 virt/kvm/coalesced_mmio.c | 2 virt/kvm/kvm_main.c | 2 105 files changed, 3268 insertions(+), 1873 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-12-16 4:41 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-12-16 4:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - lots of little subsystems - a few post-linux-next MM material. Most of this awaits more merging of other trees. 95 patches, based on 489e9fea66f31086f85d9a18e61e4791d94a56a4. Subsystems affected by this patch series: mm/swap mm/memory-hotplug alpha procfs misc core-kernel bitmap lib lz4 bitops checkpatch nilfs kdump rapidio gcov bfs relay resource ubsan reboot fault-injection lzo apparmor mm/pagemap mm/cleanups mm/gup Subsystem: mm/swap Zhaoyang Huang <huangzhaoyang@gmail.com>: mm: fix a race on nr_swap_pages Subsystem: mm/memory-hotplug Laurent Dufour <ldufour@linux.ibm.com>: mm/memory_hotplug: quieting offline operation Subsystem: alpha Thomas Gleixner <tglx@linutronix.de>: alpha: replace bogus in_interrupt() Subsystem: procfs Randy Dunlap <rdunlap@infradead.org>: procfs: delete duplicated words + other fixes Anand K Mistry <amistry@google.com>: proc: provide details on indirect branch speculation Alexey Dobriyan <adobriyan@gmail.com>: proc: fix lookup in /proc/net subdirectories after setns(2) Hui Su <sh_def@163.com>: fs/proc: make pde_get() return nothing Subsystem: misc Christophe Leroy <christophe.leroy@csgroup.eu>: asm-generic: force inlining of get_order() to work around gcc10 poor decision Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: split out mathematical helpers Subsystem: core-kernel Hui Su <sh_def@163.com>: kernel/acct.c: use #elif instead of #end and #elif Subsystem: bitmap Andy Shevchenko <andriy.shevchenko@linux.intel.com>: include/linux/bitmap.h: convert bitmap_empty() / bitmap_full() to return boolean "Ma, Jianpeng" <jianpeng.ma@intel.com>: bitmap: remove unused function declaration Subsystem: lib Geert Uytterhoeven <geert@linux-m68k.org>: lib/test_free_pages.c: add basic progress indicators "Gustavo A. R. Silva" <gustavoars@kernel.org>: Patch series "] lib/stackdepot.c: Replace one-element array with flexible-array member": lib/stackdepot.c: replace one-element array with flexible-array member lib/stackdepot.c: use flex_array_size() helper in memcpy() lib/stackdepot.c: use array_size() helper in jhash2() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: lib/test_lockup.c: minimum fix to get it compiled on PREEMPT_RT Andy Shevchenko <andriy.shevchenko@linux.intel.com>: lib/list_kunit: follow new file name convention for KUnit tests lib/linear_ranges_kunit: follow new file name convention for KUnit tests lib/bits_kunit: follow new file name convention for KUnit tests lib/cmdline: fix get_option() for strings starting with hyphen lib/cmdline: allow NULL to be an output for get_option() lib/cmdline_kunit: add a new test suite for cmdline API Jakub Jelinek <jakub@redhat.com>: ilog2: improve ilog2 for constant arguments Nick Desaulniers <ndesaulniers@google.com>: lib/string: remove unnecessary #undefs Daniel Axtens <dja@axtens.net>: Patch series "Fortify strscpy()", v7: lib: string.h: detect intra-object overflow in fortified string functions lkdtm: tests for FORTIFY_SOURCE Francis Laniel <laniel_francis@privacyrequired.com>: string.h: add FORTIFY coverage for strscpy() drivers/misc/lkdtm: add new file in LKDTM to test fortified strscpy drivers/misc/lkdtm/lkdtm.h: correct wrong filenames in comment Alexey Dobriyan <adobriyan@gmail.com>: lib: cleanup kstrto*() usage Subsystem: lz4 Gao Xiang <hsiangkao@redhat.com>: lib/lz4: explicitly support in-place decompression Subsystem: bitops Syed Nayyar Waris <syednwaris@gmail.com>: Patch series "Introduce the for_each_set_clump macro", v12: bitops: introduce the for_each_set_clump macro lib/test_bitmap.c: add for_each_set_clump test cases gpio: thunderx: utilize for_each_set_clump macro gpio: xilinx: utilize generic bitmap_get_value and _set_value Subsystem: checkpatch Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: add new exception to repeated word check Aditya Srivastava <yashsri421@gmail.com>: checkpatch: fix false positives in REPEATED_WORD warning Łukasz Stelmach <l.stelmach@samsung.com>: checkpatch: ignore generated CamelCase defines and enum values Joe Perches <joe@perches.com>: checkpatch: prefer static const declarations checkpatch: allow --fix removal of unnecessary break statements Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: extend attributes check to handle more patterns Tom Rix <trix@redhat.com>: checkpatch: add a fixer for missing newline at eof Joe Perches <joe@perches.com>: checkpatch: update __attribute__((section("name"))) quote removal Aditya Srivastava <yashsri421@gmail.com>: checkpatch: add fix option for GERRIT_CHANGE_ID Joe Perches <joe@perches.com>: checkpatch: add __alias and __weak to suggested __attribute__ conversions Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: improve email parsing checkpatch: fix spelling errors and remove repeated word Aditya Srivastava <yashsri421@gmail.com>: checkpatch: avoid COMMIT_LOG_LONG_LINE warning for signature tags Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: fix unescaped left brace Aditya Srivastava <yashsri421@gmail.com>: checkpatch: add fix option for ASSIGNMENT_CONTINUATIONS checkpatch: add fix option for LOGICAL_CONTINUATIONS checkpatch: add fix and improve warning msg for non-standard signature Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: add warning for unnecessary use of %h[xudi] and %hh[xudi] checkpatch: add warning for lines starting with a '#' in commit log checkpatch: fix TYPO_SPELLING check for words with apostrophe Joe Perches <joe@perches.com>: checkpatch: add printk_once and printk_ratelimit to prefer pr_<level> warning Subsystem: nilfs Alex Shi <alex.shi@linux.alibaba.com>: fs/nilfs2: remove some unused macros to tame gcc Subsystem: kdump Alexander Egorenkov <egorenar@linux.ibm.com>: kdump: append uts_namespace.name offset to VMCOREINFO Subsystem: rapidio Sebastian Andrzej Siewior <bigeasy@linutronix.de>: rapidio: remove unused rio_get_asm() and rio_get_device() Subsystem: gcov Nick Desaulniers <ndesaulniers@google.com>: gcov: remove support for GCC < 4.9 Alex Shi <alex.shi@linux.alibaba.com>: gcov: fix kernel-doc markup issue Subsystem: bfs Randy Dunlap <rdunlap@infradead.org>: bfs: don't use WARNING: string when it's just info. Subsystem: relay Jani Nikula <jani.nikula@intel.com>: Patch series "relay: cleanup and const callbacks", v2: relay: remove unused buf_mapped and buf_unmapped callbacks relay: require non-NULL callbacks in relay_open() relay: make create_buf_file and remove_buf_file callbacks mandatory relay: allow the use of const callback structs drm/i915: make relay callbacks const ath10k: make relay callbacks const ath11k: make relay callbacks const ath9k: make relay callbacks const blktrace: make relay callbacks const Subsystem: resource Mauro Carvalho Chehab <mchehab+huawei@kernel.org>: kernel/resource.c: fix kernel-doc markups Subsystem: ubsan Kees Cook <keescook@chromium.org>: Patch series "Clean up UBSAN Makefile", v2: ubsan: remove redundant -Wno-maybe-uninitialized ubsan: move cc-option tests into Kconfig ubsan: disable object-size sanitizer under GCC ubsan: disable UBSAN_TRAP for all*config ubsan: enable for all*config builds ubsan: remove UBSAN_MISC in favor of individual options ubsan: expand tests and reporting Dmitry Vyukov <dvyukov@google.com>: kcov: don't instrument with UBSAN Zou Wei <zou_wei@huawei.com>: lib/ubsan.c: mark type_check_kinds with static keyword Subsystem: reboot Matteo Croce <mcroce@microsoft.com>: reboot: refactor and comment the cpu selection code reboot: allow to specify reboot mode via sysfs reboot: remove cf9_safe from allowed types and rename cf9_force Patch series "reboot: sysfs improvements": reboot: allow to override reboot type if quirks are found reboot: hide from sysfs not applicable settings Subsystem: fault-injection Barnabás Pőcze <pobrn@protonmail.com>: fault-injection: handle EI_ETYPE_TRUE Subsystem: lzo Jason Yan <yanaijie@huawei.com>: lib/lzo/lzo1x_compress.c: make lzogeneric1x_1_compress() static Subsystem: apparmor Andy Shevchenko <andriy.shevchenko@linux.intel.com>: apparmor: remove duplicate macro list_entry_is_head() Subsystem: mm/pagemap Christoph Hellwig <hch@lst.de>: Patch series "simplify follow_pte a bit": mm: unexport follow_pte_pmd mm: simplify follow_pte{,pmd} Subsystem: mm/cleanups Haitao Shi <shihaitao1@huawei.com>: mm: fix some spelling mistakes in comments Subsystem: mm/gup Jann Horn <jannh@google.com>: mmap locking API: don't check locking if the mm isn't live yet mm/gup: assert that the mmap lock is held in __get_user_pages() Documentation/ABI/testing/sysfs-kernel-reboot | 32 Documentation/admin-guide/kdump/vmcoreinfo.rst | 6 Documentation/dev-tools/ubsan.rst | 1 Documentation/filesystems/proc.rst | 2 MAINTAINERS | 5 arch/alpha/kernel/process.c | 2 arch/powerpc/kernel/vmlinux.lds.S | 4 arch/s390/pci/pci_mmio.c | 4 drivers/gpio/gpio-thunderx.c | 11 drivers/gpio/gpio-xilinx.c | 61 - drivers/gpu/drm/i915/gt/uc/intel_guc_log.c | 2 drivers/misc/lkdtm/Makefile | 1 drivers/misc/lkdtm/bugs.c | 50 + drivers/misc/lkdtm/core.c | 3 drivers/misc/lkdtm/fortify.c | 82 ++ drivers/misc/lkdtm/lkdtm.h | 19 drivers/net/wireless/ath/ath10k/spectral.c | 2 drivers/net/wireless/ath/ath11k/spectral.c | 2 drivers/net/wireless/ath/ath9k/common-spectral.c | 2 drivers/rapidio/rio.c | 81 -- fs/bfs/inode.c | 2 fs/dax.c | 9 fs/exec.c | 8 fs/nfs/callback_proc.c | 5 fs/nilfs2/segment.c | 5 fs/proc/array.c | 28 fs/proc/base.c | 2 fs/proc/generic.c | 24 fs/proc/internal.h | 10 fs/proc/proc_net.c | 20 include/asm-generic/bitops/find.h | 19 include/asm-generic/getorder.h | 2 include/linux/bitmap.h | 67 +- include/linux/bitops.h | 24 include/linux/dcache.h | 1 include/linux/iommu-helper.h | 4 include/linux/kernel.h | 173 ----- include/linux/log2.h | 3 include/linux/math.h | 177 +++++ include/linux/mm.h | 6 include/linux/mm_types.h | 10 include/linux/mmap_lock.h | 16 include/linux/proc_fs.h | 8 include/linux/rcu_node_tree.h | 2 include/linux/relay.h | 29 include/linux/rio_drv.h | 3 include/linux/string.h | 75 +- include/linux/units.h | 2 kernel/Makefile | 3 kernel/acct.c | 7 kernel/crash_core.c | 1 kernel/fail_function.c | 6 kernel/gcov/gcc_4_7.c | 10 kernel/reboot.c | 308 ++++++++- kernel/relay.c | 111 --- kernel/resource.c | 24 kernel/trace/blktrace.c | 2 lib/Kconfig.debug | 11 lib/Kconfig.ubsan | 154 +++- lib/Makefile | 7 lib/bits_kunit.c | 75 ++ lib/cmdline.c | 20 lib/cmdline_kunit.c | 100 +++ lib/errname.c | 1 lib/error-inject.c | 2 lib/errseq.c | 1 lib/find_bit.c | 17 lib/linear_ranges_kunit.c | 228 +++++++ lib/list-test.c | 748 ----------------------- lib/list_kunit.c | 748 +++++++++++++++++++++++ lib/lz4/lz4_decompress.c | 6 lib/lz4/lz4defs.h | 1 lib/lzo/lzo1x_compress.c | 2 lib/math/div64.c | 4 lib/math/int_pow.c | 2 lib/math/int_sqrt.c | 3 lib/math/reciprocal_div.c | 9 lib/stackdepot.c | 11 lib/string.c | 4 lib/test_bitmap.c | 143 ++++ lib/test_bits.c | 75 -- lib/test_firmware.c | 9 lib/test_free_pages.c | 5 lib/test_kmod.c | 26 lib/test_linear_ranges.c | 228 ------- lib/test_lockup.c | 16 lib/test_ubsan.c | 74 ++ lib/ubsan.c | 2 mm/filemap.c | 2 mm/gup.c | 2 mm/huge_memory.c | 2 mm/khugepaged.c | 2 mm/memblock.c | 2 mm/memory.c | 36 - mm/memory_hotplug.c | 2 mm/migrate.c | 2 mm/page_ext.c | 2 mm/swapfile.c | 11 scripts/Makefile.ubsan | 49 - scripts/checkpatch.pl | 495 +++++++++++---- security/apparmor/apparmorfs.c | 3 tools/testing/selftests/lkdtm/tests.txt | 1 102 files changed, 3022 insertions(+), 1899 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-12-15 20:32 Andrew Morton 2020-12-15 21:00 ` incoming Linus Torvalds 2020-12-15 22:48 ` incoming Linus Torvalds 0 siblings, 2 replies; 348+ messages in thread From: Andrew Morton @ 2020-12-15 20:32 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits - more MM work: a memcg scalability improvememt 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3. Subsystems affected by this patch series: Alex Shi <alex.shi@linux.alibaba.com>: Patch series "per memcg lru lock", v21: mm/thp: move lru_add_page_tail() to huge_memory.c mm/thp: use head for head page in lru_add_page_tail() mm/thp: simplify lru_add_page_tail() mm/thp: narrow lru locking mm/vmscan: remove unnecessary lruvec adding mm/rmap: stop store reordering issue on page->mapping Hugh Dickins <hughd@google.com>: mm: page_idle_get_page() does not need lru_lock Alex Shi <alex.shi@linux.alibaba.com>: mm/memcg: add debug checking in lock_page_memcg mm/swap.c: fold vm event PGROTATED into pagevec_move_tail_fn mm/lru: move lock into lru_note_cost mm/vmscan: remove lruvec reget in move_pages_to_lru mm/mlock: remove lru_lock on TestClearPageMlocked mm/mlock: remove __munlock_isolate_lru_page() mm/lru: introduce TestClearPageLRU() mm/compaction: do page isolation first in compaction mm/swap.c: serialize memcg changes in pagevec_lru_move_fn mm/lru: replace pgdat lru_lock with lruvec lock Alexander Duyck <alexander.h.duyck@linux.intel.com>: mm/lru: introduce relock_page_lruvec() Hugh Dickins <hughd@google.com>: mm/lru: revise the comments of lru_lock Documentation/admin-guide/cgroup-v1/memcg_test.rst | 15 - Documentation/admin-guide/cgroup-v1/memory.rst | 23 - Documentation/trace/events-kmem.rst | 2 Documentation/vm/unevictable-lru.rst | 22 - include/linux/memcontrol.h | 110 +++++++ include/linux/mm_types.h | 2 include/linux/mmzone.h | 6 include/linux/page-flags.h | 1 include/linux/swap.h | 4 mm/compaction.c | 98 ++++--- mm/filemap.c | 4 mm/huge_memory.c | 109 ++++--- mm/memcontrol.c | 84 +++++- mm/mlock.c | 93 ++---- mm/mmzone.c | 1 mm/page_alloc.c | 1 mm/page_idle.c | 4 mm/rmap.c | 12 mm/swap.c | 292 ++++++++------------- mm/vmscan.c | 239 ++++++++--------- mm/workingset.c | 2 21 files changed, 644 insertions(+), 480 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-12-15 20:32 incoming Andrew Morton @ 2020-12-15 21:00 ` Linus Torvalds 2020-12-15 22:48 ` incoming Linus Torvalds 1 sibling, 0 replies; 348+ messages in thread From: Linus Torvalds @ 2020-12-15 21:00 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > - more MM work: a memcg scalability improvememt > > 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3. I'm not seeing patch 10/19 at all. And patch 19/19 is corrupted and has an attachment with a '^P' character in it. I could fix it up, but with the missing patch in the middle I'm not going to even try. 'b4' is also very unhappy about that patch 19/19. I don't know what went wrong, but I'll ignore this send - please re-send the series at your leisure, ok? Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-12-15 20:32 incoming Andrew Morton 2020-12-15 21:00 ` incoming Linus Torvalds @ 2020-12-15 22:48 ` Linus Torvalds 2020-12-15 22:49 ` incoming Linus Torvalds 1 sibling, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2020-12-15 22:48 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > - more MM work: a memcg scalability improvememt > > 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3. With your re-send, I get all patches, but they don't actually apply cleanly. Is that base correct? I get error: patch failed: mm/huge_memory.c:2750 error: mm/huge_memory.c: patch does not apply Patch failed at 0004 mm/thp: narrow lru locking for that patch "[patch 04/19] mm/thp: narrow lru locking", and that's definitely true: the patch fragment has @@ -2750,7 +2751,7 @@ int split_huge_page_to_list(struct page __dec_lruvec_page_state(head, NR_FILE_THPS); } - __split_huge_page(page, list, end, flags); + __split_huge_page(page, list, end); ret = 0; } else { if (IS_ENABLED(CONFIG_DEBUG_VM) && mapcount) { but that __dec_lruvec_page_state() conversion was done by your previous commit series. So I have the feeling that what you actually mean by "base" isn't actually really the base for that series at all.. I will try to apply it on top of my merge of your previous series instead. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-12-15 22:48 ` incoming Linus Torvalds @ 2020-12-15 22:49 ` Linus Torvalds 2020-12-15 22:55 ` incoming Andrew Morton 0 siblings, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2020-12-15 22:49 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > I will try to apply it on top of my merge of your previous series instead. Yes, then it applies cleanly. So apparently we just have different concepts of what really constitutes a "base" for applying your series. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-12-15 22:49 ` incoming Linus Torvalds @ 2020-12-15 22:55 ` Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-12-15 22:55 UTC (permalink / raw) To: Linus Torvalds; +Cc: Linux-MM, mm-commits On Tue, 15 Dec 2020 14:49:24 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds > <torvalds@linux-foundation.org> wrote: > > > > I will try to apply it on top of my merge of your previous series instead. > > Yes, then it applies cleanly. So apparently we just have different > concepts of what really constitutes a "base" for applying your series. > oop, sorry, yes, the "based on" thing was wrong because I had two series in flight simultaneously. I've never tried that before.. ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-12-15 3:02 Andrew Morton 2020-12-15 3:25 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2020-12-15 3:02 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - a few random little subsystems - almost all of the MM patches which are staged ahead of linux-next material. I'll trickle to post-linux-next work in as the dependents get merged up. 200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442. Subsystems affected by this patch series: kthread kbuild ide ntfs ocfs2 arch mm/slab-generic mm/slab mm/slub mm/dax mm/debug mm/pagecache mm/gup mm/swap mm/shmem mm/memcg mm/pagemap mm/mremap mm/hmm mm/vmalloc mm/documentation mm/kasan mm/pagealloc mm/memory-failure mm/hugetlb mm/vmscan mm/z3fold mm/compaction mm/oom-kill mm/migration mm/cma mm/page-poison mm/userfaultfd mm/zswap mm/zsmalloc mm/uaccess mm/zram mm/cleanups Subsystem: kthread Rob Clark <robdclark@chromium.org>: kthread: add kthread_work tracepoints Petr Mladek <pmladek@suse.com>: kthread_worker: document CPU hotplug handling Subsystem: kbuild Petr Vorel <petr.vorel@gmail.com>: uapi: move constants from <linux/kernel.h> to <linux/const.h> Subsystem: ide Sebastian Andrzej Siewior <bigeasy@linutronix.de>: ide/falcon: remove in_interrupt() usage ide: remove BUG_ON(in_interrupt() || irqs_disabled()) from ide_unregister() Subsystem: ntfs Alex Shi <alex.shi@linux.alibaba.com>: fs/ntfs: remove unused varibles fs/ntfs: remove unused variable attr_len Subsystem: ocfs2 Tom Rix <trix@redhat.com>: fs/ocfs2/cluster/tcp.c: remove unneeded break Mauricio Faria de Oliveira <mfo@canonical.com>: ocfs2: ratelimit the 'max lookup times reached' notice Subsystem: arch Colin Ian King <colin.king@canonical.com>: arch/Kconfig: fix spelling mistakes Subsystem: mm/slab-generic Hui Su <sh_def@163.com>: mm/slab_common.c: use list_for_each_entry in dump_unreclaimable_slab() Bartosz Golaszewski <bgolaszewski@baylibre.com>: Patch series "slab: provide and use krealloc_array()", v3: mm: slab: clarify krealloc()'s behavior with __GFP_ZERO mm: slab: provide krealloc_array() ALSA: pcm: use krealloc_array() vhost: vringh: use krealloc_array() pinctrl: use krealloc_array() edac: ghes: use krealloc_array() drm: atomic: use krealloc_array() hwtracing: intel: use krealloc_array() dma-buf: use krealloc_array() Vlastimil Babka <vbabka@suse.cz>: mm, slab, slub: clear the slab_cache field when freeing page Subsystem: mm/slab Alexander Popov <alex.popov@linux.com>: mm/slab: rerform init_on_free earlier Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: mm, slub: use kmem_cache_debug_flags() in deactivate_slab() Bharata B Rao <bharata@linux.ibm.com>: mm/slub: let number of online CPUs determine the slub page order Subsystem: mm/dax Dan Williams <dan.j.williams@intel.com>: device-dax/kmem: use struct_size() Subsystem: mm/debug Zhenhua Huang <zhenhuah@codeaurora.org>: mm: fix page_owner initializing issue for arm32 Liam Mark <lmark@codeaurora.org>: mm/page_owner: record timestamp and pid Subsystem: mm/pagecache Kent Overstreet <kent.overstreet@gmail.com>: Patch series "generic_file_buffered_read() improvements", v2: mm/filemap/c: break generic_file_buffered_read up into multiple functions mm/filemap.c: generic_file_buffered_read() now uses find_get_pages_contig Alex Shi <alex.shi@linux.alibaba.com>: mm/truncate: add parameter explanation for invalidate_mapping_pagevec Hailong Liu <carver4lio@163.com>: mm/filemap.c: remove else after a return Subsystem: mm/gup John Hubbard <jhubbard@nvidia.com>: Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v3: mm/gup_benchmark: rename to mm/gup_test selftests/vm: use a common gup_test.h selftests/vm: rename run_vmtests --> run_vmtests.sh selftests/vm: minor cleanup: Makefile and gup_test.c selftests/vm: only some gup_test items are really benchmarks selftests/vm: gup_test: introduce the dump_pages() sub-test selftests/vm: run_vmtests.sh: update and clean up gup_test invocation selftests/vm: hmm-tests: remove the libhugetlbfs dependency selftests/vm: 2x speedup for run_vmtests.sh Barry Song <song.bao.hua@hisilicon.com>: mm/gup_test.c: mark gup_test_init as __init function mm/gup_test: GUP_TEST depends on DEBUG_FS Jason Gunthorpe <jgg@nvidia.com>: Patch series "Add a seqcount between gup_fast and copy_page_range()", v4: mm/gup: reorganize internal_get_user_pages_fast() mm/gup: prevent gup_fast from racing with COW during fork mm/gup: remove the vma allocation from gup_longterm_locked() mm/gup: combine put_compound_head() and unpin_user_page() Subsystem: mm/swap Ralph Campbell <rcampbell@nvidia.com>: mm: handle zone device pages in release_pages() Miaohe Lin <linmiaohe@huawei.com>: mm/swapfile.c: use helper function swap_count() in add_swap_count_continuation() mm/swap_state: skip meaningless swap cache readahead when ra_info.win == 0 mm/swapfile.c: remove unnecessary out label in __swap_duplicate() mm/swapfile.c: use memset to fill the swap_map with SWAP_HAS_CACHE Jeff Layton <jlayton@kernel.org>: mm: remove pagevec_lookup_range_nr_tag() Subsystem: mm/shmem Hui Su <sh_def@163.com>: mm/shmem.c: make shmem_mapping() inline Randy Dunlap <rdunlap@infradead.org>: tmpfs: fix Documentation nits Subsystem: mm/memcg Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: add file_thp, shmem_thp to memory.stat Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: remove unused mod_memcg_obj_state() Miaohe Lin <linmiaohe@huawei.com>: mm: memcontrol: eliminate redundant check in __mem_cgroup_insert_exceeded() Muchun Song <songmuchun@bytedance.com>: mm: memcg/slab: fix return of child memcg objcg for root memcg mm: memcg/slab: fix use after free in obj_cgroup_charge Shakeel Butt <shakeelb@google.com>: mm/rmap: always do TTU_IGNORE_ACCESS Alex Shi <alex.shi@linux.alibaba.com>: mm/memcg: update page struct member in comments Roman Gushchin <guro@fb.com>: mm: memcg: fix obsolete code comments Patch series "mm: memcg: deprecate cgroup v1 non-hierarchical mode", v1: mm: memcg: deprecate the non-hierarchical mode docs: cgroup-v1: reflect the deprecation of the non-hierarchical mode cgroup: remove obsoleted broken_hierarchy and warned_broken_hierarchy Hui Su <sh_def@163.com>: mm/page_counter: use page_counter_read in page_counter_set_max Lukas Bulwahn <lukas.bulwahn@gmail.com>: mm: memcg: remove obsolete memcg_has_children() Muchun Song <songmuchun@bytedance.com>: mm: memcg/slab: rename *_lruvec_slab_state to *_lruvec_kmem_state Kaixu Xia <kaixuxia@tencent.com>: mm: memcontrol: sssign boolean values to a bool variable Alex Shi <alex.shi@linux.alibaba.com>: mm/memcg: remove incorrect comment Shakeel Butt <shakeelb@google.com>: Patch series "memcg: add pagetable comsumption to memory.stat", v2: mm: move lruvec stats update functions to vmstat.h mm: memcontrol: account pagetables per node Subsystem: mm/pagemap Dan Williams <dan.j.williams@intel.com>: xen/unpopulated-alloc: consolidate pgmap manipulation Kalesh Singh <kaleshsingh@google.com>: Patch series "Speed up mremap on large regions", v4: kselftests: vm: add mremap tests mm: speedup mremap on 1GB or larger regions arm64: mremap speedup - enable HAVE_MOVE_PUD x86: mremap speedup - Enable HAVE_MOVE_PUD John Hubbard <jhubbard@nvidia.com>: mm: cleanup: remove unused tsk arg from __access_remote_vm Alex Shi <alex.shi@linux.alibaba.com>: mm/mapping_dirty_helpers: enhance the kernel-doc markups mm/page_vma_mapped.c: add colon to fix kernel-doc markups error for check_pte Axel Rasmussen <axelrasmussen@google.com>: mm: mmap_lock: add tracepoints around lock acquisition "Matthew Wilcox (Oracle)" <willy@infradead.org>: sparc: fix handling of page table constructor failure mm: move free_unref_page to mm/internal.h Subsystem: mm/mremap Dmitry Safonov <dima@arista.com>: Patch series "mremap: move_vma() fixes": mm/mremap: account memory on do_munmap() failure mm/mremap: for MREMAP_DONTUNMAP check security_vm_enough_memory_mm() mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio vm_ops: rename .split() callback to .may_split() mremap: check if it's possible to split original vma mm: forbid splitting special mappings Subsystem: mm/hmm Daniel Vetter <daniel.vetter@ffwll.ch>: mm: track mmu notifiers in fs_reclaim_acquire/release mm: extract might_alloc() debug check locking/selftests: add testcases for fs_reclaim Subsystem: mm/vmalloc Andrew Morton <akpm@linux-foundation.org>: mm/vmalloc.c:__vmalloc_area_node(): avoid 32-bit overflow "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: use free_vm_area() if an allocation fails mm/vmalloc: rework the drain logic Alex Shi <alex.shi@linux.alibaba.com>: mm/vmalloc: add 'align' parameter explanation for pvm_determine_end_from_reverse Baolin Wang <baolin.wang@linux.alibaba.com>: mm/vmalloc.c: remove unnecessary return statement Waiman Long <longman@redhat.com>: mm/vmalloc: Fix unlock order in s_stop() Subsystem: mm/documentation Alex Shi <alex.shi@linux.alibaba.com>: docs/vm: remove unused 3 items explanation for /proc/vmstat Subsystem: mm/kasan Vincenzo Frascino <vincenzo.frascino@arm.com>: mm/vmalloc.c: fix kasan shadow poisoning size Walter Wu <walter-zh.wu@mediatek.com>: Patch series "kasan: add workqueue stack for generic KASAN", v5: workqueue: kasan: record workqueue stack kasan: print workqueue stack lib/test_kasan.c: add workqueue test case kasan: update documentation for generic kasan Marco Elver <elver@google.com>: lkdtm: disable KASAN for rodata.o Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: Patch series "arch, mm: deprecate DISCONTIGMEM", v2: alpha: switch from DISCONTIGMEM to SPARSEMEM ia64: remove custom __early_pfn_to_nid() ia64: remove 'ifdef CONFIG_ZONE_DMA32' statements ia64: discontig: paging_init(): remove local max_pfn calculation ia64: split virtual map initialization out of paging_init() ia64: forbid using VIRTUAL_MEM_MAP with FLATMEM ia64: make SPARSEMEM default and disable DISCONTIGMEM arm: remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL arm, arm64: move free_unused_memmap() to generic mm arc: use FLATMEM with freeing of unused memory map instead of DISCONTIGMEM m68k/mm: make node data and node setup depend on CONFIG_DISCONTIGMEM m68k/mm: enable use of generic memory_model.h for !DISCONTIGMEM m68k: deprecate DISCONTIGMEM Patch series "arch, mm: improve robustness of direct map manipulation", v7: mm: introduce debug_pagealloc_{map,unmap}_pages() helpers PM: hibernate: make direct map manipulations more explicit arch, mm: restore dependency of __kernel_map_pages() on DEBUG_PAGEALLOC arch, mm: make kernel_page_present() always available Vlastimil Babka <vbabka@suse.cz>: Patch series "disable pcplists during memory offline", v3: mm, page_alloc: clean up pageset high and batch update mm, page_alloc: calculate pageset high and batch once per zone mm, page_alloc: remove setup_pageset() mm, page_alloc: simplify pageset_update() mm, page_alloc: cache pageset high and batch in struct zone mm, page_alloc: move draining pcplists to page isolation users mm, page_alloc: disable pcplists during memory offline Miaohe Lin <linmiaohe@huawei.com>: include/linux/page-flags.h: remove unused __[Set|Clear]PagePrivate "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/page-flags: fix comment mm/page_alloc: add __free_pages() documentation Zou Wei <zou_wei@huawei.com>: mm/page_alloc: mark some symbols with static keyword David Hildenbrand <david@redhat.com>: mm/page_alloc: clear all pages in post_alloc_hook() with init_on_alloc=1 Lin Feng <linf@wangsu.com>: init/main: fix broken buffer_init when DEFERRED_STRUCT_PAGE_INIT set Lorenzo Stoakes <lstoakes@gmail.com>: mm: page_alloc: refactor setup_per_zone_lowmem_reserve() Muchun Song <songmuchun@bytedance.com>: mm/page_alloc: speed up the iteration of max_order Subsystem: mm/memory-failure Oscar Salvador <osalvador@suse.de>: Patch series "HWpoison: further fixes and cleanups", v5: mm,hwpoison: drain pcplists before bailing out for non-buddy zero-refcount page mm,hwpoison: take free pages off the buddy freelists mm,hwpoison: drop unneeded pcplist draining Patch series "HWPoison: Refactor get page interface", v2: mm,hwpoison: refactor get_any_page mm,hwpoison: disable pcplists before grabbing a refcount mm,hwpoison: remove drain_all_pages from shake_page mm,memory_failure: always pin the page in madvise_inject_error mm,hwpoison: return -EBUSY when migration fails Subsystem: mm/hugetlb Hui Su <sh_def@163.com>: mm/hugetlb.c: just use put_page_testzero() instead of page_count() Ralph Campbell <rcampbell@nvidia.com>: include/linux/huge_mm.h: remove extern keyword Alex Shi <alex.shi@linux.alibaba.com>: khugepaged: add parameter explanations for kernel-doc markup Liu Xiang <liu.xiang@zlingsmart.com>: mm: hugetlb: fix type of delta parameter and related local variables in gather_surplus_pages() Oscar Salvador <osalvador@suse.de>: mm,hugetlb: remove unneeded initialization Dan Carpenter <dan.carpenter@oracle.com>: hugetlb: fix an error code in hugetlb_reserve_pages() Subsystem: mm/vmscan Johannes Weiner <hannes@cmpxchg.org>: mm: don't wake kswapd prematurely when watermark boosting is disabled Lukas Bulwahn <lukas.bulwahn@gmail.com>: mm/vmscan: drop unneeded assignment in kswapd() "logic.yu" <hymmsx.yu@gmail.com>: mm/vmscan.c: remove the filename in the top of file comment Muchun Song <songmuchun@bytedance.com>: mm/page_isolation: do not isolate the max order page Subsystem: mm/z3fold Vitaly Wool <vitaly.wool@konsulko.com>: Patch series "z3fold: stability / rt fixes": z3fold: simplify freeing slots z3fold: stricter locking and more careful reclaim z3fold: remove preempt disabled sections for RT Subsystem: mm/compaction Yanfei Xu <yanfei.xu@windriver.com>: mm/compaction: rename 'start_pfn' to 'iteration_start_pfn' in compact_zone() Hui Su <sh_def@163.com>: mm/compaction: move compaction_suitable's comment to right place mm/compaction: make defer_compaction and compaction_deferred static Subsystem: mm/oom-kill Hui Su <sh_def@163.com>: mm/oom_kill: change comment and rename is_dump_unreclaim_slabs() Subsystem: mm/migration Long Li <lonuxli.64@gmail.com>: mm/migrate.c: fix comment spelling Ralph Campbell <rcampbell@nvidia.com>: mm/migrate.c: optimize migrate_vma_pages() mmu notifier "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: support THPs in zero_user_segments Yang Shi <shy828301@gmail.com>: Patch series "mm: misc migrate cleanup and improvement", v3: mm: truncate_complete_page() does not exist any more mm: migrate: simplify the logic for handling permanent failure mm: migrate: skip shared exec THP for NUMA balancing mm: migrate: clean up migrate_prep{_local} mm: migrate: return -ENOSYS if THP migration is unsupported Stephen Zhang <starzhangzsd@gmail.com>: mm: migrate: remove unused parameter in migrate_vma_insert_page() Subsystem: mm/cma Lecopzer Chen <lecopzer.chen@mediatek.com>: mm/cma.c: remove redundant cma_mutex lock Charan Teja Reddy <charante@codeaurora.org>: mm: cma: improve pr_debug log in cma_release() Subsystem: mm/page-poison Vlastimil Babka <vbabka@suse.cz>: Patch series "cleanup page poisoning", v3: mm, page_alloc: do not rely on the order of page_poison and init_on_alloc/free parameters mm, page_poison: use static key more efficiently kernel/power: allow hibernation with page_poison sanity checking mm, page_poison: remove CONFIG_PAGE_POISONING_NO_SANITY mm, page_poison: remove CONFIG_PAGE_POISONING_ZERO Subsystem: mm/userfaultfd Lokesh Gidra <lokeshgidra@google.com>: Patch series "Control over userfaultfd kernel-fault handling", v6: userfaultfd: add UFFD_USER_MODE_ONLY userfaultfd: add user-mode only option to unprivileged_userfaultfd sysctl knob Axel Rasmussen <axelrasmussen@google.com>: userfaultfd: selftests: make __{s,u}64 format specifiers portable Peter Xu <peterx@redhat.com>: Patch series "userfaultfd: selftests: Small fixes": userfaultfd/selftests: always dump something in modes userfaultfd/selftests: fix retval check for userfaultfd_open() userfaultfd/selftests: hint the test runner on required privilege Subsystem: mm/zswap Joe Perches <joe@perches.com>: mm/zswap: make struct kernel_param_ops definitions const YueHaibing <yuehaibing@huawei.com>: mm/zswap: fix passing zero to 'PTR_ERR' warning Barry Song <song.bao.hua@hisilicon.com>: mm/zswap: move to use crypto_acomp API for hardware acceleration Subsystem: mm/zsmalloc Miaohe Lin <linmiaohe@huawei.com>: mm/zsmalloc.c: rework the list_add code in insert_zspage() Subsystem: mm/uaccess Colin Ian King <colin.king@canonical.com>: mm/process_vm_access: remove redundant initialization of iov_r Subsystem: mm/zram Minchan Kim <minchan@kernel.org>: zram: support page writeback zram: add stat to gather incompressible pages since zram set up Rui Salvaterra <rsalvaterra@gmail.com>: zram: break the strict dependency from lzo Subsystem: mm/cleanups Mauro Carvalho Chehab <mchehab+huawei@kernel.org>: mm: fix kernel-doc markups Joe Perches <joe@perches.com>: Patch series "mm: Convert sysfs sprintf family to sysfs_emit", v2: mm: use sysfs_emit for struct kobject * uses mm: huge_memory: convert remaining use of sprintf to sysfs_emit and neatening mm:backing-dev: use sysfs_emit in macro defining functions mm: shmem: convert shmem_enabled_show to use sysfs_emit_at mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at "Gustavo A. R. Silva" <gustavoars@kernel.org>: mm: fix fall-through warnings for Clang Alexey Dobriyan <adobriyan@gmail.com>: mm: cleanup kstrto*() usage /mmap_lock.h | 107 ++ a/Documentation/admin-guide/blockdev/zram.rst | 6 a/Documentation/admin-guide/cgroup-v1/memcg_test.rst | 8 a/Documentation/admin-guide/cgroup-v1/memory.rst | 42 a/Documentation/admin-guide/cgroup-v2.rst | 11 a/Documentation/admin-guide/mm/transhuge.rst | 15 a/Documentation/admin-guide/sysctl/vm.rst | 15 a/Documentation/core-api/memory-allocation.rst | 4 a/Documentation/core-api/pin_user_pages.rst | 8 a/Documentation/dev-tools/kasan.rst | 5 a/Documentation/filesystems/tmpfs.rst | 8 a/Documentation/vm/memory-model.rst | 3 a/Documentation/vm/page_owner.rst | 12 a/arch/Kconfig | 21 a/arch/alpha/Kconfig | 8 a/arch/alpha/include/asm/mmzone.h | 14 a/arch/alpha/include/asm/page.h | 7 a/arch/alpha/include/asm/pgtable.h | 12 a/arch/alpha/include/asm/sparsemem.h | 18 a/arch/alpha/kernel/setup.c | 1 a/arch/arc/Kconfig | 3 a/arch/arc/include/asm/page.h | 20 a/arch/arc/mm/init.c | 29 a/arch/arm/Kconfig | 12 a/arch/arm/kernel/vdso.c | 9 a/arch/arm/mach-bcm/Kconfig | 1 a/arch/arm/mach-davinci/Kconfig | 1 a/arch/arm/mach-exynos/Kconfig | 1 a/arch/arm/mach-highbank/Kconfig | 1 a/arch/arm/mach-omap2/Kconfig | 1 a/arch/arm/mach-s5pv210/Kconfig | 1 a/arch/arm/mach-tango/Kconfig | 1 a/arch/arm/mm/init.c | 78 - a/arch/arm64/Kconfig | 9 a/arch/arm64/include/asm/cacheflush.h | 1 a/arch/arm64/include/asm/pgtable.h | 1 a/arch/arm64/kernel/vdso.c | 41 a/arch/arm64/mm/init.c | 68 - a/arch/arm64/mm/pageattr.c | 12 a/arch/ia64/Kconfig | 11 a/arch/ia64/include/asm/meminit.h | 2 a/arch/ia64/mm/contig.c | 88 -- a/arch/ia64/mm/discontig.c | 44 - a/arch/ia64/mm/init.c | 14 a/arch/ia64/mm/numa.c | 30 a/arch/m68k/Kconfig.cpu | 31 a/arch/m68k/include/asm/page.h | 2 a/arch/m68k/include/asm/page_mm.h | 7 a/arch/m68k/include/asm/virtconvert.h | 7 a/arch/m68k/mm/init.c | 10 a/arch/mips/vdso/genvdso.c | 4 a/arch/nds32/mm/mm-nds32.c | 6 a/arch/powerpc/Kconfig | 5 a/arch/riscv/Kconfig | 4 a/arch/riscv/include/asm/pgtable.h | 2 a/arch/riscv/include/asm/set_memory.h | 1 a/arch/riscv/mm/pageattr.c | 31 a/arch/s390/Kconfig | 4 a/arch/s390/configs/debug_defconfig | 2 a/arch/s390/configs/defconfig | 2 a/arch/s390/kernel/vdso.c | 11 a/arch/sparc/Kconfig | 4 a/arch/sparc/mm/init_64.c | 2 a/arch/x86/Kconfig | 5 a/arch/x86/entry/vdso/vma.c | 17 a/arch/x86/include/asm/set_memory.h | 1 a/arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 2 a/arch/x86/kernel/tboot.c | 1 a/arch/x86/mm/pat/set_memory.c | 6 a/drivers/base/node.c | 2 a/drivers/block/zram/Kconfig | 42 a/drivers/block/zram/zcomp.c | 2 a/drivers/block/zram/zram_drv.c | 29 a/drivers/block/zram/zram_drv.h | 1 a/drivers/dax/device.c | 4 a/drivers/dax/kmem.c | 2 a/drivers/dma-buf/sync_file.c | 3 a/drivers/edac/ghes_edac.c | 4 a/drivers/firmware/efi/efi.c | 1 a/drivers/gpu/drm/drm_atomic.c | 3 a/drivers/hwtracing/intel_th/msu.c | 2 a/drivers/ide/falconide.c | 2 a/drivers/ide/ide-probe.c | 3 a/drivers/misc/lkdtm/Makefile | 1 a/drivers/pinctrl/pinctrl-utils.c | 2 a/drivers/vhost/vringh.c | 3 a/drivers/virtio/virtio_balloon.c | 6 a/drivers/xen/unpopulated-alloc.c | 14 a/fs/aio.c | 5 a/fs/ntfs/file.c | 5 a/fs/ntfs/inode.c | 2 a/fs/ntfs/logfile.c | 3 a/fs/ocfs2/cluster/tcp.c | 1 a/fs/ocfs2/namei.c | 4 a/fs/proc/kcore.c | 2 a/fs/proc/meminfo.c | 2 a/fs/userfaultfd.c | 20 a/include/linux/cgroup-defs.h | 15 a/include/linux/compaction.h | 12 a/include/linux/fs.h | 2 a/include/linux/gfp.h | 2 a/include/linux/highmem.h | 19 a/include/linux/huge_mm.h | 93 -- a/include/linux/memcontrol.h | 148 --- a/include/linux/migrate.h | 4 a/include/linux/mm.h | 118 +- a/include/linux/mm_types.h | 8 a/include/linux/mmap_lock.h | 94 ++ a/include/linux/mmzone.h | 50 - a/include/linux/page-flags.h | 6 a/include/linux/page_ext.h | 8 a/include/linux/pagevec.h | 3 a/include/linux/poison.h | 4 a/include/linux/rmap.h | 1 a/include/linux/sched/mm.h | 16 a/include/linux/set_memory.h | 5 a/include/linux/shmem_fs.h | 6 a/include/linux/slab.h | 18 a/include/linux/vmalloc.h | 8 a/include/linux/vmstat.h | 104 ++ a/include/trace/events/sched.h | 84 + a/include/uapi/linux/const.h | 5 a/include/uapi/linux/ethtool.h | 2 a/include/uapi/linux/kernel.h | 9 a/include/uapi/linux/lightnvm.h | 2 a/include/uapi/linux/mroute6.h | 2 a/include/uapi/linux/netfilter/x_tables.h | 2 a/include/uapi/linux/netlink.h | 2 a/include/uapi/linux/sysctl.h | 2 a/include/uapi/linux/userfaultfd.h | 9 a/init/main.c | 6 a/ipc/shm.c | 8 a/kernel/cgroup/cgroup.c | 12 a/kernel/fork.c | 3 a/kernel/kthread.c | 29 a/kernel/power/hibernate.c | 2 a/kernel/power/power.h | 2 a/kernel/power/snapshot.c | 52 + a/kernel/ptrace.c | 2 a/kernel/workqueue.c | 3 a/lib/locking-selftest.c | 47 + a/lib/test_kasan_module.c | 29 a/mm/Kconfig | 25 a/mm/Kconfig.debug | 28 a/mm/Makefile | 4 a/mm/backing-dev.c | 8 a/mm/cma.c | 6 a/mm/compaction.c | 29 a/mm/filemap.c | 823 ++++++++++--------- a/mm/gup.c | 329 ++----- a/mm/gup_benchmark.c | 210 ---- a/mm/gup_test.c | 299 ++++++ a/mm/gup_test.h | 40 a/mm/highmem.c | 52 + a/mm/huge_memory.c | 86 + a/mm/hugetlb.c | 28 a/mm/init-mm.c | 1 a/mm/internal.h | 5 a/mm/kasan/generic.c | 3 a/mm/kasan/report.c | 4 a/mm/khugepaged.c | 58 - a/mm/ksm.c | 50 - a/mm/madvise.c | 14 a/mm/mapping_dirty_helpers.c | 6 a/mm/memblock.c | 80 + a/mm/memcontrol.c | 170 +-- a/mm/memory-failure.c | 322 +++---- a/mm/memory.c | 24 a/mm/memory_hotplug.c | 44 - a/mm/mempolicy.c | 8 a/mm/migrate.c | 183 ++-- a/mm/mm_init.c | 1 a/mm/mmap.c | 22 a/mm/mmap_lock.c | 230 +++++ a/mm/mmu_notifier.c | 7 a/mm/mmzone.c | 14 a/mm/mremap.c | 282 ++++-- a/mm/nommu.c | 8 a/mm/oom_kill.c | 14 a/mm/page_alloc.c | 517 ++++++----- a/mm/page_counter.c | 4 a/mm/page_ext.c | 10 a/mm/page_isolation.c | 18 a/mm/page_owner.c | 17 a/mm/page_poison.c | 56 - a/mm/page_vma_mapped.c | 9 a/mm/process_vm_access.c | 2 a/mm/rmap.c | 9 a/mm/shmem.c | 39 a/mm/slab.c | 10 a/mm/slab.h | 9 a/mm/slab_common.c | 10 a/mm/slob.c | 6 a/mm/slub.c | 156 +-- a/mm/swap.c | 12 a/mm/swap_state.c | 7 a/mm/swapfile.c | 14 a/mm/truncate.c | 18 a/mm/vmalloc.c | 105 +- a/mm/vmscan.c | 21 a/mm/vmstat.c | 6 a/mm/workingset.c | 8 a/mm/z3fold.c | 215 ++-- a/mm/zsmalloc.c | 11 a/mm/zswap.c | 193 +++- a/sound/core/pcm_lib.c | 4 a/tools/include/linux/poison.h | 6 a/tools/testing/selftests/vm/.gitignore | 4 a/tools/testing/selftests/vm/Makefile | 41 a/tools/testing/selftests/vm/check_config.sh | 31 a/tools/testing/selftests/vm/config | 2 a/tools/testing/selftests/vm/gup_benchmark.c | 143 --- a/tools/testing/selftests/vm/gup_test.c | 258 +++++ a/tools/testing/selftests/vm/hmm-tests.c | 10 a/tools/testing/selftests/vm/mremap_test.c | 344 +++++++ a/tools/testing/selftests/vm/run_vmtests | 51 - a/tools/testing/selftests/vm/userfaultfd.c | 94 -- 217 files changed, 4817 insertions(+), 3369 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-12-15 3:02 incoming Andrew Morton @ 2020-12-15 3:25 ` Linus Torvalds 2020-12-15 3:30 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2020-12-15 3:25 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM On Mon, Dec 14, 2020 at 7:02 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442. I haven't actually processed the patches yet, but I have a question for Konstantin wrt b4. All the patches except for _one_ get a nice little green check-mark next to them when I use 'git am' on this series. The one that did not was [patch 192/200]. I have no idea why - and it doesn't matter a lot to me, it just stood out as being different. I'm assuming Andrew has started doing patch attestation, and that patch failed. But if so, maybe Konstantin wants to know what went wrong. Konstantin? Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-12-15 3:25 ` incoming Linus Torvalds @ 2020-12-15 3:30 ` Linus Torvalds 2020-12-15 14:04 ` incoming Konstantin Ryabitsev 0 siblings, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2020-12-15 3:30 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM On Mon, Dec 14, 2020 at 7:25 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > All the patches except for _one_ get a nice little green check-mark > next to them when I use 'git am' on this series. > > The one that did not was [patch 192/200]. > > I have no idea why Hmm. It looks like that patch is the only one in the series with the ">From" marker in the commit message, from the silly "clarify that this isn't the first line in a new message in mbox format". And "b4 am" has turned the single ">" into two, making the stupid marker worse, and actually corrupting the end result. Coincidence? Or cause? Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-12-15 3:30 ` incoming Linus Torvalds @ 2020-12-15 14:04 ` Konstantin Ryabitsev 0 siblings, 0 replies; 348+ messages in thread From: Konstantin Ryabitsev @ 2020-12-15 14:04 UTC (permalink / raw) To: Linus Torvalds; +Cc: Andrew Morton, mm-commits, Linux-MM On Mon, Dec 14, 2020 at 07:30:54PM -0800, Linus Torvalds wrote: > > All the patches except for _one_ get a nice little green check-mark > > next to them when I use 'git am' on this series. > > > > The one that did not was [patch 192/200]. > > > > I have no idea why > > Hmm. It looks like that patch is the only one in the series with the > ">From" marker in the commit message, from the silly "clarify that > this isn't the first line in a new message in mbox format". > > And "b4 am" has turned the single ">" into two, making the stupid > marker worse, and actually corrupting the end result. It's a bug in b4 that I overlooked. Public-inbox emits mboxrd-formatted .mbox files, while Python's mailbox.mbox consumes mboxo only. The main distinction between the two is precisely that mboxrd will convert ">From " into ">>From " in an attempt to avoid corruption during escape/unescape (it didn't end up fixing the problem 100% and mostly introduced incompatibilities like this one). I have a fix in master/stable-0.6.y and I'll release a 0.6.2 before the end of the week. Thanks for the report. -K ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-12-11 21:35 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-12-11 21:35 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 8 patches, based on 33dc9614dc208291d0c4bcdeb5d30d481dcd2c4c. Subsystems affected by this patch series: mm/pagecache proc selftests kbuild mm/kasan mm/hugetlb Subsystem: mm/pagecache Andrew Morton <akpm@linux-foundation.org>: revert "mm/filemap: add static for function __add_to_page_cache_locked" Subsystem: proc Miles Chen <miles.chen@mediatek.com>: proc: use untagged_addr() for pagemap_read addresses Subsystem: selftests Arnd Bergmann <arnd@arndb.de>: selftest/fpu: avoid clang warning Subsystem: kbuild Arnd Bergmann <arnd@arndb.de>: kbuild: avoid static_assert for genksyms initramfs: fix clang build failure elfcore: fix building with clang Subsystem: mm/kasan Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: kasan: fix object remaining in offline per-cpu quarantine Subsystem: mm/hugetlb Gerald Schaefer <gerald.schaefer@linux.ibm.com>: mm/hugetlb: clear compound_nr before freeing gigantic pages fs/proc/task_mmu.c | 8 ++++++-- include/linux/build_bug.h | 5 +++++ include/linux/elfcore.h | 22 ++++++++++++++++++++++ init/initramfs.c | 2 +- kernel/Makefile | 1 - kernel/elfcore.c | 26 -------------------------- lib/Makefile | 3 ++- mm/filemap.c | 2 +- mm/hugetlb.c | 1 + mm/kasan/quarantine.c | 39 +++++++++++++++++++++++++++++++++++++++ 10 files changed, 77 insertions(+), 32 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-12-06 6:14 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-12-06 6:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 12 patches, based on 33256ce194110874d4bc90078b577c59f9076c59. Subsystems affected by this patch series: lib coredump mm/memcg mm/zsmalloc mm/swap mailmap mm/selftests mm/pagecache mm/hugetlb mm/pagemap Subsystem: lib Randy Dunlap <rdunlap@infradead.org>: zlib: export S390 symbols for zlib modules Subsystem: coredump Menglong Dong <dong.menglong@zte.com.cn>: coredump: fix core_pattern parse error Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: memcg/slab: fix obj_cgroup_charge() return value handling Yang Shi <shy828301@gmail.com>: mm: list_lru: set shrinker map bit when child nr_items is not zero Subsystem: mm/zsmalloc Minchan Kim <minchan@kernel.org>: mm/zsmalloc.c: drop ZSMALLOC_PGTABLE_MAPPING Subsystem: mm/swap Qian Cai <qcai@redhat.com>: mm/swapfile: do not sleep with a spin lock held Subsystem: mailmap Uwe Kleine-König <u.kleine-koenig@pengutronix.de>: mailmap: add two more addresses of Uwe Kleine-König Subsystem: mm/selftests Xingxing Su <suxingxing@loongson.cn>: tools/testing/selftests/vm: fix build error Axel Rasmussen <axelrasmussen@google.com>: userfaultfd: selftests: fix SIGSEGV if huge mmap fails Subsystem: mm/pagecache Alex Shi <alex.shi@linux.alibaba.com>: mm/filemap: add static for function __add_to_page_cache_locked Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: hugetlb_cgroup: fix offline of hugetlb cgroup with reservations Subsystem: mm/pagemap Liu Zixian <liuzixian4@huawei.com>: mm/mmap.c: fix mmap return value when vma is merged after call_mmap() .mailmap | 2 + arch/arm/configs/omap2plus_defconfig | 1 fs/coredump.c | 3 + include/linux/zsmalloc.h | 1 lib/zlib_dfltcc/dfltcc_inflate.c | 3 + mm/Kconfig | 13 ------- mm/filemap.c | 2 - mm/hugetlb_cgroup.c | 8 +--- mm/list_lru.c | 10 ++--- mm/mmap.c | 26 ++++++-------- mm/slab.h | 40 +++++++++++++--------- mm/swapfile.c | 4 +- mm/zsmalloc.c | 54 ------------------------------- tools/testing/selftests/vm/Makefile | 4 ++ tools/testing/selftests/vm/userfaultfd.c | 25 +++++++++----- 15 files changed, 75 insertions(+), 121 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-11-22 6:16 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-11-22 6:16 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 8 patches, based on a349e4c659609fd20e4beea89e5c4a4038e33a95. Subsystems affected by this patch series: mm/madvise kbuild mm/pagemap mm/readahead mm/memcg mm/userfaultfd vfs-akpm mm/madvise Subsystem: mm/madvise Eric Dumazet <edumazet@google.com>: mm/madvise: fix memory leak from process_madvise Subsystem: kbuild Nick Desaulniers <ndesaulniers@google.com>: compiler-clang: remove version check for BPF Tracing Subsystem: mm/pagemap Dan Williams <dan.j.williams@intel.com>: mm: fix phys_to_target_node() and memory_add_physaddr_to_nid() exports Subsystem: mm/readahead "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: fix readahead_page_batch for retry entries Subsystem: mm/memcg Muchun Song <songmuchun@bytedance.com>: mm: memcg/slab: fix root memcg vmstats Subsystem: mm/userfaultfd Gerald Schaefer <gerald.schaefer@linux.ibm.com>: mm/userfaultfd: do not access vma->vm_mm after calling handle_userfault() Subsystem: vfs-akpm Yicong Yang <yangyicong@hisilicon.com>: libfs: fix error cast of negative value in simple_attr_write() Subsystem: mm/madvise "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: fix madvise WILLNEED performance problem arch/ia64/include/asm/sparsemem.h | 6 ++++++ arch/powerpc/include/asm/mmzone.h | 5 +++++ arch/powerpc/include/asm/sparsemem.h | 5 ++--- arch/powerpc/mm/mem.c | 1 + arch/x86/include/asm/sparsemem.h | 10 ++++++++++ arch/x86/mm/numa.c | 2 ++ drivers/dax/Kconfig | 1 - fs/libfs.c | 6 ++++-- include/linux/compiler-clang.h | 2 ++ include/linux/memory_hotplug.h | 14 -------------- include/linux/numa.h | 30 +++++++++++++++++++++++++++++- include/linux/pagemap.h | 2 ++ mm/huge_memory.c | 9 ++++----- mm/madvise.c | 4 +--- mm/memcontrol.c | 9 +++++++-- mm/memory_hotplug.c | 18 ------------------ 16 files changed, 75 insertions(+), 49 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-11-14 6:51 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-11-14 6:51 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 14 patches, based on 9e6a39eae450b81c8b2c8cbbfbdf8218e9b40c81. Subsystems affected by this patch series: mm/migration mm/vmscan mailmap mm/slub mm/gup kbuild reboot kernel/watchdog mm/memcg mm/hugetlbfs panic ocfs2 Subsystem: mm/migration Zi Yan <ziy@nvidia.com>: mm/compaction: count pages and stop correctly during page isolation mm/compaction: stop isolation if too many pages are isolated and we have pages to migrate Subsystem: mm/vmscan Nicholas Piggin <npiggin@gmail.com>: mm/vmscan: fix NR_ISOLATED_FILE corruption on 64-bit Subsystem: mailmap Dmitry Baryshkov <dbaryshkov@gmail.com>: mailmap: fix entry for Dmitry Baryshkov/Eremin-Solenikov Subsystem: mm/slub Laurent Dufour <ldufour@linux.ibm.com>: mm/slub: fix panic in slab_alloc_node() Subsystem: mm/gup Jason Gunthorpe <jgg@nvidia.com>: mm/gup: use unpin_user_pages() in __gup_longterm_locked() Subsystem: kbuild Arvind Sankar <nivedita@alum.mit.edu>: compiler.h: fix barrier_data() on clang Subsystem: reboot Matteo Croce <mcroce@microsoft.com>: Patch series "fix parsing of reboot= cmdline", v3: Revert "kernel/reboot.c: convert simple_strtoul to kstrtoint" reboot: fix overflow parsing reboot cpu number Subsystem: kernel/watchdog Santosh Sivaraj <santosh@fossix.org>: kernel/watchdog: fix watchdog_allowed_mask not used warning Subsystem: mm/memcg Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: fix missing wakeup polling thread Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: hugetlbfs: fix anon huge page migration race Subsystem: panic Christophe Leroy <christophe.leroy@csgroup.eu>: panic: don't dump stack twice on warn Subsystem: ocfs2 Wengang Wang <wen.gang.wang@oracle.com>: ocfs2: initialize ip_next_orphan .mailmap | 5 +- fs/ocfs2/super.c | 1 include/asm-generic/barrier.h | 1 include/linux/compiler-clang.h | 6 -- include/linux/compiler-gcc.h | 19 -------- include/linux/compiler.h | 18 +++++++- include/linux/memcontrol.h | 11 ++++- kernel/panic.c | 3 - kernel/reboot.c | 28 ++++++------ kernel/watchdog.c | 4 - mm/compaction.c | 12 +++-- mm/gup.c | 14 ++++-- mm/hugetlb.c | 90 ++--------------------------------------- mm/memory-failure.c | 36 +++++++--------- mm/migrate.c | 46 +++++++++++--------- mm/rmap.c | 5 -- mm/slub.c | 2 mm/vmscan.c | 5 +- 18 files changed, 119 insertions(+), 187 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-11-02 1:06 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-11-02 1:06 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 15 patches, based on 3cea11cd5e3b00d91caf0b4730194039b45c5891. Subsystems affected by this patch series: mm/memremap mm/memcg mm/slab-generic mm/kasan mm/mempolicy signals lib mm/pagecache kthread mm/oom-kill mm/pagemap epoll core-kernel Subsystem: mm/memremap Ralph Campbell <rcampbell@nvidia.com>: mm/mremap_pages: fix static key devmap_managed_key updates Subsystem: mm/memcg Mike Kravetz <mike.kravetz@oracle.com>: hugetlb_cgroup: fix reservation accounting zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>: mm: memcontrol: correct the NR_ANON_THPS counter of hierarchical memcg Roman Gushchin <guro@fb.com>: mm: memcg: link page counters to root if use_hierarchy is false Subsystem: mm/slab-generic Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: adopt KUNIT tests to SW_TAGS mode Subsystem: mm/mempolicy Shijie Luo <luoshijie1@huawei.com>: mm: mempolicy: fix potential pte_unmap_unlock pte error Subsystem: signals Oleg Nesterov <oleg@redhat.com>: ptrace: fix task_join_group_stop() for the case when current is traced Subsystem: lib Vasily Gorbik <gor@linux.ibm.com>: lib/crc32test: remove extra local_irq_disable/enable Subsystem: mm/pagecache Jason Yan <yanaijie@huawei.com>: mm/truncate.c: make __invalidate_mapping_pages() static Subsystem: kthread Zqiang <qiang.zhang@windriver.com>: kthread_worker: prevent queuing delayed work from timer_fn when it is being canceled Subsystem: mm/oom-kill Charles Haithcock <chaithco@redhat.com>: mm, oom: keep oom_adj under or at upper limit when printing Subsystem: mm/pagemap Jason Gunthorpe <jgg@nvidia.com>: mm: always have io_remap_pfn_range() set pgprot_decrypted() Subsystem: epoll Soheil Hassas Yeganeh <soheil@google.com>: epoll: check ep_events_available() upon timeout epoll: add a selftest for epoll timeout race Subsystem: core-kernel Lukas Bulwahn <lukas.bulwahn@gmail.com>: kernel/hung_task.c: make type annotations consistent fs/eventpoll.c | 16 + fs/proc/base.c | 2 include/linux/mm.h | 9 include/linux/pgtable.h | 4 kernel/hung_task.c | 3 kernel/kthread.c | 3 kernel/signal.c | 19 - lib/crc32test.c | 4 lib/test_kasan.c | 149 +++++++--- mm/hugetlb.c | 20 - mm/memcontrol.c | 25 + mm/mempolicy.c | 6 mm/memremap.c | 39 +- mm/truncate.c | 2 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 95 ++++++ 15 files changed, 290 insertions(+), 106 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-10-17 23:13 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-10-17 23:13 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 40 patches, based on 9d9af1007bc08971953ae915d88dc9bb21344b53. Subsystems affected by this patch series: ia64 mm/memcg mm/migration mm/pagemap mm/gup mm/madvise mm/vmalloc misc Subsystem: ia64 Krzysztof Kozlowski <krzk@kernel.org>: ia64: fix build error with !COREDUMP Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm, memcg: rework remote charging API to support nesting Patch series "mm: kmem: kernel memory accounting in an interrupt context": mm: kmem: move memcg_kmem_bypass() calls to get_mem/obj_cgroup_from_current() mm: kmem: remove redundant checks from get_obj_cgroup_from_current() mm: kmem: prepare remote memcg charging infra for interrupt contexts mm: kmem: enable kernel memcg accounting from interrupt contexts Subsystem: mm/migration Joonsoo Kim <iamjoonsoo.kim@lge.com>: mm/memory-failure: remove a wrapper for alloc_migration_target() mm/memory_hotplug: remove a wrapper for alloc_migration_target() Miaohe Lin <linmiaohe@huawei.com>: mm/migrate: avoid possible unnecessary process right check in kernel_move_pages() Subsystem: mm/pagemap "Liam R. Howlett" <Liam.Howlett@Oracle.com>: mm/mmap: add inline vma_next() for readability of mmap code mm/mmap: add inline munmap_vma_range() for code readability Subsystem: mm/gup Jann Horn <jannh@google.com>: mm/gup_benchmark: take the mmap lock around GUP binfmt_elf: take the mmap lock around find_extend_vma() mm/gup: assert that the mmap lock is held in __get_user_pages() John Hubbard <jhubbard@nvidia.com>: Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v2: mm/gup_benchmark: rename to mm/gup_test selftests/vm: use a common gup_test.h selftests/vm: rename run_vmtests --> run_vmtests.sh selftests/vm: minor cleanup: Makefile and gup_test.c selftests/vm: only some gup_test items are really benchmarks selftests/vm: gup_test: introduce the dump_pages() sub-test selftests/vm: run_vmtests.sh: update and clean up gup_test invocation selftests/vm: hmm-tests: remove the libhugetlbfs dependency selftests/vm: 10x speedup for hmm-tests Subsystem: mm/madvise Minchan Kim <minchan@kernel.org>: Patch series "introduce memory hinting API for external process", v9: mm/madvise: pass mm to do_madvise pid: move pidfd_get_pid() to pid.c mm/madvise: introduce process_madvise() syscall: an external memory hinting API Subsystem: mm/vmalloc "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "remove alloc_vm_area", v4: mm: update the documentation for vfree Christoph Hellwig <hch@lst.de>: mm: add a VM_MAP_PUT_PAGES flag for vmap mm: add a vmap_pfn function mm: allow a NULL fn callback in apply_to_page_range zsmalloc: switch from alloc_vm_area to get_vm_area drm/i915: use vmap in shmem_pin_map drm/i915: stop using kmap in i915_gem_object_map drm/i915: use vmap in i915_gem_object_map xen/xenbus: use apply_to_page_range directly in xenbus_map_ring_pv x86/xen: open code alloc_vm_area in arch_gnttab_valloc mm: remove alloc_vm_area Patch series "two small vmalloc cleanups": mm: cleanup the gfp_mask handling in __vmalloc_area_node mm: remove the filename in the top of file comment in vmalloc.c Subsystem: misc Tian Tao <tiantao6@hisilicon.com>: mm: remove duplicate include statement in mmu.c Documentation/core-api/pin_user_pages.rst | 8 arch/alpha/kernel/syscalls/syscall.tbl | 1 arch/arm/mm/mmu.c | 1 arch/arm/tools/syscall.tbl | 1 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 2 arch/ia64/kernel/Makefile | 2 arch/ia64/kernel/syscalls/syscall.tbl | 1 arch/m68k/kernel/syscalls/syscall.tbl | 1 arch/microblaze/kernel/syscalls/syscall.tbl | 1 arch/mips/kernel/syscalls/syscall_n32.tbl | 1 arch/mips/kernel/syscalls/syscall_n64.tbl | 1 arch/mips/kernel/syscalls/syscall_o32.tbl | 1 arch/parisc/kernel/syscalls/syscall.tbl | 1 arch/powerpc/kernel/syscalls/syscall.tbl | 1 arch/s390/configs/debug_defconfig | 2 arch/s390/configs/defconfig | 2 arch/s390/kernel/syscalls/syscall.tbl | 1 arch/sh/kernel/syscalls/syscall.tbl | 1 arch/sparc/kernel/syscalls/syscall.tbl | 1 arch/x86/entry/syscalls/syscall_32.tbl | 1 arch/x86/entry/syscalls/syscall_64.tbl | 1 arch/x86/xen/grant-table.c | 27 +- arch/xtensa/kernel/syscalls/syscall.tbl | 1 drivers/gpu/drm/i915/Kconfig | 1 drivers/gpu/drm/i915/gem/i915_gem_pages.c | 136 ++++------ drivers/gpu/drm/i915/gt/shmem_utils.c | 78 +----- drivers/xen/xenbus/xenbus_client.c | 30 +- fs/binfmt_elf.c | 3 fs/buffer.c | 6 fs/io_uring.c | 2 fs/notify/fanotify/fanotify.c | 5 fs/notify/inotify/inotify_fsnotify.c | 5 include/linux/memcontrol.h | 12 include/linux/mm.h | 2 include/linux/pid.h | 1 include/linux/sched/mm.h | 43 +-- include/linux/syscalls.h | 2 include/linux/vmalloc.h | 7 include/uapi/asm-generic/unistd.h | 4 kernel/exit.c | 19 - kernel/pid.c | 19 + kernel/sys_ni.c | 1 mm/Kconfig | 24 + mm/Makefile | 2 mm/gup.c | 2 mm/gup_benchmark.c | 225 ------------------ mm/gup_test.c | 295 +++++++++++++++++++++-- mm/gup_test.h | 40 ++- mm/madvise.c | 125 ++++++++-- mm/memcontrol.c | 83 ++++-- mm/memory-failure.c | 18 - mm/memory.c | 16 - mm/memory_hotplug.c | 46 +-- mm/migrate.c | 71 +++-- mm/mmap.c | 74 ++++- mm/nommu.c | 7 mm/percpu.c | 3 mm/slab.h | 3 mm/vmalloc.c | 147 +++++------ mm/zsmalloc.c | 10 tools/testing/selftests/vm/.gitignore | 3 tools/testing/selftests/vm/Makefile | 40 ++- tools/testing/selftests/vm/check_config.sh | 31 ++ tools/testing/selftests/vm/config | 2 tools/testing/selftests/vm/gup_benchmark.c | 143 ----------- tools/testing/selftests/vm/gup_test.c | 260 ++++++++++++++++++-- tools/testing/selftests/vm/hmm-tests.c | 12 tools/testing/selftests/vm/run_vmtests | 334 -------------------------- tools/testing/selftests/vm/run_vmtests.sh | 350 +++++++++++++++++++++++++++- 70 files changed, 1580 insertions(+), 1224 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-10-16 2:40 Andrew Morton 2020-10-16 3:03 ` incoming Andrew Morton 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2020-10-16 2:40 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - most of the rest of mm/ - various other subsystems 156 patches, based on 578a7155c5a1894a789d4ece181abf9d25dc6b0d. Subsystems affected by this patch series: mm/dax mm/debug mm/thp mm/readahead mm/page-poison mm/util mm/memory-hotplug mm/zram mm/cleanups misc core-kernel get_maintainer MAINTAINERS lib bitops checkpatch binfmt ramfs autofs nilfs rapidio panic relay kgdb ubsan romfs fault-injection Subsystem: mm/dax Dan Williams <dan.j.williams@intel.com>: device-dax/kmem: fix resource release Subsystem: mm/debug "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "mm/debug_vm_pgtable fixes", v4: powerpc/mm: add DEBUG_VM WARN for pmd_clear powerpc/mm: move setting pte specific flags to pfn_pte mm/debug_vm_pgtable/ppc64: avoid setting top bits in radom value mm/debug_vm_pgtables/hugevmap: use the arch helper to identify huge vmap support. mm/debug_vm_pgtable/savedwrite: enable savedwrite test with CONFIG_NUMA_BALANCING mm/debug_vm_pgtable/THP: mark the pte entry huge before using set_pmd/pud_at mm/debug_vm_pgtable/set_pte/pmd/pud: don't use set_*_at to update an existing pte entry mm/debug_vm_pgtable/locks: move non page table modifying test together mm/debug_vm_pgtable/locks: take correct page table lock mm/debug_vm_pgtable/thp: use page table depost/withdraw with THP mm/debug_vm_pgtable/pmd_clear: don't use pmd/pud_clear on pte entries mm/debug_vm_pgtable/hugetlb: disable hugetlb test on ppc64 mm/debug_vm_pgtable: avoid none pte in pte_clear_test mm/debug_vm_pgtable: avoid doing memory allocation with pgtable_t mapped. Subsystem: mm/thp "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Fix read-only THP for non-tmpfs filesystems": XArray: add xa_get_order XArray: add xas_split mm/filemap: fix storing to a THP shadow entry Patch series "Remove assumptions of THP size": mm/filemap: fix page cache removal for arbitrary sized THPs mm/memory: remove page fault assumption of compound page size mm/page_owner: change split_page_owner to take a count "Kirill A. Shutemov" <kirill@shutemov.name>: mm/huge_memory: fix total_mapcount assumption of page size mm/huge_memory: fix split assumption of page size "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/huge_memory: fix page_trans_huge_mapcount assumption of THP size mm/huge_memory: fix can_split_huge_page assumption of THP size mm/rmap: fix assumptions of THP size mm/truncate: fix truncation for pages of arbitrary size mm/page-writeback: support tail pages in wait_for_stable_page mm/vmscan: allow arbitrary sized pages to be paged out fs: add a filesystem flag for THPs fs: do not update nr_thps for mappings which support THPs Huang Ying <ying.huang@intel.com>: mm: fix a race during THP splitting Subsystem: mm/readahead "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Readahead patches for 5.9/5.10": mm/readahead: add DEFINE_READAHEAD mm/readahead: make page_cache_ra_unbounded take a readahead_control mm/readahead: make do_page_cache_ra take a readahead_control David Howells <dhowells@redhat.com>: mm/readahead: make ondemand_readahead take a readahead_control mm/readahead: pass readahead_control to force_page_cache_ra "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/readahead: add page_cache_sync_ra and page_cache_async_ra David Howells <dhowells@redhat.com>: mm/filemap: fold ra_submit into do_sync_mmap_readahead mm/readahead: pass a file_ra_state into force_page_cache_ra Subsystem: mm/page-poison Naoya Horiguchi <naoya.horiguchi@nec.com>: Patch series "HWPOISON: soft offline rework", v7: mm,hwpoison: cleanup unused PageHuge() check mm, hwpoison: remove recalculating hpage mm,hwpoison-inject: don't pin for hwpoison_filter Oscar Salvador <osalvador@suse.de>: mm,hwpoison: unexport get_hwpoison_page and make it static mm,hwpoison: refactor madvise_inject_error mm,hwpoison: kill put_hwpoison_page mm,hwpoison: unify THP handling for hard and soft offline mm,hwpoison: rework soft offline for free pages mm,hwpoison: rework soft offline for in-use pages mm,hwpoison: refactor soft_offline_huge_page and __soft_offline_page mm,hwpoison: return 0 if the page is already poisoned in soft-offline Naoya Horiguchi <naoya.horiguchi@nec.com>: mm,hwpoison: introduce MF_MSG_UNSPLIT_THP mm,hwpoison: double-check page count in __get_any_page() Oscar Salvador <osalvador@suse.de>: mm,hwpoison: try to narrow window race for free pages Mateusz Nosek <mateusznosek0@gmail.com>: mm/page_poison.c: replace bool variable with static key Miaohe Lin <linmiaohe@huawei.com>: mm/vmstat.c: use helper macro abs() Subsystem: mm/util Bartosz Golaszewski <bgolaszewski@baylibre.com>: mm/util.c: update the kerneldoc for kstrdup_const() Jann Horn <jannh@google.com>: mm/mmu_notifier: fix mmget() assert in __mmu_interval_notifier_insert Subsystem: mm/memory-hotplug David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: online_pages()/offline_pages() cleanups", v2: mm/memory_hotplug: inline __offline_pages() into offline_pages() mm/memory_hotplug: enforce section granularity when onlining/offlining mm/memory_hotplug: simplify page offlining mm/page_alloc: simplify __offline_isolated_pages() mm/memory_hotplug: drop nr_isolate_pageblock in offline_pages() mm/page_isolation: simplify return value of start_isolate_page_range() mm/memory_hotplug: simplify page onlining mm/page_alloc: drop stale pageblock comment in memmap_init_zone*() mm: pass migratetype into memmap_init_zone() and move_pfn_range_to_zone() mm/memory_hotplug: mark pageblocks MIGRATE_ISOLATE while onlining memory Patch series "selective merging of system ram resources", v4: kernel/resource: make release_mem_region_adjustable() never fail kernel/resource: move and rename IORESOURCE_MEM_DRIVER_MANAGED mm/memory_hotplug: guard more declarations by CONFIG_MEMORY_HOTPLUG mm/memory_hotplug: prepare passing flags to add_memory() and friends mm/memory_hotplug: MEMHP_MERGE_RESOURCE to specify merging of System RAM resources virtio-mem: try to merge system ram resources xen/balloon: try to merge system ram resources hv_balloon: try to merge system ram resources kernel/resource: make iomem_resource implicit in release_mem_region_adjustable() Laurent Dufour <ldufour@linux.ibm.com>: mm: don't panic when links can't be created in sysfs David Hildenbrand <david@redhat.com>: Patch series "mm: place pages to the freelist tail when onlining and undoing isolation", v2: mm/page_alloc: convert "report" flag of __free_one_page() to a proper flag mm/page_alloc: place pages to tail in __putback_isolated_page() mm/page_alloc: move pages to tail in move_to_free_list() mm/page_alloc: place pages to tail in __free_pages_core() mm/memory_hotplug: update comment regarding zone shuffling Subsystem: mm/zram Douglas Anderson <dianders@chromium.org>: zram: failing to decompress is WARN_ON worthy Subsystem: mm/cleanups YueHaibing <yuehaibing@huawei.com>: mm/slab.h: remove duplicate include Wei Yang <richard.weiyang@linux.alibaba.com>: mm/page_reporting.c: drop stale list head check in page_reporting_cycle Ira Weiny <ira.weiny@intel.com>: mm/highmem.c: clean up endif comments Yu Zhao <yuzhao@google.com>: mm: use self-explanatory macros rather than "2" Miaohe Lin <linmiaohe@huawei.com>: mm: fix some broken comments Chen Tao <chentao3@hotmail.com>: mm: fix some comments formatting Xiaofei Tan <tanxiaofei@huawei.com>: mm/workingset.c: fix some doc warnings Miaohe Lin <linmiaohe@huawei.com>: mm: use helper function put_write_access() Mike Rapoport <rppt@linux.ibm.com>: include/linux/mmzone.h: remove unused early_pfn_valid() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: rename page_order() to buddy_order() Subsystem: misc Randy Dunlap <rdunlap@infradead.org>: fs: configfs: delete repeated words in comments Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: split out min()/max() et al. helpers Subsystem: core-kernel Liao Pingfang <liao.pingfang@zte.com.cn>: kernel/sys.c: replace do_brk with do_brk_flags in comment of prctl_set_mm_map() Randy Dunlap <rdunlap@infradead.org>: kernel/: fix repeated words in comments kernel: acct.c: fix some kernel-doc nits Subsystem: get_maintainer Joe Perches <joe@perches.com>: get_maintainer: add test for file in VCS Subsystem: MAINTAINERS Joe Perches <joe@perches.com>: get_maintainer: exclude MAINTAINERS file(s) from --git-fallback Jarkko Sakkinen <jarkko.sakkinen@linux.intel.com>: MAINTAINERS: jarkko.sakkinen@linux.intel.com -> jarkko@kernel.org Subsystem: lib Randy Dunlap <rdunlap@infradead.org>: lib: bitmap: delete duplicated words lib: libcrc32c: delete duplicated words lib: decompress_bunzip2: delete duplicated words lib: dynamic_queue_limits: delete duplicated words + fix typo lib: earlycpio: delete duplicated words lib: radix-tree: delete duplicated words lib: syscall: delete duplicated words lib: test_sysctl: delete duplicated words lib/mpi/mpi-bit.c: fix spello of "functions" Stephen Boyd <swboyd@chromium.org>: lib/idr.c: document calling context for IDA APIs mustn't use locks lib/idr.c: document that ida_simple_{get,remove}() are deprecated Christophe JAILLET <christophe.jaillet@wanadoo.fr>: lib/scatterlist.c: avoid a double memset Miaohe Lin <linmiaohe@huawei.com>: lib/percpu_counter.c: use helper macro abs() Andy Shevchenko <andriy.shevchenko@linux.intel.com>: include/linux/list.h: add a macro to test if entry is pointing to the head Dan Carpenter <dan.carpenter@oracle.com>: lib/test_hmm.c: fix an error code in dmirror_allocate_chunk() Tobias Jordan <kernel@cdqe.de>: lib/crc32.c: fix trivial typo in preprocessor condition Subsystem: bitops Wei Yang <richard.weiyang@linux.alibaba.com>: bitops: simplify get_count_order_long() bitops: use the same mechanism for get_count_order[_long] Subsystem: checkpatch Jerome Forissier <jerome@forissier.org>: checkpatch: add --kconfig-prefix Joe Perches <joe@perches.com>: checkpatch: move repeated word test checkpatch: add test for comma use that should be semicolon Rikard Falkeborn <rikard.falkeborn@gmail.com>: const_structs.checkpatch: add phy_ops Nicolas Boichat <drinkcat@chromium.org>: checkpatch: warn if trace_printk and friends are called Rikard Falkeborn <rikard.falkeborn@gmail.com>: const_structs.checkpatch: add pinctrl_ops and pinmux_ops Joe Perches <joe@perches.com>: checkpatch: warn on self-assignments checkpatch: allow not using -f with files that are in git Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: extend author Signed-off-by check for split From: header Joe Perches <joe@perches.com>: checkpatch: emit a warning on embedded filenames Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: fix multi-statement macro checks for while blocks. Łukasz Stelmach <l.stelmach@samsung.com>: checkpatch: fix false positive on empty block comment lines Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: add new warnings to author signoff checks. Subsystem: binfmt Chris Kennelly <ckennelly@google.com>: Patch series "Selecting Load Addresses According to p_align", v3: fs/binfmt_elf: use PT_LOAD p_align values for suitable start address tools/testing/selftests: add self-test for verifying load alignment Jann Horn <jannh@google.com>: Patch series "Fix ELF / FDPIC ELF core dumping, and use mmap_lock properly in there", v5: binfmt_elf_fdpic: stop using dump_emit() on user pointers on !MMU coredump: let dump_emit() bail out on short writes coredump: refactor page range dumping into common helper coredump: rework elf/elf_fdpic vma_dump_size() into common helper binfmt_elf, binfmt_elf_fdpic: use a VMA list snapshot mm/gup: take mmap_lock in get_dump_page() mm: remove the now-unnecessary mmget_still_valid() hack Subsystem: ramfs Matthew Wilcox (Oracle) <willy@infradead.org>: ramfs: fix nommu mmap with gaps in the page cache Subsystem: autofs Matthew Wilcox <willy@infradead.org>: autofs: harden ioctl table Subsystem: nilfs Wang Hai <wanghai38@huawei.com>: nilfs2: fix some kernel-doc warnings for nilfs2 Subsystem: rapidio Souptick Joarder <jrdr.linux@gmail.com>: rapidio: fix error handling path Jing Xiangfeng <jingxiangfeng@huawei.com>: rapidio: fix the missed put_device() for rio_mport_add_riodev Subsystem: panic Alexey Kardashevskiy <aik@ozlabs.ru>: panic: dump registers on panic_on_warn Subsystem: relay Sudip Mukherjee <sudipm.mukherjee@gmail.com>: kernel/relay.c: drop unneeded initialization Subsystem: kgdb Ritesh Harjani <riteshh@linux.ibm.com>: scripts/gdb/proc: add struct mount & struct super_block addr in lx-mounts command scripts/gdb/tasks: add headers and improve spacing format Subsystem: ubsan Elena Petrova <lenaptr@google.com>: sched.h: drop in_ubsan field when UBSAN is in trap mode George Popescu <georgepope@android.com>: ubsan: introduce CONFIG_UBSAN_LOCAL_BOUNDS for Clang Subsystem: romfs Libing Zhou <libing.zhou@nokia-sbell.com>: ROMFS: support inode blocks calculation Subsystem: fault-injection Albert van der Linde <alinde@google.com>: Patch series "add fault injection to user memory access", v3: lib, include/linux: add usercopy failure capability lib, uaccess: add failure injection to usercopy functions .mailmap | 1 Documentation/admin-guide/kernel-parameters.txt | 1 Documentation/core-api/xarray.rst | 14 Documentation/fault-injection/fault-injection.rst | 7 MAINTAINERS | 6 arch/ia64/mm/init.c | 4 arch/powerpc/include/asm/book3s/64/pgtable.h | 29 + arch/powerpc/include/asm/nohash/pgtable.h | 5 arch/powerpc/mm/pgtable.c | 5 arch/powerpc/platforms/powernv/memtrace.c | 2 arch/powerpc/platforms/pseries/hotplug-memory.c | 2 drivers/acpi/acpi_memhotplug.c | 3 drivers/base/memory.c | 3 drivers/base/node.c | 33 +- drivers/block/zram/zram_drv.c | 2 drivers/dax/kmem.c | 50 ++- drivers/hv/hv_balloon.c | 4 drivers/infiniband/core/uverbs_main.c | 3 drivers/rapidio/devices/rio_mport_cdev.c | 18 - drivers/s390/char/sclp_cmd.c | 2 drivers/vfio/pci/vfio_pci.c | 38 +- drivers/virtio/virtio_mem.c | 5 drivers/xen/balloon.c | 4 fs/autofs/dev-ioctl.c | 8 fs/binfmt_elf.c | 267 +++------------- fs/binfmt_elf_fdpic.c | 176 ++-------- fs/configfs/dir.c | 2 fs/configfs/file.c | 2 fs/coredump.c | 238 +++++++++++++- fs/ext4/verity.c | 4 fs/f2fs/verity.c | 4 fs/inode.c | 2 fs/nilfs2/bmap.c | 2 fs/nilfs2/cpfile.c | 6 fs/nilfs2/page.c | 1 fs/nilfs2/sufile.c | 4 fs/proc/task_mmu.c | 18 - fs/ramfs/file-nommu.c | 2 fs/romfs/super.c | 1 fs/userfaultfd.c | 28 - include/linux/bitops.h | 13 include/linux/blkdev.h | 1 include/linux/bvec.h | 6 include/linux/coredump.h | 13 include/linux/fault-inject-usercopy.h | 22 + include/linux/fs.h | 28 - include/linux/idr.h | 13 include/linux/ioport.h | 15 include/linux/jiffies.h | 3 include/linux/kernel.h | 150 --------- include/linux/list.h | 29 + include/linux/memory_hotplug.h | 42 +- include/linux/minmax.h | 153 +++++++++ include/linux/mm.h | 5 include/linux/mmzone.h | 17 - include/linux/node.h | 16 include/linux/nodemask.h | 2 include/linux/page-flags.h | 6 include/linux/page_owner.h | 6 include/linux/pagemap.h | 111 ++++++ include/linux/sched.h | 2 include/linux/sched/mm.h | 25 - include/linux/uaccess.h | 12 include/linux/vmstat.h | 2 include/linux/xarray.h | 22 + include/ras/ras_event.h | 3 kernel/acct.c | 10 kernel/cgroup/cpuset.c | 2 kernel/dma/direct.c | 2 kernel/fork.c | 4 kernel/futex.c | 2 kernel/irq/timings.c | 2 kernel/jump_label.c | 2 kernel/kcsan/encoding.h | 2 kernel/kexec_core.c | 2 kernel/kexec_file.c | 2 kernel/kthread.c | 2 kernel/livepatch/state.c | 2 kernel/panic.c | 12 kernel/pid_namespace.c | 2 kernel/power/snapshot.c | 2 kernel/range.c | 3 kernel/relay.c | 2 kernel/resource.c | 114 +++++-- kernel/smp.c | 2 kernel/sys.c | 2 kernel/user_namespace.c | 2 lib/Kconfig.debug | 7 lib/Kconfig.ubsan | 14 lib/Makefile | 1 lib/bitmap.c | 2 lib/crc32.c | 2 lib/decompress_bunzip2.c | 2 lib/dynamic_queue_limits.c | 4 lib/earlycpio.c | 2 lib/fault-inject-usercopy.c | 39 ++ lib/find_bit.c | 1 lib/hexdump.c | 1 lib/idr.c | 9 lib/iov_iter.c | 5 lib/libcrc32c.c | 2 lib/math/rational.c | 2 lib/math/reciprocal_div.c | 1 lib/mpi/mpi-bit.c | 2 lib/percpu_counter.c | 2 lib/radix-tree.c | 2 lib/scatterlist.c | 2 lib/strncpy_from_user.c | 3 lib/syscall.c | 2 lib/test_hmm.c | 2 lib/test_sysctl.c | 2 lib/test_xarray.c | 65 ++++ lib/usercopy.c | 5 lib/xarray.c | 208 ++++++++++++ mm/Kconfig | 2 mm/compaction.c | 6 mm/debug_vm_pgtable.c | 267 ++++++++-------- mm/filemap.c | 58 ++- mm/gup.c | 73 ++-- mm/highmem.c | 4 mm/huge_memory.c | 47 +- mm/hwpoison-inject.c | 18 - mm/internal.h | 47 +- mm/khugepaged.c | 2 mm/madvise.c | 52 --- mm/memory-failure.c | 357 ++++++++++------------ mm/memory.c | 7 mm/memory_hotplug.c | 223 +++++-------- mm/memremap.c | 3 mm/migrate.c | 11 mm/mmap.c | 7 mm/mmu_notifier.c | 2 mm/page-writeback.c | 1 mm/page_alloc.c | 289 +++++++++++------ mm/page_isolation.c | 16 mm/page_owner.c | 10 mm/page_poison.c | 20 - mm/page_reporting.c | 4 mm/readahead.c | 174 ++++------ mm/rmap.c | 10 mm/shmem.c | 2 mm/shuffle.c | 2 mm/slab.c | 2 mm/slab.h | 1 mm/slub.c | 2 mm/sparse.c | 2 mm/swap_state.c | 2 mm/truncate.c | 6 mm/util.c | 3 mm/vmscan.c | 5 mm/vmstat.c | 8 mm/workingset.c | 2 scripts/Makefile.ubsan | 10 scripts/checkpatch.pl | 238 ++++++++++---- scripts/const_structs.checkpatch | 3 scripts/gdb/linux/proc.py | 15 scripts/gdb/linux/tasks.py | 9 scripts/get_maintainer.pl | 9 tools/testing/selftests/exec/.gitignore | 1 tools/testing/selftests/exec/Makefile | 9 tools/testing/selftests/exec/load_address.c | 68 ++++ 161 files changed, 2532 insertions(+), 1864 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-10-16 2:40 incoming Andrew Morton @ 2020-10-16 3:03 ` Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-10-16 3:03 UTC (permalink / raw) To: Linus Torvalds, mm-commits, linux-mm And... I forgot to set in-reply-to :( Shall resend, omitting linux-mm. ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-10-13 23:46 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-10-13 23:46 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 181 patches, based on 029f56db6ac248769f2c260bfaf3c3c0e23e904c. Subsystems affected by this patch series: kbuild scripts ntfs ocfs2 vfs mm/slab mm/slub mm/kmemleak mm/dax mm/debug mm/pagecache mm/fadvise mm/gup mm/swap mm/memremap mm/memcg mm/selftests mm/pagemap mm/mincore mm/hmm mm/dma mm/memory-failure mm/vmalloc mm/documentation mm/kasan mm/pagealloc mm/hugetlb mm/vmscan mm/z3fold mm/zbud mm/compaction mm/mempolicy mm/mempool mm/memblock mm/oom-kill mm/migration Subsystem: kbuild Nick Desaulniers <ndesaulniers@google.com>: Patch series "set clang minimum version to 10.0.1", v3: compiler-clang: add build check for clang 10.0.1 Revert "kbuild: disable clang's default use of -fmerge-all-constants" Revert "arm64: bti: Require clang >= 10.0.1 for in-kernel BTI support" Revert "arm64: vdso: Fix compilation with clang older than 8" Partially revert "ARM: 8905/1: Emit __gnu_mcount_nc when using Clang 10.0.0 or newer" Marco Elver <elver@google.com>: kasan: remove mentions of unsupported Clang versions Nick Desaulniers <ndesaulniers@google.com>: compiler-gcc: improve version error compiler.h: avoid escaped section names export.h: fix section name for CONFIG_TRIM_UNUSED_KSYMS for Clang Lukas Bulwahn <lukas.bulwahn@gmail.com>: kbuild: doc: describe proper script invocation Subsystem: scripts Wang Qing <wangqing@vivo.com>: scripts/spelling.txt: increase error-prone spell checking Naoki Hayama <naoki.hayama@lineo.co.jp>: scripts/spelling.txt: add "arbitrary" typo Borislav Petkov <bp@suse.de>: scripts/decodecode: add the capability to supply the program counter Subsystem: ntfs Rustam Kovhaev <rkovhaev@gmail.com>: ntfs: add check for mft record size in superblock Subsystem: ocfs2 Randy Dunlap <rdunlap@infradead.org>: ocfs2: delete repeated words in comments Gang He <ghe@suse.com>: ocfs2: fix potential soft lockup during fstrim Subsystem: vfs Randy Dunlap <rdunlap@infradead.org>: fs/xattr.c: fix kernel-doc warnings for setxattr & removexattr Luo Jiaxing <luojiaxing@huawei.com>: fs_parse: mark fs_param_bad_value() as static Subsystem: mm/slab Mateusz Nosek <mateusznosek0@gmail.com>: mm/slab.c: clean code by removing redundant if condition tangjianqiang <wyqt1985@gmail.com>: include/linux/slab.h: fix a typo error in comment Subsystem: mm/slub Abel Wu <wuyun.wu@huawei.com>: mm/slub.c: branch optimization in free slowpath mm/slub: fix missing ALLOC_SLOWPATH stat when bulk alloc mm/slub: make add_full() condition more explicit Subsystem: mm/kmemleak Davidlohr Bueso <dave@stgolabs.net>: mm/kmemleak: rely on rcu for task stack scanning Hui Su <sh_def@163.com>: mm,kmemleak-test.c: move kmemleak-test.c to samples dir Subsystem: mm/dax Dan Williams <dan.j.williams@intel.com>: Patch series "device-dax: Support sub-dividing soft-reserved ranges", v5: x86/numa: cleanup configuration dependent command-line options x86/numa: add 'nohmat' option efi/fake_mem: arrange for a resource entry per efi_fake_mem instance ACPI: HMAT: refactor hmat_register_target_device to hmem_register_device resource: report parent to walk_iomem_res_desc() callback mm/memory_hotplug: introduce default phys_to_target_node() implementation ACPI: HMAT: attach a device for each soft-reserved range device-dax: drop the dax_region.pfn_flags attribute device-dax: move instance creation parameters to 'struct dev_dax_data' device-dax: make pgmap optional for instance creation device-dax/kmem: introduce dax_kmem_range() device-dax/kmem: move resource name tracking to drvdata device-dax/kmem: replace release_resource() with release_mem_region() device-dax: add an allocation interface for device-dax instances device-dax: introduce 'struct dev_dax' typed-driver operations device-dax: introduce 'seed' devices drivers/base: make device_find_child_by_name() compatible with sysfs inputs device-dax: add resize support mm/memremap_pages: convert to 'struct range' mm/memremap_pages: support multiple ranges per invocation device-dax: add dis-contiguous resource support device-dax: introduce 'mapping' devices Joao Martins <joao.m.martins@oracle.com>: device-dax: make align a per-device property Dan Williams <dan.j.williams@intel.com>: device-dax: add an 'align' attribute Joao Martins <joao.m.martins@oracle.com>: dax/hmem: introduce dax_hmem.region_idle parameter device-dax: add a range mapping allocation attribute Subsystem: mm/debug "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/debug.c: do not dereference i_ino blindly John Hubbard <jhubbard@nvidia.com>: mm, dump_page: rename head_mapcount() --> head_compound_mapcount() Subsystem: mm/pagecache "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Return head pages from find_*_entry", v2: mm: factor find_get_incore_page out of mincore_page mm: use find_get_incore_page in memcontrol mm: optimise madvise WILLNEED proc: optimise smaps for shmem entries i915: use find_lock_page instead of find_lock_entry mm: convert find_get_entry to return the head page mm/shmem: return head page from find_lock_entry mm: add find_lock_head mm/filemap: fix filemap_map_pages for THP Subsystem: mm/fadvise Yafang Shao <laoar.shao@gmail.com>: mm, fadvise: improve the expensive remote LRU cache draining after FADV_DONTNEED Subsystem: mm/gup Barry Song <song.bao.hua@hisilicon.com>: mm/gup_benchmark: update the documentation in Kconfig mm/gup_benchmark: use pin_user_pages for FOLL_LONGTERM flag mm/gup: don't permit users to call get_user_pages with FOLL_LONGTERM John Hubbard <jhubbard@nvidia.com>: mm/gup: protect unpin_user_pages() against npages==-ERRNO Subsystem: mm/swap Gao Xiang <hsiangkao@redhat.com>: swap: rename SWP_FS to SWAP_FS_OPS to avoid ambiguity Yu Zhao <yuzhao@google.com>: mm: remove activate_page() from unuse_pte() mm: remove superfluous __ClearPageActive() Miaohe Lin <linmiaohe@huawei.com>: mm/swap.c: fix confusing comment in release_pages() mm/swap_slots.c: remove always zero and unused return value of enable_swap_slots_cache() mm/page_io.c: remove useless out label in __swap_writepage() mm/swap.c: fix incomplete comment in lru_cache_add_inactive_or_unevictable() mm/swapfile.c: remove unnecessary goto out in _swap_info_get() mm/swapfile.c: fix potential memory leak in sys_swapon Subsystem: mm/memremap Ira Weiny <ira.weiny@intel.com>: mm/memremap.c: convert devmap static branch to {inc,dec} Subsystem: mm/memcg "Gustavo A. R. Silva" <gustavoars@kernel.org>: mm: memcontrol: use flex_array_size() helper in memcpy() mm: memcontrol: use the preferred form for passing the size of a structure type Roman Gushchin <guro@fb.com>: mm: memcg/slab: fix racy access to page->mem_cgroup in mem_cgroup_from_obj() Miaohe Lin <linmiaohe@huawei.com>: mm: memcontrol: correct the comment of mem_cgroup_iter() Waiman Long <longman@redhat.com>: Patch series "mm/memcg: Miscellaneous cleanups and streamlining", v2: mm/memcg: clean up obsolete enum charge_type mm/memcg: simplify mem_cgroup_get_max() mm/memcg: unify swap and memsw page counters Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: add the missing numa_stat interface for cgroup v2 Miaohe Lin <linmiaohe@huawei.com>: mm/page_counter: correct the obsolete func name in the comment of page_counter_try_charge() mm: memcontrol: reword obsolete comment of mem_cgroup_unmark_under_oom() Bharata B Rao <bharata@linux.ibm.com>: mm: memcg/slab: uncharge during kmem_cache_free_bulk() Ralph Campbell <rcampbell@nvidia.com>: mm/memcg: fix device private memcg accounting Subsystem: mm/selftests John Hubbard <jhubbard@nvidia.com>: Patch series "selftests/vm: fix some minor aggravating factors in the Makefile": selftests/vm: fix false build success on the second and later attempts selftests/vm: fix incorrect gcc invocation in some cases Subsystem: mm/pagemap Matthew Wilcox <willy@infradead.org>: mm: account PMD tables like PTE tables Yanfei Xu <yanfei.xu@windriver.com>: mm/memory.c: fix typo in __do_fault() comment mm/memory.c: replace vmf->vma with variable vma Wei Yang <richard.weiyang@linux.alibaba.com>: mm/mmap: rename __vma_unlink_common() to __vma_unlink() mm/mmap: leverage vma_rb_erase_ignore() to implement vma_rb_erase() Chinwen Chang <chinwen.chang@mediatek.com>: Patch series "Try to release mmap_lock temporarily in smaps_rollup", v4: mmap locking API: add mmap_lock_is_contended() mm: smaps*: extend smap_gather_stats to support specified beginning mm: proc: smaps_rollup: do not stall write attempts on mmap_lock "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Fix PageDoubleMap": mm: move PageDoubleMap bit mm: simplify PageDoubleMap with PF_SECOND policy Wei Yang <richard.weiyang@linux.alibaba.com>: mm/mmap: leave adjust_next as virtual address instead of page frame number Randy Dunlap <rdunlap@infradead.org>: mm/memory.c: fix spello of "function" Wei Yang <richard.weiyang@linux.alibaba.com>: mm/mmap: not necessary to check mapping separately mm/mmap: check on file instead of the rb_root_cached of its address_space Miaohe Lin <linmiaohe@huawei.com>: mm: use helper function mapping_allow_writable() mm/mmap.c: use helper function allow_write_access() in __remove_shared_vm_struct() Liao Pingfang <liao.pingfang@zte.com.cn>: mm/mmap.c: replace do_brk with do_brk_flags in comment of insert_vm_struct() Peter Xu <peterx@redhat.com>: mm: remove src/dst mm parameter in copy_page_range() Subsystem: mm/mincore yuleixzhang <yulei.kernel@gmail.com>: include/linux/huge_mm.h: remove mincore_huge_pmd declaration Subsystem: mm/hmm Ralph Campbell <rcampbell@nvidia.com>: tools/testing/selftests/vm/hmm-tests.c: use the new SKIP() macro lib/test_hmm.c: remove unused dmirror_zero_page Subsystem: mm/dma Andy Shevchenko <andriy.shevchenko@linux.intel.com>: mm/dmapool.c: replace open-coded list_for_each_entry_safe() mm/dmapool.c: replace hard coded function name with __func__ Subsystem: mm/memory-failure Xianting Tian <tian.xianting@h3c.com>: mm/memory-failure: do pgoff calculation before for_each_process() Alex Shi <alex.shi@linux.alibaba.com>: mm/memory-failure.c: remove unused macro `writeback' Subsystem: mm/vmalloc Hui Su <sh_def@163.com>: mm/vmalloc.c: update the comment in __vmalloc_area_node() mm/vmalloc.c: fix the comment of find_vm_area Subsystem: mm/documentation Alexander Gordeev <agordeev@linux.ibm.com>: docs/vm: fix 'mm_count' vs 'mm_users' counter confusion Subsystem: mm/kasan Patricia Alfonso <trishalfonso@google.com>: Patch series "KASAN-KUnit Integration", v14: kasan/kunit: add KUnit Struct to Current Task KUnit: KASAN Integration KASAN: port KASAN Tests to KUnit KASAN: Testing Documentation David Gow <davidgow@google.com>: mm: kasan: do not panic if both panic_on_warn and kasan_multishot set Subsystem: mm/pagealloc David Hildenbrand <david@redhat.com>: Patch series "mm / virtio-mem: support ZONE_MOVABLE", v5: mm/page_alloc: tweak comments in has_unmovable_pages() mm/page_isolation: exit early when pageblock is isolated in set_migratetype_isolate() mm/page_isolation: drop WARN_ON_ONCE() in set_migratetype_isolate() mm/page_isolation: cleanup set_migratetype_isolate() virtio-mem: don't special-case ZONE_MOVABLE mm: document semantics of ZONE_MOVABLE Li Xinhai <lixinhai.lxh@gmail.com>: mm, isolation: avoid checking unmovable pages across pageblock boundary Mateusz Nosek <mateusznosek0@gmail.com>: mm/page_alloc.c: clean code by removing unnecessary initialization mm/page_alloc.c: micro-optimization remove unnecessary branch mm/page_alloc.c: fix early params garbage value accesses mm/page_alloc.c: clean code by merging two functions Yanfei Xu <yanfei.xu@windriver.com>: mm/page_alloc.c: __perform_reclaim should return 'unsigned long' Mateusz Nosek <mateusznosek0@gmail.com>: mmzone: clean code by removing unused macro parameter Ralph Campbell <rcampbell@nvidia.com>: mm: move call to compound_head() in release_pages() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/page_alloc.c: fix freeing non-compound pages Michal Hocko <mhocko@suse.com>: include/linux/gfp.h: clarify usage of GFP_ATOMIC in !preemptible contexts Subsystem: mm/hugetlb Baoquan He <bhe@redhat.com>: Patch series "mm/hugetlb: Small cleanup and improvement", v2: mm/hugetlb.c: make is_hugetlb_entry_hwpoisoned return bool mm/hugetlb.c: remove the unnecessary non_swap_entry() doc/vm: fix typo in the hugetlb admin documentation Wei Yang <richard.weiyang@linux.alibaba.com>: Patch series "mm/hugetlb: code refine and simplification", v4: mm/hugetlb: not necessary to coalesce regions recursively mm/hugetlb: remove VM_BUG_ON(!nrg) in get_file_region_entry_from_cache() mm/hugetlb: use list_splice to merge two list at once mm/hugetlb: count file_region to be added when regions_needed != NULL mm/hugetlb: a page from buddy is not on any list mm/hugetlb: narrow the hugetlb_lock protection area during preparing huge page mm/hugetlb: take the free hpage during the iteration directly Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: add lockdep check for i_mmap_rwsem held in huge_pmd_share Subsystem: mm/vmscan Chunxin Zang <zangchunxin@bytedance.com>: mm/vmscan: fix infinite loop in drop_slab_node Hui Su <sh_def@163.com>: mm/vmscan: fix comments for isolate_lru_page() Subsystem: mm/z3fold Hui Su <sh_def@163.com>: mm/z3fold.c: use xx_zalloc instead xx_alloc and memset Subsystem: mm/zbud Xiang Chen <chenxiang66@hisilicon.com>: mm/zbud: remove redundant initialization Subsystem: mm/compaction Mateusz Nosek <mateusznosek0@gmail.com>: mm/compaction.c: micro-optimization remove unnecessary branch include/linux/compaction.h: clean code by removing unused enum value John Hubbard <jhubbard@nvidia.com>: selftests/vm: 8x compaction_test speedup Subsystem: mm/mempolicy Wei Yang <richard.weiyang@linux.alibaba.com>: mm/mempolicy: remove or narrow the lock on current mm: remove unused alloc_page_vma_node() Subsystem: mm/mempool Miaohe Lin <linmiaohe@huawei.com>: mm/mempool: add 'else' to split mutually exclusive case Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: Patch series "memblock: seasonal cleaning^w cleanup", v3: KVM: PPC: Book3S HV: simplify kvm_cma_reserve() dma-contiguous: simplify cma_early_percent_memory() arm, xtensa: simplify initialization of high memory pages arm64: numa: simplify dummy_numa_init() h8300, nds32, openrisc: simplify detection of memory extents riscv: drop unneeded node initialization mircoblaze: drop unneeded NUMA and sparsemem initializations memblock: make for_each_memblock_type() iterator private memblock: make memblock_debug and related functionality private memblock: reduce number of parameters in for_each_mem_range() arch, mm: replace for_each_memblock() with for_each_mem_pfn_range() arch, drivers: replace for_each_membock() with for_each_mem_range() x86/setup: simplify initrd relocation and reservation x86/setup: simplify reserve_crashkernel() memblock: remove unused memblock_mem_size() memblock: implement for_each_reserved_mem_region() using __next_mem_region() memblock: use separate iterators for memory and reserved regions Subsystem: mm/oom-kill Suren Baghdasaryan <surenb@google.com>: mm, oom_adj: don't loop through tasks in __set_oom_adj when not necessary Subsystem: mm/migration Ralph Campbell <rcampbell@nvidia.com>: mm/migrate: remove cpages-- in migrate_vma_finalize() mm/migrate: remove obsolete comment about device public .clang-format | 7 Documentation/admin-guide/cgroup-v2.rst | 69 + Documentation/admin-guide/mm/hugetlbpage.rst | 2 Documentation/dev-tools/kasan.rst | 74 + Documentation/dev-tools/kmemleak.rst | 2 Documentation/kbuild/makefiles.rst | 20 Documentation/vm/active_mm.rst | 2 Documentation/x86/x86_64/boot-options.rst | 4 MAINTAINERS | 2 Makefile | 9 arch/arm/Kconfig | 2 arch/arm/include/asm/tlb.h | 1 arch/arm/kernel/setup.c | 18 arch/arm/mm/init.c | 59 - arch/arm/mm/mmu.c | 39 arch/arm/mm/pmsa-v7.c | 23 arch/arm/mm/pmsa-v8.c | 17 arch/arm/xen/mm.c | 7 arch/arm64/Kconfig | 2 arch/arm64/kernel/machine_kexec_file.c | 6 arch/arm64/kernel/setup.c | 4 arch/arm64/kernel/vdso/Makefile | 7 arch/arm64/mm/init.c | 11 arch/arm64/mm/kasan_init.c | 10 arch/arm64/mm/mmu.c | 11 arch/arm64/mm/numa.c | 15 arch/c6x/kernel/setup.c | 9 arch/h8300/kernel/setup.c | 8 arch/microblaze/mm/init.c | 23 arch/mips/cavium-octeon/dma-octeon.c | 14 arch/mips/kernel/setup.c | 31 arch/mips/netlogic/xlp/setup.c | 2 arch/nds32/kernel/setup.c | 8 arch/openrisc/kernel/setup.c | 9 arch/openrisc/mm/init.c | 8 arch/powerpc/kernel/fadump.c | 61 - arch/powerpc/kexec/file_load_64.c | 16 arch/powerpc/kvm/book3s_hv_builtin.c | 12 arch/powerpc/kvm/book3s_hv_uvmem.c | 14 arch/powerpc/mm/book3s64/hash_utils.c | 16 arch/powerpc/mm/book3s64/radix_pgtable.c | 10 arch/powerpc/mm/kasan/kasan_init_32.c | 8 arch/powerpc/mm/mem.c | 31 arch/powerpc/mm/numa.c | 7 arch/powerpc/mm/pgtable_32.c | 8 arch/riscv/mm/init.c | 36 arch/riscv/mm/kasan_init.c | 10 arch/s390/kernel/setup.c | 27 arch/s390/mm/page-states.c | 6 arch/s390/mm/vmem.c | 7 arch/sh/mm/init.c | 9 arch/sparc/mm/init_64.c | 12 arch/x86/include/asm/numa.h | 8 arch/x86/kernel/e820.c | 16 arch/x86/kernel/setup.c | 56 - arch/x86/mm/numa.c | 13 arch/x86/mm/numa_emulation.c | 3 arch/x86/xen/enlighten_pv.c | 2 arch/xtensa/mm/init.c | 55 - drivers/acpi/numa/hmat.c | 76 - drivers/acpi/numa/srat.c | 9 drivers/base/core.c | 2 drivers/bus/mvebu-mbus.c | 12 drivers/dax/Kconfig | 6 drivers/dax/Makefile | 3 drivers/dax/bus.c | 1237 +++++++++++++++++++++++---- drivers/dax/bus.h | 34 drivers/dax/dax-private.h | 74 + drivers/dax/device.c | 164 +-- drivers/dax/hmem.c | 56 - drivers/dax/hmem/Makefile | 8 drivers/dax/hmem/device.c | 100 ++ drivers/dax/hmem/hmem.c | 93 +- drivers/dax/kmem.c | 236 ++--- drivers/dax/pmem/compat.c | 2 drivers/dax/pmem/core.c | 36 drivers/firmware/efi/x86_fake_mem.c | 12 drivers/gpu/drm/i915/gem/i915_gem_shmem.c | 4 drivers/gpu/drm/nouveau/nouveau_dmem.c | 15 drivers/irqchip/irq-gic-v3-its.c | 2 drivers/nvdimm/badrange.c | 26 drivers/nvdimm/claim.c | 13 drivers/nvdimm/nd.h | 3 drivers/nvdimm/pfn_devs.c | 13 drivers/nvdimm/pmem.c | 27 drivers/nvdimm/region.c | 21 drivers/pci/p2pdma.c | 12 drivers/virtio/virtio_mem.c | 47 - drivers/xen/unpopulated-alloc.c | 45 fs/fs_parser.c | 2 fs/ntfs/inode.c | 6 fs/ocfs2/alloc.c | 6 fs/ocfs2/localalloc.c | 2 fs/proc/base.c | 3 fs/proc/task_mmu.c | 104 +- fs/xattr.c | 22 include/acpi/acpi_numa.h | 14 include/kunit/test.h | 5 include/linux/acpi.h | 2 include/linux/compaction.h | 3 include/linux/compiler-clang.h | 8 include/linux/compiler-gcc.h | 2 include/linux/compiler.h | 2 include/linux/dax.h | 8 include/linux/export.h | 2 include/linux/fs.h | 4 include/linux/gfp.h | 6 include/linux/huge_mm.h | 3 include/linux/kasan.h | 6 include/linux/memblock.h | 90 + include/linux/memcontrol.h | 13 include/linux/memory_hotplug.h | 23 include/linux/memremap.h | 15 include/linux/mm.h | 36 include/linux/mmap_lock.h | 5 include/linux/mmzone.h | 37 include/linux/numa.h | 11 include/linux/oom.h | 1 include/linux/page-flags.h | 42 include/linux/pagemap.h | 43 include/linux/range.h | 6 include/linux/sched.h | 4 include/linux/sched/coredump.h | 1 include/linux/slab.h | 2 include/linux/swap.h | 10 include/linux/swap_slots.h | 2 kernel/dma/contiguous.c | 11 kernel/fork.c | 25 kernel/resource.c | 11 lib/Kconfig.debug | 9 lib/Kconfig.kasan | 31 lib/Makefile | 5 lib/kunit/test.c | 13 lib/test_free_pages.c | 42 lib/test_hmm.c | 65 - lib/test_kasan.c | 732 ++++++--------- lib/test_kasan_module.c | 111 ++ mm/Kconfig | 4 mm/Makefile | 1 mm/compaction.c | 5 mm/debug.c | 18 mm/dmapool.c | 46 - mm/fadvise.c | 9 mm/filemap.c | 78 - mm/gup.c | 44 mm/gup_benchmark.c | 23 mm/huge_memory.c | 4 mm/hugetlb.c | 100 +- mm/internal.h | 3 mm/kasan/report.c | 34 mm/kmemleak-test.c | 99 -- mm/kmemleak.c | 8 mm/madvise.c | 21 mm/memblock.c | 102 -- mm/memcontrol.c | 262 +++-- mm/memory-failure.c | 5 mm/memory.c | 147 +-- mm/memory_hotplug.c | 10 mm/mempolicy.c | 8 mm/mempool.c | 18 mm/memremap.c | 344 ++++--- mm/migrate.c | 3 mm/mincore.c | 28 mm/mmap.c | 45 mm/oom_kill.c | 2 mm/page_alloc.c | 82 - mm/page_counter.c | 2 mm/page_io.c | 14 mm/page_isolation.c | 41 mm/shmem.c | 19 mm/slab.c | 4 mm/slab.h | 50 - mm/slub.c | 33 mm/sparse.c | 10 mm/swap.c | 14 mm/swap_slots.c | 3 mm/swap_state.c | 38 mm/swapfile.c | 12 mm/truncate.c | 58 - mm/vmalloc.c | 6 mm/vmscan.c | 5 mm/z3fold.c | 3 mm/zbud.c | 1 samples/Makefile | 1 samples/kmemleak/Makefile | 3 samples/kmemleak/kmemleak-test.c | 99 ++ scripts/decodecode | 29 scripts/spelling.txt | 4 tools/testing/nvdimm/dax-dev.c | 28 tools/testing/nvdimm/test/iomap.c | 2 tools/testing/selftests/vm/Makefile | 17 tools/testing/selftests/vm/compaction_test.c | 11 tools/testing/selftests/vm/gup_benchmark.c | 14 tools/testing/selftests/vm/hmm-tests.c | 4 194 files changed, 4273 insertions(+), 2777 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-10-11 6:15 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-10-11 6:15 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 5 patches, based on da690031a5d6d50a361e3f19f3eeabd086a6f20d. Subsystems affected by this patch series: MAINTAINERS mm/pagemap mm/swap mm/hugetlb Subsystem: MAINTAINERS Kees Cook <keescook@chromium.org>: MAINTAINERS: change hardening mailing list Antoine Tenart <atenart@kernel.org>: MAINTAINERS: Antoine Tenart's email address Subsystem: mm/pagemap Miaohe Lin <linmiaohe@huawei.com>: mm: mmap: Fix general protection fault in unlink_file_vma() Subsystem: mm/swap Minchan Kim <minchan@kernel.org>: mm: validate inode in mapping_set_error() Subsystem: mm/hugetlb Vijay Balakrishna <vijayb@linux.microsoft.com>: mm: khugepaged: recalculate min_free_kbytes after memory hotplug as expected by khugepaged .mailmap | 4 +++- MAINTAINERS | 8 ++++---- include/linux/khugepaged.h | 5 +++++ include/linux/pagemap.h | 3 ++- mm/khugepaged.c | 13 +++++++++++-- mm/mmap.c | 6 +++++- mm/page_alloc.c | 3 +++ 7 files changed, 33 insertions(+), 9 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-10-03 5:20 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-10-03 5:20 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 3 patches, based on d3d45f8220d60a0b2aaaacf8fb2be4e6ffd9008e. Subsystems affected by this patch series: mm/slub mm/cma scripts Subsystem: mm/slub Eric Farman <farman@linux.ibm.com>: mm, slub: restore initial kmem_cache flags Subsystem: mm/cma Joonsoo Kim <iamjoonsoo.kim@lge.com>: mm/page_alloc: handle a missing case for memalloc_nocma_{save/restore} APIs Subsystem: scripts Eric Biggers <ebiggers@google.com>: scripts/spelling.txt: fix malformed entry mm/page_alloc.c | 19 ++++++++++++++++--- mm/slub.c | 6 +----- scripts/spelling.txt | 2 +- 3 files changed, 18 insertions(+), 9 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-09-26 4:17 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-09-26 4:17 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 9 patches, based on 7c7ec3226f5f33f9c050d85ec20f18419c622ad6. Subsystems affected by this patch series: mm/thp mm/memcg mm/gup mm/migration lib x86 mm/memory-hotplug Subsystem: mm/thp Gao Xiang <hsiangkao@redhat.com>: mm, THP, swap: fix allocating cluster for swapfile by mistake Subsystem: mm/memcg Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: fix missing suffix of workingset_restore Subsystem: mm/gup Vasily Gorbik <gor@linux.ibm.com>: mm/gup: fix gup_fast with dynamic page table folding Subsystem: mm/migration Zi Yan <ziy@nvidia.com>: mm/migrate: correct thp migration stats Subsystem: lib Nick Desaulniers <ndesaulniers@google.com>: lib/string.c: implement stpcpy Jason Yan <yanaijie@huawei.com>: lib/memregion.c: include memregion.h Subsystem: x86 Mikulas Patocka <mpatocka@redhat.com>: arch/x86/lib/usercopy_64.c: fix __copy_user_flushcache() cache writeback Subsystem: mm/memory-hotplug Laurent Dufour <ldufour@linux.ibm.com>: Patch series "mm: fix memory to node bad links in sysfs", v3: mm: replace memmap_context by meminit_context mm: don't rely on system state to detect hot-plug operations Documentation/admin-guide/cgroup-v2.rst | 25 ++++++--- arch/ia64/mm/init.c | 6 +- arch/s390/include/asm/pgtable.h | 42 +++++++++++---- arch/x86/lib/usercopy_64.c | 2 drivers/base/node.c | 85 ++++++++++++++++++++------------ include/linux/mm.h | 2 include/linux/mmzone.h | 11 +++- include/linux/node.h | 11 ++-- include/linux/pgtable.h | 10 +++ lib/memregion.c | 1 lib/string.c | 24 +++++++++ mm/gup.c | 18 +++--- mm/memcontrol.c | 4 - mm/memory_hotplug.c | 5 + mm/migrate.c | 7 +- mm/page_alloc.c | 10 +-- mm/swapfile.c | 2 17 files changed, 181 insertions(+), 84 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-09-19 4:19 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-09-19 4:19 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 15 patches, based on 92ab97adeefccf375de7ebaad9d5b75d4125fe8b. Subsystems affected by this patch series: mailmap mm/hotfixes mm/thp mm/memory-hotplug misc kcsan Subsystem: mailmap Kees Cook <keescook@chromium.org>: mailmap: add older email addresses for Kees Cook Subsystem: mm/hotfixes Hugh Dickins <hughd@google.com>: Patch series "mm: fixes to past from future testing": ksm: reinstate memcg charge on copied pages mm: migration of hugetlbfs page skip memcg shmem: shmem_writepage() split unlikely i915 THP mm: fix check_move_unevictable_pages() on THP mlock: fix unevictable_pgs event counts on THP Byron Stanoszek <gandalf@winds.org>: tmpfs: restore functionality of nr_inodes=0 Muchun Song <songmuchun@bytedance.com>: kprobes: fix kill kprobe which has been marked as gone Subsystem: mm/thp Ralph Campbell <rcampbell@nvidia.com>: mm/thp: fix __split_huge_pmd_locked() for migration PMD Christophe Leroy <christophe.leroy@csgroup.eu>: selftests/vm: fix display of page size in map_hugetlb Subsystem: mm/memory-hotplug Pavel Tatashin <pasha.tatashin@soleen.com>: mm/memory_hotplug: drain per-cpu pages again during memory offline Subsystem: misc Tobias Klauser <tklauser@distanz.ch>: ftrace: let ftrace_enable_sysctl take a kernel pointer buffer stackleak: let stack_erasing_sysctl take a kernel pointer buffer fs/fs-writeback.c: adjust dirtytime_interval_handler definition to match prototype Subsystem: kcsan Changbin Du <changbin.du@gmail.com>: kcsan: kconfig: move to menu 'Generic Kernel Debugging Instruments' .mailmap | 4 ++ fs/fs-writeback.c | 2 - include/linux/ftrace.h | 3 -- include/linux/stackleak.h | 2 - kernel/kprobes.c | 9 +++++- kernel/stackleak.c | 2 - kernel/trace/ftrace.c | 3 -- lib/Kconfig.debug | 4 -- mm/huge_memory.c | 42 ++++++++++++++++--------------- mm/ksm.c | 4 ++ mm/memory_hotplug.c | 14 ++++++++++ mm/migrate.c | 3 +- mm/mlock.c | 24 +++++++++++------ mm/page_isolation.c | 8 +++++ mm/shmem.c | 20 +++++++++++--- mm/swap.c | 6 ++-- mm/vmscan.c | 10 +++++-- tools/testing/selftests/vm/map_hugetlb.c | 2 - 18 files changed, 111 insertions(+), 51 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-09-04 23:34 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-09-04 23:34 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 19 patches, based on 59126901f200f5fc907153468b03c64e0081b6e6. Subsystems affected by this patch series: mm/memcg mm/slub MAINTAINERS mm/pagemap ipc fork checkpatch mm/madvise mm/migration mm/hugetlb lib Subsystem: mm/memcg Michal Hocko <mhocko@suse.com>: memcg: fix use-after-free in uncharge_batch Xunlei Pang <xlpang@linux.alibaba.com>: mm: memcg: fix memcg reclaim soft lockup Subsystem: mm/slub Eugeniu Rosca <erosca@de.adit-jv.com>: mm: slub: fix conversion of freelist_corrupted() Subsystem: MAINTAINERS Robert Richter <rric@kernel.org>: MAINTAINERS: update Cavium/Marvell entries Nick Desaulniers <ndesaulniers@google.com>: MAINTAINERS: add LLVM maintainers Randy Dunlap <rdunlap@infradead.org>: MAINTAINERS: IA64: mark Status as Odd Fixes only Subsystem: mm/pagemap Joerg Roedel <jroedel@suse.de>: mm: track page table modifications in __apply_to_page_range() Subsystem: ipc Tobias Klauser <tklauser@distanz.ch>: ipc: adjust proc_ipc_sem_dointvec definition to match prototype Subsystem: fork Tobias Klauser <tklauser@distanz.ch>: fork: adjust sysctl_max_threads definition to match prototype Subsystem: checkpatch Mrinal Pandey <mrinalmni@gmail.com>: checkpatch: fix the usage of capture group ( ... ) Subsystem: mm/madvise Yang Shi <shy828301@gmail.com>: mm: madvise: fix vma user-after-free Subsystem: mm/migration Alistair Popple <alistair@popple.id.au>: mm/migrate: fixup setting UFFD_WP flag mm/rmap: fixup copying of soft dirty and uffd ptes Ralph Campbell <rcampbell@nvidia.com>: Patch series "mm/migrate: preserve soft dirty in remove_migration_pte()": mm/migrate: remove unnecessary is_zone_device_page() check mm/migrate: preserve soft dirty in remove_migration_pte() Subsystem: mm/hugetlb Li Xinhai <lixinhai.lxh@gmail.com>: mm/hugetlb: try preferred node first when alloc gigantic page from cma Muchun Song <songmuchun@bytedance.com>: mm/hugetlb: fix a race between hugetlb sysctl handlers David Howells <dhowells@redhat.com>: mm/khugepaged.c: fix khugepaged's request size in collapse_file Subsystem: lib Jason Gunthorpe <jgg@nvidia.com>: include/linux/log2.h: add missing () around n in roundup_pow_of_two() MAINTAINERS | 32 ++++++++++++++++---------------- include/linux/log2.h | 2 +- ipc/ipc_sysctl.c | 2 +- kernel/fork.c | 2 +- mm/hugetlb.c | 49 +++++++++++++++++++++++++++++++++++++------------ mm/khugepaged.c | 2 +- mm/madvise.c | 2 +- mm/memcontrol.c | 6 ++++++ mm/memory.c | 37 ++++++++++++++++++++++++------------- mm/migrate.c | 31 +++++++++++++++++++------------ mm/rmap.c | 9 +++++++-- mm/slub.c | 12 ++++++------ mm/vmscan.c | 8 ++++++++ scripts/checkpatch.pl | 4 ++-- 14 files changed, 130 insertions(+), 68 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-08-21 0:41 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-08-21 0:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 11 patches, based on 7eac66d0456fe12a462e5c14c68e97c7460989da. Subsystems affected by this patch series: misc mm/hugetlb mm/vmalloc mm/misc romfs relay uprobes squashfs mm/cma mm/pagealloc Subsystem: misc Nick Desaulniers <ndesaulniers@google.com>: mailmap: add Andi Kleen Subsystem: mm/hugetlb Xu Wang <vulab@iscas.ac.cn>: hugetlb_cgroup: convert comma to semicolon Hugh Dickins <hughd@google.com>: khugepaged: adjust VM_BUG_ON_MM() in __khugepaged_enter() Subsystem: mm/vmalloc "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/vunmap: add cond_resched() in vunmap_pmd_range Subsystem: mm/misc Leon Romanovsky <leonro@nvidia.com>: mm/rodata_test.c: fix missing function declaration Subsystem: romfs Jann Horn <jannh@google.com>: romfs: fix uninitialized memory leak in romfs_dev_read() Subsystem: relay Wei Yongjun <weiyongjun1@huawei.com>: kernel/relay.c: fix memleak on destroy relay channel Subsystem: uprobes Hugh Dickins <hughd@google.com>: uprobes: __replace_page() avoid BUG in munlock_vma_page() Subsystem: squashfs Phillip Lougher <phillip@squashfs.org.uk>: squashfs: avoid bio_alloc() failure with 1Mbyte blocks Subsystem: mm/cma Doug Berger <opendmb@gmail.com>: mm: include CMA pages in lowmem_reserve at boot Subsystem: mm/pagealloc Charan Teja Reddy <charante@codeaurora.org>: mm, page_alloc: fix core hung in free_pcppages_bulk() .mailmap | 1 + fs/romfs/storage.c | 4 +--- fs/squashfs/block.c | 6 +++++- kernel/events/uprobes.c | 2 +- kernel/relay.c | 1 + mm/hugetlb_cgroup.c | 4 ++-- mm/khugepaged.c | 2 +- mm/page_alloc.c | 7 ++++++- mm/rodata_test.c | 1 + mm/vmalloc.c | 2 ++ 10 files changed, 21 insertions(+), 9 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-08-15 0:29 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-08-15 0:29 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 39 patches, based on b923f1247b72fc100b87792fd2129d026bb10e66. Subsystems affected by this patch series: mm/hotfixes lz4 exec mailmap mm/thp autofs mm/madvise sysctl mm/kmemleak mm/misc lib Subsystem: mm/hotfixes Mike Rapoport <rppt@linux.ibm.com>: asm-generic: pgalloc.h: use correct #ifdef to enable pud_alloc_one() Baoquan He <bhe@redhat.com>: Revert "mm/vmstat.c: do not show lowmem reserve protection information of empty zone" Subsystem: lz4 Nick Terrell <terrelln@fb.com>: lz4: fix kernel decompression speed Subsystem: exec Kees Cook <keescook@chromium.org>: Patch series "Fix S_ISDIR execve() errno": exec: restore EACCES of S_ISDIR execve() selftests/exec: add file type errno tests Subsystem: mailmap Greg Kurz <groug@kaod.org>: mailmap: add entry for Greg Kurz Subsystem: mm/thp "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "THP prep patches": mm: store compound_nr as well as compound_order mm: move page-flags include to top of file mm: add thp_order mm: add thp_size mm: replace hpage_nr_pages with thp_nr_pages mm: add thp_head mm: introduce offset_in_thp Subsystem: autofs Randy Dunlap <rdunlap@infradead.org>: fs: autofs: delete repeated words in comments Subsystem: mm/madvise Minchan Kim <minchan@kernel.org>: Patch series "introduce memory hinting API for external process", v8: mm/madvise: pass task and mm to do_madvise pid: move pidfd_get_pid() to pid.c mm/madvise: introduce process_madvise() syscall: an external memory hinting API mm/madvise: check fatal signal pending of target process Subsystem: sysctl Xiaoming Ni <nixiaoming@huawei.com>: all arch: remove system call sys_sysctl Subsystem: mm/kmemleak Qian Cai <cai@lca.pw>: mm/kmemleak: silence KCSAN splats in checksum Subsystem: mm/misc Qian Cai <cai@lca.pw>: mm/frontswap: mark various intentional data races mm/page_io: mark various intentional data races mm/swap_state: mark various intentional data races Kirill A. Shutemov <kirill@shutemov.name>: mm/filemap.c: fix a data race in filemap_fault() Qian Cai <cai@lca.pw>: mm/swapfile: fix and annotate various data races mm/page_counter: fix various data races at memsw mm/memcontrol: fix a data race in scan count mm/list_lru: fix a data race in list_lru_count_one mm/mempool: fix a data race in mempool_free() mm/rmap: annotate a data race at tlb_flush_batched mm/swap.c: annotate data races for lru_rotate_pvecs mm: annotate a data race in page_zonenum() Romain Naour <romain.naour@gmail.com>: include/asm-generic/vmlinux.lds.h: align ro_after_init Kuninori Morimoto <kuninori.morimoto.gx@renesas.com>: sh: clkfwk: remove r8/r16/r32 sh: use generic strncpy() Subsystem: lib Krzysztof Kozlowski <krzk@kernel.org>: Patch series "iomap: Constify ioreadX() iomem argument", v3: iomap: constify ioreadX() iomem argument (as in generic implementation) rtl818x: constify ioreadX() iomem argument (as in generic implementation) ntb: intel: constify ioreadX() iomem argument (as in generic implementation) virtio: pci: constify ioreadX() iomem argument (as in generic implementation) .mailmap | 1 arch/alpha/include/asm/core_apecs.h | 6 arch/alpha/include/asm/core_cia.h | 6 arch/alpha/include/asm/core_lca.h | 6 arch/alpha/include/asm/core_marvel.h | 4 arch/alpha/include/asm/core_mcpcia.h | 6 arch/alpha/include/asm/core_t2.h | 2 arch/alpha/include/asm/io.h | 12 - arch/alpha/include/asm/io_trivial.h | 16 - arch/alpha/include/asm/jensen.h | 2 arch/alpha/include/asm/machvec.h | 6 arch/alpha/kernel/core_marvel.c | 2 arch/alpha/kernel/io.c | 12 - arch/alpha/kernel/syscalls/syscall.tbl | 3 arch/arm/configs/am200epdkit_defconfig | 1 arch/arm/tools/syscall.tbl | 3 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 6 arch/ia64/kernel/syscalls/syscall.tbl | 3 arch/m68k/kernel/syscalls/syscall.tbl | 3 arch/microblaze/kernel/syscalls/syscall.tbl | 3 arch/mips/configs/cu1000-neo_defconfig | 1 arch/mips/kernel/syscalls/syscall_n32.tbl | 3 arch/mips/kernel/syscalls/syscall_n64.tbl | 3 arch/mips/kernel/syscalls/syscall_o32.tbl | 3 arch/parisc/include/asm/io.h | 4 arch/parisc/kernel/syscalls/syscall.tbl | 3 arch/parisc/lib/iomap.c | 72 +++--- arch/powerpc/kernel/iomap.c | 28 +- arch/powerpc/kernel/syscalls/syscall.tbl | 3 arch/s390/kernel/syscalls/syscall.tbl | 3 arch/sh/configs/dreamcast_defconfig | 1 arch/sh/configs/espt_defconfig | 1 arch/sh/configs/hp6xx_defconfig | 1 arch/sh/configs/landisk_defconfig | 1 arch/sh/configs/lboxre2_defconfig | 1 arch/sh/configs/microdev_defconfig | 1 arch/sh/configs/migor_defconfig | 1 arch/sh/configs/r7780mp_defconfig | 1 arch/sh/configs/r7785rp_defconfig | 1 arch/sh/configs/rts7751r2d1_defconfig | 1 arch/sh/configs/rts7751r2dplus_defconfig | 1 arch/sh/configs/se7206_defconfig | 1 arch/sh/configs/se7343_defconfig | 1 arch/sh/configs/se7619_defconfig | 1 arch/sh/configs/se7705_defconfig | 1 arch/sh/configs/se7750_defconfig | 1 arch/sh/configs/se7751_defconfig | 1 arch/sh/configs/secureedge5410_defconfig | 1 arch/sh/configs/sh03_defconfig | 1 arch/sh/configs/sh7710voipgw_defconfig | 1 arch/sh/configs/sh7757lcr_defconfig | 1 arch/sh/configs/sh7763rdp_defconfig | 1 arch/sh/configs/shmin_defconfig | 1 arch/sh/configs/titan_defconfig | 1 arch/sh/include/asm/string_32.h | 26 -- arch/sh/kernel/iomap.c | 22 - arch/sh/kernel/syscalls/syscall.tbl | 3 arch/sparc/kernel/syscalls/syscall.tbl | 3 arch/x86/entry/syscalls/syscall_32.tbl | 3 arch/x86/entry/syscalls/syscall_64.tbl | 4 arch/xtensa/kernel/syscalls/syscall.tbl | 3 drivers/mailbox/bcm-pdc-mailbox.c | 2 drivers/net/wireless/realtek/rtl818x/rtl8180/rtl8180.h | 6 drivers/ntb/hw/intel/ntb_hw_gen1.c | 2 drivers/ntb/hw/intel/ntb_hw_gen3.h | 2 drivers/ntb/hw/intel/ntb_hw_intel.h | 2 drivers/nvdimm/btt.c | 4 drivers/nvdimm/pmem.c | 6 drivers/sh/clk/cpg.c | 25 -- drivers/virtio/virtio_pci_modern.c | 6 fs/autofs/dev-ioctl.c | 4 fs/io_uring.c | 2 fs/namei.c | 4 include/asm-generic/iomap.h | 28 +- include/asm-generic/pgalloc.h | 2 include/asm-generic/vmlinux.lds.h | 1 include/linux/compat.h | 5 include/linux/huge_mm.h | 58 ++++- include/linux/io-64-nonatomic-hi-lo.h | 4 include/linux/io-64-nonatomic-lo-hi.h | 4 include/linux/memcontrol.h | 2 include/linux/mm.h | 16 - include/linux/mm_inline.h | 6 include/linux/mm_types.h | 1 include/linux/pagemap.h | 6 include/linux/pid.h | 1 include/linux/syscalls.h | 4 include/linux/sysctl.h | 6 include/uapi/asm-generic/unistd.h | 4 kernel/Makefile | 2 kernel/exit.c | 17 - kernel/pid.c | 17 + kernel/sys_ni.c | 3 kernel/sysctl_binary.c | 171 -------------- lib/iomap.c | 30 +- lib/lz4/lz4_compress.c | 4 lib/lz4/lz4_decompress.c | 18 - lib/lz4/lz4defs.h | 10 lib/lz4/lz4hc_compress.c | 2 mm/compaction.c | 2 mm/filemap.c | 22 + mm/frontswap.c | 8 mm/gup.c | 2 mm/internal.h | 4 mm/kmemleak.c | 2 mm/list_lru.c | 2 mm/madvise.c | 190 ++++++++++++++-- mm/memcontrol.c | 10 mm/memory.c | 4 mm/memory_hotplug.c | 7 mm/mempolicy.c | 2 mm/mempool.c | 2 mm/migrate.c | 18 - mm/mlock.c | 9 mm/page_alloc.c | 5 mm/page_counter.c | 13 - mm/page_io.c | 12 - mm/page_vma_mapped.c | 6 mm/rmap.c | 10 mm/swap.c | 21 - mm/swap_state.c | 10 mm/swapfile.c | 33 +- mm/vmscan.c | 6 mm/vmstat.c | 12 - mm/workingset.c | 6 tools/perf/arch/powerpc/entry/syscalls/syscall.tbl | 2 tools/perf/arch/s390/entry/syscalls/syscall.tbl | 2 tools/perf/arch/x86/entry/syscalls/syscall_64.tbl | 2 tools/testing/selftests/exec/.gitignore | 1 tools/testing/selftests/exec/Makefile | 5 tools/testing/selftests/exec/non-regular.c | 196 +++++++++++++++++ 132 files changed, 815 insertions(+), 614 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-08-12 1:29 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-08-12 1:29 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - Most of the rest of MM - various other subsystems 165 patches, based on 00e4db51259a5f936fec1424b884f029479d3981. Subsystems affected by this patch series: mm/memcg mm/hugetlb mm/vmscan mm/proc mm/compaction mm/mempolicy mm/oom-kill mm/hugetlbfs mm/migration mm/thp mm/cma mm/util mm/memory-hotplug mm/cleanups mm/uaccess alpha misc sparse bitmap lib lz4 bitops checkpatch autofs minix nilfs ufs fat signals kmod coredump exec kdump rapidio panic kcov kgdb ipc mm/migration mm/gup mm/pagemap Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: Patch series "mm: memcg accounting of percpu memory", v3: percpu: return number of released bytes from pcpu_free_area() mm: memcg/percpu: account percpu memory to memory cgroups mm: memcg/percpu: per-memcg percpu memory statistics mm: memcg: charge memcg percpu memory to the parent cgroup kselftests: cgroup: add perpcu memory accounting test Subsystem: mm/hugetlb Muchun Song <songmuchun@bytedance.com>: mm/hugetlb: add mempolicy check in the reservation routine Subsystem: mm/vmscan Joonsoo Kim <iamjoonsoo.kim@lge.com>: Patch series "workingset protection/detection on the anonymous LRU list", v7: mm/vmscan: make active/inactive ratio as 1:1 for anon lru mm/vmscan: protect the workingset on anonymous LRU mm/workingset: prepare the workingset detection infrastructure for anon LRU mm/swapcache: support to handle the shadow entries mm/swap: implement workingset detection for anonymous LRU mm/vmscan: restore active/inactive ratio for anonymous LRU Subsystem: mm/proc Michal Koutný <mkoutny@suse.com>: /proc/PID/smaps: consistent whitespace output format Subsystem: mm/compaction Nitin Gupta <nigupta@nvidia.com>: mm: proactive compaction mm: fix compile error due to COMPACTION_HPAGE_ORDER mm: use unsigned types for fragmentation score Alex Shi <alex.shi@linux.alibaba.com>: mm/compaction: correct the comments of compact_defer_shift Subsystem: mm/mempolicy Krzysztof Kozlowski <krzk@kernel.org>: mm: mempolicy: fix kerneldoc of numa_map_to_online_node() Wenchao Hao <haowenchao22@gmail.com>: mm/mempolicy.c: check parameters first in kernel_get_mempolicy Yanfei Xu <yanfei.xu@windriver.com>: include/linux/mempolicy.h: fix typo Subsystem: mm/oom-kill Yafang Shao <laoar.shao@gmail.com>: mm, oom: make the calculation of oom badness more accurate Michal Hocko <mhocko@suse.com>: doc, mm: sync up oom_score_adj documentation doc, mm: clarify /proc/<pid>/oom_score value range Yafang Shao <laoar.shao@gmail.com>: mm, oom: show process exiting information in __oom_kill_process() Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: hugetlbfs: prevent filesystem stacking of hugetlbfs hugetlbfs: remove call to huge_pte_alloc without i_mmap_rwsem Subsystem: mm/migration Ralph Campbell <rcampbell@nvidia.com>: Patch series "mm/migrate: optimize migrate_vma_setup() for holes": mm/migrate: optimize migrate_vma_setup() for holes mm/migrate: add migrate-shared test for migrate_vma_*() Subsystem: mm/thp Yang Shi <yang.shi@linux.alibaba.com>: mm: thp: remove debug_cow switch Anshuman Khandual <anshuman.khandual@arm.com>: mm/vmstat: add events for THP migration without split Subsystem: mm/cma Jianqun Xu <jay.xu@rock-chips.com>: mm/cma.c: fix NULL pointer dereference when cma could not be activated Barry Song <song.bao.hua@hisilicon.com>: Patch series "mm: fix the names of general cma and hugetlb cma", v2: mm: cma: fix the name of CMA areas mm: hugetlb: fix the name of hugetlb CMA Mike Kravetz <mike.kravetz@oracle.com>: cma: don't quit at first error when activating reserved areas Subsystem: mm/util Waiman Long <longman@redhat.com>: include/linux/sched/mm.h: optimize current_gfp_context() Krzysztof Kozlowski <krzk@kernel.org>: mm: mmu_notifier: fix and extend kerneldoc Subsystem: mm/memory-hotplug Daniel Jordan <daniel.m.jordan@oracle.com>: x86/mm: use max memory block size on bare metal Jia He <justin.he@arm.com>: mm/memory_hotplug: introduce default dummy memory_add_physaddr_to_nid() mm/memory_hotplug: fix unpaired mem_hotplug_begin/done Charan Teja Reddy <charante@codeaurora.org>: mm, memory_hotplug: update pcp lists everytime onlining a memory block Subsystem: mm/cleanups Randy Dunlap <rdunlap@infradead.org>: mm: drop duplicated words in <linux/pgtable.h> mm: drop duplicated words in <linux/mm.h> include/linux/highmem.h: fix duplicated words in a comment include/linux/frontswap.h: drop duplicated word in a comment include/linux/memcontrol.h: drop duplicate word and fix spello Arvind Sankar <nivedita@alum.mit.edu>: sh/mm: drop unused MAX_PHYSADDR_BITS sparc: drop unused MAX_PHYSADDR_BITS Randy Dunlap <rdunlap@infradead.org>: mm/compaction.c: delete duplicated word mm/filemap.c: delete duplicated word mm/hmm.c: delete duplicated word mm/hugetlb.c: delete duplicated words mm/memcontrol.c: delete duplicated words mm/memory.c: delete duplicated words mm/migrate.c: delete duplicated word mm/nommu.c: delete duplicated words mm/page_alloc.c: delete or fix duplicated words mm/shmem.c: delete duplicated word mm/slab_common.c: delete duplicated word mm/usercopy.c: delete duplicated word mm/vmscan.c: delete or fix duplicated words mm/zpool.c: delete duplicated word and fix grammar mm/zsmalloc.c: fix duplicated words Subsystem: mm/uaccess Christoph Hellwig <hch@lst.de>: Patch series "clean up address limit helpers", v2: syscalls: use uaccess_kernel in addr_limit_user_check nds32: use uaccess_kernel in show_regs riscv: include <asm/pgtable.h> in <asm/uaccess.h> uaccess: remove segment_eq uaccess: add force_uaccess_{begin,end} helpers exec: use force_uaccess_begin during exec and exit Subsystem: alpha Luc Van Oostenryck <luc.vanoostenryck@gmail.com>: alpha: fix annotation of io{read,write}{16,32}be() Subsystem: misc Randy Dunlap <rdunlap@infradead.org>: include/linux/compiler-clang.h: drop duplicated word in a comment include/linux/exportfs.h: drop duplicated word in a comment include/linux/async_tx.h: drop duplicated word in a comment include/linux/xz.h: drop duplicated word Christoph Hellwig <hch@lst.de>: kernel: add a kernel_wait helper Feng Tang <feng.tang@intel.com>: ./Makefile: add debug option to enable function aligned on 32 bytes Arvind Sankar <nivedita@alum.mit.edu>: kernel.h: remove duplicate include of asm/div64.h "Alexander A. Klimov" <grandmaster@al2klimov.de>: include/: replace HTTP links with HTTPS ones Matthew Wilcox <willy@infradead.org>: include/linux/poison.h: remove obsolete comment Subsystem: sparse Luc Van Oostenryck <luc.vanoostenryck@gmail.com>: sparse: group the defines by functionality Subsystem: bitmap Stefano Brivio <sbrivio@redhat.com>: Patch series "lib: Fix bitmap_cut() for overlaps, add test": lib/bitmap.c: fix bitmap_cut() for partial overlapping case lib/test_bitmap.c: add test for bitmap_cut() Subsystem: lib Luc Van Oostenryck <luc.vanoostenryck@gmail.com>: lib/generic-radix-tree.c: remove unneeded __rcu Geert Uytterhoeven <geert@linux-m68k.org>: lib/test_bitops: do the full test during module init Wei Yongjun <weiyongjun1@huawei.com>: lib/test_lockup.c: make symbol 'test_works' static Tiezhu Yang <yangtiezhu@loongson.cn>: lib/Kconfig.debug: make TEST_LOCKUP depend on module lib/test_lockup.c: fix return value of test_lockup_init() "Alexander A. Klimov" <grandmaster@al2klimov.de>: lib/: replace HTTP links with HTTPS ones "Kars Mulder" <kerneldev@karsmulder.nl>: kstrto*: correct documentation references to simple_strto*() kstrto*: do not describe simple_strto*() as obsolete/replaced Subsystem: lz4 Nick Terrell <terrelln@fb.com>: lz4: fix kernel decompression speed Subsystem: bitops Rikard Falkeborn <rikard.falkeborn@gmail.com>: lib/test_bits.c: add tests of GENMASK Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: add test for possible misuse of IS_ENABLED() without CONFIG_ checkpatch: add --fix option for ASSIGN_IN_IF Quentin Monnet <quentin@isovalent.com>: checkpatch: fix CONST_STRUCT when const_structs.checkpatch is missing Joe Perches <joe@perches.com>: checkpatch: add test for repeated words checkpatch: remove missing switch/case break test Subsystem: autofs Randy Dunlap <rdunlap@infradead.org>: autofs: fix doubled word Subsystem: minix Eric Biggers <ebiggers@google.com>: Patch series "fs/minix: fix syzbot bugs and set s_maxbytes": fs/minix: check return value of sb_getblk() fs/minix: don't allow getting deleted inodes fs/minix: reject too-large maximum file size fs/minix: set s_maxbytes correctly fs/minix: fix block limit check for V1 filesystems fs/minix: remove expected error message in block_to_path() Subsystem: nilfs Eric Biggers <ebiggers@google.com>: Patch series "nilfs2 updates": nilfs2: only call unlock_new_inode() if I_NEW Joe Perches <joe@perches.com>: nilfs2: convert __nilfs_msg to integrate the level and format nilfs2: use a more common logging style Subsystem: ufs Colin Ian King <colin.king@canonical.com>: fs/ufs: avoid potential u32 multiplication overflow Subsystem: fat Yubo Feng <fengyubo3@huawei.com>: fatfs: switch write_lock to read_lock in fat_ioctl_get_attributes "Alexander A. Klimov" <grandmaster@al2klimov.de>: VFAT/FAT/MSDOS FILESYSTEM: replace HTTP links with HTTPS ones OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>: fat: fix fat_ra_init() for data clusters == 0 Subsystem: signals Helge Deller <deller@gmx.de>: fs/signalfd.c: fix inconsistent return codes for signalfd4 Subsystem: kmod Tiezhu Yang <yangtiezhu@loongson.cn>: Patch series "kmod/umh: a few fixes": selftests: kmod: use variable NAME in kmod_test_0001() kmod: remove redundant "be an" in the comment test_kmod: avoid potential double free in trigger_config_run_type() Subsystem: coredump Lepton Wu <ytht.net@gmail.com>: coredump: add %f for executable filename Subsystem: exec Kees Cook <keescook@chromium.org>: Patch series "Relocate execve() sanity checks", v2: exec: change uselib(2) IS_SREG() failure to EACCES exec: move S_ISREG() check earlier exec: move path_noexec() check earlier Subsystem: kdump Vijay Balakrishna <vijayb@linux.microsoft.com>: kdump: append kernel build-id string to VMCOREINFO Subsystem: rapidio "Gustavo A. R. Silva" <gustavoars@kernel.org>: drivers/rapidio/devices/rio_mport_cdev.c: use struct_size() helper drivers/rapidio/rio-scan.c: use struct_size() helper rapidio/rio_mport_cdev: use array_size() helper in copy_{from,to}_user() Subsystem: panic Tiezhu Yang <yangtiezhu@loongson.cn>: kernel/panic.c: make oops_may_print() return bool lib/Kconfig.debug: fix typo in the help text of CONFIG_PANIC_TIMEOUT Yue Hu <huyue2@yulong.com>: panic: make print_oops_end_marker() static Subsystem: kcov Marco Elver <elver@google.com>: kcov: unconditionally add -fno-stack-protector to compiler options Wei Yongjun <weiyongjun1@huawei.com>: kcov: make some symbols static Subsystem: kgdb Nick Desaulniers <ndesaulniers@google.com>: scripts/gdb: fix python 3.8 SyntaxWarning Subsystem: ipc Alexey Dobriyan <adobriyan@gmail.com>: ipc: uninline functions Liao Pingfang <liao.pingfang@zte.com.cn>: ipc/shm.c: remove the superfluous break Subsystem: mm/migration Joonsoo Kim <iamjoonsoo.kim@lge.com>: Patch series "clean-up the migration target allocation functions", v5: mm/page_isolation: prefer the node of the source page mm/migrate: move migration helper from .h to .c mm/hugetlb: unify migration callbacks mm/migrate: clear __GFP_RECLAIM to make the migration callback consistent with regular THP allocations mm/migrate: introduce a standard migration target allocation function mm/mempolicy: use a standard migration target allocation callback mm/page_alloc: remove a wrapper for alloc_migration_target() Subsystem: mm/gup Joonsoo Kim <iamjoonsoo.kim@lge.com>: mm/gup: restrict CMA region by using allocation scope API mm/hugetlb: make hugetlb migration callback CMA aware mm/gup: use a standard migration target allocation callback Subsystem: mm/pagemap Peter Xu <peterx@redhat.com>: Patch series "mm: Page fault accounting cleanups", v5: mm: do page fault accounting in handle_mm_fault mm/alpha: use general page fault accounting mm/arc: use general page fault accounting mm/arm: use general page fault accounting mm/arm64: use general page fault accounting mm/csky: use general page fault accounting mm/hexagon: use general page fault accounting mm/ia64: use general page fault accounting mm/m68k: use general page fault accounting mm/microblaze: use general page fault accounting mm/mips: use general page fault accounting mm/nds32: use general page fault accounting mm/nios2: use general page fault accounting mm/openrisc: use general page fault accounting mm/parisc: use general page fault accounting mm/powerpc: use general page fault accounting mm/riscv: use general page fault accounting mm/s390: use general page fault accounting mm/sh: use general page fault accounting mm/sparc32: use general page fault accounting mm/sparc64: use general page fault accounting mm/x86: use general page fault accounting mm/xtensa: use general page fault accounting mm: clean up the last pieces of page fault accountings mm/gup: remove task_struct pointer for all gup code Documentation/admin-guide/cgroup-v2.rst | 4 Documentation/admin-guide/sysctl/kernel.rst | 3 Documentation/admin-guide/sysctl/vm.rst | 15 + Documentation/filesystems/proc.rst | 11 - Documentation/vm/page_migration.rst | 27 +++ Makefile | 4 arch/alpha/include/asm/io.h | 8 arch/alpha/include/asm/uaccess.h | 2 arch/alpha/mm/fault.c | 10 - arch/arc/include/asm/segment.h | 3 arch/arc/kernel/process.c | 2 arch/arc/mm/fault.c | 20 -- arch/arm/include/asm/uaccess.h | 4 arch/arm/kernel/signal.c | 2 arch/arm/mm/fault.c | 27 --- arch/arm64/include/asm/uaccess.h | 2 arch/arm64/kernel/sdei.c | 2 arch/arm64/mm/fault.c | 31 --- arch/arm64/mm/numa.c | 10 - arch/csky/include/asm/segment.h | 2 arch/csky/mm/fault.c | 15 - arch/h8300/include/asm/segment.h | 2 arch/hexagon/mm/vm_fault.c | 11 - arch/ia64/include/asm/uaccess.h | 2 arch/ia64/mm/fault.c | 11 - arch/ia64/mm/numa.c | 2 arch/m68k/include/asm/segment.h | 2 arch/m68k/include/asm/tlbflush.h | 6 arch/m68k/mm/fault.c | 16 - arch/microblaze/include/asm/uaccess.h | 2 arch/microblaze/mm/fault.c | 11 - arch/mips/include/asm/uaccess.h | 2 arch/mips/kernel/unaligned.c | 27 +-- arch/mips/mm/fault.c | 16 - arch/nds32/include/asm/uaccess.h | 2 arch/nds32/kernel/process.c | 2 arch/nds32/mm/alignment.c | 7 arch/nds32/mm/fault.c | 21 -- arch/nios2/include/asm/uaccess.h | 2 arch/nios2/mm/fault.c | 16 - arch/openrisc/include/asm/uaccess.h | 2 arch/openrisc/mm/fault.c | 11 - arch/parisc/include/asm/uaccess.h | 2 arch/parisc/mm/fault.c | 10 - arch/powerpc/include/asm/uaccess.h | 3 arch/powerpc/mm/copro_fault.c | 7 arch/powerpc/mm/fault.c | 13 - arch/riscv/include/asm/uaccess.h | 6 arch/riscv/mm/fault.c | 18 -- arch/s390/include/asm/uaccess.h | 2 arch/s390/kvm/interrupt.c | 2 arch/s390/kvm/kvm-s390.c | 2 arch/s390/kvm/priv.c | 8 arch/s390/mm/fault.c | 18 -- arch/s390/mm/gmap.c | 4 arch/sh/include/asm/segment.h | 3 arch/sh/include/asm/sparsemem.h | 4 arch/sh/kernel/traps_32.c | 12 - arch/sh/mm/fault.c | 13 - arch/sh/mm/init.c | 9 - arch/sparc/include/asm/sparsemem.h | 1 arch/sparc/include/asm/uaccess_32.h | 2 arch/sparc/include/asm/uaccess_64.h | 2 arch/sparc/mm/fault_32.c | 15 - arch/sparc/mm/fault_64.c | 13 - arch/um/kernel/trap.c | 6 arch/x86/include/asm/uaccess.h | 2 arch/x86/mm/fault.c | 19 -- arch/x86/mm/init_64.c | 9 + arch/x86/mm/numa.c | 1 arch/xtensa/include/asm/uaccess.h | 2 arch/xtensa/mm/fault.c | 17 - drivers/firmware/arm_sdei.c | 5 drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 2 drivers/infiniband/core/umem_odp.c | 2 drivers/iommu/amd/iommu_v2.c | 2 drivers/iommu/intel/svm.c | 3 drivers/rapidio/devices/rio_mport_cdev.c | 7 drivers/rapidio/rio-scan.c | 8 drivers/vfio/vfio_iommu_type1.c | 4 fs/coredump.c | 17 + fs/exec.c | 38 ++-- fs/fat/Kconfig | 2 fs/fat/fatent.c | 3 fs/fat/file.c | 4 fs/hugetlbfs/inode.c | 6 fs/minix/inode.c | 48 ++++- fs/minix/itree_common.c | 8 fs/minix/itree_v1.c | 16 - fs/minix/itree_v2.c | 15 - fs/minix/minix.h | 1 fs/namei.c | 10 - fs/nilfs2/alloc.c | 38 ++-- fs/nilfs2/btree.c | 42 ++-- fs/nilfs2/cpfile.c | 10 - fs/nilfs2/dat.c | 14 - fs/nilfs2/direct.c | 14 - fs/nilfs2/gcinode.c | 2 fs/nilfs2/ifile.c | 4 fs/nilfs2/inode.c | 32 +-- fs/nilfs2/ioctl.c | 37 ++-- fs/nilfs2/mdt.c | 2 fs/nilfs2/namei.c | 6 fs/nilfs2/nilfs.h | 18 +- fs/nilfs2/page.c | 11 - fs/nilfs2/recovery.c | 32 +-- fs/nilfs2/segbuf.c | 2 fs/nilfs2/segment.c | 38 ++-- fs/nilfs2/sufile.c | 29 +-- fs/nilfs2/super.c | 73 ++++---- fs/nilfs2/sysfs.c | 29 +-- fs/nilfs2/the_nilfs.c | 85 ++++----- fs/open.c | 6 fs/proc/base.c | 11 + fs/proc/task_mmu.c | 4 fs/signalfd.c | 10 - fs/ufs/super.c | 2 include/asm-generic/uaccess.h | 4 include/clocksource/timer-ti-dm.h | 2 include/linux/async_tx.h | 2 include/linux/btree.h | 2 include/linux/compaction.h | 6 include/linux/compiler-clang.h | 2 include/linux/compiler_types.h | 44 ++--- include/linux/crash_core.h | 6 include/linux/delay.h | 2 include/linux/dma/k3-psil.h | 2 include/linux/dma/k3-udma-glue.h | 2 include/linux/dma/ti-cppi5.h | 2 include/linux/exportfs.h | 2 include/linux/frontswap.h | 2 include/linux/fs.h | 10 + include/linux/generic-radix-tree.h | 2 include/linux/highmem.h | 2 include/linux/huge_mm.h | 7 include/linux/hugetlb.h | 53 ++++-- include/linux/irqchip/irq-omap-intc.h | 2 include/linux/jhash.h | 2 include/linux/kernel.h | 12 - include/linux/leds-ti-lmu-common.h | 2 include/linux/memcontrol.h | 12 + include/linux/mempolicy.h | 18 +- include/linux/migrate.h | 42 +--- include/linux/mm.h | 20 +- include/linux/mmzone.h | 17 + include/linux/oom.h | 4 include/linux/pgtable.h | 12 - include/linux/platform_data/davinci-cpufreq.h | 2 include/linux/platform_data/davinci_asp.h | 2 include/linux/platform_data/elm.h | 2 include/linux/platform_data/gpio-davinci.h | 2 include/linux/platform_data/gpmc-omap.h | 2 include/linux/platform_data/mtd-davinci-aemif.h | 2 include/linux/platform_data/omap-twl4030.h | 2 include/linux/platform_data/uio_pruss.h | 2 include/linux/platform_data/usb-omap.h | 2 include/linux/poison.h | 4 include/linux/sched/mm.h | 8 include/linux/sched/task.h | 1 include/linux/soc/ti/k3-ringacc.h | 2 include/linux/soc/ti/knav_qmss.h | 2 include/linux/soc/ti/ti-msgmgr.h | 2 include/linux/swap.h | 25 ++ include/linux/syscalls.h | 2 include/linux/uaccess.h | 20 ++ include/linux/vm_event_item.h | 3 include/linux/wkup_m3_ipc.h | 2 include/linux/xxhash.h | 2 include/linux/xz.h | 4 include/linux/zlib.h | 2 include/soc/arc/aux.h | 2 include/trace/events/migrate.h | 17 + include/uapi/linux/auto_dev-ioctl.h | 2 include/uapi/linux/elf.h | 2 include/uapi/linux/map_to_7segment.h | 2 include/uapi/linux/types.h | 2 include/uapi/linux/usb/ch9.h | 2 ipc/sem.c | 3 ipc/shm.c | 4 kernel/Makefile | 2 kernel/crash_core.c | 50 +++++ kernel/events/callchain.c | 5 kernel/events/core.c | 5 kernel/events/uprobes.c | 8 kernel/exit.c | 18 +- kernel/futex.c | 2 kernel/kcov.c | 6 kernel/kmod.c | 5 kernel/kthread.c | 5 kernel/panic.c | 4 kernel/stacktrace.c | 5 kernel/sysctl.c | 11 + kernel/umh.c | 29 --- lib/Kconfig.debug | 27 ++- lib/Makefile | 1 lib/bitmap.c | 4 lib/crc64.c | 2 lib/decompress_bunzip2.c | 2 lib/decompress_unlzma.c | 6 lib/kstrtox.c | 20 -- lib/lz4/lz4_compress.c | 4 lib/lz4/lz4_decompress.c | 18 +- lib/lz4/lz4defs.h | 10 + lib/lz4/lz4hc_compress.c | 2 lib/math/rational.c | 2 lib/rbtree.c | 2 lib/test_bitmap.c | 58 ++++++ lib/test_bitops.c | 18 +- lib/test_bits.c | 75 ++++++++ lib/test_kmod.c | 2 lib/test_lockup.c | 6 lib/ts_bm.c | 2 lib/xxhash.c | 2 lib/xz/xz_crc32.c | 2 lib/xz/xz_dec_bcj.c | 2 lib/xz/xz_dec_lzma2.c | 2 lib/xz/xz_lzma2.h | 2 lib/xz/xz_stream.h | 2 mm/cma.c | 40 +--- mm/cma.h | 4 mm/compaction.c | 207 +++++++++++++++++++++-- mm/filemap.c | 2 mm/gup.c | 195 ++++++---------------- mm/hmm.c | 5 mm/huge_memory.c | 23 -- mm/hugetlb.c | 93 ++++------ mm/internal.h | 9 - mm/khugepaged.c | 2 mm/ksm.c | 3 mm/maccess.c | 22 +- mm/memcontrol.c | 42 +++- mm/memory-failure.c | 7 mm/memory.c | 107 +++++++++--- mm/memory_hotplug.c | 30 ++- mm/mempolicy.c | 49 +---- mm/migrate.c | 151 ++++++++++++++--- mm/mmu_notifier.c | 9 - mm/nommu.c | 4 mm/oom_kill.c | 24 +- mm/page_alloc.c | 14 + mm/page_isolation.c | 21 -- mm/percpu-internal.h | 55 ++++++ mm/percpu-km.c | 5 mm/percpu-stats.c | 36 ++-- mm/percpu-vm.c | 5 mm/percpu.c | 208 +++++++++++++++++++++--- mm/process_vm_access.c | 2 mm/rmap.c | 2 mm/shmem.c | 5 mm/slab_common.c | 2 mm/swap.c | 13 - mm/swap_state.c | 80 +++++++-- mm/swapfile.c | 4 mm/usercopy.c | 2 mm/userfaultfd.c | 2 mm/vmscan.c | 36 ++-- mm/vmstat.c | 32 +++ mm/workingset.c | 23 +- mm/zpool.c | 8 mm/zsmalloc.c | 2 scripts/checkpatch.pl | 116 +++++++++---- scripts/gdb/linux/rbtree.py | 4 security/tomoyo/domain.c | 2 tools/testing/selftests/cgroup/test_kmem.c | 70 +++++++- tools/testing/selftests/kmod/kmod.sh | 4 tools/testing/selftests/vm/hmm-tests.c | 35 ++++ virt/kvm/async_pf.c | 2 virt/kvm/kvm_main.c | 2 268 files changed, 2481 insertions(+), 1551 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-08-07 6:16 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-08-07 6:16 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - A few MM hotfixes - kthread, tools, scripts, ntfs and ocfs2 - Some of MM 163 patches, based on d6efb3ac3e6c19ab722b28bdb9252bae0b9676b6. Subsystems affected by this patch series: mm/pagemap mm/hofixes mm/pagealloc kthread tools scripts ntfs ocfs2 mm/slab-generic mm/slab mm/slub mm/kcsan mm/debug mm/pagecache mm/gup mm/swap mm/shmem mm/memcg mm/pagemap mm/mremap mm/mincore mm/sparsemem mm/vmalloc mm/kasan mm/pagealloc mm/hugetlb mm/vmscan Subsystem: mm/pagemap Yang Shi <yang.shi@linux.alibaba.com>: mm/memory.c: avoid access flag update TLB flush for retried page fault Subsystem: mm/hofixes Ralph Campbell <rcampbell@nvidia.com>: mm/migrate: fix migrate_pgmap_owner w/o CONFIG_MMU_NOTIFIER Subsystem: mm/pagealloc David Hildenbrand <david@redhat.com>: mm/shuffle: don't move pages between zones and don't read garbage memmaps Subsystem: kthread Peter Zijlstra <peterz@infradead.org>: mm: fix kthread_use_mm() vs TLB invalidate Ilias Stamatis <stamatis.iliass@gmail.com>: kthread: remove incorrect comment in kthread_create_on_cpu() Subsystem: tools "Alexander A. Klimov" <grandmaster@al2klimov.de>: tools/: replace HTTP links with HTTPS ones Gaurav Singh <gaurav1086@gmail.com>: tools/testing/selftests/cgroup/cgroup_util.c: cg_read_strcmp: fix null pointer dereference Subsystem: scripts Jialu Xu <xujialu@vimux.org>: scripts/tags.sh: collect compiled source precisely Nikolay Borisov <nborisov@suse.com>: scripts/bloat-o-meter: Support comparing library archives Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: scripts/decode_stacktrace.sh: skip missing symbols scripts/decode_stacktrace.sh: guess basepath if not specified scripts/decode_stacktrace.sh: guess path to modules scripts/decode_stacktrace.sh: guess path to vmlinux by release name Joe Perches <joe@perches.com>: const_structs.checkpatch: add regulator_ops Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ntfs Luca Stefani <luca.stefani.ge1@gmail.com>: ntfs: fix ntfs_test_inode and ntfs_init_locked_inode function type Subsystem: ocfs2 Gang He <ghe@suse.com>: ocfs2: fix remounting needed after setfacl command Randy Dunlap <rdunlap@infradead.org>: ocfs2: suballoc.h: delete a duplicated word Junxiao Bi <junxiao.bi@oracle.com>: ocfs2: change slot number type s16 to u16 "Alexander A. Klimov" <grandmaster@al2klimov.de>: ocfs2: replace HTTP links with HTTPS ones Pavel Machek <pavel@ucw.cz>: ocfs2: fix unbalanced locking Subsystem: mm/slab-generic Waiman Long <longman@redhat.com>: mm, treewide: rename kzfree() to kfree_sensitive() William Kucharski <william.kucharski@oracle.com>: mm: ksize() should silently accept a NULL pointer Subsystem: mm/slab Kees Cook <keescook@chromium.org>: Patch series "mm: Expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB": mm/slab: expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB mm/slab: add naive detection of double free Long Li <lonuxli.64@gmail.com>: mm, slab: check GFP_SLAB_BUG_MASK before alloc_pages in kmalloc_order Xiao Yang <yangx.jy@cn.fujitsu.com>: mm/slab.c: update outdated kmem_list3 in a comment Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: Patch series "slub_debug fixes and improvements": mm, slub: extend slub_debug syntax for multiple blocks mm, slub: make some slub_debug related attributes read-only mm, slub: remove runtime allocation order changes mm, slub: make remaining slub_debug related attributes read-only mm, slub: make reclaim_account attribute read-only mm, slub: introduce static key for slub_debug() mm, slub: introduce kmem_cache_debug_flags() mm, slub: extend checks guarded by slub_debug static key mm, slab/slub: move and improve cache_from_obj() mm, slab/slub: improve error reporting and overhead of cache_from_obj() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/slub.c: drop lockdep_assert_held() from put_map() Subsystem: mm/kcsan Marco Elver <elver@google.com>: mm, kcsan: instrument SLAB/SLUB free with "ASSERT_EXCLUSIVE_ACCESS" Subsystem: mm/debug Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/debug_vm_pgtable: Add some more tests", v5: mm/debug_vm_pgtable: add tests validating arch helpers for core MM features mm/debug_vm_pgtable: add tests validating advanced arch page table helpers mm/debug_vm_pgtable: add debug prints for individual tests Documentation/mm: add descriptions for arch page table helpers "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Improvements for dump_page()", v2: mm/debug: handle page->mapping better in dump_page mm/debug: dump compound page information on a second line mm/debug: print head flags in dump_page mm/debug: switch dump_page to get_kernel_nofault mm/debug: print the inode number in dump_page mm/debug: print hashed address of struct page John Hubbard <jhubbard@nvidia.com>: mm, dump_page: do not crash with bad compound_mapcount() Subsystem: mm/pagecache Yang Shi <yang.shi@linux.alibaba.com>: mm: filemap: clear idle flag for writes mm: filemap: add missing FGP_ flags in kerneldoc comment for pagecache_get_page Subsystem: mm/gup Tang Yizhou <tangyizhou@huawei.com>: mm/gup.c: fix the comment of return value for populate_vma_page_range() Subsystem: mm/swap Zhen Lei <thunder.leizhen@huawei.com>: Patch series "clean up some functions in mm/swap_slots.c": mm/swap_slots.c: simplify alloc_swap_slot_cache() mm/swap_slots.c: simplify enable_swap_slots_cache() mm/swap_slots.c: remove redundant check for swap_slot_cache_initialized Krzysztof Kozlowski <krzk@kernel.org>: mm: swap: fix kerneldoc of swap_vma_readahead() Xianting Tian <xianting_tian@126.com>: mm/page_io.c: use blk_io_schedule() for avoiding task hung in sync io Subsystem: mm/shmem Chris Down <chris@chrisdown.name>: Patch series "tmpfs: inode: Reduce risk of inum overflow", v7: tmpfs: per-superblock i_ino support tmpfs: support 64-bit inums per-sb Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: kmem: make memcg_kmem_enabled() irreversible Patch series "The new cgroup slab memory controller", v7: mm: memcg: factor out memcg- and lruvec-level changes out of __mod_lruvec_state() mm: memcg: prepare for byte-sized vmstat items mm: memcg: convert vmstat slab counters to bytes mm: slub: implement SLUB version of obj_to_index() Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: decouple reference counting from page accounting Roman Gushchin <guro@fb.com>: mm: memcg/slab: obj_cgroup API mm: memcg/slab: allocate obj_cgroups for non-root slab pages mm: memcg/slab: save obj_cgroup for non-root slab objects mm: memcg/slab: charge individual slab objects instead of pages mm: memcg/slab: deprecate memory.kmem.slabinfo mm: memcg/slab: move memcg_kmem_bypass() to memcontrol.h mm: memcg/slab: use a single set of kmem_caches for all accounted allocations mm: memcg/slab: simplify memcg cache creation mm: memcg/slab: remove memcg_kmem_get_cache() mm: memcg/slab: deprecate slab_root_caches mm: memcg/slab: remove redundant check in memcg_accumulate_slabinfo() mm: memcg/slab: use a single set of kmem_caches for all allocations kselftests: cgroup: add kernel memory accounting tests tools/cgroup: add memcg_slabinfo.py tool Shakeel Butt <shakeelb@google.com>: mm: memcontrol: account kernel stack per node Roman Gushchin <guro@fb.com>: mm: memcg/slab: remove unused argument by charge_slab_page() mm: slab: rename (un)charge_slab_page() to (un)account_slab_page() mm: kmem: switch to static_branch_likely() in memcg_kmem_enabled() mm: memcontrol: avoid workload stalls when lowering memory.high Chris Down <chris@chrisdown.name>: Patch series "mm, memcg: reclaim harder before high throttling", v2: mm, memcg: reclaim more aggressively before high allocator throttling mm, memcg: unify reclaim retry limits with page allocator Yafang Shao <laoar.shao@gmail.com>: Patch series "mm, memcg: memory.{low,min} reclaim fix & cleanup", v4: mm, memcg: avoid stale protection values when cgroup is above protection Chris Down <chris@chrisdown.name>: mm, memcg: decouple e{low,min} state mutations from protection checks Yafang Shao <laoar.shao@gmail.com>: memcg, oom: check memcg margin for parallel oom Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: restore proper dirty throttling when memory.high changes mm: memcontrol: don't count limit-setting reclaim as memory pressure Michal Koutný <mkoutny@suse.com>: mm/page_counter.c: fix protection usage propagation Subsystem: mm/pagemap Ralph Campbell <rcampbell@nvidia.com>: mm: remove redundant check non_swap_entry() Alex Zhang <zhangalex@google.com>: mm/memory.c: make remap_pfn_range() reject unaligned addr Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: cleanup usage of <asm/pgalloc.h>": mm: remove unneeded includes of <asm/pgalloc.h> opeinrisc: switch to generic version of pte allocation xtensa: switch to generic version of pte allocation asm-generic: pgalloc: provide generic pmd_alloc_one() and pmd_free_one() asm-generic: pgalloc: provide generic pud_alloc_one() and pud_free_one() asm-generic: pgalloc: provide generic pgd_free() mm: move lib/ioremap.c to mm/ Joerg Roedel <jroedel@suse.de>: mm: move p?d_alloc_track to separate header file Zhen Lei <thunder.leizhen@huawei.com>: mm/mmap: optimize a branch judgment in ksys_mmap_pgoff() Feng Tang <feng.tang@intel.com>: Patch series "make vm_committed_as_batch aware of vm overcommit policy", v6: proc/meminfo: avoid open coded reading of vm_committed_as mm/util.c: make vm_memory_committed() more accurate percpu_counter: add percpu_counter_sync() mm: adjust vm_committed_as_batch according to vm overcommit policy Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "arm64: Enable vmemmap mapping from device memory", v4: mm/sparsemem: enable vmem_altmap support in vmemmap_populate_basepages() mm/sparsemem: enable vmem_altmap support in vmemmap_alloc_block_buf() arm64/mm: enable vmem_altmap support for vmemmap mappings Miaohe Lin <linmiaohe@huawei.com>: mm: mmap: merge vma after call_mmap() if possible Peter Collingbourne <pcc@google.com>: mm: remove unnecessary wrapper function do_mmap_pgoff() Subsystem: mm/mremap Wei Yang <richard.weiyang@linux.alibaba.com>: Patch series "mm/mremap: cleanup move_page_tables() a little", v5: mm/mremap: it is sure to have enough space when extent meets requirement mm/mremap: calculate extent in one place mm/mremap: start addresses are properly aligned Subsystem: mm/mincore Ricardo Cañuelo <ricardo.canuelo@collabora.com>: selftests: add mincore() tests Subsystem: mm/sparsemem Wei Yang <richard.weiyang@linux.alibaba.com>: mm/sparse: never partially remove memmap for early section mm/sparse: only sub-section aligned range would be populated Mike Rapoport <rppt@linux.ibm.com>: mm/sparse: cleanup the code surrounding memory_present() Subsystem: mm/vmalloc "Matthew Wilcox (Oracle)" <willy@infradead.org>: vmalloc: convert to XArray "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: simplify merge_or_add_vmap_area() mm/vmalloc: simplify augment_tree_propagate_check() mm/vmalloc: switch to "propagate()" callback mm/vmalloc: update the header about KVA rework Mike Rapoport <rppt@linux.ibm.com>: mm: vmalloc: remove redundant assignment in unmap_kernel_range_noflush() "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc.c: remove BUG() from the find_va_links() Subsystem: mm/kasan Marco Elver <elver@google.com>: kasan: improve and simplify Kconfig.kasan kasan: update required compiler versions in documentation Walter Wu <walter-zh.wu@mediatek.com>: Patch series "kasan: memorize and print call_rcu stack", v8: rcu: kasan: record and print call_rcu() call stack kasan: record and print the free track kasan: add tests for call_rcu stack recording kasan: update documentation for generic kasan Vincenzo Frascino <vincenzo.frascino@arm.com>: kasan: remove kasan_unpoison_stack_above_sp_to() Walter Wu <walter-zh.wu@mediatek.com>: lib/test_kasan.c: fix KASAN unit tests for tag-based KASAN Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: support stack instrumentation for tag-based mode", v2: kasan: don't tag stacks allocated with pagealloc efi: provide empty efi_enter_virtual_mode implementation kasan, arm64: don't instrument functions that enable kasan kasan: allow enabling stack tagging for tag-based mode kasan: adjust kasan_stack_oob for tag-based mode Subsystem: mm/pagealloc Vlastimil Babka <vbabka@suse.cz>: mm, page_alloc: use unlikely() in task_capc() Jaewon Kim <jaewon31.kim@samsung.com>: page_alloc: consider highatomic reserve in watermark fast Charan Teja Reddy <charante@codeaurora.org>: mm, page_alloc: skip ->waternark_boost for atomic order-0 allocations David Hildenbrand <david@redhat.com>: mm: remove vm_total_pages mm/page_alloc: remove nr_free_pagecache_pages() mm/memory_hotplug: document why shuffle_zone() is relevant mm/shuffle: remove dynamic reconfiguration Wei Yang <richard.weiyang@linux.alibaba.com>: mm/page_alloc.c: replace the definition of NR_MIGRATETYPE_BITS with PB_migratetype_bits mm/page_alloc.c: extract the common part in pfn_to_bitidx() mm/page_alloc.c: simplify pageblock bitmap access mm/page_alloc.c: remove unnecessary end_bitidx for [set|get]_pfnblock_flags_mask() Qian Cai <cai@lca.pw>: mm/page_alloc: silence a KASAN false positive Wei Yang <richard.weiyang@linux.alibaba.com>: mm/page_alloc: fallbacks at most has 3 elements Muchun Song <songmuchun@bytedance.com>: mm/page_alloc.c: skip setting nodemask when we are in interrupt Joonsoo Kim <iamjoonsoo.kim@lge.com>: mm/page_alloc: fix memalloc_nocma_{save/restore} APIs Subsystem: mm/hugetlb "Alexander A. Klimov" <grandmaster@al2klimov.de>: mm: thp: replace HTTP links with HTTPS ones Peter Xu <peterx@redhat.com>: mm/hugetlb: fix calculation of adjust_range_if_pmd_sharing_possible Hugh Dickins <hughd@google.com>: khugepaged: collapse_pte_mapped_thp() flush the right range khugepaged: collapse_pte_mapped_thp() protect the pmd lock khugepaged: retract_page_tables() remember to test exit khugepaged: khugepaged_test_exit() check mmget_still_valid() Subsystem: mm/vmscan dylan-meiners <spacct.spacct@gmail.com>: mm/vmscan.c: fix typo Shakeel Butt <shakeelb@google.com>: mm: vmscan: consistent update to pgrefill Documentation/admin-guide/kernel-parameters.txt | 2 Documentation/dev-tools/kasan.rst | 10 Documentation/filesystems/dlmfs.rst | 2 Documentation/filesystems/ocfs2.rst | 2 Documentation/filesystems/tmpfs.rst | 18 Documentation/vm/arch_pgtable_helpers.rst | 258 +++++ Documentation/vm/memory-model.rst | 9 Documentation/vm/slub.rst | 51 - arch/alpha/include/asm/pgalloc.h | 21 arch/alpha/include/asm/tlbflush.h | 1 arch/alpha/kernel/core_irongate.c | 1 arch/alpha/kernel/core_marvel.c | 1 arch/alpha/kernel/core_titan.c | 1 arch/alpha/kernel/machvec_impl.h | 2 arch/alpha/kernel/smp.c | 1 arch/alpha/mm/numa.c | 1 arch/arc/mm/fault.c | 1 arch/arc/mm/init.c | 1 arch/arm/include/asm/pgalloc.h | 12 arch/arm/include/asm/tlb.h | 1 arch/arm/kernel/machine_kexec.c | 1 arch/arm/kernel/smp.c | 1 arch/arm/kernel/suspend.c | 1 arch/arm/mach-omap2/omap-mpuss-lowpower.c | 1 arch/arm/mm/hugetlbpage.c | 1 arch/arm/mm/init.c | 9 arch/arm/mm/mmu.c | 1 arch/arm64/include/asm/pgalloc.h | 39 arch/arm64/kernel/setup.c | 2 arch/arm64/kernel/smp.c | 1 arch/arm64/mm/hugetlbpage.c | 1 arch/arm64/mm/init.c | 6 arch/arm64/mm/ioremap.c | 1 arch/arm64/mm/mmu.c | 63 - arch/csky/include/asm/pgalloc.h | 7 arch/csky/kernel/smp.c | 1 arch/hexagon/include/asm/pgalloc.h | 7 arch/ia64/include/asm/pgalloc.h | 24 arch/ia64/include/asm/tlb.h | 1 arch/ia64/kernel/process.c | 1 arch/ia64/kernel/smp.c | 1 arch/ia64/kernel/smpboot.c | 1 arch/ia64/mm/contig.c | 1 arch/ia64/mm/discontig.c | 4 arch/ia64/mm/hugetlbpage.c | 1 arch/ia64/mm/tlb.c | 1 arch/m68k/include/asm/mmu_context.h | 2 arch/m68k/include/asm/sun3_pgalloc.h | 7 arch/m68k/kernel/dma.c | 2 arch/m68k/kernel/traps.c | 3 arch/m68k/mm/cache.c | 2 arch/m68k/mm/fault.c | 1 arch/m68k/mm/kmap.c | 2 arch/m68k/mm/mcfmmu.c | 1 arch/m68k/mm/memory.c | 1 arch/m68k/sun3x/dvma.c | 2 arch/microblaze/include/asm/pgalloc.h | 6 arch/microblaze/include/asm/tlbflush.h | 1 arch/microblaze/kernel/process.c | 1 arch/microblaze/kernel/signal.c | 1 arch/microblaze/mm/init.c | 3 arch/mips/include/asm/pgalloc.h | 19 arch/mips/kernel/setup.c | 8 arch/mips/loongson64/numa.c | 1 arch/mips/sgi-ip27/ip27-memory.c | 2 arch/mips/sgi-ip32/ip32-memory.c | 1 arch/nds32/mm/mm-nds32.c | 2 arch/nios2/include/asm/pgalloc.h | 7 arch/openrisc/include/asm/pgalloc.h | 33 arch/openrisc/include/asm/tlbflush.h | 1 arch/openrisc/kernel/or32_ksyms.c | 1 arch/parisc/include/asm/mmu_context.h | 1 arch/parisc/include/asm/pgalloc.h | 12 arch/parisc/kernel/cache.c | 1 arch/parisc/kernel/pci-dma.c | 1 arch/parisc/kernel/process.c | 1 arch/parisc/kernel/signal.c | 1 arch/parisc/kernel/smp.c | 1 arch/parisc/mm/hugetlbpage.c | 1 arch/parisc/mm/init.c | 5 arch/parisc/mm/ioremap.c | 2 arch/powerpc/include/asm/tlb.h | 1 arch/powerpc/mm/book3s64/hash_hugetlbpage.c | 1 arch/powerpc/mm/book3s64/hash_pgtable.c | 1 arch/powerpc/mm/book3s64/hash_tlb.c | 1 arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 1 arch/powerpc/mm/init_32.c | 1 arch/powerpc/mm/init_64.c | 4 arch/powerpc/mm/kasan/8xx.c | 1 arch/powerpc/mm/kasan/book3s_32.c | 1 arch/powerpc/mm/mem.c | 3 arch/powerpc/mm/nohash/40x.c | 1 arch/powerpc/mm/nohash/8xx.c | 1 arch/powerpc/mm/nohash/fsl_booke.c | 1 arch/powerpc/mm/nohash/kaslr_booke.c | 1 arch/powerpc/mm/nohash/tlb.c | 1 arch/powerpc/mm/numa.c | 1 arch/powerpc/mm/pgtable.c | 1 arch/powerpc/mm/pgtable_64.c | 1 arch/powerpc/mm/ptdump/hashpagetable.c | 2 arch/powerpc/mm/ptdump/ptdump.c | 1 arch/powerpc/platforms/pseries/cmm.c | 1 arch/riscv/include/asm/pgalloc.h | 18 arch/riscv/mm/fault.c | 1 arch/riscv/mm/init.c | 3 arch/s390/crypto/prng.c | 4 arch/s390/include/asm/tlb.h | 1 arch/s390/include/asm/tlbflush.h | 1 arch/s390/kernel/machine_kexec.c | 1 arch/s390/kernel/ptrace.c | 1 arch/s390/kvm/diag.c | 1 arch/s390/kvm/priv.c | 1 arch/s390/kvm/pv.c | 1 arch/s390/mm/cmm.c | 1 arch/s390/mm/init.c | 1 arch/s390/mm/mmap.c | 1 arch/s390/mm/pgtable.c | 1 arch/sh/include/asm/pgalloc.h | 4 arch/sh/kernel/idle.c | 1 arch/sh/kernel/machine_kexec.c | 1 arch/sh/mm/cache-sh3.c | 1 arch/sh/mm/cache-sh7705.c | 1 arch/sh/mm/hugetlbpage.c | 1 arch/sh/mm/init.c | 7 arch/sh/mm/ioremap_fixed.c | 1 arch/sh/mm/numa.c | 3 arch/sh/mm/tlb-sh3.c | 1 arch/sparc/include/asm/ide.h | 1 arch/sparc/include/asm/tlb_64.h | 1 arch/sparc/kernel/leon_smp.c | 1 arch/sparc/kernel/process_32.c | 1 arch/sparc/kernel/signal_32.c | 1 arch/sparc/kernel/smp_32.c | 1 arch/sparc/kernel/smp_64.c | 1 arch/sparc/kernel/sun4m_irq.c | 1 arch/sparc/mm/highmem.c | 1 arch/sparc/mm/init_64.c | 1 arch/sparc/mm/io-unit.c | 1 arch/sparc/mm/iommu.c | 1 arch/sparc/mm/tlb.c | 1 arch/um/include/asm/pgalloc.h | 9 arch/um/include/asm/pgtable-3level.h | 3 arch/um/kernel/mem.c | 17 arch/x86/ia32/ia32_aout.c | 1 arch/x86/include/asm/mmu_context.h | 1 arch/x86/include/asm/pgalloc.h | 42 arch/x86/kernel/alternative.c | 1 arch/x86/kernel/apic/apic.c | 1 arch/x86/kernel/mpparse.c | 1 arch/x86/kernel/traps.c | 1 arch/x86/mm/fault.c | 1 arch/x86/mm/hugetlbpage.c | 1 arch/x86/mm/init_32.c | 2 arch/x86/mm/init_64.c | 12 arch/x86/mm/kaslr.c | 1 arch/x86/mm/pgtable_32.c | 1 arch/x86/mm/pti.c | 1 arch/x86/platform/uv/bios_uv.c | 1 arch/x86/power/hibernate.c | 2 arch/xtensa/include/asm/pgalloc.h | 46 arch/xtensa/kernel/xtensa_ksyms.c | 1 arch/xtensa/mm/cache.c | 1 arch/xtensa/mm/fault.c | 1 crypto/adiantum.c | 2 crypto/ahash.c | 4 crypto/api.c | 2 crypto/asymmetric_keys/verify_pefile.c | 4 crypto/deflate.c | 2 crypto/drbg.c | 10 crypto/ecc.c | 8 crypto/ecdh.c | 2 crypto/gcm.c | 2 crypto/gf128mul.c | 4 crypto/jitterentropy-kcapi.c | 2 crypto/rng.c | 2 crypto/rsa-pkcs1pad.c | 6 crypto/seqiv.c | 2 crypto/shash.c | 2 crypto/skcipher.c | 2 crypto/testmgr.c | 6 crypto/zstd.c | 2 drivers/base/node.c | 10 drivers/block/xen-blkback/common.h | 1 drivers/crypto/allwinner/sun8i-ce/sun8i-ce-cipher.c | 2 drivers/crypto/allwinner/sun8i-ss/sun8i-ss-cipher.c | 2 drivers/crypto/amlogic/amlogic-gxl-cipher.c | 4 drivers/crypto/atmel-ecc.c | 2 drivers/crypto/caam/caampkc.c | 28 drivers/crypto/cavium/cpt/cptvf_main.c | 6 drivers/crypto/cavium/cpt/cptvf_reqmanager.c | 12 drivers/crypto/cavium/nitrox/nitrox_lib.c | 4 drivers/crypto/cavium/zip/zip_crypto.c | 6 drivers/crypto/ccp/ccp-crypto-rsa.c | 6 drivers/crypto/ccree/cc_aead.c | 4 drivers/crypto/ccree/cc_buffer_mgr.c | 4 drivers/crypto/ccree/cc_cipher.c | 6 drivers/crypto/ccree/cc_hash.c | 8 drivers/crypto/ccree/cc_request_mgr.c | 2 drivers/crypto/marvell/cesa/hash.c | 2 drivers/crypto/marvell/octeontx/otx_cptvf_main.c | 6 drivers/crypto/marvell/octeontx/otx_cptvf_reqmgr.h | 2 drivers/crypto/nx/nx.c | 4 drivers/crypto/virtio/virtio_crypto_algs.c | 12 drivers/crypto/virtio/virtio_crypto_core.c | 2 drivers/iommu/ipmmu-vmsa.c | 1 drivers/md/dm-crypt.c | 32 drivers/md/dm-integrity.c | 6 drivers/misc/ibmvmc.c | 6 drivers/net/ethernet/hisilicon/hns3/hns3pf/hclge_mbx.c | 2 drivers/net/ethernet/intel/ixgbe/ixgbe_ipsec.c | 6 drivers/net/ppp/ppp_mppe.c | 6 drivers/net/wireguard/noise.c | 4 drivers/net/wireguard/peer.c | 2 drivers/net/wireless/intel/iwlwifi/pcie/rx.c | 2 drivers/net/wireless/intel/iwlwifi/pcie/tx-gen2.c | 6 drivers/net/wireless/intel/iwlwifi/pcie/tx.c | 6 drivers/net/wireless/intersil/orinoco/wext.c | 4 drivers/s390/crypto/ap_bus.h | 4 drivers/staging/ks7010/ks_hostif.c | 2 drivers/staging/rtl8723bs/core/rtw_security.c | 2 drivers/staging/wlan-ng/p80211netdev.c | 2 drivers/target/iscsi/iscsi_target_auth.c | 2 drivers/xen/balloon.c | 1 drivers/xen/privcmd.c | 1 fs/Kconfig | 21 fs/aio.c | 6 fs/binfmt_elf_fdpic.c | 1 fs/cifs/cifsencrypt.c | 2 fs/cifs/connect.c | 10 fs/cifs/dfs_cache.c | 2 fs/cifs/misc.c | 8 fs/crypto/inline_crypt.c | 5 fs/crypto/keyring.c | 6 fs/crypto/keysetup_v1.c | 4 fs/ecryptfs/keystore.c | 4 fs/ecryptfs/messaging.c | 2 fs/hugetlbfs/inode.c | 2 fs/ntfs/dir.c | 2 fs/ntfs/inode.c | 27 fs/ntfs/inode.h | 4 fs/ntfs/mft.c | 4 fs/ocfs2/Kconfig | 6 fs/ocfs2/acl.c | 2 fs/ocfs2/blockcheck.c | 2 fs/ocfs2/dlmglue.c | 8 fs/ocfs2/ocfs2.h | 4 fs/ocfs2/suballoc.c | 4 fs/ocfs2/suballoc.h | 2 fs/ocfs2/super.c | 4 fs/proc/meminfo.c | 10 include/asm-generic/pgalloc.h | 80 + include/asm-generic/tlb.h | 1 include/crypto/aead.h | 2 include/crypto/akcipher.h | 2 include/crypto/gf128mul.h | 2 include/crypto/hash.h | 2 include/crypto/internal/acompress.h | 2 include/crypto/kpp.h | 2 include/crypto/skcipher.h | 2 include/linux/efi.h | 4 include/linux/fs.h | 17 include/linux/huge_mm.h | 2 include/linux/kasan.h | 4 include/linux/memcontrol.h | 209 +++- include/linux/mm.h | 86 - include/linux/mm_types.h | 5 include/linux/mman.h | 4 include/linux/mmu_notifier.h | 13 include/linux/mmzone.h | 54 - include/linux/pageblock-flags.h | 30 include/linux/percpu_counter.h | 4 include/linux/sched/mm.h | 8 include/linux/shmem_fs.h | 3 include/linux/slab.h | 11 include/linux/slab_def.h | 9 include/linux/slub_def.h | 31 include/linux/swap.h | 2 include/linux/vmstat.h | 14 init/Kconfig | 9 init/main.c | 2 ipc/shm.c | 2 kernel/fork.c | 54 - kernel/kthread.c | 8 kernel/power/snapshot.c | 2 kernel/rcu/tree.c | 2 kernel/scs.c | 2 kernel/sysctl.c | 2 lib/Kconfig.kasan | 39 lib/Makefile | 1 lib/ioremap.c | 287 ----- lib/mpi/mpiutil.c | 6 lib/percpu_counter.c | 19 lib/test_kasan.c | 87 + mm/Kconfig | 6 mm/Makefile | 2 mm/debug.c | 103 +- mm/debug_vm_pgtable.c | 666 +++++++++++++ mm/filemap.c | 9 mm/gup.c | 3 mm/huge_memory.c | 14 mm/hugetlb.c | 25 mm/ioremap.c | 289 +++++ mm/kasan/common.c | 41 mm/kasan/generic.c | 43 mm/kasan/generic_report.c | 1 mm/kasan/kasan.h | 25 mm/kasan/quarantine.c | 1 mm/kasan/report.c | 54 - mm/kasan/tags.c | 37 mm/khugepaged.c | 75 - mm/memcontrol.c | 832 ++++++++++------- mm/memory.c | 15 mm/memory_hotplug.c | 11 mm/migrate.c | 6 mm/mm_init.c | 20 mm/mmap.c | 45 mm/mremap.c | 19 mm/nommu.c | 6 mm/oom_kill.c | 2 mm/page-writeback.c | 6 mm/page_alloc.c | 226 ++-- mm/page_counter.c | 6 mm/page_io.c | 2 mm/pgalloc-track.h | 51 + mm/shmem.c | 133 ++ mm/shuffle.c | 46 mm/shuffle.h | 17 mm/slab.c | 129 +- mm/slab.h | 755 ++++++--------- mm/slab_common.c | 829 ++-------------- mm/slob.c | 12 mm/slub.c | 680 ++++--------- mm/sparse-vmemmap.c | 62 - mm/sparse.c | 31 mm/swap_slots.c | 45 mm/swap_state.c | 2 mm/util.c | 52 + mm/vmalloc.c | 176 +-- mm/vmscan.c | 39 mm/vmstat.c | 38 mm/workingset.c | 6 net/atm/mpoa_caches.c | 4 net/bluetooth/ecdh_helper.c | 6 net/bluetooth/smp.c | 24 net/core/sock.c | 2 net/ipv4/tcp_fastopen.c | 2 net/mac80211/aead_api.c | 4 net/mac80211/aes_gmac.c | 2 net/mac80211/key.c | 2 net/mac802154/llsec.c | 20 net/sctp/auth.c | 2 net/sunrpc/auth_gss/gss_krb5_crypto.c | 4 net/sunrpc/auth_gss/gss_krb5_keys.c | 6 net/sunrpc/auth_gss/gss_krb5_mech.c | 2 net/tipc/crypto.c | 10 net/wireless/core.c | 2 net/wireless/ibss.c | 4 net/wireless/lib80211_crypt_tkip.c | 2 net/wireless/lib80211_crypt_wep.c | 2 net/wireless/nl80211.c | 24 net/wireless/sme.c | 6 net/wireless/util.c | 2 net/wireless/wext-sme.c | 2 scripts/Makefile.kasan | 3 scripts/bloat-o-meter | 2 scripts/coccinelle/free/devm_free.cocci | 4 scripts/coccinelle/free/ifnullfree.cocci | 4 scripts/coccinelle/free/kfree.cocci | 6 scripts/coccinelle/free/kfreeaddr.cocci | 2 scripts/const_structs.checkpatch | 1 scripts/decode_stacktrace.sh | 85 + scripts/spelling.txt | 19 scripts/tags.sh | 18 security/apparmor/domain.c | 4 security/apparmor/include/file.h | 2 security/apparmor/policy.c | 24 security/apparmor/policy_ns.c | 6 security/apparmor/policy_unpack.c | 14 security/keys/big_key.c | 6 security/keys/dh.c | 14 security/keys/encrypted-keys/encrypted.c | 14 security/keys/trusted-keys/trusted_tpm1.c | 34 security/keys/user_defined.c | 6 tools/cgroup/memcg_slabinfo.py | 226 ++++ tools/include/linux/jhash.h | 2 tools/lib/rbtree.c | 2 tools/lib/traceevent/event-parse.h | 2 tools/testing/ktest/examples/README | 2 tools/testing/ktest/examples/crosstests.conf | 2 tools/testing/selftests/Makefile | 1 tools/testing/selftests/cgroup/.gitignore | 1 tools/testing/selftests/cgroup/Makefile | 2 tools/testing/selftests/cgroup/cgroup_util.c | 2 tools/testing/selftests/cgroup/test_kmem.c | 382 +++++++ tools/testing/selftests/mincore/.gitignore | 2 tools/testing/selftests/mincore/Makefile | 6 tools/testing/selftests/mincore/mincore_selftest.c | 361 +++++++ 397 files changed, 5547 insertions(+), 4072 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-07-24 4:14 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-07-24 4:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 15 patches, based on f37e99aca03f63aa3f2bd13ceaf769455d12c4b0. Subsystems affected by this patch series: mm/pagemap mm/shmem mm/hotfixes mm/memcg mm/hugetlb mailmap squashfs scripts io-mapping MAINTAINERS gdb Subsystem: mm/pagemap Yang Shi <yang.shi@linux.alibaba.com>: mm/memory.c: avoid access flag update TLB flush for retried page fault "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: mm/mmap.c: close race between munmap() and expand_upwards()/downwards() Subsystem: mm/shmem Chengguang Xu <cgxu519@mykernel.net>: vfs/xattr: mm/shmem: kernfs: release simple xattr entry in a right way Subsystem: mm/hotfixes Tom Rix <trix@redhat.com>: mm: initialize return of vm_insert_pages Bhupesh Sharma <bhsharma@redhat.com>: mm/memcontrol: fix OOPS inside mem_cgroup_get_nr_swap_pages() Subsystem: mm/memcg Hugh Dickins <hughd@google.com>: mm/memcg: fix refcount error while moving and swapping Muchun Song <songmuchun@bytedance.com>: mm: memcg/slab: fix memory leak at non-root kmem_cache destroy Subsystem: mm/hugetlb Barry Song <song.bao.hua@hisilicon.com>: mm/hugetlb: avoid hardcoding while checking if cma is enabled "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: khugepaged: fix null-pointer dereference due to race Subsystem: mailmap Mike Rapoport <rppt@linux.ibm.com>: mailmap: add entry for Mike Rapoport Subsystem: squashfs Phillip Lougher <phillip@squashfs.org.uk>: squashfs: fix length field overlap check in metadata reading Subsystem: scripts Pi-Hsun Shih <pihsun@chromium.org>: scripts/decode_stacktrace: strip basepath from all paths Subsystem: io-mapping "Michael J. Ruhl" <michael.j.ruhl@intel.com>: io-mapping: indicate mapping failure Subsystem: MAINTAINERS Andrey Konovalov <andreyknvl@google.com>: MAINTAINERS: add KCOV section Subsystem: gdb Stefano Garzarella <sgarzare@redhat.com>: scripts/gdb: fix lx-symbols 'gdb.error' while loading modules .mailmap | 3 +++ MAINTAINERS | 11 +++++++++++ fs/squashfs/block.c | 2 +- include/linux/io-mapping.h | 5 ++++- include/linux/xattr.h | 3 ++- mm/hugetlb.c | 15 ++++++++++----- mm/khugepaged.c | 3 +++ mm/memcontrol.c | 13 ++++++++++--- mm/memory.c | 9 +++++++-- mm/mmap.c | 16 ++++++++++++++-- mm/shmem.c | 2 +- mm/slab_common.c | 35 ++++++++++++++++++++++++++++------- scripts/decode_stacktrace.sh | 4 ++-- scripts/gdb/linux/symbols.py | 2 +- 14 files changed, 97 insertions(+), 26 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-07-03 22:14 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-07-03 22:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 5 patches, based on cdd3bb54332f82295ed90cd0c09c78cd0c0ee822. Subsystems affected by this patch series: mm/hugetlb samples mm/cma mm/vmalloc mm/pagealloc Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: mm/hugetlb.c: fix pages per hugetlb calculation Subsystem: samples Kees Cook <keescook@chromium.org>: samples/vfs: avoid warning in statx override Subsystem: mm/cma Barry Song <song.bao.hua@hisilicon.com>: mm/cma.c: use exact_nid true to fix possible per-numa cma leak Subsystem: mm/vmalloc Christoph Hellwig <hch@lst.de>: vmalloc: fix the owner argument for the new __vmalloc_node_range callers Subsystem: mm/pagealloc Joel Savitz <jsavitz@redhat.com>: mm/page_alloc: fix documentation error arch/arm64/kernel/probes/kprobes.c | 2 +- arch/x86/hyperv/hv_init.c | 3 ++- kernel/module.c | 2 +- mm/cma.c | 4 ++-- mm/hugetlb.c | 2 +- mm/page_alloc.c | 2 +- samples/vfs/test-statx.c | 2 ++ 7 files changed, 10 insertions(+), 7 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-06-26 3:28 Andrew Morton 2020-06-26 6:51 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2020-06-26 3:28 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a. Subsystems affected by this patch series: hotfixes mm/pagealloc kexec ocfs2 lib misc mm/slab mm/slab mm/slub mm/swap mm/pagemap mm/vmalloc mm/memcg mm/gup mm/thp mm/vmscan x86 mm/memory-hotplug MAINTAINERS Subsystem: hotfixes Stafford Horne <shorne@gmail.com>: openrisc: fix boot oops when DEBUG_VM is enabled Michal Hocko <mhocko@suse.com>: mm: do_swap_page(): fix up the error code Subsystem: mm/pagealloc Vlastimil Babka <vbabka@suse.cz>: mm, compaction: make capture control handling safe wrt interrupts Subsystem: kexec Lianbo Jiang <lijiang@redhat.com>: kexec: do not verify the signature without the lockdown or mandatory signature Subsystem: ocfs2 Junxiao Bi <junxiao.bi@oracle.com>: Patch series "ocfs2: fix nfsd over ocfs2 issues", v2: ocfs2: avoid inode removal while nfsd is accessing it ocfs2: load global_inode_alloc ocfs2: fix panic on nfs server over ocfs2 ocfs2: fix value of OCFS2_INVALID_SLOT Subsystem: lib Randy Dunlap <rdunlap@infradead.org>: lib: fix test_hmm.c reference after free Subsystem: misc Rikard Falkeborn <rikard.falkeborn@gmail.com>: linux/bits.h: fix unsigned less than zero warnings Subsystem: mm/slab Waiman Long <longman@redhat.com>: mm, slab: fix sign conversion problem in memcg_uncharge_slab() Subsystem: mm/slab Waiman Long <longman@redhat.com>: mm/slab: use memzero_explicit() in kzfree() Subsystem: mm/slub Sebastian Andrzej Siewior <bigeasy@linutronix.de>: slub: cure list_slab_objects() from double fix Subsystem: mm/swap Hugh Dickins <hughd@google.com>: mm: fix swap cache node allocation mask Subsystem: mm/pagemap Arjun Roy <arjunroy@google.com>: mm/memory.c: properly pte_offset_map_lock/unlock in vm_insert_pages() Christophe Leroy <christophe.leroy@csgroup.eu>: mm/debug_vm_pgtable: fix build failure with powerpc 8xx Stephen Rothwell <sfr@canb.auug.org.au>: make asm-generic/cacheflush.h more standalone Nathan Chancellor <natechancellor@gmail.com>: media: omap3isp: remove cacheflush.h Subsystem: mm/vmalloc Masanari Iida <standby24x7@gmail.com>: mm/vmalloc.c: fix a warning while make xmldocs Subsystem: mm/memcg Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: handle div0 crash race condition in memory.low Muchun Song <songmuchun@bytedance.com>: mm/memcontrol.c: add missed css_put() Chris Down <chris@chrisdown.name>: mm/memcontrol.c: prevent missed memory.low load tears Subsystem: mm/gup Souptick Joarder <jrdr.linux@gmail.com>: docs: mm/gup: minor documentation update Subsystem: mm/thp Yang Shi <yang.shi@linux.alibaba.com>: doc: THP CoW fault no longer allocate THP Subsystem: mm/vmscan Johannes Weiner <hannes@cmpxchg.org>: Patch series "fix for "mm: balance LRU lists based on relative thrashing" patchset": mm: workingset: age nonresident information alongside anonymous pages Joonsoo Kim <iamjoonsoo.kim@lge.com>: mm/swap: fix for "mm: workingset: age nonresident information alongside anonymous pages" mm/memory: fix IO cost for anonymous page Subsystem: x86 Christoph Hellwig <hch@lst.de>: Patch series "fix a hyperv W^X violation and remove vmalloc_exec": x86/hyperv: allocate the hypercall page with only read and execute bits arm64: use PAGE_KERNEL_ROX directly in alloc_insn_page mm: remove vmalloc_exec Subsystem: mm/memory-hotplug Ben Widawsky <ben.widawsky@intel.com>: mm/memory_hotplug.c: fix false softlockup during pfn range removal Subsystem: MAINTAINERS Luc Van Oostenryck <luc.vanoostenryck@gmail.com>: MAINTAINERS: update info for sparse Documentation/admin-guide/cgroup-v2.rst | 4 +- Documentation/admin-guide/mm/transhuge.rst | 3 - Documentation/core-api/pin_user_pages.rst | 2 - MAINTAINERS | 4 +- arch/arm64/kernel/probes/kprobes.c | 12 +------ arch/openrisc/kernel/dma.c | 5 +++ arch/x86/hyperv/hv_init.c | 4 +- arch/x86/include/asm/pgtable_types.h | 2 + drivers/media/platform/omap3isp/isp.c | 2 - drivers/media/platform/omap3isp/ispvideo.c | 1 fs/ocfs2/dlmglue.c | 17 ++++++++++ fs/ocfs2/ocfs2.h | 1 fs/ocfs2/ocfs2_fs.h | 4 +- fs/ocfs2/suballoc.c | 9 +++-- include/asm-generic/cacheflush.h | 5 +++ include/linux/bits.h | 3 + include/linux/mmzone.h | 4 +- include/linux/swap.h | 1 include/linux/vmalloc.h | 1 kernel/kexec_file.c | 36 ++++------------------ kernel/module.c | 4 +- lib/test_hmm.c | 3 - mm/compaction.c | 17 ++++++++-- mm/debug_vm_pgtable.c | 4 +- mm/memcontrol.c | 18 ++++++++--- mm/memory.c | 33 +++++++++++++------- mm/memory_hotplug.c | 13 ++++++-- mm/nommu.c | 17 ---------- mm/slab.h | 4 +- mm/slab_common.c | 2 - mm/slub.c | 19 ++--------- mm/swap.c | 3 - mm/swap_state.c | 4 +- mm/vmalloc.c | 21 ------------- mm/vmscan.c | 3 + mm/workingset.c | 46 +++++++++++++++++------------ 36 files changed, 168 insertions(+), 163 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-06-26 3:28 incoming Andrew Morton @ 2020-06-26 6:51 ` Linus Torvalds 2020-06-26 7:31 ` incoming Linus Torvalds 2020-06-26 17:39 ` incoming Konstantin Ryabitsev 0 siblings, 2 replies; 348+ messages in thread From: Linus Torvalds @ 2020-06-26 6:51 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits On Thu, Jun 25, 2020 at 8:28 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a. You didn't cc lkml, so now none of the nice 'b4' automation seems to work for this series.. Yes, this cover-letter went to linux-mm (which is on lore), but the individual patches didn't. Konstantin, maybe mm-commits could be on lore too and then they'd have been caught that way? Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-06-26 6:51 ` incoming Linus Torvalds @ 2020-06-26 7:31 ` Linus Torvalds 2020-06-26 17:39 ` incoming Konstantin Ryabitsev 1 sibling, 0 replies; 348+ messages in thread From: Linus Torvalds @ 2020-06-26 7:31 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits On Thu, Jun 25, 2020 at 11:51 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > You didn't cc lkml, so now none of the nice 'b4' automation seems to > work for this series.. Note that I've picked them up the old-fashioned way, so don't re-send them. So more of a note for "please, next time..." Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-06-26 6:51 ` incoming Linus Torvalds 2020-06-26 7:31 ` incoming Linus Torvalds @ 2020-06-26 17:39 ` Konstantin Ryabitsev 2020-06-26 17:40 ` incoming Konstantin Ryabitsev 1 sibling, 1 reply; 348+ messages in thread From: Konstantin Ryabitsev @ 2020-06-26 17:39 UTC (permalink / raw) To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits On Thu, Jun 25, 2020 at 11:51:06PM -0700, Linus Torvalds wrote: > On Thu, Jun 25, 2020 at 8:28 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > 32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a. > > You didn't cc lkml, so now none of the nice 'b4' automation seems to > work for this series.. > > Yes, this cover-letter went to linux-mm (which is on lore), but the > individual patches didn't. > > Konstantin, maybe mm-commits could be on lore too and then they'd have > been caught that way? Yes, I already have a request from Kees for linux-mm addition, so that should show up in archives before long. -K ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-06-26 17:39 ` incoming Konstantin Ryabitsev @ 2020-06-26 17:40 ` Konstantin Ryabitsev 0 siblings, 0 replies; 348+ messages in thread From: Konstantin Ryabitsev @ 2020-06-26 17:40 UTC (permalink / raw) To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits On Fri, 26 Jun 2020 at 13:39, Konstantin Ryabitsev <konstantin@linuxfoundation.org> wrote: > > Konstantin, maybe mm-commits could be on lore too and then they'd have > > been caught that way? > > Yes, I already have a request from Kees for linux-mm addition, so that > should show up in archives before long. correction: mm-commits, that is -K ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-06-12 0:30 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-06-12 0:30 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits A few fixes and stragglers. 5 patches, based on 623f6dc593eaf98b91916836785278eddddaacf8. Subsystems affected by this patch series: mm/memory-failure ocfs2 lib/lzo misc Subsystem: mm/memory-failure Naoya Horiguchi <nao.horiguchi@gmail.com>: Patch series "hwpoison: fixes signaling on memory error": mm/memory-failure: prioritize prctl(PR_MCE_KILL) over vm.memory_failure_early_kill mm/memory-failure: send SIGBUS(BUS_MCEERR_AR) only to current thread Subsystem: ocfs2 Tom Seewald <tseewald@gmail.com>: ocfs2: fix build failure when TCP/IP is disabled Subsystem: lib/lzo Dave Rodgman <dave.rodgman@arm.com>: lib/lzo: fix ambiguous encoding bug in lzo-rle Subsystem: misc Christoph Hellwig <hch@lst.de>: amdgpu: a NULL ->mm does not mean a thread is a kthread Documentation/lzo.txt | 8 ++++- drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 2 - fs/ocfs2/Kconfig | 2 - lib/lzo/lzo1x_compress.c | 13 ++++++++ mm/memory-failure.c | 43 +++++++++++++++++------------ 5 files changed, 47 insertions(+), 21 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-06-11 1:40 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-06-11 1:40 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - various hotfixes and minor things - hch's use_mm/unuse_mm clearnups - new syscall process_madvise(): perform madvise() on a process other than self 25 patches, based on 6f630784cc0d92fb58ea326e2bc01aa056279ecb. Subsystems affected by this patch series: mm/hugetlb scripts kcov lib nilfs checkpatch lib mm/debug ocfs2 lib misc mm/madvise Subsystem: mm/hugetlb Dan Carpenter <dan.carpenter@oracle.com>: khugepaged: selftests: fix timeout condition in wait_for_scan() Subsystem: scripts SeongJae Park <sjpark@amazon.de>: scripts/spelling: add a few more typos Subsystem: kcov Andrey Konovalov <andreyknvl@google.com>: kcov: check kcov_softirq in kcov_remote_stop() Subsystem: lib Joe Perches <joe@perches.com>: lib/lz4/lz4_decompress.c: document deliberate use of `&' Subsystem: nilfs Ryusuke Konishi <konishi.ryusuke@gmail.com>: nilfs2: fix null pointer dereference at nilfs_segctor_do_construct() Subsystem: checkpatch Tim Froidcoeur <tim.froidcoeur@tessares.net>: checkpatch: correct check for kernel parameters doc Subsystem: lib Alexander Gordeev <agordeev@linux.ibm.com>: lib: fix bitmap_parse() on 64-bit big endian archs Subsystem: mm/debug "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/debug_vm_pgtable: fix kernel crash by checking for THP support Subsystem: ocfs2 Keyur Patel <iamkeyur96@gmail.com>: ocfs2: fix spelling mistake and grammar Ben Widawsky <ben.widawsky@intel.com>: mm: add comments on pglist_data zones Subsystem: lib Wei Yang <richard.weiyang@gmail.com>: lib: test get_count_order/long in test_bitops.c Subsystem: misc Walter Wu <walter-zh.wu@mediatek.com>: stacktrace: cleanup inconsistent variable type Christoph Hellwig <hch@lst.de>: Patch series "improve use_mm / unuse_mm", v2: kernel: move use_mm/unuse_mm to kthread.c kernel: move use_mm/unuse_mm to kthread.c kernel: better document the use_mm/unuse_mm API contract kernel: set USER_DS in kthread_use_mm Subsystem: mm/madvise Minchan Kim <minchan@kernel.org>: Patch series "introduce memory hinting API for external process", v7: mm/madvise: pass task and mm to do_madvise mm/madvise: introduce process_madvise() syscall: an external memory hinting API mm/madvise: check fatal signal pending of target process pid: move pidfd_get_pid() to pid.c mm/madvise: support both pid and pidfd for process_madvise Oleksandr Natalenko <oleksandr@redhat.com>: mm/madvise: allow KSM hints for remote API Minchan Kim <minchan@kernel.org>: mm: support vector address ranges for process_madvise mm: use only pidfd for process_madvise syscall YueHaibing <yuehaibing@huawei.com>: mm/madvise.c: remove duplicated include arch/alpha/kernel/syscalls/syscall.tbl | 1 arch/arm/tools/syscall.tbl | 1 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 4 arch/ia64/kernel/syscalls/syscall.tbl | 1 arch/m68k/kernel/syscalls/syscall.tbl | 1 arch/microblaze/kernel/syscalls/syscall.tbl | 1 arch/mips/kernel/syscalls/syscall_n32.tbl | 3 arch/mips/kernel/syscalls/syscall_n64.tbl | 1 arch/mips/kernel/syscalls/syscall_o32.tbl | 3 arch/parisc/kernel/syscalls/syscall.tbl | 3 arch/powerpc/kernel/syscalls/syscall.tbl | 3 arch/powerpc/platforms/powernv/vas-fault.c | 4 arch/s390/kernel/syscalls/syscall.tbl | 3 arch/sh/kernel/syscalls/syscall.tbl | 1 arch/sparc/kernel/syscalls/syscall.tbl | 3 arch/x86/entry/syscalls/syscall_32.tbl | 3 arch/x86/entry/syscalls/syscall_64.tbl | 5 arch/xtensa/kernel/syscalls/syscall.tbl | 1 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 5 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_arcturus.c | 1 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v10.c | 1 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v9.c | 2 drivers/gpu/drm/i915/gvt/kvmgt.c | 2 drivers/usb/gadget/function/f_fs.c | 10 drivers/usb/gadget/legacy/inode.c | 6 drivers/vfio/vfio_iommu_type1.c | 6 drivers/vhost/vhost.c | 8 fs/aio.c | 1 fs/io-wq.c | 15 - fs/io_uring.c | 11 fs/nilfs2/segment.c | 2 fs/ocfs2/mmap.c | 2 include/linux/compat.h | 10 include/linux/kthread.h | 9 include/linux/mm.h | 3 include/linux/mmu_context.h | 5 include/linux/mmzone.h | 14 include/linux/pid.h | 1 include/linux/stacktrace.h | 2 include/linux/syscalls.h | 16 - include/uapi/asm-generic/unistd.h | 7 kernel/exit.c | 17 - kernel/kcov.c | 26 + kernel/kthread.c | 95 +++++- kernel/pid.c | 17 + kernel/sys_ni.c | 2 lib/Kconfig.debug | 10 lib/bitmap.c | 9 lib/lz4/lz4_decompress.c | 3 lib/test_bitops.c | 53 +++ mm/Makefile | 2 mm/debug_vm_pgtable.c | 6 mm/madvise.c | 295 ++++++++++++++------ mm/mmu_context.c | 64 ---- mm/oom_kill.c | 6 mm/vmacache.c | 4 scripts/checkpatch.pl | 4 scripts/spelling.txt | 9 tools/testing/selftests/vm/khugepaged.c | 2 62 files changed, 526 insertions(+), 285 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-06-09 4:29 Andrew Morton 2020-06-09 16:58 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2020-06-09 4:29 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - a kernel-wide sweep of show_stack() - pagetable cleanups - abstract out accesses to mmap_sem - prep for mmap_sem scalability work - hch's user acess work 93 patches, based on abfbb29297c27e3f101f348dc9e467b0fe70f919: Subsystems affected by this patch series: debug mm/pagemap mm/maccess mm/documentation Subsystem: debug Dmitry Safonov <dima@arista.com>: Patch series "Add log level to show_stack()", v3: kallsyms/printk: add loglvl to print_ip_sym() alpha: add show_stack_loglvl() arc: add show_stack_loglvl() arm/asm: add loglvl to c_backtrace() arm: add loglvl to unwind_backtrace() arm: add loglvl to dump_backtrace() arm: wire up dump_backtrace_{entry,stm} arm: add show_stack_loglvl() arm64: add loglvl to dump_backtrace() arm64: add show_stack_loglvl() c6x: add show_stack_loglvl() csky: add show_stack_loglvl() h8300: add show_stack_loglvl() hexagon: add show_stack_loglvl() ia64: pass log level as arg into ia64_do_show_stack() ia64: add show_stack_loglvl() m68k: add show_stack_loglvl() microblaze: add loglvl to microblaze_unwind_inner() microblaze: add loglvl to microblaze_unwind() microblaze: add show_stack_loglvl() mips: add show_stack_loglvl() nds32: add show_stack_loglvl() nios2: add show_stack_loglvl() openrisc: add show_stack_loglvl() parisc: add show_stack_loglvl() powerpc: add show_stack_loglvl() riscv: add show_stack_loglvl() s390: add show_stack_loglvl() sh: add loglvl to dump_mem() sh: remove needless printk() sh: add loglvl to printk_address() sh: add loglvl to show_trace() sh: add show_stack_loglvl() sparc: add show_stack_loglvl() um/sysrq: remove needless variable sp um: add show_stack_loglvl() unicore32: remove unused pmode argument in c_backtrace() unicore32: add loglvl to c_backtrace() unicore32: add show_stack_loglvl() x86: add missing const qualifiers for log_lvl x86: add show_stack_loglvl() xtensa: add loglvl to show_trace() xtensa: add show_stack_loglvl() sysrq: use show_stack_loglvl() x86/amd_gart: print stacktrace for a leak with KERN_ERR power: use show_stack_loglvl() kdb: don't play with console_loglevel sched: print stack trace with KERN_INFO kernel: use show_stack_loglvl() kernel: rename show_stack_loglvl() => show_stack() Subsystem: mm/pagemap Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: consolidate definitions of page table accessors", v2: mm: don't include asm/pgtable.h if linux/mm.h is already included mm: introduce include/linux/pgtable.h mm: reorder includes after introduction of linux/pgtable.h csky: replace definitions of __pXd_offset() with pXd_index() m68k/mm/motorola: move comment about page table allocation funcitons m68k/mm: move {cache,nocahe}_page() definitions close to their user x86/mm: simplify init_trampoline() and surrounding logic mm: pgtable: add shortcuts for accessing kernel PMD and PTE mm: consolidate pte_index() and pte_offset_*() definitions Michel Lespinasse <walken@google.com>: mmap locking API: initial implementation as rwsem wrappers MMU notifier: use the new mmap locking API DMA reservations: use the new mmap locking API mmap locking API: use coccinelle to convert mmap_sem rwsem call sites mmap locking API: convert mmap_sem call sites missed by coccinelle mmap locking API: convert nested write lock sites mmap locking API: add mmap_read_trylock_non_owner() mmap locking API: add MMAP_LOCK_INITIALIZER mmap locking API: add mmap_assert_locked() and mmap_assert_write_locked() mmap locking API: rename mmap_sem to mmap_lock mmap locking API: convert mmap_sem API comments mmap locking API: convert mmap_sem comments Subsystem: mm/maccess Christoph Hellwig <hch@lst.de>: Patch series "clean up and streamline probe_kernel_* and friends", v4: maccess: unexport probe_kernel_write() maccess: remove various unused weak aliases maccess: remove duplicate kerneldoc comments maccess: clarify kerneldoc comments maccess: update the top of file comment maccess: rename strncpy_from_unsafe_user to strncpy_from_user_nofault maccess: rename strncpy_from_unsafe_strict to strncpy_from_kernel_nofault maccess: rename strnlen_unsafe_user to strnlen_user_nofault maccess: remove probe_read_common and probe_write_common maccess: unify the probe kernel arch hooks bpf: factor out a bpf_trace_copy_string helper bpf: handle the compat string in bpf_trace_copy_string better Andrew Morton <akpm@linux-foundation.org>: bpf:bpf_seq_printf(): handle potentially unsafe format string better Christoph Hellwig <hch@lst.de>: bpf: rework the compat kernel probe handling tracing/kprobes: handle mixed kernel/userspace probes better maccess: remove strncpy_from_unsafe maccess: always use strict semantics for probe_kernel_read maccess: move user access routines together maccess: allow architectures to provide kernel probing directly x86: use non-set_fs based maccess routines maccess: return -ERANGE when probe_kernel_read() fails Subsystem: mm/documentation Luis Chamberlain <mcgrof@kernel.org>: include/linux/cache.h: expand documentation over __read_mostly Documentation/admin-guide/mm/numa_memory_policy.rst | 10 Documentation/admin-guide/mm/userfaultfd.rst | 2 Documentation/filesystems/locking.rst | 2 Documentation/vm/hmm.rst | 6 Documentation/vm/transhuge.rst | 4 arch/alpha/boot/bootp.c | 1 arch/alpha/boot/bootpz.c | 1 arch/alpha/boot/main.c | 1 arch/alpha/include/asm/io.h | 1 arch/alpha/include/asm/pgtable.h | 16 arch/alpha/kernel/process.c | 1 arch/alpha/kernel/proto.h | 4 arch/alpha/kernel/ptrace.c | 1 arch/alpha/kernel/setup.c | 1 arch/alpha/kernel/smp.c | 1 arch/alpha/kernel/sys_alcor.c | 1 arch/alpha/kernel/sys_cabriolet.c | 1 arch/alpha/kernel/sys_dp264.c | 1 arch/alpha/kernel/sys_eb64p.c | 1 arch/alpha/kernel/sys_eiger.c | 1 arch/alpha/kernel/sys_jensen.c | 1 arch/alpha/kernel/sys_marvel.c | 1 arch/alpha/kernel/sys_miata.c | 1 arch/alpha/kernel/sys_mikasa.c | 1 arch/alpha/kernel/sys_nautilus.c | 1 arch/alpha/kernel/sys_noritake.c | 1 arch/alpha/kernel/sys_rawhide.c | 1 arch/alpha/kernel/sys_ruffian.c | 1 arch/alpha/kernel/sys_rx164.c | 1 arch/alpha/kernel/sys_sable.c | 1 arch/alpha/kernel/sys_sio.c | 1 arch/alpha/kernel/sys_sx164.c | 1 arch/alpha/kernel/sys_takara.c | 1 arch/alpha/kernel/sys_titan.c | 1 arch/alpha/kernel/sys_wildfire.c | 1 arch/alpha/kernel/traps.c | 40 arch/alpha/mm/fault.c | 12 arch/alpha/mm/init.c | 1 arch/arc/include/asm/bug.h | 3 arch/arc/include/asm/pgtable.h | 24 arch/arc/kernel/process.c | 4 arch/arc/kernel/stacktrace.c | 29 arch/arc/kernel/troubleshoot.c | 6 arch/arc/mm/fault.c | 6 arch/arc/mm/highmem.c | 14 arch/arc/mm/tlbex.S | 4 arch/arm/include/asm/bug.h | 3 arch/arm/include/asm/efi.h | 3 arch/arm/include/asm/fixmap.h | 4 arch/arm/include/asm/idmap.h | 2 arch/arm/include/asm/pgtable-2level.h | 1 arch/arm/include/asm/pgtable-3level.h | 7 arch/arm/include/asm/pgtable-nommu.h | 3 arch/arm/include/asm/pgtable.h | 25 arch/arm/include/asm/traps.h | 3 arch/arm/include/asm/unwind.h | 3 arch/arm/kernel/head.S | 4 arch/arm/kernel/machine_kexec.c | 1 arch/arm/kernel/module.c | 1 arch/arm/kernel/process.c | 4 arch/arm/kernel/ptrace.c | 1 arch/arm/kernel/smp.c | 1 arch/arm/kernel/suspend.c | 4 arch/arm/kernel/swp_emulate.c | 4 arch/arm/kernel/traps.c | 61 arch/arm/kernel/unwind.c | 7 arch/arm/kernel/vdso.c | 2 arch/arm/kernel/vmlinux.lds.S | 4 arch/arm/lib/backtrace-clang.S | 9 arch/arm/lib/backtrace.S | 14 arch/arm/lib/uaccess_with_memcpy.c | 16 arch/arm/mach-ebsa110/core.c | 1 arch/arm/mach-footbridge/common.c | 1 arch/arm/mach-imx/mm-imx21.c | 1 arch/arm/mach-imx/mm-imx27.c | 1 arch/arm/mach-imx/mm-imx3.c | 1 arch/arm/mach-integrator/core.c | 4 arch/arm/mach-iop32x/i2c.c | 1 arch/arm/mach-iop32x/iq31244.c | 1 arch/arm/mach-iop32x/iq80321.c | 1 arch/arm/mach-iop32x/n2100.c | 1 arch/arm/mach-ixp4xx/common.c | 1 arch/arm/mach-keystone/platsmp.c | 4 arch/arm/mach-sa1100/assabet.c | 3 arch/arm/mach-sa1100/hackkit.c | 4 arch/arm/mach-tegra/iomap.h | 2 arch/arm/mach-zynq/common.c | 4 arch/arm/mm/copypage-v4mc.c | 1 arch/arm/mm/copypage-v6.c | 1 arch/arm/mm/copypage-xscale.c | 1 arch/arm/mm/dump.c | 1 arch/arm/mm/fault-armv.c | 1 arch/arm/mm/fault.c | 9 arch/arm/mm/highmem.c | 4 arch/arm/mm/idmap.c | 4 arch/arm/mm/ioremap.c | 31 arch/arm/mm/mm.h | 8 arch/arm/mm/mmu.c | 7 arch/arm/mm/pageattr.c | 1 arch/arm/mm/proc-arm1020.S | 4 arch/arm/mm/proc-arm1020e.S | 4 arch/arm/mm/proc-arm1022.S | 4 arch/arm/mm/proc-arm1026.S | 4 arch/arm/mm/proc-arm720.S | 4 arch/arm/mm/proc-arm740.S | 4 arch/arm/mm/proc-arm7tdmi.S | 4 arch/arm/mm/proc-arm920.S | 4 arch/arm/mm/proc-arm922.S | 4 arch/arm/mm/proc-arm925.S | 4 arch/arm/mm/proc-arm926.S | 4 arch/arm/mm/proc-arm940.S | 4 arch/arm/mm/proc-arm946.S | 4 arch/arm/mm/proc-arm9tdmi.S | 4 arch/arm/mm/proc-fa526.S | 4 arch/arm/mm/proc-feroceon.S | 4 arch/arm/mm/proc-mohawk.S | 4 arch/arm/mm/proc-sa110.S | 4 arch/arm/mm/proc-sa1100.S | 4 arch/arm/mm/proc-v6.S | 4 arch/arm/mm/proc-v7.S | 4 arch/arm/mm/proc-xsc3.S | 4 arch/arm/mm/proc-xscale.S | 4 arch/arm/mm/pv-fixup-asm.S | 4 arch/arm64/include/asm/io.h | 4 arch/arm64/include/asm/kernel-pgtable.h | 2 arch/arm64/include/asm/kvm_mmu.h | 4 arch/arm64/include/asm/mmu_context.h | 4 arch/arm64/include/asm/pgtable.h | 40 arch/arm64/include/asm/stacktrace.h | 3 arch/arm64/include/asm/stage2_pgtable.h | 2 arch/arm64/include/asm/vmap_stack.h | 4 arch/arm64/kernel/acpi.c | 4 arch/arm64/kernel/head.S | 4 arch/arm64/kernel/hibernate.c | 5 arch/arm64/kernel/kaslr.c | 4 arch/arm64/kernel/process.c | 2 arch/arm64/kernel/ptrace.c | 1 arch/arm64/kernel/smp.c | 1 arch/arm64/kernel/suspend.c | 4 arch/arm64/kernel/traps.c | 37 arch/arm64/kernel/vdso.c | 8 arch/arm64/kernel/vmlinux.lds.S | 3 arch/arm64/kvm/mmu.c | 14 arch/arm64/mm/dump.c | 1 arch/arm64/mm/fault.c | 9 arch/arm64/mm/kasan_init.c | 3 arch/arm64/mm/mmu.c | 8 arch/arm64/mm/pageattr.c | 1 arch/arm64/mm/proc.S | 4 arch/c6x/include/asm/pgtable.h | 3 arch/c6x/kernel/traps.c | 28 arch/csky/include/asm/io.h | 2 arch/csky/include/asm/pgtable.h | 37 arch/csky/kernel/module.c | 1 arch/csky/kernel/ptrace.c | 5 arch/csky/kernel/stacktrace.c | 20 arch/csky/kernel/vdso.c | 4 arch/csky/mm/fault.c | 10 arch/csky/mm/highmem.c | 2 arch/csky/mm/init.c | 7 arch/csky/mm/tlb.c | 1 arch/h8300/include/asm/pgtable.h | 1 arch/h8300/kernel/process.c | 1 arch/h8300/kernel/setup.c | 1 arch/h8300/kernel/signal.c | 1 arch/h8300/kernel/traps.c | 26 arch/h8300/mm/fault.c | 1 arch/h8300/mm/init.c | 1 arch/h8300/mm/memory.c | 1 arch/hexagon/include/asm/fixmap.h | 4 arch/hexagon/include/asm/pgtable.h | 55 arch/hexagon/kernel/traps.c | 39 arch/hexagon/kernel/vdso.c | 4 arch/hexagon/mm/uaccess.c | 2 arch/hexagon/mm/vm_fault.c | 9 arch/ia64/include/asm/pgtable.h | 34 arch/ia64/include/asm/ptrace.h | 1 arch/ia64/include/asm/uaccess.h | 2 arch/ia64/kernel/efi.c | 1 arch/ia64/kernel/entry.S | 4 arch/ia64/kernel/head.S | 5 arch/ia64/kernel/irq_ia64.c | 4 arch/ia64/kernel/ivt.S | 4 arch/ia64/kernel/kprobes.c | 4 arch/ia64/kernel/mca.c | 2 arch/ia64/kernel/mca_asm.S | 4 arch/ia64/kernel/perfmon.c | 8 arch/ia64/kernel/process.c | 37 arch/ia64/kernel/ptrace.c | 1 arch/ia64/kernel/relocate_kernel.S | 6 arch/ia64/kernel/setup.c | 4 arch/ia64/kernel/smp.c | 1 arch/ia64/kernel/smpboot.c | 1 arch/ia64/kernel/uncached.c | 4 arch/ia64/kernel/vmlinux.lds.S | 4 arch/ia64/mm/contig.c | 1 arch/ia64/mm/fault.c | 17 arch/ia64/mm/init.c | 12 arch/m68k/68000/m68EZ328.c | 2 arch/m68k/68000/m68VZ328.c | 4 arch/m68k/68000/timers.c | 1 arch/m68k/amiga/config.c | 1 arch/m68k/apollo/config.c | 1 arch/m68k/atari/atasound.c | 1 arch/m68k/atari/stram.c | 1 arch/m68k/bvme6000/config.c | 1 arch/m68k/include/asm/mcf_pgtable.h | 63 arch/m68k/include/asm/motorola_pgalloc.h | 8 arch/m68k/include/asm/motorola_pgtable.h | 84 - arch/m68k/include/asm/pgtable_mm.h | 1 arch/m68k/include/asm/pgtable_no.h | 2 arch/m68k/include/asm/sun3_pgtable.h | 24 arch/m68k/include/asm/sun3xflop.h | 4 arch/m68k/kernel/head.S | 4 arch/m68k/kernel/process.c | 1 arch/m68k/kernel/ptrace.c | 1 arch/m68k/kernel/setup_no.c | 1 arch/m68k/kernel/signal.c | 1 arch/m68k/kernel/sys_m68k.c | 14 arch/m68k/kernel/traps.c | 27 arch/m68k/kernel/uboot.c | 1 arch/m68k/mac/config.c | 1 arch/m68k/mm/fault.c | 10 arch/m68k/mm/init.c | 2 arch/m68k/mm/mcfmmu.c | 1 arch/m68k/mm/motorola.c | 65 arch/m68k/mm/sun3kmap.c | 1 arch/m68k/mm/sun3mmu.c | 1 arch/m68k/mvme147/config.c | 1 arch/m68k/mvme16x/config.c | 1 arch/m68k/q40/config.c | 1 arch/m68k/sun3/config.c | 1 arch/m68k/sun3/dvma.c | 1 arch/m68k/sun3/mmu_emu.c | 1 arch/m68k/sun3/sun3dvma.c | 1 arch/m68k/sun3x/dvma.c | 1 arch/m68k/sun3x/prom.c | 1 arch/microblaze/include/asm/pgalloc.h | 4 arch/microblaze/include/asm/pgtable.h | 23 arch/microblaze/include/asm/uaccess.h | 2 arch/microblaze/include/asm/unwind.h | 3 arch/microblaze/kernel/hw_exception_handler.S | 4 arch/microblaze/kernel/module.c | 4 arch/microblaze/kernel/setup.c | 4 arch/microblaze/kernel/signal.c | 9 arch/microblaze/kernel/stacktrace.c | 4 arch/microblaze/kernel/traps.c | 28 arch/microblaze/kernel/unwind.c | 46 arch/microblaze/mm/fault.c | 17 arch/microblaze/mm/init.c | 9 arch/microblaze/mm/pgtable.c | 4 arch/mips/fw/arc/memory.c | 1 arch/mips/include/asm/fixmap.h | 3 arch/mips/include/asm/mach-generic/floppy.h | 1 arch/mips/include/asm/mach-jazz/floppy.h | 1 arch/mips/include/asm/pgtable-32.h | 22 arch/mips/include/asm/pgtable-64.h | 32 arch/mips/include/asm/pgtable.h | 2 arch/mips/jazz/irq.c | 4 arch/mips/jazz/jazzdma.c | 1 arch/mips/jazz/setup.c | 4 arch/mips/kernel/module.c | 1 arch/mips/kernel/process.c | 1 arch/mips/kernel/ptrace.c | 1 arch/mips/kernel/ptrace32.c | 1 arch/mips/kernel/smp-bmips.c | 1 arch/mips/kernel/traps.c | 58 arch/mips/kernel/vdso.c | 4 arch/mips/kvm/mips.c | 4 arch/mips/kvm/mmu.c | 20 arch/mips/kvm/tlb.c | 1 arch/mips/kvm/trap_emul.c | 2 arch/mips/lib/dump_tlb.c | 1 arch/mips/lib/r3k_dump_tlb.c | 1 arch/mips/mm/c-octeon.c | 1 arch/mips/mm/c-r3k.c | 11 arch/mips/mm/c-r4k.c | 11 arch/mips/mm/c-tx39.c | 11 arch/mips/mm/fault.c | 12 arch/mips/mm/highmem.c | 2 arch/mips/mm/init.c | 1 arch/mips/mm/page.c | 1 arch/mips/mm/pgtable-32.c | 1 arch/mips/mm/pgtable-64.c | 1 arch/mips/mm/sc-ip22.c | 1 arch/mips/mm/sc-mips.c | 1 arch/mips/mm/sc-r5k.c | 1 arch/mips/mm/tlb-r3k.c | 1 arch/mips/mm/tlb-r4k.c | 1 arch/mips/mm/tlbex.c | 4 arch/mips/sgi-ip27/ip27-init.c | 1 arch/mips/sgi-ip27/ip27-timer.c | 1 arch/mips/sgi-ip32/ip32-memory.c | 1 arch/nds32/include/asm/highmem.h | 3 arch/nds32/include/asm/pgtable.h | 22 arch/nds32/kernel/head.S | 4 arch/nds32/kernel/module.c | 2 arch/nds32/kernel/traps.c | 33 arch/nds32/kernel/vdso.c | 6 arch/nds32/mm/fault.c | 17 arch/nds32/mm/init.c | 13 arch/nds32/mm/proc.c | 7 arch/nios2/include/asm/pgtable.h | 24 arch/nios2/kernel/module.c | 1 arch/nios2/kernel/nios2_ksyms.c | 4 arch/nios2/kernel/traps.c | 35 arch/nios2/mm/fault.c | 14 arch/nios2/mm/init.c | 5 arch/nios2/mm/pgtable.c | 1 arch/nios2/mm/tlb.c | 1 arch/openrisc/include/asm/io.h | 3 arch/openrisc/include/asm/pgtable.h | 33 arch/openrisc/include/asm/tlbflush.h | 1 arch/openrisc/kernel/asm-offsets.c | 1 arch/openrisc/kernel/entry.S | 4 arch/openrisc/kernel/head.S | 4 arch/openrisc/kernel/or32_ksyms.c | 4 arch/openrisc/kernel/process.c | 1 arch/openrisc/kernel/ptrace.c | 1 arch/openrisc/kernel/setup.c | 1 arch/openrisc/kernel/traps.c | 27 arch/openrisc/mm/fault.c | 12 arch/openrisc/mm/init.c | 1 arch/openrisc/mm/ioremap.c | 4 arch/openrisc/mm/tlb.c | 1 arch/parisc/include/asm/io.h | 2 arch/parisc/include/asm/mmu_context.h | 1 arch/parisc/include/asm/pgtable.h | 33 arch/parisc/kernel/asm-offsets.c | 4 arch/parisc/kernel/entry.S | 4 arch/parisc/kernel/head.S | 4 arch/parisc/kernel/module.c | 1 arch/parisc/kernel/pacache.S | 4 arch/parisc/kernel/pci-dma.c | 2 arch/parisc/kernel/pdt.c | 4 arch/parisc/kernel/ptrace.c | 1 arch/parisc/kernel/smp.c | 1 arch/parisc/kernel/traps.c | 42 arch/parisc/lib/memcpy.c | 14 arch/parisc/mm/fault.c | 10 arch/parisc/mm/fixmap.c | 6 arch/parisc/mm/init.c | 1 arch/powerpc/include/asm/book3s/32/pgtable.h | 20 arch/powerpc/include/asm/book3s/64/pgtable.h | 43 arch/powerpc/include/asm/fixmap.h | 4 arch/powerpc/include/asm/io.h | 1 arch/powerpc/include/asm/kup.h | 2 arch/powerpc/include/asm/nohash/32/pgtable.h | 17 arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 4 arch/powerpc/include/asm/nohash/64/pgtable.h | 22 arch/powerpc/include/asm/nohash/pgtable.h | 2 arch/powerpc/include/asm/pgtable.h | 28 arch/powerpc/include/asm/pkeys.h | 2 arch/powerpc/include/asm/tlb.h | 2 arch/powerpc/kernel/asm-offsets.c | 1 arch/powerpc/kernel/btext.c | 4 arch/powerpc/kernel/fpu.S | 3 arch/powerpc/kernel/head_32.S | 4 arch/powerpc/kernel/head_40x.S | 4 arch/powerpc/kernel/head_44x.S | 4 arch/powerpc/kernel/head_8xx.S | 4 arch/powerpc/kernel/head_fsl_booke.S | 4 arch/powerpc/kernel/io-workarounds.c | 4 arch/powerpc/kernel/irq.c | 4 arch/powerpc/kernel/mce_power.c | 4 arch/powerpc/kernel/paca.c | 4 arch/powerpc/kernel/process.c | 30 arch/powerpc/kernel/prom.c | 4 arch/powerpc/kernel/prom_init.c | 4 arch/powerpc/kernel/rtas_pci.c | 4 arch/powerpc/kernel/setup-common.c | 4 arch/powerpc/kernel/setup_32.c | 4 arch/powerpc/kernel/setup_64.c | 4 arch/powerpc/kernel/signal_32.c | 1 arch/powerpc/kernel/signal_64.c | 1 arch/powerpc/kernel/smp.c | 4 arch/powerpc/kernel/stacktrace.c | 2 arch/powerpc/kernel/traps.c | 1 arch/powerpc/kernel/vdso.c | 7 arch/powerpc/kvm/book3s_64_mmu_radix.c | 4 arch/powerpc/kvm/book3s_hv.c | 6 arch/powerpc/kvm/book3s_hv_nested.c | 4 arch/powerpc/kvm/book3s_hv_rm_xics.c | 4 arch/powerpc/kvm/book3s_hv_rm_xive.c | 4 arch/powerpc/kvm/book3s_hv_uvmem.c | 18 arch/powerpc/kvm/e500_mmu_host.c | 4 arch/powerpc/kvm/fpu.S | 4 arch/powerpc/lib/code-patching.c | 1 arch/powerpc/mm/book3s32/hash_low.S | 4 arch/powerpc/mm/book3s32/mmu.c | 2 arch/powerpc/mm/book3s32/tlb.c | 6 arch/powerpc/mm/book3s64/hash_hugetlbpage.c | 1 arch/powerpc/mm/book3s64/hash_native.c | 4 arch/powerpc/mm/book3s64/hash_pgtable.c | 5 arch/powerpc/mm/book3s64/hash_utils.c | 4 arch/powerpc/mm/book3s64/iommu_api.c | 4 arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 1 arch/powerpc/mm/book3s64/radix_pgtable.c | 1 arch/powerpc/mm/book3s64/slb.c | 4 arch/powerpc/mm/book3s64/subpage_prot.c | 16 arch/powerpc/mm/copro_fault.c | 4 arch/powerpc/mm/fault.c | 23 arch/powerpc/mm/hugetlbpage.c | 1 arch/powerpc/mm/init-common.c | 4 arch/powerpc/mm/init_32.c | 1 arch/powerpc/mm/init_64.c | 1 arch/powerpc/mm/kasan/8xx.c | 4 arch/powerpc/mm/kasan/book3s_32.c | 2 arch/powerpc/mm/kasan/kasan_init_32.c | 8 arch/powerpc/mm/mem.c | 1 arch/powerpc/mm/nohash/40x.c | 5 arch/powerpc/mm/nohash/8xx.c | 2 arch/powerpc/mm/nohash/fsl_booke.c | 1 arch/powerpc/mm/nohash/tlb_low_64e.S | 4 arch/powerpc/mm/pgtable.c | 2 arch/powerpc/mm/pgtable_32.c | 5 arch/powerpc/mm/pgtable_64.c | 1 arch/powerpc/mm/ptdump/8xx.c | 2 arch/powerpc/mm/ptdump/bats.c | 4 arch/powerpc/mm/ptdump/book3s64.c | 2 arch/powerpc/mm/ptdump/hashpagetable.c | 1 arch/powerpc/mm/ptdump/ptdump.c | 1 arch/powerpc/mm/ptdump/shared.c | 2 arch/powerpc/oprofile/cell/spu_task_sync.c | 6 arch/powerpc/perf/callchain.c | 1 arch/powerpc/perf/callchain_32.c | 1 arch/powerpc/perf/callchain_64.c | 1 arch/powerpc/platforms/85xx/corenet_generic.c | 4 arch/powerpc/platforms/85xx/mpc85xx_cds.c | 4 arch/powerpc/platforms/85xx/qemu_e500.c | 4 arch/powerpc/platforms/85xx/sbc8548.c | 4 arch/powerpc/platforms/85xx/smp.c | 4 arch/powerpc/platforms/86xx/mpc86xx_smp.c | 4 arch/powerpc/platforms/8xx/cpm1.c | 1 arch/powerpc/platforms/8xx/micropatch.c | 1 arch/powerpc/platforms/cell/cbe_regs.c | 4 arch/powerpc/platforms/cell/interrupt.c | 4 arch/powerpc/platforms/cell/pervasive.c | 4 arch/powerpc/platforms/cell/setup.c | 1 arch/powerpc/platforms/cell/smp.c | 4 arch/powerpc/platforms/cell/spider-pic.c | 4 arch/powerpc/platforms/cell/spufs/file.c | 10 arch/powerpc/platforms/chrp/pci.c | 4 arch/powerpc/platforms/chrp/setup.c | 1 arch/powerpc/platforms/chrp/smp.c | 4 arch/powerpc/platforms/maple/setup.c | 1 arch/powerpc/platforms/maple/time.c | 1 arch/powerpc/platforms/powermac/setup.c | 1 arch/powerpc/platforms/powermac/smp.c | 4 arch/powerpc/platforms/powermac/time.c | 1 arch/powerpc/platforms/pseries/lpar.c | 4 arch/powerpc/platforms/pseries/setup.c | 1 arch/powerpc/platforms/pseries/smp.c | 4 arch/powerpc/sysdev/cpm2.c | 1 arch/powerpc/sysdev/fsl_85xx_cache_sram.c | 2 arch/powerpc/sysdev/mpic.c | 4 arch/powerpc/xmon/xmon.c | 1 arch/riscv/include/asm/fixmap.h | 4 arch/riscv/include/asm/io.h | 4 arch/riscv/include/asm/kasan.h | 4 arch/riscv/include/asm/pgtable-64.h | 7 arch/riscv/include/asm/pgtable.h | 22 arch/riscv/kernel/module.c | 2 arch/riscv/kernel/setup.c | 1 arch/riscv/kernel/soc.c | 2 arch/riscv/kernel/stacktrace.c | 23 arch/riscv/kernel/vdso.c | 4 arch/riscv/mm/cacheflush.c | 3 arch/riscv/mm/fault.c | 14 arch/riscv/mm/init.c | 31 arch/riscv/mm/kasan_init.c | 4 arch/riscv/mm/pageattr.c | 6 arch/riscv/mm/ptdump.c | 2 arch/s390/boot/ipl_parm.c | 4 arch/s390/boot/kaslr.c | 4 arch/s390/include/asm/hugetlb.h | 4 arch/s390/include/asm/kasan.h | 4 arch/s390/include/asm/pgtable.h | 15 arch/s390/include/asm/tlbflush.h | 1 arch/s390/kernel/asm-offsets.c | 4 arch/s390/kernel/dumpstack.c | 25 arch/s390/kernel/machine_kexec.c | 1 arch/s390/kernel/ptrace.c | 1 arch/s390/kernel/uv.c | 4 arch/s390/kernel/vdso.c | 5 arch/s390/kvm/gaccess.c | 8 arch/s390/kvm/interrupt.c | 4 arch/s390/kvm/kvm-s390.c | 32 arch/s390/kvm/priv.c | 38 arch/s390/mm/dump_pagetables.c | 1 arch/s390/mm/extmem.c | 4 arch/s390/mm/fault.c | 17 arch/s390/mm/gmap.c | 80 arch/s390/mm/init.c | 1 arch/s390/mm/kasan_init.c | 4 arch/s390/mm/pageattr.c | 13 arch/s390/mm/pgalloc.c | 2 arch/s390/mm/pgtable.c | 1 arch/s390/mm/vmem.c | 1 arch/s390/pci/pci_mmio.c | 4 arch/sh/include/asm/io.h | 2 arch/sh/include/asm/kdebug.h | 6 arch/sh/include/asm/pgtable-3level.h | 7 arch/sh/include/asm/pgtable.h | 2 arch/sh/include/asm/pgtable_32.h | 25 arch/sh/include/asm/processor_32.h | 2 arch/sh/kernel/dumpstack.c | 54 arch/sh/kernel/machine_kexec.c | 1 arch/sh/kernel/process_32.c | 2 arch/sh/kernel/ptrace_32.c | 1 arch/sh/kernel/signal_32.c | 1 arch/sh/kernel/sys_sh.c | 6 arch/sh/kernel/traps.c | 4 arch/sh/kernel/vsyscall/vsyscall.c | 4 arch/sh/mm/cache-sh3.c | 1 arch/sh/mm/cache-sh4.c | 11 arch/sh/mm/cache-sh7705.c | 1 arch/sh/mm/fault.c | 16 arch/sh/mm/kmap.c | 5 arch/sh/mm/nommu.c | 1 arch/sh/mm/pmb.c | 4 arch/sparc/include/asm/floppy_32.h | 4 arch/sparc/include/asm/highmem.h | 4 arch/sparc/include/asm/ide.h | 2 arch/sparc/include/asm/io-unit.h | 4 arch/sparc/include/asm/pgalloc_32.h | 4 arch/sparc/include/asm/pgalloc_64.h | 2 arch/sparc/include/asm/pgtable_32.h | 34 arch/sparc/include/asm/pgtable_64.h | 32 arch/sparc/kernel/cpu.c | 4 arch/sparc/kernel/entry.S | 4 arch/sparc/kernel/head_64.S | 4 arch/sparc/kernel/ktlb.S | 4 arch/sparc/kernel/leon_smp.c | 1 arch/sparc/kernel/pci.c | 4 arch/sparc/kernel/process_32.c | 29 arch/sparc/kernel/process_64.c | 3 arch/sparc/kernel/ptrace_32.c | 1 arch/sparc/kernel/ptrace_64.c | 1 arch/sparc/kernel/setup_32.c | 1 arch/sparc/kernel/setup_64.c | 1 arch/sparc/kernel/signal32.c | 1 arch/sparc/kernel/signal_32.c | 1 arch/sparc/kernel/signal_64.c | 1 arch/sparc/kernel/smp_32.c | 1 arch/sparc/kernel/smp_64.c | 1 arch/sparc/kernel/sun4m_irq.c | 4 arch/sparc/kernel/trampoline_64.S | 4 arch/sparc/kernel/traps_32.c | 4 arch/sparc/kernel/traps_64.c | 24 arch/sparc/lib/clear_page.S | 4 arch/sparc/lib/copy_page.S | 2 arch/sparc/mm/fault_32.c | 21 arch/sparc/mm/fault_64.c | 17 arch/sparc/mm/highmem.c | 12 arch/sparc/mm/hugetlbpage.c | 1 arch/sparc/mm/init_32.c | 1 arch/sparc/mm/init_64.c | 7 arch/sparc/mm/io-unit.c | 11 arch/sparc/mm/iommu.c | 9 arch/sparc/mm/tlb.c | 1 arch/sparc/mm/tsb.c | 4 arch/sparc/mm/ultra.S | 4 arch/sparc/vdso/vma.c | 4 arch/um/drivers/mconsole_kern.c | 2 arch/um/include/asm/mmu_context.h | 5 arch/um/include/asm/pgtable-3level.h | 4 arch/um/include/asm/pgtable.h | 69 arch/um/kernel/maccess.c | 12 arch/um/kernel/mem.c | 10 arch/um/kernel/process.c | 1 arch/um/kernel/skas/mmu.c | 3 arch/um/kernel/skas/uaccess.c | 1 arch/um/kernel/sysrq.c | 35 arch/um/kernel/tlb.c | 5 arch/um/kernel/trap.c | 15 arch/um/kernel/um_arch.c | 1 arch/unicore32/include/asm/pgtable.h | 19 arch/unicore32/kernel/hibernate.c | 4 arch/unicore32/kernel/hibernate_asm.S | 4 arch/unicore32/kernel/module.c | 1 arch/unicore32/kernel/setup.h | 4 arch/unicore32/kernel/traps.c | 50 arch/unicore32/lib/backtrace.S | 24 arch/unicore32/mm/alignment.c | 4 arch/unicore32/mm/fault.c | 9 arch/unicore32/mm/mm.h | 10 arch/unicore32/mm/proc-ucv2.S | 4 arch/x86/boot/compressed/kaslr_64.c | 4 arch/x86/entry/vdso/vma.c | 14 arch/x86/events/core.c | 4 arch/x86/include/asm/agp.h | 2 arch/x86/include/asm/asm-prototypes.h | 4 arch/x86/include/asm/efi.h | 4 arch/x86/include/asm/iomap.h | 1 arch/x86/include/asm/kaslr.h | 2 arch/x86/include/asm/mmu.h | 2 arch/x86/include/asm/pgtable-3level.h | 8 arch/x86/include/asm/pgtable.h | 89 - arch/x86/include/asm/pgtable_32.h | 11 arch/x86/include/asm/pgtable_64.h | 4 arch/x86/include/asm/setup.h | 12 arch/x86/include/asm/stacktrace.h | 2 arch/x86/include/asm/uaccess.h | 16 arch/x86/include/asm/xen/hypercall.h | 4 arch/x86/include/asm/xen/page.h | 1 arch/x86/kernel/acpi/boot.c | 4 arch/x86/kernel/acpi/sleep.c | 4 arch/x86/kernel/alternative.c | 1 arch/x86/kernel/amd_gart_64.c | 5 arch/x86/kernel/apic/apic_numachip.c | 4 arch/x86/kernel/cpu/bugs.c | 4 arch/x86/kernel/cpu/common.c | 4 arch/x86/kernel/cpu/intel.c | 4 arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 6 arch/x86/kernel/cpu/resctrl/rdtgroup.c | 6 arch/x86/kernel/crash_core_32.c | 4 arch/x86/kernel/crash_core_64.c | 4 arch/x86/kernel/doublefault_32.c | 1 arch/x86/kernel/dumpstack.c | 21 arch/x86/kernel/early_printk.c | 4 arch/x86/kernel/espfix_64.c | 2 arch/x86/kernel/head64.c | 4 arch/x86/kernel/head_64.S | 4 arch/x86/kernel/i8259.c | 4 arch/x86/kernel/irqinit.c | 4 arch/x86/kernel/kprobes/core.c | 4 arch/x86/kernel/kprobes/opt.c | 4 arch/x86/kernel/ldt.c | 2 arch/x86/kernel/machine_kexec_32.c | 1 arch/x86/kernel/machine_kexec_64.c | 1 arch/x86/kernel/module.c | 1 arch/x86/kernel/paravirt.c | 4 arch/x86/kernel/process_32.c | 1 arch/x86/kernel/process_64.c | 1 arch/x86/kernel/ptrace.c | 1 arch/x86/kernel/reboot.c | 4 arch/x86/kernel/smpboot.c | 4 arch/x86/kernel/tboot.c | 3 arch/x86/kernel/vm86_32.c | 4 arch/x86/kvm/mmu/paging_tmpl.h | 8 arch/x86/mm/cpu_entry_area.c | 4 arch/x86/mm/debug_pagetables.c | 2 arch/x86/mm/dump_pagetables.c | 1 arch/x86/mm/fault.c | 22 arch/x86/mm/init.c | 22 arch/x86/mm/init_32.c | 27 arch/x86/mm/init_64.c | 1 arch/x86/mm/ioremap.c | 4 arch/x86/mm/kasan_init_64.c | 1 arch/x86/mm/kaslr.c | 37 arch/x86/mm/maccess.c | 44 arch/x86/mm/mem_encrypt_boot.S | 2 arch/x86/mm/mmio-mod.c | 4 arch/x86/mm/pat/cpa-test.c | 1 arch/x86/mm/pat/memtype.c | 1 arch/x86/mm/pat/memtype_interval.c | 4 arch/x86/mm/pgtable.c | 1 arch/x86/mm/pgtable_32.c | 1 arch/x86/mm/pti.c | 1 arch/x86/mm/setup_nx.c | 4 arch/x86/platform/efi/efi_32.c | 4 arch/x86/platform/efi/efi_64.c | 1 arch/x86/platform/olpc/olpc_ofw.c | 4 arch/x86/power/cpu.c | 4 arch/x86/power/hibernate.c | 4 arch/x86/power/hibernate_32.c | 4 arch/x86/power/hibernate_64.c | 4 arch/x86/realmode/init.c | 4 arch/x86/um/vdso/vma.c | 4 arch/x86/xen/enlighten_pv.c | 1 arch/x86/xen/grant-table.c | 1 arch/x86/xen/mmu_pv.c | 4 arch/x86/xen/smp_pv.c | 2 arch/xtensa/include/asm/fixmap.h | 12 arch/xtensa/include/asm/highmem.h | 4 arch/xtensa/include/asm/initialize_mmu.h | 2 arch/xtensa/include/asm/mmu_context.h | 4 arch/xtensa/include/asm/pgtable.h | 20 arch/xtensa/kernel/entry.S | 4 arch/xtensa/kernel/process.c | 1 arch/xtensa/kernel/ptrace.c | 1 arch/xtensa/kernel/setup.c | 1 arch/xtensa/kernel/traps.c | 42 arch/xtensa/kernel/vectors.S | 4 arch/xtensa/mm/cache.c | 4 arch/xtensa/mm/fault.c | 12 arch/xtensa/mm/highmem.c | 2 arch/xtensa/mm/ioremap.c | 4 arch/xtensa/mm/kasan_init.c | 10 arch/xtensa/mm/misc.S | 4 arch/xtensa/mm/mmu.c | 5 drivers/acpi/scan.c | 3 drivers/android/binder_alloc.c | 14 drivers/atm/fore200e.c | 4 drivers/base/power/main.c | 4 drivers/block/z2ram.c | 4 drivers/char/agp/frontend.c | 1 drivers/char/agp/generic.c | 1 drivers/char/bsr.c | 1 drivers/char/mspec.c | 3 drivers/dma-buf/dma-resv.c | 5 drivers/firmware/efi/arm-runtime.c | 4 drivers/firmware/efi/efi.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gpuvm.c | 4 drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c | 10 drivers/gpu/drm/amd/amdkfd/kfd_events.c | 4 drivers/gpu/drm/drm_vm.c | 4 drivers/gpu/drm/etnaviv/etnaviv_gem.c | 2 drivers/gpu/drm/i915/gem/i915_gem_mman.c | 4 drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 14 drivers/gpu/drm/i915/i915_mm.c | 1 drivers/gpu/drm/i915/i915_perf.c | 2 drivers/gpu/drm/nouveau/nouveau_svm.c | 22 drivers/gpu/drm/radeon/radeon_cs.c | 4 drivers/gpu/drm/radeon/radeon_gem.c | 6 drivers/gpu/drm/ttm/ttm_bo_vm.c | 10 drivers/infiniband/core/umem_odp.c | 4 drivers/infiniband/core/uverbs_main.c | 6 drivers/infiniband/hw/hfi1/mmu_rb.c | 2 drivers/infiniband/hw/mlx4/mr.c | 4 drivers/infiniband/hw/qib/qib_file_ops.c | 4 drivers/infiniband/hw/qib/qib_user_pages.c | 6 drivers/infiniband/hw/usnic/usnic_uiom.c | 4 drivers/infiniband/sw/rdmavt/mmap.c | 1 drivers/infiniband/sw/rxe/rxe_mmap.c | 1 drivers/infiniband/sw/siw/siw_mem.c | 4 drivers/iommu/amd_iommu_v2.c | 4 drivers/iommu/intel-svm.c | 4 drivers/macintosh/macio-adb.c | 4 drivers/macintosh/mediabay.c | 4 drivers/macintosh/via-pmu.c | 4 drivers/media/pci/bt8xx/bt878.c | 4 drivers/media/pci/bt8xx/btcx-risc.c | 4 drivers/media/pci/bt8xx/bttv-risc.c | 4 drivers/media/platform/davinci/vpbe_display.c | 1 drivers/media/v4l2-core/v4l2-common.c | 1 drivers/media/v4l2-core/videobuf-core.c | 4 drivers/media/v4l2-core/videobuf-dma-contig.c | 4 drivers/media/v4l2-core/videobuf-dma-sg.c | 10 drivers/media/v4l2-core/videobuf-vmalloc.c | 4 drivers/misc/cxl/cxllib.c | 9 drivers/misc/cxl/fault.c | 4 drivers/misc/genwqe/card_utils.c | 2 drivers/misc/sgi-gru/grufault.c | 25 drivers/misc/sgi-gru/grufile.c | 4 drivers/mtd/ubi/ubi.h | 2 drivers/net/ethernet/amd/7990.c | 4 drivers/net/ethernet/amd/hplance.c | 4 drivers/net/ethernet/amd/mvme147.c | 4 drivers/net/ethernet/amd/sun3lance.c | 4 drivers/net/ethernet/amd/sunlance.c | 4 drivers/net/ethernet/apple/bmac.c | 4 drivers/net/ethernet/apple/mace.c | 4 drivers/net/ethernet/freescale/fs_enet/fs_enet-main.c | 4 drivers/net/ethernet/freescale/fs_enet/mac-fcc.c | 4 drivers/net/ethernet/freescale/fs_enet/mii-fec.c | 4 drivers/net/ethernet/i825xx/82596.c | 4 drivers/net/ethernet/korina.c | 4 drivers/net/ethernet/marvell/pxa168_eth.c | 4 drivers/net/ethernet/natsemi/jazzsonic.c | 4 drivers/net/ethernet/natsemi/macsonic.c | 4 drivers/net/ethernet/natsemi/xtsonic.c | 4 drivers/net/ethernet/sun/sunbmac.c | 4 drivers/net/ethernet/sun/sunhme.c | 1 drivers/net/ethernet/sun/sunqe.c | 4 drivers/oprofile/buffer_sync.c | 12 drivers/sbus/char/flash.c | 1 drivers/sbus/char/uctrl.c | 1 drivers/scsi/53c700.c | 4 drivers/scsi/a2091.c | 1 drivers/scsi/a3000.c | 1 drivers/scsi/arm/cumana_2.c | 4 drivers/scsi/arm/eesox.c | 4 drivers/scsi/arm/powertec.c | 4 drivers/scsi/dpt_i2o.c | 4 drivers/scsi/gvp11.c | 1 drivers/scsi/lasi700.c | 1 drivers/scsi/mac53c94.c | 4 drivers/scsi/mesh.c | 4 drivers/scsi/mvme147.c | 1 drivers/scsi/qlogicpti.c | 4 drivers/scsi/sni_53c710.c | 1 drivers/scsi/zorro_esp.c | 4 drivers/staging/android/ashmem.c | 4 drivers/staging/comedi/comedi_fops.c | 2 drivers/staging/kpc2000/kpc_dma/fileops.c | 4 drivers/staging/media/atomisp/pci/hmm/hmm_bo.c | 4 drivers/tee/optee/call.c | 4 drivers/tty/sysrq.c | 4 drivers/tty/vt/consolemap.c | 2 drivers/vfio/pci/vfio_pci.c | 22 drivers/vfio/vfio_iommu_type1.c | 8 drivers/vhost/vdpa.c | 4 drivers/video/console/newport_con.c | 1 drivers/video/fbdev/acornfb.c | 1 drivers/video/fbdev/atafb.c | 1 drivers/video/fbdev/cirrusfb.c | 1 drivers/video/fbdev/cyber2000fb.c | 1 drivers/video/fbdev/fb-puv3.c | 1 drivers/video/fbdev/hitfb.c | 1 drivers/video/fbdev/neofb.c | 1 drivers/video/fbdev/q40fb.c | 1 drivers/video/fbdev/savage/savagefb_driver.c | 1 drivers/xen/balloon.c | 1 drivers/xen/gntdev.c | 6 drivers/xen/grant-table.c | 1 drivers/xen/privcmd.c | 15 drivers/xen/xenbus/xenbus_probe.c | 1 drivers/xen/xenbus/xenbus_probe_backend.c | 1 drivers/xen/xenbus/xenbus_probe_frontend.c | 1 fs/aio.c | 4 fs/coredump.c | 8 fs/exec.c | 18 fs/ext2/file.c | 2 fs/ext4/super.c | 6 fs/hugetlbfs/inode.c | 2 fs/io_uring.c | 4 fs/kernfs/file.c | 4 fs/proc/array.c | 1 fs/proc/base.c | 24 fs/proc/meminfo.c | 1 fs/proc/nommu.c | 1 fs/proc/task_mmu.c | 34 fs/proc/task_nommu.c | 18 fs/proc/vmcore.c | 1 fs/userfaultfd.c | 46 fs/xfs/xfs_file.c | 2 fs/xfs/xfs_inode.c | 14 fs/xfs/xfs_iops.c | 4 include/asm-generic/io.h | 2 include/asm-generic/pgtable-nopmd.h | 1 include/asm-generic/pgtable-nopud.h | 1 include/asm-generic/pgtable.h | 1322 ---------------- include/linux/cache.h | 10 include/linux/crash_dump.h | 3 include/linux/dax.h | 1 include/linux/dma-noncoherent.h | 2 include/linux/fs.h | 4 include/linux/hmm.h | 2 include/linux/huge_mm.h | 2 include/linux/hugetlb.h | 2 include/linux/io-mapping.h | 4 include/linux/kallsyms.h | 4 include/linux/kasan.h | 4 include/linux/mempolicy.h | 2 include/linux/mm.h | 15 include/linux/mm_types.h | 4 include/linux/mmap_lock.h | 128 + include/linux/mmu_notifier.h | 13 include/linux/pagemap.h | 2 include/linux/pgtable.h | 1444 +++++++++++++++++- include/linux/rmap.h | 2 include/linux/sched/debug.h | 7 include/linux/sched/mm.h | 10 include/linux/uaccess.h | 62 include/xen/arm/page.h | 4 init/init_task.c | 1 ipc/shm.c | 8 kernel/acct.c | 6 kernel/bpf/stackmap.c | 21 kernel/bpf/syscall.c | 2 kernel/cgroup/cpuset.c | 4 kernel/debug/kdb/kdb_bt.c | 17 kernel/events/core.c | 10 kernel/events/uprobes.c | 20 kernel/exit.c | 11 kernel/fork.c | 15 kernel/futex.c | 4 kernel/locking/lockdep.c | 4 kernel/locking/rtmutex-debug.c | 4 kernel/power/snapshot.c | 1 kernel/relay.c | 2 kernel/sched/core.c | 10 kernel/sched/fair.c | 4 kernel/sys.c | 22 kernel/trace/bpf_trace.c | 176 +- kernel/trace/ftrace.c | 8 kernel/trace/trace_kprobe.c | 80 kernel/trace/trace_output.c | 4 lib/dump_stack.c | 4 lib/ioremap.c | 1 lib/test_hmm.c | 14 lib/test_lockup.c | 16 mm/debug.c | 10 mm/debug_vm_pgtable.c | 1 mm/filemap.c | 46 mm/frame_vector.c | 6 mm/gup.c | 73 mm/hmm.c | 2 mm/huge_memory.c | 8 mm/hugetlb.c | 3 mm/init-mm.c | 6 mm/internal.h | 6 mm/khugepaged.c | 72 mm/ksm.c | 48 mm/maccess.c | 496 +++--- mm/madvise.c | 40 mm/memcontrol.c | 10 mm/memory.c | 61 mm/mempolicy.c | 36 mm/migrate.c | 16 mm/mincore.c | 8 mm/mlock.c | 22 mm/mmap.c | 74 mm/mmu_gather.c | 2 mm/mmu_notifier.c | 22 mm/mprotect.c | 22 mm/mremap.c | 14 mm/msync.c | 8 mm/nommu.c | 22 mm/oom_kill.c | 14 mm/page_io.c | 1 mm/page_reporting.h | 2 mm/pagewalk.c | 12 mm/pgtable-generic.c | 6 mm/process_vm_access.c | 4 mm/ptdump.c | 4 mm/rmap.c | 12 mm/shmem.c | 5 mm/sparse-vmemmap.c | 1 mm/sparse.c | 1 mm/swap_state.c | 5 mm/swapfile.c | 5 mm/userfaultfd.c | 26 mm/util.c | 12 mm/vmacache.c | 1 mm/zsmalloc.c | 4 net/ipv4/tcp.c | 8 net/xdp/xdp_umem.c | 4 security/keys/keyctl.c | 2 sound/core/oss/pcm_oss.c | 2 sound/core/sgbuf.c | 1 sound/pci/hda/hda_intel.c | 4 sound/soc/intel/common/sst-firmware.c | 4 sound/soc/intel/haswell/sst-haswell-pcm.c | 4 tools/include/linux/kallsyms.h | 2 virt/kvm/async_pf.c | 4 virt/kvm/kvm_main.c | 9 942 files changed, 4580 insertions(+), 5662 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-06-09 4:29 incoming Andrew Morton @ 2020-06-09 16:58 ` Linus Torvalds 0 siblings, 0 replies; 348+ messages in thread From: Linus Torvalds @ 2020-06-09 16:58 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Mon, Jun 8, 2020 at 9:29 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 942 files changed, 4580 insertions(+), 5662 deletions(-) If you use proper tools, add a "-M" to your diff script, so that you see 941 files changed, 2614 insertions(+), 3696 deletions(-) because a big portion of the lines were due to a rename: rename include/{asm-generic => linux}/pgtable.h (91%) but at some earlier point you mentioned "diffstat", so I guess "proper tools" isn't an option ;( Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-06-08 4:35 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-06-08 4:35 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm Various trees. Mainly those parts of MM whose linux-next dependents are now merged. I'm still sitting on ~160 patches which await merges from -next. 54 patches, based on 9aa900c8094dba7a60dc805ecec1e9f720744ba1. Subsystems affected by this patch series: mm/proc ipc dynamic-debug panic lib sysctl mm/gup mm/pagemap Subsystem: mm/proc SeongJae Park <sjpark@amazon.de>: mm/page_idle.c: skip offline pages Subsystem: ipc Jules Irenge <jbi.octave@gmail.com>: ipc/msg: add missing annotation for freeque() Giuseppe Scrivano <gscrivan@redhat.com>: ipc/namespace.c: use a work queue to free_ipc Subsystem: dynamic-debug Orson Zhai <orson.zhai@unisoc.com>: dynamic_debug: add an option to enable dynamic debug for modules only Subsystem: panic Rafael Aquini <aquini@redhat.com>: kernel: add panic_on_taint Subsystem: lib Manfred Spraul <manfred@colorfullife.com>: xarray.h: correct return code documentation for xa_store_{bh,irq}() Subsystem: sysctl Vlastimil Babka <vbabka@suse.cz>: Patch series "support setting sysctl parameters from kernel command line", v3: kernel/sysctl: support setting sysctl parameters from kernel command line kernel/sysctl: support handling command line aliases kernel/hung_task convert hung_task_panic boot parameter to sysctl tools/testing/selftests/sysctl/sysctl.sh: support CONFIG_TEST_SYSCTL=y lib/test_sysctl: support testing of sysctl. boot parameter "Guilherme G. Piccoli" <gpiccoli@canonical.com>: kernel/watchdog.c: convert {soft/hard}lockup boot parameters to sysctl aliases kernel/hung_task.c: introduce sysctl to print all traces when a hung task is detected panic: add sysctl to dump all CPUs backtraces on oops event Rafael Aquini <aquini@redhat.com>: kernel/sysctl.c: ignore out-of-range taint bits introduced via kernel.tainted Subsystem: mm/gup Souptick Joarder <jrdr.linux@gmail.com>: mm/gup.c: convert to use get_user_{page|pages}_fast_only() John Hubbard <jhubbard@nvidia.com>: mm/gup: update pin_user_pages.rst for "case 3" (mmu notifiers) Patch series "mm/gup: introduce pin_user_pages_locked(), use it in frame_vector.c", v2: mm/gup: introduce pin_user_pages_locked() mm/gup: frame_vector: convert get_user_pages() --> pin_user_pages() mm/gup: documentation fix for pin_user_pages*() APIs Patch series "vhost, docs: convert to pin_user_pages(), new "case 5"": docs: mm/gup: pin_user_pages.rst: add a "case 5" vhost: convert get_user_pages() --> pin_user_pages() Subsystem: mm/pagemap Alexander Gordeev <agordeev@linux.ibm.com>: mm/mmap.c: add more sanity checks to get_unmapped_area() mm/mmap.c: do not allow mappings outside of allowed limits Christoph Hellwig <hch@lst.de>: Patch series "sort out the flush_icache_range mess", v2: arm: fix the flush_icache_range arguments in set_fiq_handler nds32: unexport flush_icache_page powerpc: unexport flush_icache_user_range unicore32: remove flush_cache_user_range asm-generic: fix the inclusion guards for cacheflush.h asm-generic: don't include <linux/mm.h> in cacheflush.h asm-generic: improve the flush_dcache_page stub alpha: use asm-generic/cacheflush.h arm64: use asm-generic/cacheflush.h c6x: use asm-generic/cacheflush.h hexagon: use asm-generic/cacheflush.h ia64: use asm-generic/cacheflush.h microblaze: use asm-generic/cacheflush.h m68knommu: use asm-generic/cacheflush.h openrisc: use asm-generic/cacheflush.h powerpc: use asm-generic/cacheflush.h riscv: use asm-generic/cacheflush.h arm,sparc,unicore32: remove flush_icache_user_range mm: rename flush_icache_user_range to flush_icache_user_page asm-generic: add a flush_icache_user_range stub sh: implement flush_icache_user_range xtensa: implement flush_icache_user_range arm: rename flush_cache_user_range to flush_icache_user_range m68k: implement flush_icache_user_range exec: only build read_code when needed exec: use flush_icache_user_range in read_code binfmt_flat: use flush_icache_user_range nommu: use flush_icache_user_range in brk and mmap module: move the set_fs hack for flush_icache_range to m68k Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: doc: cgroup: update note about conditions when oom killer is invoked Documentation/admin-guide/cgroup-v2.rst | 17 +- Documentation/admin-guide/dynamic-debug-howto.rst | 5 Documentation/admin-guide/kdump/kdump.rst | 8 + Documentation/admin-guide/kernel-parameters.txt | 34 +++- Documentation/admin-guide/sysctl/kernel.rst | 37 ++++ Documentation/core-api/pin_user_pages.rst | 47 ++++-- arch/alpha/include/asm/cacheflush.h | 38 +---- arch/alpha/kernel/smp.c | 2 arch/arm/include/asm/cacheflush.h | 7 arch/arm/kernel/fiq.c | 4 arch/arm/kernel/traps.c | 2 arch/arm64/include/asm/cacheflush.h | 46 ------ arch/c6x/include/asm/cacheflush.h | 19 -- arch/hexagon/include/asm/cacheflush.h | 19 -- arch/ia64/include/asm/cacheflush.h | 30 ---- arch/m68k/include/asm/cacheflush_mm.h | 6 arch/m68k/include/asm/cacheflush_no.h | 19 -- arch/m68k/mm/cache.c | 13 + arch/microblaze/include/asm/cacheflush.h | 29 --- arch/nds32/include/asm/cacheflush.h | 4 arch/nds32/mm/cacheflush.c | 3 arch/openrisc/include/asm/cacheflush.h | 33 ---- arch/powerpc/include/asm/cacheflush.h | 46 +----- arch/powerpc/kvm/book3s_64_mmu_hv.c | 2 arch/powerpc/kvm/book3s_64_mmu_radix.c | 2 arch/powerpc/mm/mem.c | 3 arch/powerpc/perf/callchain_64.c | 4 arch/riscv/include/asm/cacheflush.h | 65 -------- arch/sh/include/asm/cacheflush.h | 1 arch/sparc/include/asm/cacheflush_32.h | 2 arch/sparc/include/asm/cacheflush_64.h | 1 arch/um/include/asm/tlb.h | 2 arch/unicore32/include/asm/cacheflush.h | 11 - arch/x86/include/asm/cacheflush.h | 2 arch/xtensa/include/asm/cacheflush.h | 2 drivers/media/platform/omap3isp/ispvideo.c | 2 drivers/nvdimm/pmem.c | 3 drivers/vhost/vhost.c | 5 fs/binfmt_flat.c | 2 fs/exec.c | 5 fs/proc/proc_sysctl.c | 163 ++++++++++++++++++++-- include/asm-generic/cacheflush.h | 25 +-- include/linux/dev_printk.h | 6 include/linux/dynamic_debug.h | 2 include/linux/ipc_namespace.h | 2 include/linux/kernel.h | 9 + include/linux/mm.h | 12 + include/linux/net.h | 3 include/linux/netdevice.h | 6 include/linux/printk.h | 9 - include/linux/sched/sysctl.h | 7 include/linux/sysctl.h | 4 include/linux/xarray.h | 4 include/rdma/ib_verbs.h | 6 init/main.c | 2 ipc/msg.c | 2 ipc/namespace.c | 24 ++- kernel/events/core.c | 4 kernel/events/uprobes.c | 2 kernel/hung_task.c | 30 ++-- kernel/module.c | 8 - kernel/panic.c | 45 ++++++ kernel/sysctl.c | 38 ++++- kernel/watchdog.c | 37 +--- lib/Kconfig.debug | 12 + lib/Makefile | 2 lib/dynamic_debug.c | 9 - lib/test_sysctl.c | 13 + mm/frame_vector.c | 7 mm/gup.c | 74 +++++++-- mm/mmap.c | 28 ++- mm/nommu.c | 4 mm/page_alloc.c | 9 - mm/page_idle.c | 7 tools/testing/selftests/sysctl/sysctl.sh | 44 +++++ virt/kvm/kvm_main.c | 8 - 76 files changed, 732 insertions(+), 517 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-06-04 23:45 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-06-04 23:45 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits - More MM work. 100ish more to go. Mike's "mm: remove __ARCH_HAS_5LEVEL_HACK" series should fix the current ppc issue. - Various other little subsystems 127 patches, based on 6929f71e46bdddbf1c4d67c2728648176c67c555. Subsystems affected by this patch series: kcov mm/pagemap mm/vmalloc mm/kmap mm/util mm/memory-hotplug mm/cleanups mm/zram procfs core-kernel get_maintainer lib bitops checkpatch binfmt init fat seq_file exec rapidio relay selftests ubsan Subsystem: kcov Andrey Konovalov <andreyknvl@google.com>: Patch series "kcov: collect coverage from usb soft interrupts", v4: kcov: cleanup debug messages kcov: fix potential use-after-free in kcov_remote_start kcov: move t->kcov assignments into kcov_start/stop kcov: move t->kcov_sequence assignment kcov: use t->kcov_mode as enabled indicator kcov: collect coverage from interrupts usb: core: kcov: collect coverage from usb complete callback Subsystem: mm/pagemap Feng Tang <feng.tang@intel.com>: mm/util.c: remove the VM_WARN_ONCE for vm_committed_as underflow check Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: remove __ARCH_HAS_5LEVEL_HACK", v4: h8300: remove usage of __ARCH_USE_5LEVEL_HACK arm: add support for folded p4d page tables arm64: add support for folded p4d page tables hexagon: remove __ARCH_USE_5LEVEL_HACK ia64: add support for folded p4d page tables nios2: add support for folded p4d page tables openrisc: add support for folded p4d page tables powerpc: add support for folded p4d page tables Geert Uytterhoeven <geert+renesas@glider.be>: sh: fault: modernize printing of kernel messages Mike Rapoport <rppt@linux.ibm.com>: sh: drop __pXd_offset() macros that duplicate pXd_index() ones sh: add support for folded p4d page tables unicore32: remove __ARCH_USE_5LEVEL_HACK asm-generic: remove pgtable-nop4d-hack.h mm: remove __ARCH_HAS_5LEVEL_HACK and include/asm-generic/5level-fixup.h Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/debug: Add tests validating architecture page table: x86/mm: define mm_p4d_folded() mm/debug: add tests validating architecture page table helpers Subsystem: mm/vmalloc Jeongtae Park <jtp.park@samsung.com>: mm/vmalloc: fix a typo in comment Subsystem: mm/kmap Ira Weiny <ira.weiny@intel.com>: Patch series "Remove duplicated kmap code", v3: arch/kmap: remove BUG_ON() arch/xtensa: move kmap build bug out of the way arch/kmap: remove redundant arch specific kmaps arch/kunmap: remove duplicate kunmap implementations {x86,powerpc,microblaze}/kmap: move preempt disable arch/kmap_atomic: consolidate duplicate code arch/kunmap_atomic: consolidate duplicate code arch/kmap: ensure kmap_prot visibility arch/kmap: don't hard code kmap_prot values arch/kmap: define kmap_atomic_prot() for all arch's drm: remove drm specific kmap_atomic code kmap: remove kmap_atomic_to_page() parisc/kmap: remove duplicate kmap code sparc: remove unnecessary includes kmap: consolidate kmap_prot definitions Subsystem: mm/util Waiman Long <longman@redhat.com>: mm: add kvfree_sensitive() for freeing sensitive data objects Subsystem: mm/memory-hotplug Vishal Verma <vishal.l.verma@intel.com>: mm/memory_hotplug: refrain from adding memory into an impossible node David Hildenbrand <david@redhat.com>: powerpc/pseries/hotplug-memory: stop checking is_mem_section_removable() mm/memory_hotplug: remove is_mem_section_removable() Patch series "mm/memory_hotplug: handle memblocks only with: mm/memory_hotplug: set node_start_pfn of hotadded pgdat to 0 mm/memory_hotplug: handle memblocks only with CONFIG_ARCH_KEEP_MEMBLOCK Patch series "mm/memory_hotplug: Interface to add driver-managed system: mm/memory_hotplug: introduce add_memory_driver_managed() kexec_file: don't place kexec images on IORESOURCE_MEM_DRIVER_MANAGED device-dax: add memory via add_memory_driver_managed() Michal Hocko <mhocko@kernel.org>: mm/memory_hotplug: disable the functionality for 32b Subsystem: mm/cleanups chenqiwu <chenqiwu@xiaomi.com>: mm: replace zero-length array with flexible-array member Ethon Paul <ethp@qq.com>: mm/memory_hotplug: fix a typo in comment "recoreded"->"recorded" mm: ksm: fix a typo in comment "alreaady"->"already" mm: mmap: fix a typo in comment "compatbility"->"compatibility" mm/hugetlb: fix a typos in comments mm/vmsan: fix some typos in comment mm/compaction: fix a typo in comment "pessemistic"->"pessimistic" mm/memblock: fix a typo in comment "implict"->"implicit" mm/list_lru: fix a typo in comment "numbesr"->"numbers" mm/filemap: fix a typo in comment "unneccssary"->"unnecessary" mm/frontswap: fix some typos in frontswap.c mm, memcg: fix some typos in memcontrol.c mm: fix a typo in comment "strucure"->"structure" mm/slub: fix a typo in comment "disambiguiation"->"disambiguation" mm/sparse: fix a typo in comment "convienence"->"convenience" mm/page-writeback: fix a typo in comment "effictive"->"effective" mm/memory: fix a typo in comment "attampt"->"attempt" Zou Wei <zou_wei@huawei.com>: mm: use false for bool variable Jason Yan <yanaijie@huawei.com>: include/linux/mm.h: return true in cpupid_pid_unset() Subsystem: mm/zram Andy Shevchenko <andriy.shevchenko@linux.intel.com>: zcomp: Use ARRAY_SIZE() for backends list Subsystem: procfs Alexey Dobriyan <adobriyan@gmail.com>: proc: rename "catch" function argument Subsystem: core-kernel Jason Yan <yanaijie@huawei.com>: user.c: make uidhash_table static Subsystem: get_maintainer Joe Perches <joe@perches.com>: get_maintainer: add email addresses from .yaml files get_maintainer: fix unexpected behavior for path/to//file (double slashes) Subsystem: lib Christophe JAILLET <christophe.jaillet@wanadoo.fr>: lib/math: avoid trailing newline hidden in pr_fmt() KP Singh <kpsingh@chromium.org>: lib: Add might_fault() to strncpy_from_user. Jason Yan <yanaijie@huawei.com>: lib/test_lockup.c: make test_inode static Jann Horn <jannh@google.com>: lib/zlib: remove outdated and incorrect pre-increment optimization Joe Perches <joe@perches.com>: lib/percpu-refcount.c: use a more common logging style Tan Hu <tan.hu@zte.com.cn>: lib/flex_proportions.c: cleanup __fprop_inc_percpu_max Jesse Brandeburg <jesse.brandeburg@intel.com>: lib: make a test module with set/clear bit Subsystem: bitops Arnd Bergmann <arnd@arndb.de>: include/linux/bitops.h: avoid clang shift-count-overflow warnings Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: additional MAINTAINER section entry ordering checks checkpatch: look for c99 comments in ctx_locate_comment checkpatch: disallow --git and --file/--fix Geert Uytterhoeven <geert+renesas@glider.be>: checkpatch: use patch subject when reading from stdin Subsystem: binfmt Anthony Iliopoulos <ailiop@suse.com>: fs/binfmt_elf: remove redundant elf_map ifndef Nick Desaulniers <ndesaulniers@google.com>: elfnote: mark all .note sections SHF_ALLOC Subsystem: init Chris Down <chris@chrisdown.name>: init: allow distribution configuration of default init Subsystem: fat OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>: fat: don't allow to mount if the FAT length == 0 fat: improve the readahead for FAT entries Subsystem: seq_file Joe Perches <joe@perches.com>: fs/seq_file.c: seq_read: Update pr_info_ratelimited Kefeng Wang <wangkefeng.wang@huawei.com>: Patch series "seq_file: Introduce DEFINE_SEQ_ATTRIBUTE() helper macro": include/linux/seq_file.h: introduce DEFINE_SEQ_ATTRIBUTE() helper macro mm/vmstat.c: convert to use DEFINE_SEQ_ATTRIBUTE macro kernel/kprobes.c: convert to use DEFINE_SEQ_ATTRIBUTE macro Subsystem: exec Christoph Hellwig <hch@lst.de>: exec: simplify the copy_strings_kernel calling convention exec: open code copy_string_kernel Subsystem: rapidio Madhuparna Bhowmik <madhuparnabhowmik10@gmail.com>: rapidio: avoid data race between file operation callbacks and mport_cdev_add(). John Hubbard <jhubbard@nvidia.com>: rapidio: convert get_user_pages() --> pin_user_pages() Subsystem: relay Daniel Axtens <dja@axtens.net>: kernel/relay.c: handle alloc_percpu returning NULL in relay_open Pengcheng Yang <yangpc@wangsu.com>: kernel/relay.c: fix read_pos error when multiple readers Subsystem: selftests Ram Pai <linuxram@us.ibm.com>: Patch series "selftests, powerpc, x86: Memory Protection Keys", v19: selftests/x86/pkeys: move selftests to arch-neutral directory selftests/vm/pkeys: rename all references to pkru to a generic name selftests/vm/pkeys: move generic definitions to header file Thiago Jung Bauermann <bauerman@linux.ibm.com>: selftests/vm/pkeys: move some definitions to arch-specific header selftests/vm/pkeys: make gcc check arguments of sigsafe_printf() Sandipan Das <sandipan@linux.ibm.com>: selftests: vm: pkeys: Use sane types for pkey register selftests: vm: pkeys: add helpers for pkey bits Ram Pai <linuxram@us.ibm.com>: selftests/vm/pkeys: fix pkey_disable_clear() selftests/vm/pkeys: fix assertion in pkey_disable_set/clear() selftests/vm/pkeys: fix alloc_random_pkey() to make it really random Sandipan Das <sandipan@linux.ibm.com>: selftests: vm: pkeys: use the correct huge page size Ram Pai <linuxram@us.ibm.com>: selftests/vm/pkeys: introduce generic pkey abstractions selftests/vm/pkeys: introduce powerpc support "Desnes A. Nunes do Rosario" <desnesn@linux.vnet.ibm.com>: selftests/vm/pkeys: fix number of reserved powerpc pkeys Ram Pai <linuxram@us.ibm.com>: selftests/vm/pkeys: fix assertion in test_pkey_alloc_exhaust() selftests/vm/pkeys: improve checks to determine pkey support selftests/vm/pkeys: associate key on a mapped page and detect access violation selftests/vm/pkeys: associate key on a mapped page and detect write violation selftests/vm/pkeys: detect write violation on a mapped access-denied-key page selftests/vm/pkeys: introduce a sub-page allocator selftests/vm/pkeys: test correct behaviour of pkey-0 selftests/vm/pkeys: override access right definitions on powerpc Sandipan Das <sandipan@linux.ibm.com>: selftests: vm: pkeys: use the correct page size on powerpc selftests: vm: pkeys: fix multilib builds for x86 Jagadeesh Pagadala <jagdsh.linux@gmail.com>: tools/testing/selftests/vm: remove duplicate headers Subsystem: ubsan Arnd Bergmann <arnd@arndb.de>: lib/ubsan.c: fix gcc-10 warnings Documentation/dev-tools/kcov.rst | 17 Documentation/features/debug/debug-vm-pgtable/arch-support.txt | 34 arch/arc/Kconfig | 1 arch/arc/include/asm/highmem.h | 20 arch/arc/mm/highmem.c | 34 arch/arm/include/asm/highmem.h | 9 arch/arm/include/asm/pgtable.h | 1 arch/arm/lib/uaccess_with_memcpy.c | 7 arch/arm/mach-sa1100/assabet.c | 2 arch/arm/mm/dump.c | 29 arch/arm/mm/fault-armv.c | 7 arch/arm/mm/fault.c | 22 arch/arm/mm/highmem.c | 41 arch/arm/mm/idmap.c | 3 arch/arm/mm/init.c | 2 arch/arm/mm/ioremap.c | 12 arch/arm/mm/mm.h | 2 arch/arm/mm/mmu.c | 35 arch/arm/mm/pgd.c | 40 arch/arm64/Kconfig | 1 arch/arm64/include/asm/kvm_mmu.h | 10 arch/arm64/include/asm/pgalloc.h | 10 arch/arm64/include/asm/pgtable-types.h | 5 arch/arm64/include/asm/pgtable.h | 37 arch/arm64/include/asm/stage2_pgtable.h | 48 arch/arm64/kernel/hibernate.c | 44 arch/arm64/kvm/mmu.c | 209 arch/arm64/mm/fault.c | 9 arch/arm64/mm/hugetlbpage.c | 15 arch/arm64/mm/kasan_init.c | 26 arch/arm64/mm/mmu.c | 52 arch/arm64/mm/pageattr.c | 7 arch/csky/include/asm/highmem.h | 12 arch/csky/mm/highmem.c | 64 arch/h8300/include/asm/pgtable.h | 1 arch/hexagon/include/asm/fixmap.h | 4 arch/hexagon/include/asm/pgtable.h | 1 arch/ia64/include/asm/pgalloc.h | 4 arch/ia64/include/asm/pgtable.h | 17 arch/ia64/mm/fault.c | 7 arch/ia64/mm/hugetlbpage.c | 18 arch/ia64/mm/init.c | 28 arch/microblaze/include/asm/highmem.h | 55 arch/microblaze/mm/highmem.c | 21 arch/microblaze/mm/init.c | 3 arch/mips/include/asm/highmem.h | 11 arch/mips/mm/cache.c | 6 arch/mips/mm/highmem.c | 62 arch/nds32/include/asm/highmem.h | 9 arch/nds32/mm/highmem.c | 49 arch/nios2/include/asm/pgtable.h | 3 arch/nios2/mm/fault.c | 9 arch/nios2/mm/ioremap.c | 6 arch/openrisc/include/asm/pgtable.h | 1 arch/openrisc/mm/fault.c | 10 arch/openrisc/mm/init.c | 4 arch/parisc/include/asm/cacheflush.h | 32 arch/powerpc/Kconfig | 1 arch/powerpc/include/asm/book3s/32/pgtable.h | 1 arch/powerpc/include/asm/book3s/64/hash.h | 4 arch/powerpc/include/asm/book3s/64/pgalloc.h | 4 arch/powerpc/include/asm/book3s/64/pgtable.h | 60 arch/powerpc/include/asm/book3s/64/radix.h | 6 arch/powerpc/include/asm/highmem.h | 56 arch/powerpc/include/asm/nohash/32/pgtable.h | 1 arch/powerpc/include/asm/nohash/64/pgalloc.h | 2 arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 32 arch/powerpc/include/asm/nohash/64/pgtable.h | 6 arch/powerpc/include/asm/pgtable.h | 10 arch/powerpc/kvm/book3s_64_mmu_radix.c | 32 arch/powerpc/lib/code-patching.c | 7 arch/powerpc/mm/book3s64/hash_pgtable.c | 4 arch/powerpc/mm/book3s64/radix_pgtable.c | 26 arch/powerpc/mm/book3s64/subpage_prot.c | 6 arch/powerpc/mm/highmem.c | 26 arch/powerpc/mm/hugetlbpage.c | 28 arch/powerpc/mm/kasan/kasan_init_32.c | 2 arch/powerpc/mm/mem.c | 3 arch/powerpc/mm/nohash/book3e_pgtable.c | 15 arch/powerpc/mm/pgtable.c | 30 arch/powerpc/mm/pgtable_64.c | 10 arch/powerpc/mm/ptdump/hashpagetable.c | 20 arch/powerpc/mm/ptdump/ptdump.c | 12 arch/powerpc/platforms/pseries/hotplug-memory.c | 26 arch/powerpc/xmon/xmon.c | 27 arch/s390/Kconfig | 1 arch/sh/include/asm/pgtable-2level.h | 1 arch/sh/include/asm/pgtable-3level.h | 1 arch/sh/include/asm/pgtable_32.h | 5 arch/sh/include/asm/pgtable_64.h | 5 arch/sh/kernel/io_trapped.c | 7 arch/sh/mm/cache-sh4.c | 4 arch/sh/mm/cache-sh5.c | 7 arch/sh/mm/fault.c | 64 arch/sh/mm/hugetlbpage.c | 28 arch/sh/mm/init.c | 15 arch/sh/mm/kmap.c | 2 arch/sh/mm/tlbex_32.c | 6 arch/sh/mm/tlbex_64.c | 7 arch/sparc/include/asm/highmem.h | 29 arch/sparc/mm/highmem.c | 31 arch/sparc/mm/io-unit.c | 1 arch/sparc/mm/iommu.c | 1 arch/unicore32/include/asm/pgtable.h | 1 arch/unicore32/kernel/hibernate.c | 4 arch/x86/Kconfig | 1 arch/x86/include/asm/fixmap.h | 1 arch/x86/include/asm/highmem.h | 37 arch/x86/include/asm/pgtable_64.h | 6 arch/x86/mm/highmem_32.c | 52 arch/xtensa/include/asm/highmem.h | 31 arch/xtensa/mm/highmem.c | 28 drivers/block/zram/zcomp.c | 7 drivers/dax/dax-private.h | 1 drivers/dax/kmem.c | 28 drivers/gpu/drm/ttm/ttm_bo_util.c | 56 drivers/gpu/drm/vmwgfx/vmwgfx_blit.c | 17 drivers/rapidio/devices/rio_mport_cdev.c | 27 drivers/usb/core/hcd.c | 3 fs/binfmt_elf.c | 4 fs/binfmt_em86.c | 6 fs/binfmt_misc.c | 4 fs/binfmt_script.c | 6 fs/exec.c | 58 fs/fat/fatent.c | 103 fs/fat/inode.c | 6 fs/proc/array.c | 8 fs/seq_file.c | 7 include/asm-generic/5level-fixup.h | 59 include/asm-generic/pgtable-nop4d-hack.h | 64 include/asm-generic/pgtable-nopud.h | 4 include/drm/ttm/ttm_bo_api.h | 4 include/linux/binfmts.h | 3 include/linux/bitops.h | 2 include/linux/elfnote.h | 2 include/linux/highmem.h | 89 include/linux/ioport.h | 1 include/linux/memory_hotplug.h | 9 include/linux/mm.h | 12 include/linux/sched.h | 3 include/linux/seq_file.h | 19 init/Kconfig | 10 init/main.c | 10 kernel/kcov.c | 282 - kernel/kexec_file.c | 5 kernel/kprobes.c | 34 kernel/relay.c | 22 kernel/user.c | 2 lib/Kconfig.debug | 44 lib/Makefile | 2 lib/flex_proportions.c | 7 lib/math/prime_numbers.c | 10 lib/percpu-refcount.c | 6 lib/strncpy_from_user.c | 1 lib/test_bitops.c | 60 lib/test_lockup.c | 2 lib/ubsan.c | 33 lib/zlib_inflate/inffast.c | 91 mm/Kconfig | 4 mm/Makefile | 1 mm/compaction.c | 2 mm/debug_vm_pgtable.c | 382 + mm/filemap.c | 2 mm/frontswap.c | 6 mm/huge_memory.c | 2 mm/hugetlb.c | 16 mm/internal.h | 2 mm/kasan/init.c | 11 mm/ksm.c | 10 mm/list_lru.c | 2 mm/memblock.c | 2 mm/memcontrol.c | 4 mm/memory.c | 10 mm/memory_hotplug.c | 179 mm/mmap.c | 2 mm/mremap.c | 2 mm/page-writeback.c | 2 mm/slub.c | 2 mm/sparse.c | 2 mm/util.c | 22 mm/vmalloc.c | 2 mm/vmscan.c | 6 mm/vmstat.c | 32 mm/zbud.c | 2 scripts/checkpatch.pl | 62 scripts/get_maintainer.pl | 46 security/keys/internal.h | 11 security/keys/keyctl.c | 16 tools/testing/selftests/lib/config | 1 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 75 tools/testing/selftests/vm/mremap_dontunmap.c | 1 tools/testing/selftests/vm/pkey-helpers.h | 557 +- tools/testing/selftests/vm/pkey-powerpc.h | 153 tools/testing/selftests/vm/pkey-x86.h | 191 tools/testing/selftests/vm/protection_keys.c | 2370 ++++++++-- tools/testing/selftests/x86/.gitignore | 1 tools/testing/selftests/x86/Makefile | 2 tools/testing/selftests/x86/pkey-helpers.h | 219 tools/testing/selftests/x86/protection_keys.c | 1506 ------ 200 files changed, 5182 insertions(+), 4033 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-06-03 22:55 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-06-03 22:55 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm More mm/ work, plenty more to come. 131 patches, based on d6f9469a03d832dcd17041ed67774ffb5f3e73b3. Subsystems affected by this patch series: mm/slub mm/memcg mm/gup mm/kasan mm/pagealloc mm/hugetlb mm/vmscan mm/tools mm/mempolicy mm/memblock mm/hugetlbfs mm/thp mm/mmap mm/kconfig Subsystem: mm/slub Wang Hai <wanghai38@huawei.com>: mm/slub: fix a memory leak in sysfs_slab_add() Subsystem: mm/memcg Shakeel Butt <shakeelb@google.com>: mm/memcg: optimize memory.numa_stat like memory.stat Subsystem: mm/gup John Hubbard <jhubbard@nvidia.com>: Patch series "mm/gup, drm/i915: refactor gup_fast, convert to pin_user_pages()", v2: mm/gup: move __get_user_pages_fast() down a few lines in gup.c mm/gup: refactor and de-duplicate gup_fast() code mm/gup: introduce pin_user_pages_fast_only() drm/i915: convert get_user_pages() --> pin_user_pages() mm/gup: might_lock_read(mmap_sem) in get_user_pages_fast() Subsystem: mm/kasan Daniel Axtens <dja@axtens.net>: Patch series "Fix some incompatibilites between KASAN and FORTIFY_SOURCE", v4: kasan: stop tests being eliminated as dead code with FORTIFY_SOURCE string.h: fix incompatibility between FORTIFY_SOURCE and KASAN Subsystem: mm/pagealloc Michal Hocko <mhocko@suse.com>: mm: clarify __GFP_MEMALLOC usage Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: rework free_area_init*() funcitons": mm: memblock: replace dereferences of memblock_region.nid with API calls mm: make early_pfn_to_nid() and related defintions close to each other mm: remove CONFIG_HAVE_MEMBLOCK_NODE_MAP option mm: free_area_init: use maximal zone PFNs rather than zone sizes mm: use free_area_init() instead of free_area_init_nodes() alpha: simplify detection of memory zone boundaries arm: simplify detection of memory zone boundaries arm64: simplify detection of memory zone boundaries for UMA configs csky: simplify detection of memory zone boundaries m68k: mm: simplify detection of memory zone boundaries parisc: simplify detection of memory zone boundaries sparc32: simplify detection of memory zone boundaries unicore32: simplify detection of memory zone boundaries xtensa: simplify detection of memory zone boundaries Baoquan He <bhe@redhat.com>: mm: memmap_init: iterate over memblock regions rather that check each PFN Mike Rapoport <rppt@linux.ibm.com>: mm: remove early_pfn_in_nid() and CONFIG_NODES_SPAN_OTHER_NODES mm: free_area_init: allow defining max_zone_pfn in descending order mm: rename free_area_init_node() to free_area_init_memoryless_node() mm: clean up free_area_init_node() and its helpers mm: simplify find_min_pfn_with_active_regions() docs/vm: update memory-models documentation Wei Yang <richard.weiyang@gmail.com>: Patch series "mm/page_alloc.c: cleanup on check page", v3: mm/page_alloc.c: bad_[reason|flags] is not necessary when PageHWPoison mm/page_alloc.c: bad_flags is not necessary for bad_page() mm/page_alloc.c: rename free_pages_check_bad() to check_free_page_bad() mm/page_alloc.c: rename free_pages_check() to check_free_page() mm/page_alloc.c: extract check_[new|free]_page_bad() common part to page_bad_reason() Roman Gushchin <guro@fb.com>: mm,page_alloc,cma: conditionally prefer cma pageblocks for movable allocations Baoquan He <bhe@redhat.com>: mm/page_alloc.c: remove unused free_bootmem_with_active_regions Patch series "improvements about lowmem_reserve and /proc/zoneinfo", v2: mm/page_alloc.c: only tune sysctl_lowmem_reserve_ratio value once when changing it mm/page_alloc.c: clear out zone->lowmem_reserve[] if the zone is empty mm/vmstat.c: do not show lowmem reserve protection information of empty zone Joonsoo Kim <iamjoonsoo.kim@lge.com>: Patch series "integrate classzone_idx and high_zoneidx", v5: mm/page_alloc: use ac->high_zoneidx for classzone_idx mm/page_alloc: integrate classzone_idx and high_zoneidx Wei Yang <richard.weiyang@gmail.com>: mm/page_alloc.c: use NODE_MASK_NONE in build_zonelists() mm: rename gfpflags_to_migratetype to gfp_migratetype for same convention Sandipan Das <sandipan@linux.ibm.com>: mm/page_alloc.c: reset numa stats for boot pagesets Charan Teja Reddy <charante@codeaurora.org>: mm, page_alloc: reset the zone->watermark_boost early Anshuman Khandual <anshuman.khandual@arm.com>: mm/page_alloc: restrict and formalize compound_page_dtors[] Daniel Jordan <daniel.m.jordan@oracle.com>: Patch series "initialize deferred pages with interrupts enabled", v4: mm/pagealloc.c: call touch_nmi_watchdog() on max order boundaries in deferred init Pavel Tatashin <pasha.tatashin@soleen.com>: mm: initialize deferred pages with interrupts enabled mm: call cond_resched() from deferred_init_memmap() Daniel Jordan <daniel.m.jordan@oracle.com>: Patch series "padata: parallelize deferred page init", v3: padata: remove exit routine padata: initialize earlier padata: allocate work structures for parallel jobs from a pool padata: add basic support for multithreaded jobs mm: don't track number of pages during deferred initialization mm: parallelize deferred_init_memmap() mm: make deferred init's max threads arch-specific padata: document multithreaded jobs Chen Tao <chentao107@huawei.com>: mm/page_alloc.c: add missing newline Subsystem: mm/hugetlb "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: Patch series "thp/khugepaged improvements and CoW semantics", v4: khugepaged: add self test khugepaged: do not stop collapse if less than half PTEs are referenced khugepaged: drain all LRU caches before scanning pages khugepaged: drain LRU add pagevec after swapin khugepaged: allow to collapse a page shared across fork khugepaged: allow to collapse PTE-mapped compound pages thp: change CoW semantics for anon-THP khugepaged: introduce 'max_ptes_shared' tunable Mike Kravetz <mike.kravetz@oracle.com>: Patch series "Clean up hugetlb boot command line processing", v4: hugetlbfs: add arch_hugetlb_valid_size hugetlbfs: move hugepagesz= parsing to arch independent code hugetlbfs: remove hugetlb_add_hstate() warning for existing hstate hugetlbfs: clean up command line processing hugetlbfs: fix changes to command line processing Li Xinhai <lixinhai.lxh@gmail.com>: mm/hugetlb: avoid unnecessary check on pud and pmd entry in huge_pte_offset Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/hugetlb: Add some new generic fallbacks", v3: arm64/mm: drop __HAVE_ARCH_HUGE_PTEP_GET mm/hugetlb: define a generic fallback for is_hugepage_only_range() mm/hugetlb: define a generic fallback for arch_clear_hugepage_flags() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: simplify calling a compound page destructor Subsystem: mm/vmscan Wei Yang <richard.weiyang@gmail.com>: mm/vmscan.c: use update_lru_size() in update_lru_sizes() Jaewon Kim <jaewon31.kim@samsung.com>: mm/vmscan: count layzfree pages and fix nr_isolated_* mismatch Maninder Singh <maninder1.s@samsung.com>: mm/vmscan.c: change prototype for shrink_page_list Qiwu Chen <qiwuchen55@gmail.com>: mm/vmscan: update the comment of should_continue_reclaim() Johannes Weiner <hannes@cmpxchg.org>: Patch series "mm: memcontrol: charge swapin pages on instantiation", v2: mm: fix NUMA node file count error in replace_page_cache() mm: memcontrol: fix stat-corrupting race in charge moving mm: memcontrol: drop @compound parameter from memcg charging API mm: shmem: remove rare optimization when swapin races with hole punching mm: memcontrol: move out cgroup swaprate throttling mm: memcontrol: convert page cache to a new mem_cgroup_charge() API mm: memcontrol: prepare uncharging for removal of private page type counters mm: memcontrol: prepare move_account for removal of private page type counters mm: memcontrol: prepare cgroup vmstat infrastructure for native anon counters mm: memcontrol: switch to native NR_FILE_PAGES and NR_SHMEM counters mm: memcontrol: switch to native NR_ANON_MAPPED counter mm: memcontrol: switch to native NR_ANON_THPS counter mm: memcontrol: convert anon and file-thp to new mem_cgroup_charge() API mm: memcontrol: drop unused try/commit/cancel charge API mm: memcontrol: prepare swap controller setup for integration mm: memcontrol: make swap tracking an integral part of memory control mm: memcontrol: charge swapin pages on instantiation Alex Shi <alex.shi@linux.alibaba.com>: mm: memcontrol: document the new swap control behavior Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: delete unused lrucare handling mm: memcontrol: update page->mem_cgroup stability rules mm: fix LRU balancing effect of new transparent huge pages mm: keep separate anon and file statistics on page reclaim activity mm: allow swappiness that prefers reclaiming anon over the file workingset mm: fold and remove lru_cache_add_anon() and lru_cache_add_file() mm: workingset: let cache workingset challenge anon mm: remove use-once cache bias from LRU balancing mm: vmscan: drop unnecessary div0 avoidance rounding in get_scan_count() mm: base LRU balancing on an explicit cost model mm: deactivations shouldn't bias the LRU balance mm: only count actual rotations as LRU reclaim cost mm: balance LRU lists based on relative thrashing mm: vmscan: determine anon/file pressure balance at the reclaim root mm: vmscan: reclaim writepage is IO cost mm: vmscan: limit the range of LRU type balancing Shakeel Butt <shakeelb@google.com>: mm: swap: fix vmstats for huge pages mm: swap: memcg: fix memcg stats for huge pages Subsystem: mm/tools Changhee Han <ch0.han@lge.com>: tools/vm/page_owner_sort.c: filter out unneeded line Subsystem: mm/mempolicy Michal Hocko <mhocko@suse.com>: mm, mempolicy: fix up gup usage in lookup_node Subsystem: mm/memblock chenqiwu <chenqiwu@xiaomi.com>: include/linux/memblock.h: fix minor typo and unclear comment Mike Rapoport <rppt@linux.ibm.com>: sparc32: register memory occupied by kernel as memblock.memory Subsystem: mm/hugetlbfs Shijie Hu <hushijie3@huawei.com>: hugetlbfs: get unmapped area below TASK_UNMAPPED_BASE for hugetlbfs Subsystem: mm/thp Yang Shi <yang.shi@linux.alibaba.com>: mm: thp: don't need to drain lru cache when splitting and mlocking THP Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/thp: Rename pmd_mknotpresent() as pmd_mknotvalid()", v2: powerpc/mm: drop platform defined pmd_mknotpresent() mm/thp: rename pmd_mknotpresent() as pmd_mkinvalid() Subsystem: mm/mmap Scott Cheloha <cheloha@linux.vnet.ibm.com>: drivers/base/memory.c: cache memory blocks in xarray to accelerate lookup Subsystem: mm/kconfig Zong Li <zong.li@sifive.com>: Patch series "Extract DEBUG_WX to shared use": mm: add DEBUG_WX support riscv: support DEBUG_WX x86: mm: use ARCH_HAS_DEBUG_WX instead of arch defined arm64: mm: use ARCH_HAS_DEBUG_WX instead of arch defined Documentation/admin-guide/cgroup-v1/memory.rst | 19 Documentation/admin-guide/kernel-parameters.txt | 40 Documentation/admin-guide/mm/hugetlbpage.rst | 35 Documentation/admin-guide/mm/transhuge.rst | 7 Documentation/admin-guide/sysctl/vm.rst | 23 Documentation/core-api/padata.rst | 41 Documentation/features/vm/numa-memblock/arch-support.txt | 34 Documentation/vm/memory-model.rst | 9 Documentation/vm/page_owner.rst | 3 arch/alpha/mm/init.c | 16 arch/alpha/mm/numa.c | 22 arch/arc/include/asm/hugepage.h | 2 arch/arc/mm/init.c | 41 arch/arm/include/asm/hugetlb.h | 7 arch/arm/include/asm/pgtable-3level.h | 2 arch/arm/mm/init.c | 66 arch/arm64/Kconfig | 2 arch/arm64/Kconfig.debug | 29 arch/arm64/include/asm/hugetlb.h | 13 arch/arm64/include/asm/pgtable.h | 2 arch/arm64/mm/hugetlbpage.c | 48 arch/arm64/mm/init.c | 56 arch/arm64/mm/numa.c | 9 arch/c6x/mm/init.c | 8 arch/csky/kernel/setup.c | 26 arch/h8300/mm/init.c | 6 arch/hexagon/mm/init.c | 6 arch/ia64/Kconfig | 1 arch/ia64/include/asm/hugetlb.h | 5 arch/ia64/mm/contig.c | 2 arch/ia64/mm/discontig.c | 2 arch/m68k/mm/init.c | 6 arch/m68k/mm/mcfmmu.c | 9 arch/m68k/mm/motorola.c | 15 arch/m68k/mm/sun3mmu.c | 10 arch/microblaze/Kconfig | 1 arch/microblaze/mm/init.c | 2 arch/mips/Kconfig | 1 arch/mips/include/asm/hugetlb.h | 11 arch/mips/include/asm/pgtable.h | 2 arch/mips/loongson64/numa.c | 2 arch/mips/mm/init.c | 2 arch/mips/sgi-ip27/ip27-memory.c | 2 arch/nds32/mm/init.c | 11 arch/nios2/mm/init.c | 8 arch/openrisc/mm/init.c | 9 arch/parisc/include/asm/hugetlb.h | 10 arch/parisc/mm/init.c | 22 arch/powerpc/Kconfig | 10 arch/powerpc/include/asm/book3s/64/pgtable.h | 4 arch/powerpc/include/asm/hugetlb.h | 5 arch/powerpc/mm/hugetlbpage.c | 38 arch/powerpc/mm/mem.c | 2 arch/riscv/Kconfig | 2 arch/riscv/include/asm/hugetlb.h | 10 arch/riscv/include/asm/ptdump.h | 11 arch/riscv/mm/hugetlbpage.c | 44 arch/riscv/mm/init.c | 5 arch/s390/Kconfig | 1 arch/s390/include/asm/hugetlb.h | 8 arch/s390/mm/hugetlbpage.c | 34 arch/s390/mm/init.c | 2 arch/sh/Kconfig | 1 arch/sh/include/asm/hugetlb.h | 7 arch/sh/mm/init.c | 2 arch/sparc/Kconfig | 10 arch/sparc/include/asm/hugetlb.h | 10 arch/sparc/mm/init_32.c | 1 arch/sparc/mm/init_64.c | 67 arch/sparc/mm/srmmu.c | 21 arch/um/kernel/mem.c | 12 arch/unicore32/include/asm/memory.h | 2 arch/unicore32/include/mach/memory.h | 6 arch/unicore32/kernel/pci.c | 14 arch/unicore32/mm/init.c | 43 arch/x86/Kconfig | 11 arch/x86/Kconfig.debug | 27 arch/x86/include/asm/hugetlb.h | 10 arch/x86/include/asm/pgtable.h | 2 arch/x86/mm/hugetlbpage.c | 35 arch/x86/mm/init.c | 2 arch/x86/mm/init_64.c | 12 arch/x86/mm/kmmio.c | 2 arch/x86/mm/numa.c | 11 arch/xtensa/mm/init.c | 8 drivers/base/memory.c | 44 drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 22 fs/cifs/file.c | 10 fs/fuse/dev.c | 2 fs/hugetlbfs/inode.c | 67 include/asm-generic/hugetlb.h | 2 include/linux/compaction.h | 9 include/linux/gfp.h | 7 include/linux/hugetlb.h | 16 include/linux/memblock.h | 15 include/linux/memcontrol.h | 102 - include/linux/mm.h | 52 include/linux/mmzone.h | 46 include/linux/padata.h | 43 include/linux/string.h | 60 include/linux/swap.h | 17 include/linux/vm_event_item.h | 4 include/linux/vmstat.h | 2 include/trace/events/compaction.h | 22 include/trace/events/huge_memory.h | 3 include/trace/events/vmscan.h | 14 init/Kconfig | 17 init/main.c | 2 kernel/events/uprobes.c | 22 kernel/padata.c | 293 +++- kernel/sysctl.c | 3 lib/test_kasan.c | 29 mm/Kconfig | 9 mm/Kconfig.debug | 32 mm/compaction.c | 70 - mm/filemap.c | 55 mm/gup.c | 237 ++- mm/huge_memory.c | 282 ---- mm/hugetlb.c | 260 ++- mm/internal.h | 25 mm/khugepaged.c | 316 ++-- mm/memblock.c | 19 mm/memcontrol.c | 642 +++------ mm/memory.c | 103 - mm/memory_hotplug.c | 10 mm/mempolicy.c | 5 mm/migrate.c | 30 mm/oom_kill.c | 4 mm/page_alloc.c | 735 ++++------ mm/page_owner.c | 7 mm/pgtable-generic.c | 2 mm/rmap.c | 53 mm/shmem.c | 156 -- mm/slab.c | 4 mm/slub.c | 8 mm/swap.c | 199 +- mm/swap_cgroup.c | 10 mm/swap_state.c | 110 - mm/swapfile.c | 39 mm/userfaultfd.c | 15 mm/vmscan.c | 344 ++-- mm/vmstat.c | 16 mm/workingset.c | 23 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 1 tools/testing/selftests/vm/khugepaged.c | 1035 +++++++++++++++ tools/vm/page_owner_sort.c | 5 147 files changed, 3876 insertions(+), 3108 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-06-02 20:09 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-06-02 20:09 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm A few little subsystems and a start of a lot of MM patches. 128 patches, based on f359287765c04711ff54fbd11645271d8e5ff763: Subsystems affected by this patch series: squashfs ocfs2 parisc vfs mm/slab-generic mm/slub mm/debug mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/memory-failure mm/vmalloc mm/kasan Subsystem: squashfs Philippe Liard <pliard@google.com>: squashfs: migrate from ll_rw_block usage to BIO Subsystem: ocfs2 Jules Irenge <jbi.octave@gmail.com>: ocfs2: add missing annotation for dlm_empty_lockres() Gang He <ghe@suse.com>: ocfs2: mount shared volume without ha stack Subsystem: parisc Andrew Morton <akpm@linux-foundation.org>: arch/parisc/include/asm/pgtable.h: remove unused `old_pte' Subsystem: vfs Jeff Layton <jlayton@redhat.com>: Patch series "vfs: have syncfs() return error when there are writeback: vfs: track per-sb writeback errors and report them to syncfs fs/buffer.c: record blockdev write errors in super_block that it backs Subsystem: mm/slab-generic Vlastimil Babka <vbabka@suse.cz>: usercopy: mark dma-kmalloc caches as usercopy caches Subsystem: mm/slub Dongli Zhang <dongli.zhang@oracle.com>: mm/slub.c: fix corrupted freechain in deactivate_slab() Christoph Lameter <cl@linux.com>: slub: Remove userspace notifier for cache add/remove Christopher Lameter <cl@linux.com>: slub: remove kmalloc under list_lock from list_slab_objects() V2 Qian Cai <cai@lca.pw>: mm/slub: fix stack overruns with SLUB_STATS Andrew Morton <akpm@linux-foundation.org>: Documentation/vm/slub.rst: s/Toggle/Enable/ Subsystem: mm/debug Vlastimil Babka <vbabka@suse.cz>: mm, dump_page(): do not crash with invalid mapping pointer Subsystem: mm/pagecache "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Change readahead API", v11: mm: move readahead prototypes from mm.h mm: return void from various readahead functions mm: ignore return value of ->readpages mm: move readahead nr_pages check into read_pages mm: add new readahead_control API mm: use readahead_control to pass arguments mm: rename various 'offset' parameters to 'index' mm: rename readahead loop variable to 'i' mm: remove 'page_offset' from readahead loop mm: put readahead pages in cache earlier mm: add readahead address space operation mm: move end_index check out of readahead loop mm: add page_cache_readahead_unbounded mm: document why we don't set PageReadahead mm: use memalloc_nofs_save in readahead path fs: convert mpage_readpages to mpage_readahead btrfs: convert from readpages to readahead erofs: convert uncompressed files from readpages to readahead erofs: convert compressed files from readpages to readahead ext4: convert from readpages to readahead ext4: pass the inode to ext4_mpage_readpages f2fs: convert from readpages to readahead f2fs: pass the inode to f2fs_mpage_readpages fuse: convert from readpages to readahead iomap: convert from readpages to readahead Guoqing Jiang <guoqing.jiang@cloud.ionos.com>: Patch series "Introduce attach/detach_page_private to cleanup code": include/linux/pagemap.h: introduce attach/detach_page_private md: remove __clear_page_buffers and use attach/detach_page_private btrfs: use attach/detach_page_private fs/buffer.c: use attach/detach_page_private f2fs: use attach/detach_page_private iomap: use attach/detach_page_private ntfs: replace attach_page_buffers with attach_page_private orangefs: use attach/detach_page_private buffer_head.h: remove attach_page_buffers mm/migrate.c: call detach_page_private to cleanup code mm_types.h: change set_page_private to inline function "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap.c: remove misleading comment Chao Yu <yuchao0@huawei.com>: mm/page-writeback.c: remove unused variable NeilBrown <neilb@suse.de>: mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead Subsystem: mm/gup Souptick Joarder <jrdr.linux@gmail.com>: mm/gup.c: update the documentation John Hubbard <jhubbard@nvidia.com>: mm/gup: introduce pin_user_pages_unlocked ivtv: convert get_user_pages() --> pin_user_pages() Miles Chen <miles.chen@mediatek.com>: mm/gup.c: further document vma_permits_fault() Subsystem: mm/swap chenqiwu <chenqiwu@xiaomi.com>: mm/swapfile: use list_{prev,next}_entry() instead of open-coding Qian Cai <cai@lca.pw>: mm/swap_state: fix a data race in swapin_nr_pages Andrea Righi <andrea.righi@canonical.com>: mm: swap: properly update readahead statistics in unuse_pte_range() Wei Yang <richard.weiyang@gmail.com>: mm/swapfile.c: offset is only used when there is more slots mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive mm/swapfile.c: remove the unnecessary goto for SSD case mm/swapfile.c: simplify the calculation of n_goal mm/swapfile.c: remove the extra check in scan_swap_map_slots() mm/swapfile.c: found_free could be represented by (tmp < max) mm/swapfile.c: tmp is always smaller than max mm/swapfile.c: omit a duplicate code by compare tmp and max first Huang Ying <ying.huang@intel.com>: swap: try to scan more free slots even when fragmented Wei Yang <richard.weiyang@gmail.com>: mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable mm/swapfile.c: __swap_entry_free() always free 1 entry Huang Ying <ying.huang@intel.com>: mm/swapfile.c: use prandom_u32_max() swap: reduce lock contention on swap cache from swap slots allocation Randy Dunlap <rdunlap@infradead.org>: mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment Miaohe Lin <linmiaohe@huawei.com>: include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration Subsystem: mm/memcg Yafang Shao <laoar.shao@gmail.com>: mm, memcg: add workingset_restore in memory.stat Kaixu Xia <kaixuxia@tencent.com>: mm: memcontrol: simplify value comparison between count and limit Shakeel Butt <shakeelb@google.com>: memcg: expose root cgroup's memory.stat Jakub Kicinski <kuba@kernel.org>: Patch series "memcg: Slow down swap allocation as the available space gets: mm/memcg: prepare for swap over-high accounting and penalty calculation mm/memcg: move penalty delay clamping out of calculate_high_delay() mm/memcg: move cgroup high memory limit setting into struct page_counter mm/memcg: automatically penalize tasks with high swap use Zefan Li <lizefan@huawei.com>: memcg: fix memcg_kmem_bypass() for remote memcg charging Subsystem: mm/pagemap Steven Price <steven.price@arm.com>: Patch series "Fix W+X debug feature on x86": x86: mm: ptdump: calculate effective permissions correctly mm: ptdump: expand type of 'val' in note_page() Huang Ying <ying.huang@intel.com>: /proc/PID/smaps: Add PMD migration entry parsing chenqiwu <chenqiwu@xiaomi.com>: mm/memory: remove unnecessary pte_devmap case in copy_one_pte() Subsystem: mm/memory-failure Wetp Zhang <wetp.zy@linux.alibaba.com>: mm, memory_failure: don't send BUS_MCEERR_AO for action required error Subsystem: mm/vmalloc Christoph Hellwig <hch@lst.de>: Patch series "decruft the vmalloc API", v2: x86/hyperv: use vmalloc_exec for the hypercall page x86: fix vmap arguments in map_irq_stack staging: android: ion: use vmap instead of vm_map_ram staging: media: ipu3: use vmap instead of reimplementing it dma-mapping: use vmap insted of reimplementing it powerpc: add an ioremap_phb helper powerpc: remove __ioremap_at and __iounmap_at mm: remove __get_vm_area mm: unexport unmap_kernel_range_noflush mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING mm: only allow page table mappings for built-in zsmalloc mm: pass addr as unsigned long to vb_free mm: remove vmap_page_range_noflush and vunmap_page_range mm: rename vmap_page_range to map_kernel_range mm: don't return the number of pages from map_kernel_range{,_noflush} mm: remove map_vm_range mm: remove unmap_vmap_area mm: remove the prot argument from vm_map_ram mm: enforce that vmap can't map pages executable gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc mm: remove the pgprot argument to __vmalloc mm: remove the prot argument to __vmalloc_node mm: remove both instances of __vmalloc_node_flags mm: remove __vmalloc_node_flags_caller mm: switch the test_vmalloc module to use __vmalloc_node mm: remove vmalloc_user_node_flags arm64: use __vmalloc_node in arch_alloc_vmap_stack powerpc: use __vmalloc_node in alloc_vm_stack s390: use __vmalloc_node in stack_alloc Joerg Roedel <jroedel@suse.de>: Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3: mm: add functions to track page directory modifications mm/vmalloc: track which page-table levels were modified mm/ioremap: track which page-table levels were modified x86/mm/64: implement arch_sync_kernel_mappings() x86/mm/32: implement arch_sync_kernel_mappings() mm: remove vmalloc_sync_(un)mappings() x86/mm: remove vmalloc faulting Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: fix clang compilation warning due to stack protector Kees Cook <keescook@chromium.org>: ubsan: entirely disable alignment checks under UBSAN_TRAP Jing Xia <jing.xia@unisoc.com>: mm/mm_init.c: report kasan-tag information stored in page->flags Andrey Konovalov <andreyknvl@google.com>: kasan: move kasan_report() into report.c Documentation/admin-guide/cgroup-v2.rst | 24 + Documentation/core-api/cachetlb.rst | 2 Documentation/filesystems/locking.rst | 6 Documentation/filesystems/proc.rst | 4 Documentation/filesystems/vfs.rst | 15 Documentation/vm/slub.rst | 2 arch/arm/configs/omap2plus_defconfig | 2 arch/arm64/include/asm/pgtable.h | 3 arch/arm64/include/asm/vmap_stack.h | 6 arch/arm64/mm/dump.c | 2 arch/parisc/include/asm/pgtable.h | 2 arch/powerpc/include/asm/io.h | 10 arch/powerpc/include/asm/pci-bridge.h | 2 arch/powerpc/kernel/irq.c | 5 arch/powerpc/kernel/isa-bridge.c | 28 + arch/powerpc/kernel/pci_64.c | 56 +- arch/powerpc/mm/ioremap_64.c | 50 -- arch/riscv/include/asm/pgtable.h | 4 arch/riscv/mm/ptdump.c | 2 arch/s390/kernel/setup.c | 9 arch/sh/kernel/cpu/sh4/sq.c | 3 arch/x86/hyperv/hv_init.c | 5 arch/x86/include/asm/kvm_host.h | 3 arch/x86/include/asm/pgtable-2level_types.h | 2 arch/x86/include/asm/pgtable-3level_types.h | 2 arch/x86/include/asm/pgtable_64_types.h | 2 arch/x86/include/asm/pgtable_types.h | 8 arch/x86/include/asm/switch_to.h | 23 - arch/x86/kernel/irq_64.c | 2 arch/x86/kernel/setup_percpu.c | 6 arch/x86/kvm/svm/sev.c | 3 arch/x86/mm/dump_pagetables.c | 35 + arch/x86/mm/fault.c | 196 ---------- arch/x86/mm/init_64.c | 5 arch/x86/mm/pti.c | 8 arch/x86/mm/tlb.c | 37 - block/blk-core.c | 1 drivers/acpi/apei/ghes.c | 6 drivers/base/node.c | 2 drivers/block/drbd/drbd_bitmap.c | 4 drivers/block/loop.c | 2 drivers/dax/device.c | 1 drivers/gpu/drm/drm_scatter.c | 11 drivers/gpu/drm/etnaviv/etnaviv_dump.c | 4 drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c | 2 drivers/lightnvm/pblk-init.c | 5 drivers/md/dm-bufio.c | 4 drivers/md/md-bitmap.c | 12 drivers/media/common/videobuf2/videobuf2-dma-sg.c | 3 drivers/media/common/videobuf2/videobuf2-vmalloc.c | 3 drivers/media/pci/ivtv/ivtv-udma.c | 19 - drivers/media/pci/ivtv/ivtv-yuv.c | 17 drivers/media/pci/ivtv/ivtvfb.c | 4 drivers/mtd/ubi/io.c | 4 drivers/pcmcia/electra_cf.c | 45 -- drivers/scsi/sd_zbc.c | 3 drivers/staging/android/ion/ion_heap.c | 4 drivers/staging/media/ipu3/ipu3-css-pool.h | 4 drivers/staging/media/ipu3/ipu3-dmamap.c | 30 - fs/block_dev.c | 7 fs/btrfs/disk-io.c | 4 fs/btrfs/extent_io.c | 64 --- fs/btrfs/extent_io.h | 3 fs/btrfs/inode.c | 39 -- fs/buffer.c | 23 - fs/erofs/data.c | 41 -- fs/erofs/decompressor.c | 2 fs/erofs/zdata.c | 31 - fs/exfat/inode.c | 7 fs/ext2/inode.c | 10 fs/ext4/ext4.h | 5 fs/ext4/inode.c | 25 - fs/ext4/readpage.c | 25 - fs/ext4/verity.c | 35 - fs/f2fs/data.c | 56 +- fs/f2fs/f2fs.h | 14 fs/f2fs/verity.c | 35 - fs/fat/inode.c | 7 fs/file_table.c | 1 fs/fs-writeback.c | 1 fs/fuse/file.c | 100 +---- fs/gfs2/aops.c | 23 - fs/gfs2/dir.c | 9 fs/gfs2/quota.c | 2 fs/hpfs/file.c | 7 fs/iomap/buffered-io.c | 113 +---- fs/iomap/trace.h | 2 fs/isofs/inode.c | 7 fs/jfs/inode.c | 7 fs/mpage.c | 38 -- fs/nfs/blocklayout/extent_tree.c | 2 fs/nfs/internal.h | 10 fs/nfs/write.c | 4 fs/nfsd/vfs.c | 9 fs/nilfs2/inode.c | 15 fs/ntfs/aops.c | 2 fs/ntfs/malloc.h | 2 fs/ntfs/mft.c | 2 fs/ocfs2/aops.c | 34 - fs/ocfs2/dlm/dlmmaster.c | 1 fs/ocfs2/ocfs2.h | 4 fs/ocfs2/slot_map.c | 46 +- fs/ocfs2/super.c | 21 + fs/omfs/file.c | 7 fs/open.c | 3 fs/orangefs/inode.c | 32 - fs/proc/meminfo.c | 3 fs/proc/task_mmu.c | 16 fs/qnx6/inode.c | 7 fs/reiserfs/inode.c | 8 fs/squashfs/block.c | 273 +++++++------- fs/squashfs/decompressor.h | 5 fs/squashfs/decompressor_multi.c | 9 fs/squashfs/decompressor_multi_percpu.c | 17 fs/squashfs/decompressor_single.c | 9 fs/squashfs/lz4_wrapper.c | 17 fs/squashfs/lzo_wrapper.c | 17 fs/squashfs/squashfs.h | 4 fs/squashfs/xz_wrapper.c | 51 +- fs/squashfs/zlib_wrapper.c | 63 +-- fs/squashfs/zstd_wrapper.c | 62 +-- fs/sync.c | 6 fs/ubifs/debug.c | 2 fs/ubifs/lprops.c | 2 fs/ubifs/lpt_commit.c | 4 fs/ubifs/orphan.c | 2 fs/udf/inode.c | 7 fs/xfs/kmem.c | 2 fs/xfs/xfs_aops.c | 13 fs/xfs/xfs_buf.c | 2 fs/zonefs/super.c | 7 include/asm-generic/5level-fixup.h | 5 include/asm-generic/pgtable.h | 27 + include/linux/buffer_head.h | 8 include/linux/fs.h | 18 include/linux/iomap.h | 3 include/linux/memcontrol.h | 4 include/linux/mm.h | 67 ++- include/linux/mm_types.h | 6 include/linux/mmzone.h | 1 include/linux/mpage.h | 4 include/linux/page_counter.h | 8 include/linux/pagemap.h | 193 ++++++++++ include/linux/ptdump.h | 3 include/linux/sched.h | 3 include/linux/swap.h | 17 include/linux/vmalloc.h | 49 +- include/linux/zsmalloc.h | 2 include/trace/events/erofs.h | 6 include/trace/events/f2fs.h | 6 include/trace/events/writeback.h | 5 kernel/bpf/core.c | 6 kernel/bpf/syscall.c | 29 - kernel/dma/remap.c | 48 -- kernel/groups.c | 2 kernel/module.c | 3 kernel/notifier.c | 1 kernel/sys.c | 2 kernel/trace/trace.c | 12 lib/Kconfig.ubsan | 2 lib/ioremap.c | 46 +- lib/test_vmalloc.c | 26 - mm/Kconfig | 4 mm/debug.c | 56 ++ mm/fadvise.c | 6 mm/filemap.c | 1 mm/gup.c | 77 +++- mm/internal.h | 14 mm/kasan/Makefile | 21 - mm/kasan/common.c | 19 - mm/kasan/report.c | 22 + mm/memcontrol.c | 198 +++++++--- mm/memory-failure.c | 15 mm/memory.c | 2 mm/migrate.c | 9 mm/mm_init.c | 16 mm/nommu.c | 52 +- mm/page-writeback.c | 62 ++- mm/page_alloc.c | 7 mm/percpu.c | 2 mm/ptdump.c | 17 mm/readahead.c | 349 ++++++++++-------- mm/slab_common.c | 3 mm/slub.c | 67 ++- mm/swap_state.c | 5 mm/swapfile.c | 194 ++++++---- mm/util.c | 2 mm/vmalloc.c | 399 ++++++++------------- mm/vmscan.c | 4 mm/vmstat.c | 11 mm/zsmalloc.c | 12 net/bridge/netfilter/ebtables.c | 6 net/ceph/ceph_common.c | 3 sound/core/memalloc.c | 2 sound/core/pcm_memory.c | 2 195 files changed, 2292 insertions(+), 2288 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-06-02 4:44 Andrew Morton 2020-06-02 20:08 ` incoming Andrew Morton 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2020-06-02 4:44 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm A few little subsystems and a start of a lot of MM patches. 128 patches, based on 9bf9511e3d9f328c03f6f79bfb741c3d18f2f2c0: Subsystems affected by this patch series: squashfs ocfs2 parisc vfs mm/slab-generic mm/slub mm/debug mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/memory-failure mm/vmalloc mm/kasan Subsystem: squashfs Philippe Liard <pliard@google.com>: squashfs: migrate from ll_rw_block usage to BIO Subsystem: ocfs2 Jules Irenge <jbi.octave@gmail.com>: ocfs2: add missing annotation for dlm_empty_lockres() Gang He <ghe@suse.com>: ocfs2: mount shared volume without ha stack Subsystem: parisc Andrew Morton <akpm@linux-foundation.org>: arch/parisc/include/asm/pgtable.h: remove unused `old_pte' Subsystem: vfs Jeff Layton <jlayton@redhat.com>: Patch series "vfs: have syncfs() return error when there are writeback: vfs: track per-sb writeback errors and report them to syncfs fs/buffer.c: record blockdev write errors in super_block that it backs Subsystem: mm/slab-generic Vlastimil Babka <vbabka@suse.cz>: usercopy: mark dma-kmalloc caches as usercopy caches Subsystem: mm/slub Dongli Zhang <dongli.zhang@oracle.com>: mm/slub.c: fix corrupted freechain in deactivate_slab() Christoph Lameter <cl@linux.com>: slub: Remove userspace notifier for cache add/remove Christopher Lameter <cl@linux.com>: slub: remove kmalloc under list_lock from list_slab_objects() V2 Qian Cai <cai@lca.pw>: mm/slub: fix stack overruns with SLUB_STATS Andrew Morton <akpm@linux-foundation.org>: Documentation/vm/slub.rst: s/Toggle/Enable/ Subsystem: mm/debug Vlastimil Babka <vbabka@suse.cz>: mm, dump_page(): do not crash with invalid mapping pointer Subsystem: mm/pagecache "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Change readahead API", v11: mm: move readahead prototypes from mm.h mm: return void from various readahead functions mm: ignore return value of ->readpages mm: move readahead nr_pages check into read_pages mm: add new readahead_control API mm: use readahead_control to pass arguments mm: rename various 'offset' parameters to 'index' mm: rename readahead loop variable to 'i' mm: remove 'page_offset' from readahead loop mm: put readahead pages in cache earlier mm: add readahead address space operation mm: move end_index check out of readahead loop mm: add page_cache_readahead_unbounded mm: document why we don't set PageReadahead mm: use memalloc_nofs_save in readahead path fs: convert mpage_readpages to mpage_readahead btrfs: convert from readpages to readahead erofs: convert uncompressed files from readpages to readahead erofs: convert compressed files from readpages to readahead ext4: convert from readpages to readahead ext4: pass the inode to ext4_mpage_readpages f2fs: convert from readpages to readahead f2fs: pass the inode to f2fs_mpage_readpages fuse: convert from readpages to readahead iomap: convert from readpages to readahead Guoqing Jiang <guoqing.jiang@cloud.ionos.com>: Patch series "Introduce attach/detach_page_private to cleanup code": include/linux/pagemap.h: introduce attach/detach_page_private md: remove __clear_page_buffers and use attach/detach_page_private btrfs: use attach/detach_page_private fs/buffer.c: use attach/detach_page_private f2fs: use attach/detach_page_private iomap: use attach/detach_page_private ntfs: replace attach_page_buffers with attach_page_private orangefs: use attach/detach_page_private buffer_head.h: remove attach_page_buffers mm/migrate.c: call detach_page_private to cleanup code mm_types.h: change set_page_private to inline function "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap.c: remove misleading comment Chao Yu <yuchao0@huawei.com>: mm/page-writeback.c: remove unused variable NeilBrown <neilb@suse.de>: mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead Subsystem: mm/gup Souptick Joarder <jrdr.linux@gmail.com>: mm/gup.c: update the documentation John Hubbard <jhubbard@nvidia.com>: mm/gup: introduce pin_user_pages_unlocked ivtv: convert get_user_pages() --> pin_user_pages() Miles Chen <miles.chen@mediatek.com>: mm/gup.c: further document vma_permits_fault() Subsystem: mm/swap chenqiwu <chenqiwu@xiaomi.com>: mm/swapfile: use list_{prev,next}_entry() instead of open-coding Qian Cai <cai@lca.pw>: mm/swap_state: fix a data race in swapin_nr_pages Andrea Righi <andrea.righi@canonical.com>: mm: swap: properly update readahead statistics in unuse_pte_range() Wei Yang <richard.weiyang@gmail.com>: mm/swapfile.c: offset is only used when there is more slots mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive mm/swapfile.c: remove the unnecessary goto for SSD case mm/swapfile.c: simplify the calculation of n_goal mm/swapfile.c: remove the extra check in scan_swap_map_slots() mm/swapfile.c: found_free could be represented by (tmp < max) mm/swapfile.c: tmp is always smaller than max mm/swapfile.c: omit a duplicate code by compare tmp and max first Huang Ying <ying.huang@intel.com>: swap: try to scan more free slots even when fragmented Wei Yang <richard.weiyang@gmail.com>: mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable mm/swapfile.c: __swap_entry_free() always free 1 entry Huang Ying <ying.huang@intel.com>: mm/swapfile.c: use prandom_u32_max() swap: reduce lock contention on swap cache from swap slots allocation Randy Dunlap <rdunlap@infradead.org>: mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment Miaohe Lin <linmiaohe@huawei.com>: include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration Subsystem: mm/memcg Yafang Shao <laoar.shao@gmail.com>: mm, memcg: add workingset_restore in memory.stat Kaixu Xia <kaixuxia@tencent.com>: mm: memcontrol: simplify value comparison between count and limit Shakeel Butt <shakeelb@google.com>: memcg: expose root cgroup's memory.stat Jakub Kicinski <kuba@kernel.org>: Patch series "memcg: Slow down swap allocation as the available space gets: mm/memcg: prepare for swap over-high accounting and penalty calculation mm/memcg: move penalty delay clamping out of calculate_high_delay() mm/memcg: move cgroup high memory limit setting into struct page_counter mm/memcg: automatically penalize tasks with high swap use Zefan Li <lizefan@huawei.com>: memcg: fix memcg_kmem_bypass() for remote memcg charging Subsystem: mm/pagemap Steven Price <steven.price@arm.com>: Patch series "Fix W+X debug feature on x86": x86: mm: ptdump: calculate effective permissions correctly mm: ptdump: expand type of 'val' in note_page() Huang Ying <ying.huang@intel.com>: /proc/PID/smaps: Add PMD migration entry parsing chenqiwu <chenqiwu@xiaomi.com>: mm/memory: remove unnecessary pte_devmap case in copy_one_pte() Subsystem: mm/memory-failure Wetp Zhang <wetp.zy@linux.alibaba.com>: mm, memory_failure: don't send BUS_MCEERR_AO for action required error Subsystem: mm/vmalloc Christoph Hellwig <hch@lst.de>: Patch series "decruft the vmalloc API", v2: x86/hyperv: use vmalloc_exec for the hypercall page x86: fix vmap arguments in map_irq_stack staging: android: ion: use vmap instead of vm_map_ram staging: media: ipu3: use vmap instead of reimplementing it dma-mapping: use vmap insted of reimplementing it powerpc: add an ioremap_phb helper powerpc: remove __ioremap_at and __iounmap_at mm: remove __get_vm_area mm: unexport unmap_kernel_range_noflush mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING mm: only allow page table mappings for built-in zsmalloc mm: pass addr as unsigned long to vb_free mm: remove vmap_page_range_noflush and vunmap_page_range mm: rename vmap_page_range to map_kernel_range mm: don't return the number of pages from map_kernel_range{,_noflush} mm: remove map_vm_range mm: remove unmap_vmap_area mm: remove the prot argument from vm_map_ram mm: enforce that vmap can't map pages executable gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc mm: remove the pgprot argument to __vmalloc mm: remove the prot argument to __vmalloc_node mm: remove both instances of __vmalloc_node_flags mm: remove __vmalloc_node_flags_caller mm: switch the test_vmalloc module to use __vmalloc_node mm: remove vmalloc_user_node_flags arm64: use __vmalloc_node in arch_alloc_vmap_stack powerpc: use __vmalloc_node in alloc_vm_stack s390: use __vmalloc_node in stack_alloc Joerg Roedel <jroedel@suse.de>: Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3: mm: add functions to track page directory modifications mm/vmalloc: track which page-table levels were modified mm/ioremap: track which page-table levels were modified x86/mm/64: implement arch_sync_kernel_mappings() x86/mm/32: implement arch_sync_kernel_mappings() mm: remove vmalloc_sync_(un)mappings() x86/mm: remove vmalloc faulting Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: fix clang compilation warning due to stack protector Kees Cook <keescook@chromium.org>: ubsan: entirely disable alignment checks under UBSAN_TRAP Jing Xia <jing.xia@unisoc.com>: mm/mm_init.c: report kasan-tag information stored in page->flags Andrey Konovalov <andreyknvl@google.com>: kasan: move kasan_report() into report.c Documentation/admin-guide/cgroup-v2.rst | 24 + Documentation/core-api/cachetlb.rst | 2 Documentation/filesystems/locking.rst | 6 Documentation/filesystems/proc.rst | 4 Documentation/filesystems/vfs.rst | 15 Documentation/vm/slub.rst | 2 arch/arm/configs/omap2plus_defconfig | 2 arch/arm64/include/asm/pgtable.h | 3 arch/arm64/include/asm/vmap_stack.h | 6 arch/arm64/mm/dump.c | 2 arch/parisc/include/asm/pgtable.h | 2 arch/powerpc/include/asm/io.h | 10 arch/powerpc/include/asm/pci-bridge.h | 2 arch/powerpc/kernel/irq.c | 5 arch/powerpc/kernel/isa-bridge.c | 28 + arch/powerpc/kernel/pci_64.c | 56 +- arch/powerpc/mm/ioremap_64.c | 50 -- arch/riscv/include/asm/pgtable.h | 4 arch/riscv/mm/ptdump.c | 2 arch/s390/kernel/setup.c | 9 arch/sh/kernel/cpu/sh4/sq.c | 3 arch/x86/hyperv/hv_init.c | 5 arch/x86/include/asm/kvm_host.h | 3 arch/x86/include/asm/pgtable-2level_types.h | 2 arch/x86/include/asm/pgtable-3level_types.h | 2 arch/x86/include/asm/pgtable_64_types.h | 2 arch/x86/include/asm/pgtable_types.h | 8 arch/x86/include/asm/switch_to.h | 23 - arch/x86/kernel/irq_64.c | 2 arch/x86/kernel/setup_percpu.c | 6 arch/x86/kvm/svm/sev.c | 3 arch/x86/mm/dump_pagetables.c | 35 + arch/x86/mm/fault.c | 196 ---------- arch/x86/mm/init_64.c | 5 arch/x86/mm/pti.c | 8 arch/x86/mm/tlb.c | 37 - block/blk-core.c | 1 drivers/acpi/apei/ghes.c | 6 drivers/base/node.c | 2 drivers/block/drbd/drbd_bitmap.c | 4 drivers/block/loop.c | 2 drivers/dax/device.c | 1 drivers/gpu/drm/drm_scatter.c | 11 drivers/gpu/drm/etnaviv/etnaviv_dump.c | 4 drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c | 2 drivers/lightnvm/pblk-init.c | 5 drivers/md/dm-bufio.c | 4 drivers/md/md-bitmap.c | 12 drivers/media/common/videobuf2/videobuf2-dma-sg.c | 3 drivers/media/common/videobuf2/videobuf2-vmalloc.c | 3 drivers/media/pci/ivtv/ivtv-udma.c | 19 - drivers/media/pci/ivtv/ivtv-yuv.c | 17 drivers/media/pci/ivtv/ivtvfb.c | 4 drivers/mtd/ubi/io.c | 4 drivers/pcmcia/electra_cf.c | 45 -- drivers/scsi/sd_zbc.c | 3 drivers/staging/android/ion/ion_heap.c | 4 drivers/staging/media/ipu3/ipu3-css-pool.h | 4 drivers/staging/media/ipu3/ipu3-dmamap.c | 30 - fs/block_dev.c | 7 fs/btrfs/disk-io.c | 4 fs/btrfs/extent_io.c | 64 --- fs/btrfs/extent_io.h | 3 fs/btrfs/inode.c | 39 -- fs/buffer.c | 23 - fs/erofs/data.c | 41 -- fs/erofs/decompressor.c | 2 fs/erofs/zdata.c | 31 - fs/exfat/inode.c | 7 fs/ext2/inode.c | 10 fs/ext4/ext4.h | 5 fs/ext4/inode.c | 25 - fs/ext4/readpage.c | 25 - fs/ext4/verity.c | 35 - fs/f2fs/data.c | 56 +- fs/f2fs/f2fs.h | 14 fs/f2fs/verity.c | 35 - fs/fat/inode.c | 7 fs/file_table.c | 1 fs/fs-writeback.c | 1 fs/fuse/file.c | 100 +---- fs/gfs2/aops.c | 23 - fs/gfs2/dir.c | 9 fs/gfs2/quota.c | 2 fs/hpfs/file.c | 7 fs/iomap/buffered-io.c | 113 +---- fs/iomap/trace.h | 2 fs/isofs/inode.c | 7 fs/jfs/inode.c | 7 fs/mpage.c | 38 -- fs/nfs/blocklayout/extent_tree.c | 2 fs/nfs/internal.h | 10 fs/nfs/write.c | 4 fs/nfsd/vfs.c | 9 fs/nilfs2/inode.c | 15 fs/ntfs/aops.c | 2 fs/ntfs/malloc.h | 2 fs/ntfs/mft.c | 2 fs/ocfs2/aops.c | 34 - fs/ocfs2/dlm/dlmmaster.c | 1 fs/ocfs2/ocfs2.h | 4 fs/ocfs2/slot_map.c | 46 +- fs/ocfs2/super.c | 21 + fs/omfs/file.c | 7 fs/open.c | 3 fs/orangefs/inode.c | 32 - fs/proc/meminfo.c | 3 fs/proc/task_mmu.c | 16 fs/qnx6/inode.c | 7 fs/reiserfs/inode.c | 8 fs/squashfs/block.c | 273 +++++++------- fs/squashfs/decompressor.h | 5 fs/squashfs/decompressor_multi.c | 9 fs/squashfs/decompressor_multi_percpu.c | 17 fs/squashfs/decompressor_single.c | 9 fs/squashfs/lz4_wrapper.c | 17 fs/squashfs/lzo_wrapper.c | 17 fs/squashfs/squashfs.h | 4 fs/squashfs/xz_wrapper.c | 51 +- fs/squashfs/zlib_wrapper.c | 63 +-- fs/squashfs/zstd_wrapper.c | 62 +-- fs/sync.c | 6 fs/ubifs/debug.c | 2 fs/ubifs/lprops.c | 2 fs/ubifs/lpt_commit.c | 4 fs/ubifs/orphan.c | 2 fs/udf/inode.c | 7 fs/xfs/kmem.c | 2 fs/xfs/xfs_aops.c | 13 fs/xfs/xfs_buf.c | 2 fs/zonefs/super.c | 7 include/asm-generic/5level-fixup.h | 5 include/asm-generic/pgtable.h | 27 + include/linux/buffer_head.h | 8 include/linux/fs.h | 18 include/linux/iomap.h | 3 include/linux/memcontrol.h | 4 include/linux/mm.h | 67 ++- include/linux/mm_types.h | 6 include/linux/mmzone.h | 1 include/linux/mpage.h | 4 include/linux/page_counter.h | 8 include/linux/pagemap.h | 193 ++++++++++ include/linux/ptdump.h | 3 include/linux/sched.h | 3 include/linux/swap.h | 17 include/linux/vmalloc.h | 49 +- include/linux/zsmalloc.h | 2 include/trace/events/erofs.h | 6 include/trace/events/f2fs.h | 6 include/trace/events/writeback.h | 5 kernel/bpf/core.c | 6 kernel/bpf/syscall.c | 29 - kernel/dma/remap.c | 48 -- kernel/groups.c | 2 kernel/module.c | 3 kernel/notifier.c | 1 kernel/sys.c | 2 kernel/trace/trace.c | 12 lib/Kconfig.ubsan | 2 lib/ioremap.c | 46 +- lib/test_vmalloc.c | 26 - mm/Kconfig | 4 mm/debug.c | 56 ++ mm/fadvise.c | 6 mm/filemap.c | 1 mm/gup.c | 77 +++- mm/internal.h | 14 mm/kasan/Makefile | 21 - mm/kasan/common.c | 19 - mm/kasan/report.c | 22 + mm/memcontrol.c | 198 +++++++--- mm/memory-failure.c | 15 mm/memory.c | 2 mm/migrate.c | 9 mm/mm_init.c | 16 mm/nommu.c | 52 +- mm/page-writeback.c | 62 ++- mm/page_alloc.c | 7 mm/percpu.c | 2 mm/ptdump.c | 17 mm/readahead.c | 349 ++++++++++-------- mm/slab_common.c | 3 mm/slub.c | 67 ++- mm/swap_state.c | 5 mm/swapfile.c | 194 ++++++---- mm/util.c | 2 mm/vmalloc.c | 399 ++++++++------------- mm/vmscan.c | 4 mm/vmstat.c | 11 mm/zsmalloc.c | 12 net/bridge/netfilter/ebtables.c | 6 net/ceph/ceph_common.c | 3 sound/core/memalloc.c | 2 sound/core/pcm_memory.c | 2 195 files changed, 2292 insertions(+), 2288 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-06-02 4:44 incoming Andrew Morton @ 2020-06-02 20:08 ` Andrew Morton 2020-06-02 20:45 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2020-06-02 20:08 UTC (permalink / raw) To: Linus Torvalds, mm-commits, linux-mm The local_lock merge made rather a mess of all of this. I'm cooking up a full resend of the same material. ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-06-02 20:08 ` incoming Andrew Morton @ 2020-06-02 20:45 ` Linus Torvalds 2020-06-02 21:38 ` incoming Andrew Morton 0 siblings, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2020-06-02 20:45 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Tue, Jun 2, 2020 at 1:08 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > The local_lock merge made rather a mess of all of this. I'm > cooking up a full resend of the same material. Hmm. I have no issues with conflicts, and already took your previous series. I've pushed it out now - does my tree match what you expect? Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-06-02 20:45 ` incoming Linus Torvalds @ 2020-06-02 21:38 ` Andrew Morton 2020-06-02 22:18 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2020-06-02 21:38 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, Linux-MM On Tue, 2 Jun 2020 13:45:49 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Tue, Jun 2, 2020 at 1:08 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > The local_lock merge made rather a mess of all of this. I'm > > cooking up a full resend of the same material. > > Hmm. I have no issues with conflicts, and already took your previous series. Well that's odd. > I've pushed it out now - does my tree match what you expect? Yup, thanks. ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-06-02 21:38 ` incoming Andrew Morton @ 2020-06-02 22:18 ` Linus Torvalds 0 siblings, 0 replies; 348+ messages in thread From: Linus Torvalds @ 2020-06-02 22:18 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Tue, Jun 2, 2020 at 2:38 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > On Tue, 2 Jun 2020 13:45:49 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > > > > Hmm. I have no issues with conflicts, and already took your previous series. > > Well that's odd. I meant "I saw the conflicts and had no issue with them". Nothing odd. And I actually much prefer seeing conflicts from your series (against other pulls I've done) over having you delay your patch bombs because of any fear for them. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-05-28 5:20 Andrew Morton 2020-05-28 20:10 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2020-05-28 5:20 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 5 fixes, based on 444fc5cde64330661bf59944c43844e7d4c2ccd8: Qian Cai <cai@lca.pw>: mm/z3fold: silence kmemleak false positives of slots Hugh Dickins <hughd@google.com>: mm,thp: stop leaking unreleased file pages Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm: remove VM_BUG_ON(PageSlab()) from page_mapcount() Alexander Potapenko <glider@google.com>: fs/binfmt_elf.c: allocate initialized memory in fill_thread_core_info() Arnd Bergmann <arnd@arndb.de>: include/asm-generic/topology.h: guard cpumask_of_node() macro argument fs/binfmt_elf.c | 2 +- include/asm-generic/topology.h | 2 +- include/linux/mm.h | 19 +++++++++++++++---- mm/khugepaged.c | 1 + mm/z3fold.c | 3 +++ 5 files changed, 21 insertions(+), 6 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-05-28 5:20 incoming Andrew Morton @ 2020-05-28 20:10 ` Linus Torvalds 2020-05-29 20:31 ` incoming Andrew Morton 0 siblings, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2020-05-28 20:10 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM Hmm.. On Wed, May 27, 2020 at 10:20 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > fs/binfmt_elf.c | 2 +- > include/asm-generic/topology.h | 2 +- > include/linux/mm.h | 19 +++++++++++++++---- > mm/khugepaged.c | 1 + > mm/z3fold.c | 3 +++ > 5 files changed, 21 insertions(+), 6 deletions(-) I wonder how you generate that diffstat. The change to <linux/mm.h> simply doesn't match what you sent me. The patch you sent me that changed mm.h had this: include/linux/mm.h | 15 +++++++++++++-- 1 file changed, 13 insertions(+), 2 deletions(-) (note 15 lines changed: it's +13 and -2) but now suddenly in your overall diffstat you have that include/linux/mm.h | 19 +++++++++++++++---- with +15/-4. So your diffstat simply doesn't match what you are sending. What's going on? Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-05-28 20:10 ` incoming Linus Torvalds @ 2020-05-29 20:31 ` Andrew Morton 2020-05-29 20:38 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2020-05-29 20:31 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, Linux-MM On Thu, 28 May 2020 13:10:18 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > Hmm.. > > On Wed, May 27, 2020 at 10:20 PM Andrew Morton > <akpm@linux-foundation.org> wrote: > > > > fs/binfmt_elf.c | 2 +- > > include/asm-generic/topology.h | 2 +- > > include/linux/mm.h | 19 +++++++++++++++---- > > mm/khugepaged.c | 1 + > > mm/z3fold.c | 3 +++ > > 5 files changed, 21 insertions(+), 6 deletions(-) > > I wonder how you generate that diffstat. > > The change to <linux/mm.h> simply doesn't match what you sent me. The > patch you sent me that changed mm.h had this: > > include/linux/mm.h | 15 +++++++++++++-- > 1 file changed, 13 insertions(+), 2 deletions(-) > > (note 15 lines changed: it's +13 and -2) but now suddenly in your > overall diffstat you have that > > include/linux/mm.h | 19 +++++++++++++++---- > > with +15/-4. > > So your diffstat simply doesn't match what you are sending. What's going on? > Bah. I got lazy (didn't want to interrupt an ongoing build) so I generated the diffstat prior to folding two patches into a single one. Evidently diffstat isn't as smart as I had assumed! ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-05-29 20:31 ` incoming Andrew Morton @ 2020-05-29 20:38 ` Linus Torvalds 2020-05-29 21:12 ` incoming Andrew Morton 0 siblings, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2020-05-29 20:38 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Fri, May 29, 2020 at 1:31 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > Bah. I got lazy (didn't want to interrupt an ongoing build) so I > generated the diffstat prior to folding two patches into a single one. > Evidently diffstat isn't as smart as I had assumed! Ahh. Yes - given two patches, diffstat just adds up the line number counts for the individual diffs, it doesn't count some kind of "combined diff result" line counts. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-05-29 20:38 ` incoming Linus Torvalds @ 2020-05-29 21:12 ` Andrew Morton 2020-05-29 21:20 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2020-05-29 21:12 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, Linux-MM On Fri, 29 May 2020 13:38:35 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Fri, May 29, 2020 at 1:31 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > Bah. I got lazy (didn't want to interrupt an ongoing build) so I > > generated the diffstat prior to folding two patches into a single one. > > Evidently diffstat isn't as smart as I had assumed! > > Ahh. Yes - given two patches, diffstat just adds up the line number > counts for the individual diffs, it doesn't count some kind of > "combined diff result" line counts. Stupid diffstat. Means that basically all my diffstats are very wrong. Thanks for spotting it. I can fix that... ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-05-29 21:12 ` incoming Andrew Morton @ 2020-05-29 21:20 ` Linus Torvalds 0 siblings, 0 replies; 348+ messages in thread From: Linus Torvalds @ 2020-05-29 21:20 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Fri, May 29, 2020 at 2:12 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > Stupid diffstat. Means that basically all my diffstats are very wrong. I'm actually used to diffstats not matching 100%/ Usually it's not due to this issue - a "git diff --stat" *will* give the stat from the actual combined diff result - but with git diffstats the issue is that I might have gotten a patch from another source. So the diffstat I see after-the-merge is possibly different from the pre-merge diffstat simply due to merge issues. So then I usually take a look at "ok, why did that diffstat differ" and go "Ahh". In your case, when I looked at the diffstat, I couldn't for the life of me see how you would have gotten the diffstat you did, since I only saw a single patch with no merge issues. > Thanks for spotting it. > > I can fix that... I can also just live with it, knowing what your workflow is. The diffstat matching exactly just isn't that important - in fact, different versions of "diff" can give slightly different output anyway depending on diff algorithms even when they are looking at the exact same before/after state. There's not necessarily always only one way to generate a valid diff. So to me, the diffstat is more of a guide than a hard thing, and I want to see the rough outline, In fact, one reason I want to see it in pull requests is actually just that I want to get a feel for what changes even before I do the pull or merge, so it's not just a "match against what I get" thing. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-05-23 5:22 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-05-23 5:22 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 11 fixes, based on 444565650a5fe9c63ddf153e6198e31705dedeb2: David Hildenbrand <david@redhat.com>: device-dax: don't leak kernel memory to user space after unloading kmem Nick Desaulniers <ndesaulniers@google.com>: x86: bitops: fix build regression John Hubbard <jhubbard@nvidia.com>: rapidio: fix an error in get_user_pages_fast() error handling selftests/vm/.gitignore: add mremap_dontunmap selftests/vm/write_to_hugetlbfs.c: fix unused variable warning Marco Elver <elver@google.com>: kasan: disable branch tracing for core runtime Arnd Bergmann <arnd@arndb.de>: sh: include linux/time_types.h for sockios Naoya Horiguchi <n-horiguchi@ah.jp.nec.com>: MAINTAINERS: update email address for Naoya Horiguchi Mike Rapoport <rppt@linux.ibm.com>: sparc32: use PUD rather than PGD to get PMD in srmmu_nocache_init() Uladzislau Rezki <uladzislau.rezki@sony.com>: z3fold: fix use-after-free when freeing handles Baoquan He <bhe@redhat.com>: MAINTAINERS: add files related to kdump MAINTAINERS | 7 ++++++- arch/sh/include/uapi/asm/sockios.h | 2 ++ arch/sparc/mm/srmmu.c | 2 +- arch/x86/include/asm/bitops.h | 12 ++++++------ drivers/dax/kmem.c | 14 +++++++++++--- drivers/rapidio/devices/rio_mport_cdev.c | 5 +++++ mm/kasan/Makefile | 16 ++++++++-------- mm/kasan/generic.c | 1 - mm/kasan/tags.c | 1 - mm/z3fold.c | 11 ++++++----- tools/testing/selftests/vm/.gitignore | 1 + tools/testing/selftests/vm/write_to_hugetlbfs.c | 2 -- 12 files changed, 46 insertions(+), 28 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-05-14 0:50 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-05-14 0:50 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 7 fixes, based on 24085f70a6e1b0cb647ec92623284641d8270637: Yafang Shao <laoar.shao@gmail.com>: mm, memcg: fix inconsistent oom event behavior Roman Penyaev <rpenyaev@suse.de>: epoll: call final ep_events_available() check under the lock Peter Xu <peterx@redhat.com>: mm/gup: fix fixup_user_fault() on multiple retries Brian Geffon <bgeffon@google.com>: userfaultfd: fix remap event with MREMAP_DONTUNMAP Vasily Averin <vvs@virtuozzo.com>: ipc/util.c: sysvipc_find_ipc() incorrectly updates position index Andrey Konovalov <andreyknvl@google.com>: kasan: consistently disable debugging features kasan: add missing functions declarations to kasan.h fs/eventpoll.c | 48 ++++++++++++++++++++++++++------------------- include/linux/memcontrol.h | 2 + ipc/util.c | 12 +++++------ mm/gup.c | 12 ++++++----- mm/kasan/Makefile | 15 +++++++++----- mm/kasan/kasan.h | 34 ++++++++++++++++++++++++++++++- mm/mremap.c | 2 - 7 files changed, 86 insertions(+), 39 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-05-08 1:35 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-05-08 1:35 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 14 fixes and one selftest to verify the ipc fixes herein. 15 patches, based on a811c1fa0a02c062555b54651065899437bacdbe: Oleg Nesterov <oleg@redhat.com>: ipc/mqueue.c: change __do_notify() to bypass check_kill_permission() Yafang Shao <laoar.shao@gmail.com>: mm, memcg: fix error return value of mem_cgroup_css_alloc() David Hildenbrand <david@redhat.com>: mm/page_alloc: fix watchdog soft lockups during set_zone_contiguous() Maciej Grochowski <maciej.grochowski@pm.me>: kernel/kcov.c: fix typos in kcov_remote_start documentation Ivan Delalande <colona@arista.com>: scripts/decodecode: fix trapping instruction formatting Janakarajan Natarajan <Janakarajan.Natarajan@amd.com>: arch/x86/kvm/svm/sev.c: change flag passed to GUP fast in sev_pin_memory() Khazhismel Kumykov <khazhy@google.com>: eventpoll: fix missing wakeup for ovflist in ep_poll_callback Aymeric Agon-Rambosson <aymeric.agon@yandex.com>: scripts/gdb: repair rb_first() and rb_last() Waiman Long <longman@redhat.com>: mm/slub: fix incorrect interpretation of s->offset Filipe Manana <fdmanana@suse.com>: percpu: make pcpu_alloc() aware of current gfp context Roman Penyaev <rpenyaev@suse.de>: kselftests: introduce new epoll60 testcase for catching lost wakeups epoll: atomically remove wait entry on wake up Qiwu Chen <qiwuchen55@gmail.com>: mm/vmscan: remove unnecessary argument description of isolate_lru_pages() Kees Cook <keescook@chromium.org>: ubsan: disable UBSAN_ALIGNMENT under COMPILE_TEST Henry Willard <henry.willard@oracle.com>: mm: limit boost_watermark on small zones arch/x86/kvm/svm/sev.c | 2 fs/eventpoll.c | 61 ++-- ipc/mqueue.c | 34 +- kernel/kcov.c | 4 lib/Kconfig.ubsan | 15 - mm/memcontrol.c | 15 - mm/page_alloc.c | 9 mm/percpu.c | 14 mm/slub.c | 45 ++- mm/vmscan.c | 1 scripts/decodecode | 2 scripts/gdb/linux/rbtree.py | 4 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 146 ++++++++++ tools/testing/selftests/wireguard/qemu/debug.config | 1 14 files changed, 275 insertions(+), 78 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-04-21 1:13 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-04-21 1:13 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 15 fixes, based on ae83d0b416db002fe95601e7f97f64b59514d936: Masahiro Yamada <masahiroy@kernel.org>: sh: fix build error in mm/init.c Kees Cook <keescook@chromium.org>: slub: avoid redzone when choosing freepointer location Peter Xu <peterx@redhat.com>: mm/userfaultfd: disable userfaultfd-wp on x86_32 Bartosz Golaszewski <bgolaszewski@baylibre.com>: MAINTAINERS: add an entry for kfifo Longpeng <longpeng2@huawei.com>: mm/hugetlb: fix a addressing exception caused by huge_pte_offset Michal Hocko <mhocko@suse.com>: mm, gup: return EINTR when gup is interrupted by fatal signals Christophe JAILLET <christophe.jaillet@wanadoo.fr>: checkpatch: fix a typo in the regex for $allocFunctions George Burgess IV <gbiv@google.com>: tools/build: tweak unused value workaround Muchun Song <songmuchun@bytedance.com>: mm/ksm: fix NULL pointer dereference when KSM zero page is enabled Hugh Dickins <hughd@google.com>: mm/shmem: fix build without THP Jann Horn <jannh@google.com>: vmalloc: fix remap_vmalloc_range() bounds checks Hugh Dickins <hughd@google.com>: shmem: fix possible deadlocks on shmlock_user_lock Yang Shi <yang.shi@linux.alibaba.com>: mm: shmem: disable interrupt when acquiring info->lock in userfaultfd_copy path Sudip Mukherjee <sudipm.mukherjee@gmail.com>: coredump: fix null pointer dereference on coredump Lucas Stach <l.stach@pengutronix.de>: tools/vm: fix cross-compile build MAINTAINERS | 7 +++++++ arch/sh/mm/init.c | 2 +- arch/x86/Kconfig | 2 +- fs/coredump.c | 2 ++ fs/proc/vmcore.c | 5 +++-- include/linux/vmalloc.h | 2 +- mm/gup.c | 2 +- mm/hugetlb.c | 14 ++++++++------ mm/ksm.c | 12 ++++++++++-- mm/shmem.c | 13 ++++++++----- mm/slub.c | 12 ++++++++++-- mm/vmalloc.c | 16 +++++++++++++--- samples/vfio-mdev/mdpy.c | 2 +- scripts/checkpatch.pl | 2 +- tools/build/feature/test-sync-compare-and-swap.c | 2 +- tools/vm/Makefile | 2 ++ 16 files changed, 70 insertions(+), 27 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-04-12 7:41 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-04-12 7:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm A straggler. This patch caused a lot of build errors on a lot of architectures for a long time, but Anshuman believes it's all fixed up now. 1 patch, based on GIT b032227c62939b5481bcd45442b36dfa263f4a7c. Anshuman Khandual <anshuman.khandual@arm.com>: mm/debug: add tests validating architecture page table helpers Documentation/features/debug/debug-vm-pgtable/arch-support.txt | 34 arch/arc/Kconfig | 1 arch/arm64/Kconfig | 1 arch/powerpc/Kconfig | 1 arch/s390/Kconfig | 1 arch/x86/Kconfig | 1 arch/x86/include/asm/pgtable_64.h | 6 include/linux/mmdebug.h | 5 init/main.c | 2 lib/Kconfig.debug | 26 mm/Makefile | 1 mm/debug_vm_pgtable.c | 392 ++++++++++ 12 files changed, 471 insertions(+) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-04-10 21:30 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-04-10 21:30 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm Almost all of the rest of MM. Various other things. 35 patches, based on c0cc271173b2e1c2d8d0ceaef14e4dfa79eefc0d. Subsystems affected by this patch series: hfs mm/memcg mm/slab-generic mm/slab mm/pagealloc mm/gup ocfs2 mm/hugetlb mm/pagemap mm/memremap kmod misc seqfile Subsystem: hfs Simon Gander <simon@tuxera.com>: hfsplus: fix crash and filesystem corruption when deleting files Subsystem: mm/memcg Jakub Kicinski <kuba@kernel.org>: mm, memcg: do not high throttle allocators based on wraparound Subsystem: mm/slab-generic Qiujun Huang <hqjagain@gmail.com>: mm, slab_common: fix a typo in comment "eariler"->"earlier" Subsystem: mm/slab Mauro Carvalho Chehab <mchehab+huawei@kernel.org>: docs: mm: slab.h: fix a broken cross-reference Subsystem: mm/pagealloc Randy Dunlap <rdunlap@infradead.org>: mm/page_alloc.c: fix kernel-doc warning Jason Yan <yanaijie@huawei.com>: mm/page_alloc: make pcpu_drain_mutex and pcpu_drain static Subsystem: mm/gup Miles Chen <miles.chen@mediatek.com>: mm/gup: fix null pointer dereference detected by coverity Subsystem: ocfs2 Changwei Ge <chge@linux.alibaba.com>: ocfs2: no need try to truncate file beyond i_size Subsystem: mm/hugetlb Aslan Bakirov <aslan@fb.com>: mm: cma: NUMA node interface Roman Gushchin <guro@fb.com>: mm: hugetlb: optionally allocate gigantic hugepages using cma Subsystem: mm/pagemap Jaewon Kim <jaewon31.kim@samsung.com>: mm/mmap.c: initialize align_offset explicitly for vm_unmapped_area Arjun Roy <arjunroy@google.com>: mm/memory.c: refactor insert_page to prepare for batched-lock insert mm: bring sparc pte_index() semantics inline with other platforms mm: define pte_index as macro for x86 mm/memory.c: add vm_insert_pages() Anshuman Khandual <anshuman.khandual@arm.com>: mm/vma: define a default value for VM_DATA_DEFAULT_FLAGS mm/vma: introduce VM_ACCESS_FLAGS mm/special: create generic fallbacks for pte_special() and pte_mkspecial() Subsystem: mm/memremap Logan Gunthorpe <logang@deltatee.com>: Patch series "Allow setting caching mode in arch_add_memory() for P2PDMA", v4: mm/memory_hotplug: drop the flags field from struct mhp_restrictions mm/memory_hotplug: rename mhp_restrictions to mhp_params x86/mm: thread pgprot_t through init_memory_mapping() x86/mm: introduce __set_memory_prot() powerpc/mm: thread pgprot_t through create_section_mapping() mm/memory_hotplug: add pgprot_t to mhp_params mm/memremap: set caching mode for PCI P2PDMA memory to WC Subsystem: kmod Eric Biggers <ebiggers@google.com>: Patch series "module autoloading fixes and cleanups", v5: kmod: make request_module() return an error when autoloading is disabled fs/filesystems.c: downgrade user-reachable WARN_ONCE() to pr_warn_once() docs: admin-guide: document the kernel.modprobe sysctl selftests: kmod: fix handling test numbers above 9 selftests: kmod: test disabling module autoloading Subsystem: misc Pali Rohár <pali@kernel.org>: change email address for Pali Rohár kbuild test robot <lkp@intel.com>: drivers/dma/tegra20-apb-dma.c: fix platform_get_irq.cocci warnings Subsystem: seqfile Vasily Averin <vvs@virtuozzo.com>: Patch series "seq_file .next functions should increase position index": fs/seq_file.c: seq_read(): add info message about buggy .next functions kernel/gcov/fs.c: gcov_seq_next() should increase position index ipc/util.c: sysvipc_find_ipc() should increase position index Documentation/ABI/testing/sysfs-platform-dell-laptop | 8 Documentation/admin-guide/kernel-parameters.txt | 8 Documentation/admin-guide/sysctl/kernel.rst | 21 ++ MAINTAINERS | 16 - arch/alpha/include/asm/page.h | 3 arch/alpha/include/asm/pgtable.h | 2 arch/arc/include/asm/page.h | 2 arch/arm/include/asm/page.h | 4 arch/arm/include/asm/pgtable-2level.h | 2 arch/arm/include/asm/pgtable.h | 15 - arch/arm/mach-omap2/omap-secure.c | 2 arch/arm/mach-omap2/omap-secure.h | 2 arch/arm/mach-omap2/omap-smc.S | 2 arch/arm/mm/fault.c | 2 arch/arm/mm/mmu.c | 14 + arch/arm64/include/asm/page.h | 4 arch/arm64/mm/fault.c | 2 arch/arm64/mm/init.c | 6 arch/arm64/mm/mmu.c | 7 arch/c6x/include/asm/page.h | 5 arch/csky/include/asm/page.h | 3 arch/csky/include/asm/pgtable.h | 3 arch/h8300/include/asm/page.h | 2 arch/hexagon/include/asm/page.h | 3 arch/hexagon/include/asm/pgtable.h | 2 arch/ia64/include/asm/page.h | 5 arch/ia64/include/asm/pgtable.h | 2 arch/ia64/mm/init.c | 7 arch/m68k/include/asm/mcf_pgtable.h | 10 - arch/m68k/include/asm/motorola_pgtable.h | 2 arch/m68k/include/asm/page.h | 3 arch/m68k/include/asm/sun3_pgtable.h | 2 arch/microblaze/include/asm/page.h | 2 arch/microblaze/include/asm/pgtable.h | 4 arch/mips/include/asm/page.h | 5 arch/mips/include/asm/pgtable.h | 44 +++- arch/nds32/include/asm/page.h | 3 arch/nds32/include/asm/pgtable.h | 9 - arch/nds32/mm/fault.c | 2 arch/nios2/include/asm/page.h | 3 arch/nios2/include/asm/pgtable.h | 3 arch/openrisc/include/asm/page.h | 5 arch/openrisc/include/asm/pgtable.h | 2 arch/parisc/include/asm/page.h | 3 arch/parisc/include/asm/pgtable.h | 2 arch/powerpc/include/asm/book3s/64/hash.h | 3 arch/powerpc/include/asm/book3s/64/radix.h | 3 arch/powerpc/include/asm/page.h | 9 - arch/powerpc/include/asm/page_64.h | 7 arch/powerpc/include/asm/sparsemem.h | 3 arch/powerpc/mm/book3s64/hash_utils.c | 5 arch/powerpc/mm/book3s64/pgtable.c | 7 arch/powerpc/mm/book3s64/pkeys.c | 2 arch/powerpc/mm/book3s64/radix_pgtable.c | 18 +- arch/powerpc/mm/mem.c | 12 - arch/riscv/include/asm/page.h | 3 arch/s390/include/asm/page.h | 3 arch/s390/mm/fault.c | 2 arch/s390/mm/init.c | 9 - arch/sh/include/asm/page.h | 3 arch/sh/mm/init.c | 7 arch/sparc/include/asm/page_32.h | 3 arch/sparc/include/asm/page_64.h | 3 arch/sparc/include/asm/pgtable_32.h | 7 arch/sparc/include/asm/pgtable_64.h | 10 - arch/um/include/asm/pgtable.h | 10 - arch/unicore32/include/asm/page.h | 3 arch/unicore32/include/asm/pgtable.h | 3 arch/unicore32/mm/fault.c | 2 arch/x86/include/asm/page_types.h | 7 arch/x86/include/asm/pgtable.h | 6 arch/x86/include/asm/set_memory.h | 1 arch/x86/kernel/amd_gart_64.c | 3 arch/x86/kernel/setup.c | 4 arch/x86/mm/init.c | 9 - arch/x86/mm/init_32.c | 19 +- arch/x86/mm/init_64.c | 42 ++-- arch/x86/mm/mm_internal.h | 3 arch/x86/mm/pat/set_memory.c | 13 + arch/x86/mm/pkeys.c | 2 arch/x86/platform/uv/bios_uv.c | 3 arch/x86/um/asm/vm-flags.h | 10 - arch/xtensa/include/asm/page.h | 3 arch/xtensa/include/asm/pgtable.h | 3 drivers/char/hw_random/omap3-rom-rng.c | 4 drivers/dma/tegra20-apb-dma.c | 1 drivers/hwmon/dell-smm-hwmon.c | 4 drivers/platform/x86/dell-laptop.c | 4 drivers/platform/x86/dell-rbtn.c | 4 drivers/platform/x86/dell-rbtn.h | 2 drivers/platform/x86/dell-smbios-base.c | 4 drivers/platform/x86/dell-smbios-smm.c | 2 drivers/platform/x86/dell-smbios.h | 2 drivers/platform/x86/dell-smo8800.c | 2 drivers/platform/x86/dell-wmi.c | 4 drivers/power/supply/bq2415x_charger.c | 4 drivers/power/supply/bq27xxx_battery.c | 2 drivers/power/supply/isp1704_charger.c | 2 drivers/power/supply/rx51_battery.c | 4 drivers/staging/gasket/gasket_core.c | 2 fs/filesystems.c | 4 fs/hfsplus/attributes.c | 4 fs/ocfs2/alloc.c | 4 fs/seq_file.c | 7 fs/udf/ecma_167.h | 2 fs/udf/osta_udf.h | 2 include/linux/cma.h | 14 + include/linux/hugetlb.h | 12 + include/linux/memblock.h | 3 include/linux/memory_hotplug.h | 21 +- include/linux/mm.h | 34 +++ include/linux/power/bq2415x_charger.h | 2 include/linux/slab.h | 2 ipc/util.c | 2 kernel/gcov/fs.c | 2 kernel/kmod.c | 4 mm/cma.c | 16 + mm/gup.c | 3 mm/hugetlb.c | 109 ++++++++++++ mm/memblock.c | 2 mm/memcontrol.c | 3 mm/memory.c | 168 +++++++++++++++++-- mm/memory_hotplug.c | 13 - mm/memremap.c | 17 + mm/mmap.c | 4 mm/mprotect.c | 4 mm/page_alloc.c | 5 mm/slab_common.c | 2 tools/laptop/freefall/freefall.c | 2 tools/testing/selftests/kmod/kmod.sh | 43 ++++ 130 files changed, 710 insertions(+), 370 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-04-07 3:02 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-04-07 3:02 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits - a lot more of MM, quite a bit more yet to come. - various other subsystems 166 patches based on 7e63420847ae5f1036e4f7c42f0b3282e73efbc2. Subsystems affected by this patch series: mm/memcg mm/pagemap mm/vmalloc mm/pagealloc mm/migration mm/thp mm/ksm mm/madvise mm/virtio mm/userfaultfd mm/memory-hotplug mm/shmem mm/rmap mm/zswap mm/zsmalloc mm/cleanups procfs misc MAINTAINERS bitops lib checkpatch epoll binfmt kallsyms reiserfs kmod gcov kconfig kcov ubsan fault-injection ipc Subsystem: mm/memcg Chris Down <chris@chrisdown.name>: mm, memcg: bypass high reclaim iteration for cgroup hierarchy root Subsystem: mm/pagemap Li Xinhai <lixinhai.lxh@gmail.com>: Patch series "mm: Fix misuse of parent anon_vma in dup_mmap path": mm: don't prepare anon_vma if vma has VM_WIPEONFORK Revert "mm/rmap.c: reuse mergeable anon_vma as parent when fork" mm: set vm_next and vm_prev to NULL in vm_area_dup() Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/vma: Use all available wrappers when possible", v2: mm/vma: add missing VMA flag readable name for VM_SYNC mm/vma: make vma_is_accessible() available for general use mm/vma: replace all remaining open encodings with is_vm_hugetlb_page() mm/vma: replace all remaining open encodings with vma_is_anonymous() mm/vma: append unlikely() while testing VMA access permissions Subsystem: mm/vmalloc Qiujun Huang <hqjagain@gmail.com>: mm/vmalloc: fix a typo in comment Subsystem: mm/pagealloc Michal Hocko <mhocko@suse.com>: mm: make it clear that gfp reclaim modifiers are valid only for sleepable allocations Subsystem: mm/migration Wei Yang <richardw.yang@linux.intel.com>: Patch series "cleanup on do_pages_move()", v5: mm/migrate.c: no need to check for i > start in do_pages_move() mm/migrate.c: wrap do_move_pages_to_node() and store_status() mm/migrate.c: check pagelist in move_pages_and_store_status() mm/migrate.c: unify "not queued for migration" handling in do_pages_move() Yang Shi <yang.shi@linux.alibaba.com>: mm/migrate.c: migrate PG_readahead flag Subsystem: mm/thp David Rientjes <rientjes@google.com>: mm, shmem: add vmstat for hugepage fallback mm, thp: track fallbacks due to failed memcg charges separately "Matthew Wilcox (Oracle)" <willy@infradead.org>: include/linux/pagemap.h: optimise find_subpage for !THP mm: remove CONFIG_TRANSPARENT_HUGE_PAGECACHE Subsystem: mm/ksm Li Chen <chenli@uniontech.com>: mm/ksm.c: update get_user_pages() argument in comment Subsystem: mm/madvise Huang Ying <ying.huang@intel.com>: mm: code cleanup for MADV_FREE Subsystem: mm/virtio Alexander Duyck <alexander.h.duyck@linux.intel.com>: Patch series "mm / virtio: Provide support for free page reporting", v17: mm: adjust shuffle code to allow for future coalescing mm: use zone and order instead of free area in free_list manipulators mm: add function __putback_isolated_page mm: introduce Reported pages virtio-balloon: pull page poisoning config out of free page hinting virtio-balloon: add support for providing free page reports to host mm/page_reporting: rotate reported pages to the tail of the list mm/page_reporting: add budget limit on how many pages can be reported per pass mm/page_reporting: add free page reporting documentation David Hildenbrand <david@redhat.com>: virtio-balloon: switch back to OOM handler for VIRTIO_BALLOON_F_DEFLATE_ON_OOM Subsystem: mm/userfaultfd Shaohua Li <shli@fb.com>: Patch series "userfaultfd: write protection support", v6: userfaultfd: wp: add helper for writeprotect check Andrea Arcangeli <aarcange@redhat.com>: userfaultfd: wp: hook userfault handler to write protection fault userfaultfd: wp: add WP pagetable tracking to x86 userfaultfd: wp: userfaultfd_pte/huge_pmd_wp() helpers userfaultfd: wp: add UFFDIO_COPY_MODE_WP Peter Xu <peterx@redhat.com>: mm: merge parameters for change_protection() userfaultfd: wp: apply _PAGE_UFFD_WP bit userfaultfd: wp: drop _PAGE_UFFD_WP properly when fork userfaultfd: wp: add pmd_swp_*uffd_wp() helpers userfaultfd: wp: support swap and page migration khugepaged: skip collapse if uffd-wp detected Shaohua Li <shli@fb.com>: userfaultfd: wp: support write protection for userfault vma range Andrea Arcangeli <aarcange@redhat.com>: userfaultfd: wp: add the writeprotect API to userfaultfd ioctl Shaohua Li <shli@fb.com>: userfaultfd: wp: enabled write protection in userfaultfd API Peter Xu <peterx@redhat.com>: userfaultfd: wp: don't wake up when doing write protect Martin Cracauer <cracauer@cons.org>: userfaultfd: wp: UFFDIO_REGISTER_MODE_WP documentation update Peter Xu <peterx@redhat.com>: userfaultfd: wp: declare _UFFDIO_WRITEPROTECT conditionally userfaultfd: selftests: refactor statistics userfaultfd: selftests: add write-protect test Subsystem: mm/memory-hotplug David Hildenbrand <david@redhat.com>: Patch series "mm: drop superfluous section checks when onlining/offlining": drivers/base/memory.c: drop section_count drivers/base/memory.c: drop pages_correctly_probed() mm/page_ext.c: drop pfn_present() check when onlining Baoquan He <bhe@redhat.com>: mm/memory_hotplug.c: only respect mem= parameter during boot stage David Hildenbrand <david@redhat.com>: mm/memory_hotplug.c: simplify calculation of number of pages in __remove_pages() mm/memory_hotplug.c: cleanup __add_pages() Baoquan He <bhe@redhat.com>: Patch series "mm/hotplug: Only use subsection map for VMEMMAP", v4: mm/sparse.c: introduce new function fill_subsection_map() mm/sparse.c: introduce a new function clear_subsection_map() mm/sparse.c: only use subsection map in VMEMMAP case mm/sparse.c: add note about only VMEMMAP supporting sub-section hotplug mm/sparse.c: move subsection_map related functions together David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: allow to specify a default online_type", v3: drivers/base/memory: rename MMOP_ONLINE_KEEP to MMOP_ONLINE drivers/base/memory: map MMOP_OFFLINE to 0 drivers/base/memory: store mapping between MMOP_* and string in an array powernv/memtrace: always online added memory blocks hv_balloon: don't check for memhp_auto_online manually mm/memory_hotplug: unexport memhp_auto_online mm/memory_hotplug: convert memhp_auto_online to store an online_type mm/memory_hotplug: allow to specify a default online_type chenqiwu <chenqiwu@xiaomi.com>: mm/memory_hotplug.c: use __pfn_to_section() instead of open-coding Subsystem: mm/shmem Kees Cook <keescook@chromium.org>: mm/shmem.c: distribute switch variables for initialization Mateusz Nosek <mateusznosek0@gmail.com>: mm/shmem.c: clean code by removing unnecessary assignment Hugh Dickins <hughd@google.com>: mm: huge tmpfs: try to split_huge_page() when punching hole Subsystem: mm/rmap Palmer Dabbelt <palmerdabbelt@google.com>: mm: prevent a warning when casting void* -> enum Subsystem: mm/zswap "Maciej S. Szmigiero" <mail@maciej.szmigiero.name>: mm/zswap: allow setting default status, compressor and allocator in Kconfig Subsystem: mm/zsmalloc Subsystem: mm/cleanups Jules Irenge <jbi.octave@gmail.com>: mm/compaction: add missing annotation for compact_lock_irqsave mm/hugetlb: add missing annotation for gather_surplus_pages() mm/mempolicy: add missing annotation for queue_pages_pmd() mm/slub: add missing annotation for get_map() mm/slub: add missing annotation for put_map() mm/zsmalloc: add missing annotation for migrate_read_lock() mm/zsmalloc: add missing annotation for migrate_read_unlock() mm/zsmalloc: add missing annotation for pin_tag() mm/zsmalloc: add missing annotation for unpin_tag() chenqiwu <chenqiwu@xiaomi.com>: mm: fix ambiguous comments for better code readability Mateusz Nosek <mateusznosek0@gmail.com>: mm/mm_init.c: clean code. Use BUILD_BUG_ON when comparing compile time constant Joe Perches <joe@perches.com>: mm: use fallthrough; Steven Price <steven.price@arm.com>: include/linux/swapops.h: correct guards for non_swap_entry() Ira Weiny <ira.weiny@intel.com>: include/linux/memremap.h: remove stale comments Mateusz Nosek <mateusznosek0@gmail.com>: mm/dmapool.c: micro-optimisation remove unnecessary branch Waiman Long <longman@redhat.com>: mm: remove dummy struct bootmem_data/bootmem_data_t Subsystem: procfs Jules Irenge <jbi.octave@gmail.com>: fs/proc/inode.c: annotate close_pdeo() for sparse Alexey Dobriyan <adobriyan@gmail.com>: proc: faster open/read/close with "permanent" files proc: speed up /proc/*/statm "Matthew Wilcox (Oracle)" <willy@infradead.org>: proc: inline vma_stop into m_stop proc: remove m_cache_vma proc: use ppos instead of m->version seq_file: remove m->version proc: inline m_next_vma into m_next Subsystem: misc Michal Simek <michal.simek@xilinx.com>: asm-generic: fix unistd_32.h generation format Nathan Chancellor <natechancellor@gmail.com>: kernel/extable.c: use address-of operator on section symbols Masahiro Yamada <masahiroy@kernel.org>: sparc,x86: vdso: remove meaningless undefining CONFIG_OPTIMIZE_INLINING compiler: remove CONFIG_OPTIMIZE_INLINING entirely Vegard Nossum <vegard.nossum@oracle.com>: compiler.h: fix error in BUILD_BUG_ON() reporting Subsystem: MAINTAINERS Joe Perches <joe@perches.com>: MAINTAINERS: list the section entries in the preferred order Subsystem: bitops Josh Poimboeuf <jpoimboe@redhat.com>: bitops: always inline sign extension helpers Subsystem: lib Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: lib/test_lockup: test module to generate lockups Colin Ian King <colin.king@canonical.com>: lib/test_lockup.c: fix spelling mistake "iteraions" -> "iterations" Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: lib/test_lockup.c: add parameters for locking generic vfs locks "Gustavo A. R. Silva" <gustavo@embeddedor.com>: lib/bch.c: replace zero-length array with flexible-array member lib/ts_bm.c: replace zero-length array with flexible-array member lib/ts_fsm.c: replace zero-length array with flexible-array member lib/ts_kmp.c: replace zero-length array with flexible-array member Geert Uytterhoeven <geert+renesas@glider.be>: lib/scatterlist: fix sg_copy_buffer() kerneldoc Kees Cook <keescook@chromium.org>: lib: test_stackinit.c: XFAIL switch variable init tests Alexander Potapenko <glider@google.com>: lib/stackdepot.c: check depot_index before accessing the stack slab lib/stackdepot.c: fix a condition in stack_depot_fetch() lib/stackdepot.c: build with -fno-builtin kasan: stackdepot: move filter_irq_stacks() to stackdepot.c Qian Cai <cai@lca.pw>: percpu_counter: fix a data race at vm_committed_as Andy Shevchenko <andriy.shevchenko@linux.intel.com>: lib/test_bitmap.c: make use of EXP2_IN_BITS chenqiwu <chenqiwu@xiaomi.com>: lib/rbtree: fix coding style of assignments Dan Carpenter <dan.carpenter@oracle.com>: lib/test_kmod.c: remove a NULL test Rikard Falkeborn <rikard.falkeborn@gmail.com>: linux/bits.h: add compile time sanity check of GENMASK inputs Chris Wilson <chris@chris-wilson.co.uk>: lib/list: prevent compiler reloads inside 'safe' list iteration Nathan Chancellor <natechancellor@gmail.com>: lib/dynamic_debug.c: use address-of operator on section symbols Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: remove email address comment from email address comparisons Lubomir Rintel <lkundrak@v3.sk>: checkpatch: check SPDX tags in YAML files John Hubbard <jhubbard@nvidia.com>: checkpatch: support "base-commit:" format Joe Perches <joe@perches.com>: checkpatch: prefer fallthrough; over fallthrough comments Antonio Borneo <borneo.antonio@gmail.com>: checkpatch: fix minor typo and mixed space+tab in indentation checkpatch: fix multiple const * types checkpatch: add command-line option for TAB size Joe Perches <joe@perches.com>: checkpatch: improve Gerrit Change-Id: test Lubomir Rintel <lkundrak@v3.sk>: checkpatch: check proper licensing of Devicetree bindings Joe Perches <joe@perches.com>: checkpatch: avoid warning about uninitialized_var() Subsystem: epoll Roman Penyaev <rpenyaev@suse.de>: kselftest: introduce new epoll test case Jason Baron <jbaron@akamai.com>: fs/epoll: make nesting accounting safe for -rt kernel Subsystem: binfmt Alexey Dobriyan <adobriyan@gmail.com>: fs/binfmt_elf.c: delete "loc" variable fs/binfmt_elf.c: allocate less for static executable fs/binfmt_elf.c: don't free interpreter's ELF pheaders on common path Subsystem: kallsyms Will Deacon <will@kernel.org>: Patch series "Unexport kallsyms_lookup_name() and kallsyms_on_each_symbol()": samples/hw_breakpoint: drop HW_BREAKPOINT_R when reporting writes samples/hw_breakpoint: drop use of kallsyms_lookup_name() kallsyms: unexport kallsyms_lookup_name() and kallsyms_on_each_symbol() Subsystem: reiserfs Colin Ian King <colin.king@canonical.com>: reiserfs: clean up several indentation issues Subsystem: kmod Qiujun Huang <hqjagain@gmail.com>: kernel/kmod.c: fix a typo "assuems" -> "assumes" Subsystem: gcov "Gustavo A. R. Silva" <gustavo@embeddedor.com>: gcov: gcc_4_7: replace zero-length array with flexible-array member gcov: gcc_3_4: replace zero-length array with flexible-array member kernel/gcov/fs.c: replace zero-length array with flexible-array member Subsystem: kconfig Krzysztof Kozlowski <krzk@kernel.org>: init/Kconfig: clean up ANON_INODES and old IO schedulers options Subsystem: kcov Andrey Konovalov <andreyknvl@google.com>: Patch series "kcov: collect coverage from usb soft interrupts", v4: kcov: cleanup debug messages kcov: fix potential use-after-free in kcov_remote_start kcov: move t->kcov assignments into kcov_start/stop kcov: move t->kcov_sequence assignment kcov: use t->kcov_mode as enabled indicator kcov: collect coverage from interrupts usb: core: kcov: collect coverage from usb complete callback Subsystem: ubsan Kees Cook <keescook@chromium.org>: Patch series "ubsan: Split out bounds checker", v5: ubsan: add trap instrumentation option ubsan: split "bounds" checker from other options drivers/misc/lkdtm/bugs.c: add arithmetic overflow and array bounds checks ubsan: check panic_on_warn kasan: unset panic_on_warn before calling panic() ubsan: include bug type in report header Subsystem: fault-injection Qiujun Huang <hqjagain@gmail.com>: lib/Kconfig.debug: fix a typo "capabilitiy" -> "capability" Subsystem: ipc Somala Swaraj <somalaswaraj@gmail.com>: ipc/mqueue.c: fix a brace coding style issue Jason Yan <yanaijie@huawei.com>: ipc/shm.c: make compat_ksys_shmctl() static Documentation/admin-guide/kernel-parameters.txt | 13 Documentation/admin-guide/mm/transhuge.rst | 14 Documentation/admin-guide/mm/userfaultfd.rst | 51 Documentation/dev-tools/kcov.rst | 17 Documentation/vm/free_page_reporting.rst | 41 Documentation/vm/zswap.rst | 20 MAINTAINERS | 35 arch/alpha/include/asm/mmzone.h | 2 arch/alpha/kernel/syscalls/syscallhdr.sh | 2 arch/csky/mm/fault.c | 4 arch/ia64/kernel/syscalls/syscallhdr.sh | 2 arch/ia64/kernel/vmlinux.lds.S | 2 arch/m68k/mm/fault.c | 4 arch/microblaze/kernel/syscalls/syscallhdr.sh | 2 arch/mips/kernel/syscalls/syscallhdr.sh | 3 arch/mips/mm/fault.c | 4 arch/nds32/kernel/vmlinux.lds.S | 1 arch/parisc/kernel/syscalls/syscallhdr.sh | 2 arch/powerpc/kernel/syscalls/syscallhdr.sh | 3 arch/powerpc/kvm/e500_mmu_host.c | 2 arch/powerpc/mm/fault.c | 2 arch/powerpc/platforms/powernv/memtrace.c | 14 arch/sh/kernel/syscalls/syscallhdr.sh | 2 arch/sh/mm/fault.c | 2 arch/sparc/kernel/syscalls/syscallhdr.sh | 2 arch/sparc/vdso/vdso32/vclock_gettime.c | 4 arch/x86/Kconfig | 1 arch/x86/configs/i386_defconfig | 1 arch/x86/configs/x86_64_defconfig | 1 arch/x86/entry/vdso/vdso32/vclock_gettime.c | 4 arch/x86/include/asm/pgtable.h | 67 + arch/x86/include/asm/pgtable_64.h | 8 arch/x86/include/asm/pgtable_types.h | 12 arch/x86/mm/fault.c | 2 arch/xtensa/kernel/syscalls/syscallhdr.sh | 2 drivers/base/memory.c | 138 -- drivers/hv/hv_balloon.c | 25 drivers/misc/lkdtm/bugs.c | 75 + drivers/misc/lkdtm/core.c | 3 drivers/misc/lkdtm/lkdtm.h | 3 drivers/usb/core/hcd.c | 3 drivers/virtio/Kconfig | 1 drivers/virtio/virtio_balloon.c | 190 ++- fs/binfmt_elf.c | 56 fs/eventpoll.c | 64 - fs/proc/array.c | 39 fs/proc/cpuinfo.c | 1 fs/proc/generic.c | 31 fs/proc/inode.c | 188 ++- fs/proc/internal.h | 6 fs/proc/kmsg.c | 1 fs/proc/stat.c | 1 fs/proc/task_mmu.c | 97 - fs/reiserfs/do_balan.c | 2 fs/reiserfs/ioctl.c | 11 fs/reiserfs/namei.c | 10 fs/seq_file.c | 28 fs/userfaultfd.c | 116 + include/asm-generic/pgtable.h | 1 include/asm-generic/pgtable_uffd.h | 66 + include/asm-generic/tlb.h | 3 include/linux/bitops.h | 4 include/linux/bits.h | 22 include/linux/compiler.h | 2 include/linux/compiler_types.h | 11 include/linux/gfp.h | 2 include/linux/huge_mm.h | 2 include/linux/list.h | 50 include/linux/memory.h | 1 include/linux/memory_hotplug.h | 13 include/linux/memremap.h | 2 include/linux/mm.h | 25 include/linux/mm_inline.h | 15 include/linux/mm_types.h | 4 include/linux/mmzone.h | 47 include/linux/page-flags.h | 16 include/linux/page_reporting.h | 26 include/linux/pagemap.h | 4 include/linux/percpu_counter.h | 4 include/linux/proc_fs.h | 17 include/linux/sched.h | 3 include/linux/seq_file.h | 1 include/linux/shmem_fs.h | 10 include/linux/stackdepot.h | 2 include/linux/swapops.h | 5 include/linux/userfaultfd_k.h | 42 include/linux/vm_event_item.h | 5 include/trace/events/huge_memory.h | 1 include/trace/events/mmflags.h | 1 include/trace/events/vmscan.h | 2 include/uapi/linux/userfaultfd.h | 40 include/uapi/linux/virtio_balloon.h | 1 init/Kconfig | 8 ipc/mqueue.c | 5 ipc/shm.c | 2 ipc/util.c | 1 kernel/configs/tiny.config | 1 kernel/events/core.c | 3 kernel/extable.c | 3 kernel/fork.c | 10 kernel/gcov/fs.c | 2 kernel/gcov/gcc_3_4.c | 6 kernel/gcov/gcc_4_7.c | 2 kernel/kallsyms.c | 2 kernel/kcov.c | 282 +++- kernel/kmod.c | 2 kernel/module.c | 1 kernel/sched/fair.c | 2 lib/Kconfig.debug | 35 lib/Kconfig.ubsan | 51 lib/Makefile | 8 lib/bch.c | 2 lib/dynamic_debug.c | 2 lib/rbtree.c | 4 lib/scatterlist.c | 2 lib/stackdepot.c | 39 lib/test_bitmap.c | 2 lib/test_kmod.c | 2 lib/test_lockup.c | 601 +++++++++- lib/test_stackinit.c | 28 lib/ts_bm.c | 2 lib/ts_fsm.c | 2 lib/ts_kmp.c | 2 lib/ubsan.c | 47 mm/Kconfig | 135 ++ mm/Makefile | 1 mm/compaction.c | 3 mm/dmapool.c | 4 mm/filemap.c | 14 mm/gup.c | 9 mm/huge_memory.c | 36 mm/hugetlb.c | 1 mm/hugetlb_cgroup.c | 6 mm/internal.h | 2 mm/kasan/common.c | 23 mm/kasan/report.c | 10 mm/khugepaged.c | 39 mm/ksm.c | 5 mm/list_lru.c | 2 mm/memcontrol.c | 5 mm/memory-failure.c | 2 mm/memory.c | 42 mm/memory_hotplug.c | 53 mm/mempolicy.c | 11 mm/migrate.c | 122 +- mm/mm_init.c | 2 mm/mmap.c | 10 mm/mprotect.c | 76 - mm/page_alloc.c | 174 ++ mm/page_ext.c | 5 mm/page_isolation.c | 6 mm/page_reporting.c | 384 ++++++ mm/page_reporting.h | 54 mm/rmap.c | 23 mm/shmem.c | 168 +- mm/shuffle.c | 12 mm/shuffle.h | 6 mm/slab_common.c | 1 mm/slub.c | 3 mm/sparse.c | 236 ++- mm/swap.c | 20 mm/swapfile.c | 1 mm/userfaultfd.c | 98 + mm/vmalloc.c | 2 mm/vmscan.c | 12 mm/vmstat.c | 3 mm/zsmalloc.c | 10 mm/zswap.c | 24 samples/hw_breakpoint/data_breakpoint.c | 11 scripts/Makefile.ubsan | 16 scripts/checkpatch.pl | 155 +- tools/lib/rbtree.c | 4 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 67 + tools/testing/selftests/vm/userfaultfd.c | 233 +++ 174 files changed, 3990 insertions(+), 1399 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-04-02 4:01 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-04-02 4:01 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits A large amount of MM, plenty more to come. 155 patches, based on GIT 1a323ea5356edbb3073dc59d51b9e6b86908857d Subsystems affected by this patch series: tools kthread kbuild scripts ocfs2 vfs mm/slub mm/kmemleak mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/mremap mm/sparsemem mm/kasan mm/pagealloc mm/vmscan mm/compaction mm/mempolicy mm/hugetlbfs mm/hugetlb Subsystem: tools David Ahern <dsahern@kernel.org>: tools/accounting/getdelays.c: fix netlink attribute length Subsystem: kthread Petr Mladek <pmladek@suse.com>: kthread: mark timer used by delayed kthread works as IRQ safe Subsystem: kbuild Masahiro Yamada <masahiroy@kernel.org>: asm-generic: make more kernel-space headers mandatory Subsystem: scripts Jonathan Neuschäfer <j.neuschaefer@gmx.net>: scripts/spelling.txt: add syfs/sysfs pattern Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ocfs2 Alex Shi <alex.shi@linux.alibaba.com>: ocfs2: remove FS_OCFS2_NM ocfs2: remove unused macros ocfs2: use OCFS2_SEC_BITS in macro ocfs2: remove dlm_lock_is_remote wangyan <wangyan122@huawei.com>: ocfs2: there is no need to log twice in several functions ocfs2: correct annotation from "l_next_rec" to "l_next_free_rec" Alex Shi <alex.shi@linux.alibaba.com>: ocfs2: remove useless err Jules Irenge <jbi.octave@gmail.com>: ocfs2: Add missing annotations for ocfs2_refcount_cache_lock() and ocfs2_refcount_cache_unlock() "Gustavo A. R. Silva" <gustavo@embeddedor.com>: ocfs2: replace zero-length array with flexible-array member ocfs2: cluster: replace zero-length array with flexible-array member ocfs2: dlm: replace zero-length array with flexible-array member ocfs2: ocfs2_fs.h: replace zero-length array with flexible-array member wangjian <wangjian161@huawei.com>: ocfs2: roll back the reference count modification of the parent directory if an error occurs Takashi Iwai <tiwai@suse.de>: ocfs2: use scnprintf() for avoiding potential buffer overflow "Matthew Wilcox (Oracle)" <willy@infradead.org>: ocfs2: use memalloc_nofs_save instead of memalloc_noio_save Subsystem: vfs Kees Cook <keescook@chromium.org>: fs_parse: Remove pr_notice() about each validation Subsystem: mm/slub chenqiwu <chenqiwu@xiaomi.com>: mm/slub.c: replace cpu_slab->partial with wrapped APIs mm/slub.c: replace kmem_cache->cpu_partial with wrapped APIs Kees Cook <keescook@chromium.org>: slub: improve bit diffusion for freelist ptr obfuscation slub: relocate freelist pointer to middle of object Vlastimil Babka <vbabka@suse.cz>: Revert "topology: add support for node_to_mem_node() to determine the fallback node" Subsystem: mm/kmemleak Nathan Chancellor <natechancellor@gmail.com>: mm/kmemleak.c: use address-of operator on section symbols Qian Cai <cai@lca.pw>: mm/Makefile: disable KCSAN for kmemleak Subsystem: mm/pagecache Jan Kara <jack@suse.cz>: mm/filemap.c: don't bother dropping mmap_sem for zero size readahead Mauricio Faria de Oliveira <mfo@canonical.com>: mm/page-writeback.c: write_cache_pages(): deduplicate identical checks Xianting Tian <xianting_tian@126.com>: mm/filemap.c: clear page error before actual read Souptick Joarder <jrdr.linux@gmail.com>: mm/filemap.c: remove unused argument from shrink_readahead_size_eio() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap.c: use vm_fault error code directly include/linux/pagemap.h: rename arguments to find_subpage mm/page-writeback.c: use VM_BUG_ON_PAGE in clear_page_dirty_for_io mm/filemap.c: unexport find_get_entry mm/filemap.c: rewrite pagecache_get_page documentation Subsystem: mm/gup John Hubbard <jhubbard@nvidia.com>: Patch series "mm/gup: track FOLL_PIN pages", v6: mm/gup: split get_user_pages_remote() into two routines mm/gup: pass a flags arg to __gup_device_* functions mm: introduce page_ref_sub_return() mm/gup: pass gup flags to two more routines mm/gup: require FOLL_GET for get_user_pages_fast() mm/gup: track FOLL_PIN pages mm/gup: page->hpage_pinned_refcount: exact pin counts for huge pages mm/gup: /proc/vmstat: pin_user_pages (FOLL_PIN) reporting mm/gup_benchmark: support pin_user_pages() and related calls selftests/vm: run_vmtests: invoke gup_benchmark with basic FOLL_PIN coverage "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: improve dump_page() for compound pages John Hubbard <jhubbard@nvidia.com>: mm: dump_page(): additional diagnostics for huge pinned pages Claudio Imbrenda <imbrenda@linux.ibm.com>: mm/gup/writeback: add callbacks for inaccessible pages Pingfan Liu <kernelfans@gmail.com>: mm/gup: rename nr as nr_pinned in get_user_pages_fast() mm/gup: fix omission of check on FOLL_LONGTERM in gup fast path Subsystem: mm/swap Chen Wandun <chenwandun@huawei.com>: mm/swapfile.c: fix comments for swapcache_prepare Wei Yang <richardw.yang@linux.intel.com>: mm/swap.c: not necessary to export __pagevec_lru_add() Qian Cai <cai@lca.pw>: mm/swapfile: fix data races in try_to_unuse() Wei Yang <richard.weiyang@linux.alibaba.com>: mm/swap_slots.c: assign|reset cache slot by value directly Yang Shi <yang.shi@linux.alibaba.com>: mm: swap: make page_evictable() inline mm: swap: use smp_mb__after_atomic() to order LRU bit set Wei Yang <richard.weiyang@gmail.com>: mm/swap_state.c: use the same way to count page in [add_to|delete_from]_swap_cache Subsystem: mm/memcg Yafang Shao <laoar.shao@gmail.com>: mm, memcg: fix build error around the usage of kmem_caches Kirill Tkhai <ktkhai@virtuozzo.com>: mm/memcontrol.c: allocate shrinker_map on appropriate NUMA node Roman Gushchin <guro@fb.com>: mm: memcg/slab: use mem_cgroup_from_obj() Patch series "mm: memcg: kmem API cleanup", v2: mm: kmem: cleanup (__)memcg_kmem_charge_memcg() arguments mm: kmem: cleanup memcg_kmem_uncharge_memcg() arguments mm: kmem: rename memcg_kmem_(un)charge() into memcg_kmem_(un)charge_page() mm: kmem: switch to nr_pages in (__)memcg_kmem_charge_memcg() mm: memcg/slab: cache page number in memcg_(un)charge_slab() mm: kmem: rename (__)memcg_kmem_(un)charge_memcg() to __memcg_kmem_(un)charge() Johannes Weiner <hannes@cmpxchg.org>: Patch series "mm: memcontrol: recursive memory.low protection", v3: mm: memcontrol: fix memory.low proportional distribution mm: memcontrol: clean up and document effective low/min calculations mm: memcontrol: recursive memory.low protection Shakeel Butt <shakeelb@google.com>: memcg: css_tryget_online cleanups Vincenzo Frascino <vincenzo.frascino@arm.com>: mm/memcontrol.c: make mem_cgroup_id_get_many() __maybe_unused Chris Down <chris@chrisdown.name>: mm, memcg: prevent memory.high load/store tearing mm, memcg: prevent memory.max load tearing mm, memcg: prevent memory.low load/store tearing mm, memcg: prevent memory.min load/store tearing mm, memcg: prevent memory.swap.max load tearing mm, memcg: prevent mem_cgroup_protected store tearing Roman Gushchin <guro@fb.com>: mm: memcg: make memory.oom.group tolerable to task migration Subsystem: mm/pagemap Thomas Hellstrom <thellstrom@vmware.com>: mm/mapping_dirty_helpers: Update huge page-table entry callbacks Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/vma: some more minor changes", v2: mm/vma: move VM_NO_KHUGEPAGED into generic header mm/vma: make vma_is_foreign() available for general use mm/vma: make is_vma_temporary_stack() available for general use "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: add pagemap.h to the fine documentation Peter Xu <peterx@redhat.com>: Patch series "mm: Page fault enhancements", v6: mm/gup: rename "nonblocking" to "locked" where proper mm/gup: fix __get_user_pages() on fault retry of hugetlb mm: introduce fault_signal_pending() x86/mm: use helper fault_signal_pending() arc/mm: use helper fault_signal_pending() arm64/mm: use helper fault_signal_pending() powerpc/mm: use helper fault_signal_pending() sh/mm: use helper fault_signal_pending() mm: return faster for non-fatal signals in user mode faults userfaultfd: don't retake mmap_sem to emulate NOPAGE mm: introduce FAULT_FLAG_DEFAULT mm: introduce FAULT_FLAG_INTERRUPTIBLE mm: allow VM_FAULT_RETRY for multiple times mm/gup: allow VM_FAULT_RETRY for multiple times mm/gup: allow to react to fatal signals mm/userfaultfd: honor FAULT_FLAG_KILLABLE in fault path WANG Wenhu <wenhu.wang@vivo.com>: mm: clarify a confusing comment for remap_pfn_range() Wang Wenhu <wenhu.wang@vivo.com>: mm/memory.c: clarify a confusing comment for vm_iomap_memory Jaewon Kim <jaewon31.kim@samsung.com>: Patch series "mm: mmap: add mmap trace point", v3: mmap: remove inline of vm_unmapped_area mm: mmap: add trace point of vm_unmapped_area Subsystem: mm/mremap Brian Geffon <bgeffon@google.com>: mm/mremap: add MREMAP_DONTUNMAP to mremap() selftests: add MREMAP_DONTUNMAP selftest Subsystem: mm/sparsemem Wei Yang <richardw.yang@linux.intel.com>: mm/sparsemem: get address to page struct instead of address to pfn Pingfan Liu <kernelfans@gmail.com>: mm/sparse: rename pfn_present() to pfn_in_present_section() Baoquan He <bhe@redhat.com>: mm/sparse.c: use kvmalloc/kvfree to alloc/free memmap for the classic sparse mm/sparse.c: allocate memmap preferring the given node Subsystem: mm/kasan Walter Wu <walter-zh.wu@mediatek.com>: Patch series "fix the missing underflow in memory operation function", v4: kasan: detect negative size in memory operation function kasan: add test for invalid size in memmove Subsystem: mm/pagealloc Joel Savitz <jsavitz@redhat.com>: mm/page_alloc: increase default min_free_kbytes bound Mateusz Nosek <mateusznosek0@gmail.com>: mm, pagealloc: micro-optimisation: save two branches on hot page allocation path chenqiwu <chenqiwu@xiaomi.com>: mm/page_alloc.c: use free_area_empty() instead of open-coding Mateusz Nosek <mateusznosek0@gmail.com>: mm/page_alloc.c: micro-optimisation Remove unnecessary branch chenqiwu <chenqiwu@xiaomi.com>: mm/page_alloc: simplify page_is_buddy() for better code readability Subsystem: mm/vmscan Yang Shi <yang.shi@linux.alibaba.com>: mm: vmpressure: don't need call kfree if kstrndup fails mm: vmpressure: use mem_cgroup_is_root API mm: vmscan: replace open codings to NUMA_NO_NODE Wei Yang <richardw.yang@linux.intel.com>: mm/vmscan.c: remove cpu online notification for now Qian Cai <cai@lca.pw>: mm/vmscan.c: fix data races using kswapd_classzone_idx Mateusz Nosek <mateusznosek0@gmail.com>: mm/vmscan.c: Clean code by removing unnecessary assignment Kirill Tkhai <ktkhai@virtuozzo.com>: mm/vmscan.c: make may_enter_fs bool in shrink_page_list() Mateusz Nosek <mateusznosek0@gmail.com>: mm/vmscan.c: do_try_to_free_pages(): clean code by removing unnecessary assignment Michal Hocko <mhocko@suse.com>: selftests: vm: drop dependencies on page flags from mlock2 tests Subsystem: mm/compaction Rik van Riel <riel@surriel.com>: Patch series "fix THP migration for CMA allocations", v2: mm,compaction,cma: add alloc_contig flag to compact_control mm,thp,compaction,cma: allow THP migration for CMA allocations Vlastimil Babka <vbabka@suse.cz>: mm, compaction: fully assume capture is not NULL in compact_zone_order() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/compaction: really limit compact_unevictable_allowed to 0 and 1 mm/compaction: Disable compact_unevictable_allowed on RT Mateusz Nosek <mateusznosek0@gmail.com>: mm/compaction.c: clean code by removing unnecessary assignment Subsystem: mm/mempolicy Li Xinhai <lixinhai.lxh@gmail.com>: mm/mempolicy: support MPOL_MF_STRICT for huge page mapping mm/mempolicy: check hugepage migration is supported by arch in vma_migratable() Yang Shi <yang.shi@linux.alibaba.com>: mm: mempolicy: use VM_BUG_ON_VMA in queue_pages_test_walk() Randy Dunlap <rdunlap@infradead.org>: mm: mempolicy: require at least one nodeid for MPOL_PREFERRED Colin Ian King <colin.king@canonical.com>: mm/memblock.c: remove redundant assignment to variable max_addr Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: Patch series "hugetlbfs: use i_mmap_rwsem for more synchronization", v2: hugetlbfs: use i_mmap_rwsem for more pmd sharing synchronization hugetlbfs: Use i_mmap_rwsem to address page fault/truncate race Subsystem: mm/hugetlb Mina Almasry <almasrymina@google.com>: hugetlb_cgroup: add hugetlb_cgroup reservation counter hugetlb_cgroup: add interface for charge/uncharge hugetlb reservations mm/hugetlb_cgroup: fix hugetlb_cgroup migration hugetlb_cgroup: add reservation accounting for private mappings hugetlb: disable region_add file_region coalescing hugetlb_cgroup: add accounting for shared mappings hugetlb_cgroup: support noreserve mappings hugetlb: support file_region coalescing again hugetlb_cgroup: add hugetlb_cgroup reservation tests hugetlb_cgroup: add hugetlb_cgroup reservation docs Mateusz Nosek <mateusznosek0@gmail.com>: mm/hugetlb.c: clean code by removing unnecessary initialization Vlastimil Babka <vbabka@suse.cz>: mm/hugetlb: remove unnecessary memory fetch in PageHeadHuge() Christophe Leroy <christophe.leroy@c-s.fr>: selftests/vm: fix map_hugetlb length used for testing read and write mm/hugetlb: fix build failure with HUGETLB_PAGE but not HUGEBTLBFS "Matthew Wilcox (Oracle)" <willy@infradead.org>: include/linux/huge_mm.h: check PageTail in hpage_nr_pages even when !THP Documentation/admin-guide/cgroup-v1/hugetlb.rst | 103 +- Documentation/admin-guide/cgroup-v2.rst | 11 Documentation/admin-guide/sysctl/vm.rst | 3 Documentation/core-api/mm-api.rst | 3 Documentation/core-api/pin_user_pages.rst | 86 + arch/alpha/include/asm/Kbuild | 11 arch/alpha/mm/fault.c | 6 arch/arc/include/asm/Kbuild | 21 arch/arc/mm/fault.c | 37 arch/arm/include/asm/Kbuild | 12 arch/arm/mm/fault.c | 7 arch/arm64/include/asm/Kbuild | 18 arch/arm64/mm/fault.c | 26 arch/c6x/include/asm/Kbuild | 37 arch/csky/include/asm/Kbuild | 36 arch/h8300/include/asm/Kbuild | 46 arch/hexagon/include/asm/Kbuild | 33 arch/hexagon/mm/vm_fault.c | 5 arch/ia64/include/asm/Kbuild | 7 arch/ia64/mm/fault.c | 5 arch/m68k/include/asm/Kbuild | 24 arch/m68k/mm/fault.c | 7 arch/microblaze/include/asm/Kbuild | 29 arch/microblaze/mm/fault.c | 5 arch/mips/include/asm/Kbuild | 13 arch/mips/mm/fault.c | 5 arch/nds32/include/asm/Kbuild | 37 arch/nds32/mm/fault.c | 5 arch/nios2/include/asm/Kbuild | 38 arch/nios2/mm/fault.c | 7 arch/openrisc/include/asm/Kbuild | 36 arch/openrisc/mm/fault.c | 5 arch/parisc/include/asm/Kbuild | 18 arch/parisc/mm/fault.c | 8 arch/powerpc/include/asm/Kbuild | 4 arch/powerpc/mm/book3s64/pkeys.c | 12 arch/powerpc/mm/fault.c | 20 arch/powerpc/platforms/pseries/hotplug-memory.c | 2 arch/riscv/include/asm/Kbuild | 28 arch/riscv/mm/fault.c | 9 arch/s390/include/asm/Kbuild | 15 arch/s390/mm/fault.c | 10 arch/sh/include/asm/Kbuild | 16 arch/sh/mm/fault.c | 13 arch/sparc/include/asm/Kbuild | 14 arch/sparc/mm/fault_32.c | 5 arch/sparc/mm/fault_64.c | 5 arch/um/kernel/trap.c | 3 arch/unicore32/include/asm/Kbuild | 34 arch/unicore32/mm/fault.c | 8 arch/x86/include/asm/Kbuild | 2 arch/x86/include/asm/mmu_context.h | 15 arch/x86/mm/fault.c | 32 arch/xtensa/include/asm/Kbuild | 26 arch/xtensa/mm/fault.c | 5 drivers/base/node.c | 2 drivers/gpu/drm/ttm/ttm_bo_vm.c | 12 fs/fs_parser.c | 2 fs/hugetlbfs/inode.c | 30 fs/ocfs2/alloc.c | 3 fs/ocfs2/cluster/heartbeat.c | 12 fs/ocfs2/cluster/netdebug.c | 4 fs/ocfs2/cluster/tcp.c | 27 fs/ocfs2/cluster/tcp.h | 2 fs/ocfs2/dir.c | 4 fs/ocfs2/dlm/dlmcommon.h | 8 fs/ocfs2/dlm/dlmdebug.c | 100 - fs/ocfs2/dlm/dlmmaster.c | 2 fs/ocfs2/dlm/dlmthread.c | 3 fs/ocfs2/dlmglue.c | 2 fs/ocfs2/journal.c | 2 fs/ocfs2/namei.c | 15 fs/ocfs2/ocfs2_fs.h | 18 fs/ocfs2/refcounttree.c | 2 fs/ocfs2/reservations.c | 3 fs/ocfs2/stackglue.c | 2 fs/ocfs2/suballoc.c | 5 fs/ocfs2/super.c | 46 fs/pipe.c | 2 fs/userfaultfd.c | 64 - include/asm-generic/Kbuild | 52 + include/linux/cgroup-defs.h | 5 include/linux/fs.h | 5 include/linux/gfp.h | 6 include/linux/huge_mm.h | 10 include/linux/hugetlb.h | 76 + include/linux/hugetlb_cgroup.h | 175 +++ include/linux/kasan.h | 2 include/linux/kthread.h | 3 include/linux/memcontrol.h | 66 - include/linux/mempolicy.h | 29 include/linux/mm.h | 243 +++- include/linux/mm_types.h | 7 include/linux/mmzone.h | 6 include/linux/page_ref.h | 9 include/linux/pagemap.h | 29 include/linux/sched/signal.h | 18 include/linux/swap.h | 1 include/linux/topology.h | 17 include/trace/events/mmap.h | 48 include/uapi/linux/mman.h | 5 kernel/cgroup/cgroup.c | 17 kernel/fork.c | 9 kernel/sysctl.c | 31 lib/test_kasan.c | 19 mm/Makefile | 1 mm/compaction.c | 31 mm/debug.c | 54 - mm/filemap.c | 77 - mm/gup.c | 682 ++++++++++--- mm/gup_benchmark.c | 71 + mm/huge_memory.c | 29 mm/hugetlb.c | 866 ++++++++++++----- mm/hugetlb_cgroup.c | 347 +++++- mm/internal.h | 32 mm/kasan/common.c | 26 mm/kasan/generic.c | 9 mm/kasan/generic_report.c | 11 mm/kasan/kasan.h | 2 mm/kasan/report.c | 5 mm/kasan/tags.c | 9 mm/kasan/tags_report.c | 11 mm/khugepaged.c | 4 mm/kmemleak.c | 2 mm/list_lru.c | 12 mm/mapping_dirty_helpers.c | 42 mm/memblock.c | 2 mm/memcontrol.c | 378 ++++--- mm/memory-failure.c | 29 mm/memory.c | 4 mm/mempolicy.c | 73 + mm/migrate.c | 25 mm/mmap.c | 32 mm/mremap.c | 92 + mm/page-writeback.c | 19 mm/page_alloc.c | 82 - mm/page_counter.c | 29 mm/page_ext.c | 2 mm/rmap.c | 39 mm/shuffle.c | 2 mm/slab.h | 32 mm/slab_common.c | 2 mm/slub.c | 27 mm/sparse.c | 33 mm/swap.c | 5 mm/swap_slots.c | 12 mm/swap_state.c | 2 mm/swapfile.c | 10 mm/userfaultfd.c | 11 mm/vmpressure.c | 8 mm/vmscan.c | 111 -- mm/vmstat.c | 2 scripts/spelling.txt | 21 tools/accounting/getdelays.c | 2 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 2 tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 575 +++++++++++ tools/testing/selftests/vm/gup_benchmark.c | 15 tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 244 ++++ tools/testing/selftests/vm/map_hugetlb.c | 14 tools/testing/selftests/vm/mlock2-tests.c | 233 ---- tools/testing/selftests/vm/mremap_dontunmap.c | 313 ++++++ tools/testing/selftests/vm/run_vmtests | 37 tools/testing/selftests/vm/write_hugetlb_memory.sh | 23 tools/testing/selftests/vm/write_to_hugetlbfs.c | 242 ++++ 165 files changed, 5020 insertions(+), 2376 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-03-29 2:14 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-03-29 2:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 5 fixes, based on 83fd69c93340177dcd66fd26ce6441fb581c1dbf: Naohiro Aota <naohiro.aota@wdc.com>: mm/swapfile.c: move inode_lock out of claim_swapfile David Hildenbrand <david@redhat.com>: drivers/base/memory.c: indicate all memory blocks as removable Mina Almasry <almasrymina@google.com>: hugetlb_cgroup: fix illegal access to memory Roman Gushchin <guro@fb.com>: mm: fork: fix kernel_stack memcg stats for various stack implementations "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/sparse: fix kernel crash with pfn_section_valid check drivers/base/memory.c | 23 +++-------------------- include/linux/memcontrol.h | 12 ++++++++++++ kernel/fork.c | 4 ++-- mm/hugetlb_cgroup.c | 3 +-- mm/memcontrol.c | 38 ++++++++++++++++++++++++++++++++++++++ mm/sparse.c | 6 ++++++ mm/swapfile.c | 41 ++++++++++++++++++++--------------------- 7 files changed, 82 insertions(+), 45 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-03-22 1:19 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-03-22 1:19 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 10 fixes, based on c63c50fc2ec9afc4de21ef9ead2eac64b178cce1: Chunguang Xu <brookxu@tencent.com>: memcg: fix NULL pointer dereference in __mem_cgroup_usage_unregister_event Baoquan He <bhe@redhat.com>: mm/hotplug: fix hot remove failure in SPARSEMEM|!VMEMMAP case Qian Cai <cai@lca.pw>: page-flags: fix a crash at SetPageError(THP_SWAP) Chris Down <chris@chrisdown.name>: mm, memcg: fix corruption on 64-bit divisor in memory.high throttling mm, memcg: throttle allocators based on ancestral memory.high Michal Hocko <mhocko@suse.com>: mm: do not allow MADV_PAGEOUT for CoW pages Roman Penyaev <rpenyaev@suse.de>: epoll: fix possible lost wakeup on epoll_ctl() path Qian Cai <cai@lca.pw>: mm/mmu_notifier: silence PROVE_RCU_LIST warnings Vlastimil Babka <vbabka@suse.cz>: mm, slub: prevent kmalloc_node crashes and memory leaks Joerg Roedel <jroedel@suse.de>: x86/mm: split vmalloc_sync_all() arch/x86/mm/fault.c | 26 ++++++++++- drivers/acpi/apei/ghes.c | 2 fs/eventpoll.c | 8 +-- include/linux/page-flags.h | 2 include/linux/vmalloc.h | 5 +- kernel/notifier.c | 2 mm/madvise.c | 12 +++-- mm/memcontrol.c | 105 ++++++++++++++++++++++++++++----------------- mm/mmu_notifier.c | 27 +++++++---- mm/nommu.c | 10 +++- mm/slub.c | 26 +++++++---- mm/sparse.c | 8 ++- mm/vmalloc.c | 11 +++- 13 files changed, 165 insertions(+), 79 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-03-06 6:27 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-03-06 6:27 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 7 fixes, based on 9f65ed5fe41ce08ed1cb1f6a950f9ec694c142ad: Mel Gorman <mgorman@techsingularity.net>: mm, numa: fix bad pmd by atomically check for pmd_trans_huge when marking page tables prot_numa Huang Ying <ying.huang@intel.com>: mm: fix possible PMD dirty bit lost in set_pmd_migration_entry() "Kirill A. Shutemov" <kirill@shutemov.name>: mm: avoid data corruption on CoW fault into PFN-mapped VMA OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>: fat: fix uninit-memory access for partial initialized inode Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/z3fold.c: do not include rwlock.h directly Vlastimil Babka <vbabka@suse.cz>: mm, hotplug: fix page online with DEBUG_PAGEALLOC compiled but not enabled Miroslav Benes <mbenes@suse.cz>: arch/Kconfig: update HAVE_RELIABLE_STACKTRACE description arch/Kconfig | 5 +++-- fs/fat/inode.c | 19 +++++++------------ include/linux/mm.h | 4 ++++ mm/huge_memory.c | 3 +-- mm/memory.c | 35 +++++++++++++++++++++++++++-------- mm/memory_hotplug.c | 8 +++++++- mm/mprotect.c | 38 ++++++++++++++++++++++++++++++++++++-- mm/z3fold.c | 1 - 8 files changed, 85 insertions(+), 28 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-02-21 4:00 Andrew Morton 2020-02-21 4:03 ` incoming Andrew Morton 2020-02-21 18:21 ` incoming Linus Torvalds 0 siblings, 2 replies; 348+ messages in thread From: Andrew Morton @ 2020-02-21 4:00 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits - A few y2038 fixes which missed the merge window whiole dependencies in NFS were being sorted out. - A bunch of fixes. Some minor, some not. Subsystems affected by this patch series: Arnd Bergmann <arnd@arndb.de>: y2038: remove ktime to/from timespec/timeval conversion y2038: remove unused time32 interfaces y2038: hide timeval/timespec/itimerval/itimerspec types Ioanna Alifieraki <ioanna-maria.alifieraki@canonical.com>: Revert "ipc,sem: remove uneeded sem_undo_list lock usage in exit_sem()" Christian Borntraeger <borntraeger@de.ibm.com>: include/uapi/linux/swab.h: fix userspace breakage, use __BITS_PER_LONG for swap SeongJae Park <sjpark@amazon.de>: selftests/vm: add missed tests in run_vmtests Joe Perches <joe@perches.com>: get_maintainer: remove uses of P: for maintainer name Douglas Anderson <dianders@chromium.org>: scripts/get_maintainer.pl: deprioritize old Fixes: addresses Christoph Hellwig <hch@lst.de>: mm/swapfile.c: fix a comment in sys_swapon() Vasily Averin <vvs@virtuozzo.com>: mm/memcontrol.c: lost css_put in memcg_expand_shrinker_maps() Alexandru Ardelean <alexandru.ardelean@analog.com>: lib/string.c: update match_string() doc-strings with correct behavior Gavin Shan <gshan@redhat.com>: mm/vmscan.c: don't round up scan size for online memory cgroup Wei Yang <richardw.yang@linux.intel.com>: mm/sparsemem: pfn_to_page is not valid yet on SPARSEMEM Alexander Potapenko <glider@google.com>: lib/stackdepot.c: fix global out-of-bounds in stack_slabs Randy Dunlap <rdunlap@infradead.org>: MAINTAINERS: use tabs for SAFESETID MAINTAINERS | 8 - include/linux/compat.h | 29 ------ include/linux/ktime.h | 37 ------- include/linux/time32.h | 154 --------------------------------- include/linux/timekeeping32.h | 32 ------ include/linux/types.h | 5 - include/uapi/asm-generic/posix_types.h | 2 include/uapi/linux/swab.h | 4 include/uapi/linux/time.h | 22 ++-- ipc/sem.c | 6 - kernel/compat.c | 64 ------------- kernel/time/time.c | 43 --------- lib/stackdepot.c | 8 + lib/string.c | 16 +++ mm/memcontrol.c | 4 mm/sparse.c | 2 mm/swapfile.c | 2 mm/vmscan.c | 9 + scripts/get_maintainer.pl | 32 ------ tools/testing/selftests/vm/run_vmtests | 33 +++++++ 20 files changed, 93 insertions(+), 419 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-02-21 4:00 incoming Andrew Morton @ 2020-02-21 4:03 ` Andrew Morton 2020-02-21 18:21 ` incoming Linus Torvalds 1 sibling, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-02-21 4:03 UTC (permalink / raw) To: Linus Torvalds, linux-mm, mm-commits On Thu, 20 Feb 2020 20:00:30 -0800 Andrew Morton <akpm@linux-foundation.org> wrote: > - A few y2038 fixes which missed the merge window whiole dependencies > in NFS were being sorted out. > > - A bunch of fixes. Some minor, some not. 15 patches, based on ca7e1fd1026c5af6a533b4b5447e1d2f153e28f2 ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-02-21 4:00 incoming Andrew Morton 2020-02-21 4:03 ` incoming Andrew Morton @ 2020-02-21 18:21 ` Linus Torvalds 2020-02-21 18:32 ` incoming Konstantin Ryabitsev 2020-02-21 19:33 ` incoming Linus Torvalds 1 sibling, 2 replies; 348+ messages in thread From: Linus Torvalds @ 2020-02-21 18:21 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits On Thu, Feb 20, 2020 at 8:00 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > - A few y2038 fixes which missed the merge window whiole dependencies > in NFS were being sorted out. > > - A bunch of fixes. Some minor, some not. Hmm. Konstantin's nice lore script _used_ to pick up your patches, but now they don't. I'm not sure what changed. It worked with your big series of 118 patches. It doesn't work with this smaller series of fixes. I think the difference is that you've done something bad to your patch sending. That big series was properly threaded with each of the patches being a reply to the 'incoming' message. This series is not. Please, Andrew, can you make your email flow more consistent so that I can actually use the nice new tool to download a patch series? Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-02-21 18:21 ` incoming Linus Torvalds @ 2020-02-21 18:32 ` Konstantin Ryabitsev 2020-02-27 9:59 ` incoming Vlastimil Babka 2020-02-21 19:33 ` incoming Linus Torvalds 1 sibling, 1 reply; 348+ messages in thread From: Konstantin Ryabitsev @ 2020-02-21 18:32 UTC (permalink / raw) To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits On Fri, Feb 21, 2020 at 10:21:19AM -0800, Linus Torvalds wrote: > On Thu, Feb 20, 2020 at 8:00 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > - A few y2038 fixes which missed the merge window whiole dependencies > > in NFS were being sorted out. > > > > - A bunch of fixes. Some minor, some not. > > Hmm. Konstantin's nice lore script _used_ to pick up your patches, but > now they don't. > > I'm not sure what changed. It worked with your big series of 118 patches. > > It doesn't work with this smaller series of fixes. > > I think the difference is that you've done something bad to your patch > sending. That big series was properly threaded with each of the > patches being a reply to the 'incoming' message. > > This series is not. This is correct -- each patch is posted without an in-reply-to, so public-inbox doesn't group them into a thread. E.g.: https://lore.kernel.org/linux-mm/20200221040350.84HaG%25akpm@linux-foundation.org/ > > Please, Andrew, can you make your email flow more consistent so that I > can actually use the nice new tool to download a patch series? Andrew, I'll be happy to provide you with a helper tool if you can describe me your workflow. E.g. if you have a quilt directory of patches plus a series file, it could easily be a tiny wrapper like: send-patches --base-commit 1234abcd --cover cover.txt patchdir/series -K ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-02-21 18:32 ` incoming Konstantin Ryabitsev @ 2020-02-27 9:59 ` Vlastimil Babka 0 siblings, 0 replies; 348+ messages in thread From: Vlastimil Babka @ 2020-02-27 9:59 UTC (permalink / raw) To: Konstantin Ryabitsev, Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits On 2/21/20 7:32 PM, Konstantin Ryabitsev wrote: > On Fri, Feb 21, 2020 at 10:21:19AM -0800, Linus Torvalds wrote: >> On Thu, Feb 20, 2020 at 8:00 PM Andrew Morton <akpm@linux-foundation.org> wrote: >> > >> > - A few y2038 fixes which missed the merge window whiole dependencies >> > in NFS were being sorted out. >> > >> > - A bunch of fixes. Some minor, some not. >> >> Hmm. Konstantin's nice lore script _used_ to pick up your patches, but >> now they don't. >> >> I'm not sure what changed. It worked with your big series of 118 patches. >> >> It doesn't work with this smaller series of fixes. >> >> I think the difference is that you've done something bad to your patch >> sending. That big series was properly threaded with each of the >> patches being a reply to the 'incoming' message. >> >> This series is not. > > This is correct -- each patch is posted without an in-reply-to, so > public-inbox doesn't group them into a thread. > > E.g.: > https://lore.kernel.org/linux-mm/20200221040350.84HaG%25akpm@linux-foundation.org/ > >> >> Please, Andrew, can you make your email flow more consistent so that I >> can actually use the nice new tool to download a patch series? > > Andrew, I'll be happy to provide you with a helper tool if you can > describe me your workflow. E.g. if you have a quilt directory of patches > plus a series file, it could easily be a tiny wrapper like: > > send-patches --base-commit 1234abcd --cover cover.txt patchdir/series Once/if there is such tool, could it perhaps instead of mass e-mailing create git commits, push them to korg repo and send a pull request? Thanks, Vlastimil > -K > ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-02-21 18:21 ` incoming Linus Torvalds 2020-02-21 18:32 ` incoming Konstantin Ryabitsev @ 2020-02-21 19:33 ` Linus Torvalds 1 sibling, 0 replies; 348+ messages in thread From: Linus Torvalds @ 2020-02-21 19:33 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits Side note: I've obviously picked it up the old-fashioned way, but I had been looking forward to seeing if I could just automate this more. Linus On Fri, Feb 21, 2020 at 10:21 AM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > Please, Andrew, can you make your email flow more consistent so that I > can actually use the nice new tool to download a patch series? > > Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-02-04 1:33 Andrew Morton 2020-02-04 2:27 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2020-02-04 1:33 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm The rest of MM and the rest of everything else. Subsystems affected by this patch series: hotfixes mm/pagealloc mm/memory-hotplug ipc misc mm/cleanups mm/pagemap procfs lib cleanups arm Subsystem: hotfixes Gang He <GHe@suse.com>: ocfs2: fix oops when writing cloned file David Hildenbrand <david@redhat.com>: Patch series "mm: fix max_pfn not falling on section boundary", v2: mm/page_alloc.c: fix uninitialized memmaps on a partially populated last section fs/proc/page.c: allow inspection of last section and fix end detection mm/page_alloc.c: initialize memmap of unavailable memory directly Subsystem: mm/pagealloc David Hildenbrand <david@redhat.com>: mm/page_alloc: fix and rework pfn handling in memmap_init_zone() mm: factor out next_present_section_nr() Subsystem: mm/memory-hotplug "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "mm/memory_hotplug: Shrink zones before removing memory", v6: mm/memmap_init: update variable name in memmap_init_zone David Hildenbrand <david@redhat.com>: mm/memory_hotplug: poison memmap in remove_pfn_range_from_zone() mm/memory_hotplug: we always have a zone in find_(smallest|biggest)_section_pfn mm/memory_hotplug: don't check for "all holes" in shrink_zone_span() mm/memory_hotplug: drop local variables in shrink_zone_span() mm/memory_hotplug: cleanup __remove_pages() mm/memory_hotplug: drop valid_start/valid_end from test_pages_in_a_zone() Subsystem: ipc Manfred Spraul <manfred@colorfullife.com>: smp_mb__{before,after}_atomic(): update Documentation Davidlohr Bueso <dave@stgolabs.net>: ipc/mqueue.c: remove duplicated code Manfred Spraul <manfred@colorfullife.com>: ipc/mqueue.c: update/document memory barriers ipc/msg.c: update and document memory barriers ipc/sem.c: document and update memory barriers Lu Shuaibing <shuaibinglu@126.com>: ipc/msg.c: consolidate all xxxctl_down() functions drivers/block/null_blk_main.c: fix layout Subsystem: misc Andrew Morton <akpm@linux-foundation.org>: drivers/block/null_blk_main.c: fix layout drivers/block/null_blk_main.c: fix uninitialized var warnings Randy Dunlap <rdunlap@infradead.org>: pinctrl: fix pxa2xx.c build warnings Subsystem: mm/cleanups Florian Westphal <fw@strlen.de>: mm: remove __krealloc Subsystem: mm/pagemap Steven Price <steven.price@arm.com>: Patch series "Generic page walk and ptdump", v17: mm: add generic p?d_leaf() macros arc: mm: add p?d_leaf() definitions arm: mm: add p?d_leaf() definitions arm64: mm: add p?d_leaf() definitions mips: mm: add p?d_leaf() definitions powerpc: mm: add p?d_leaf() definitions riscv: mm: add p?d_leaf() definitions s390: mm: add p?d_leaf() definitions sparc: mm: add p?d_leaf() definitions x86: mm: add p?d_leaf() definitions mm: pagewalk: add p4d_entry() and pgd_entry() mm: pagewalk: allow walking without vma mm: pagewalk: don't lock PTEs for walk_page_range_novma() mm: pagewalk: fix termination condition in walk_pte_range() mm: pagewalk: add 'depth' parameter to pte_hole x86: mm: point to struct seq_file from struct pg_state x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct mm: add generic ptdump x86: mm: convert dump_pagetables to use walk_page_range arm64: mm: convert mm/dump.c to use walk_page_range() arm64: mm: display non-present entries in ptdump mm: ptdump: reduce level numbers by 1 in note_page() x86: mm: avoid allocating struct mm_struct on the stack "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "Fixup page directory freeing", v4: powerpc/mmu_gather: enable RCU_TABLE_FREE even for !SMP case Peter Zijlstra <peterz@infradead.org>: mm/mmu_gather: invalidate TLB correctly on batch allocation failure and flush asm-generic/tlb: avoid potential double flush asm-gemeric/tlb: remove stray function declarations asm-generic/tlb: add missing CONFIG symbol asm-generic/tlb: rename HAVE_RCU_TABLE_FREE asm-generic/tlb: rename HAVE_MMU_GATHER_PAGE_SIZE asm-generic/tlb: rename HAVE_MMU_GATHER_NO_GATHER asm-generic/tlb: provide MMU_GATHER_TABLE_FREE Subsystem: procfs Alexey Dobriyan <adobriyan@gmail.com>: proc: decouple proc from VFS with "struct proc_ops" proc: convert everything to "struct proc_ops" Subsystem: lib Yury Norov <yury.norov@gmail.com>: Patch series "lib: rework bitmap_parse", v5: lib/string: add strnchrnul() bitops: more BITS_TO_* macros lib: add test for bitmap_parse() lib: make bitmap_parse_user a wrapper on bitmap_parse lib: rework bitmap_parse() lib: new testcases for bitmap_parse{_user} include/linux/cpumask.h: don't calculate length of the input string Subsystem: cleanups Masahiro Yamada <masahiroy@kernel.org>: treewide: remove redundant IS_ERR() before error code check Subsystem: arm Chen-Yu Tsai <wens@csie.org>: ARM: dma-api: fix max_pfn off-by-one error in __dma_supported() Documentation/memory-barriers.txt | 14 arch/Kconfig | 17 arch/alpha/kernel/srm_env.c | 17 arch/arc/include/asm/pgtable.h | 1 arch/arm/Kconfig | 2 arch/arm/include/asm/pgtable-2level.h | 1 arch/arm/include/asm/pgtable-3level.h | 1 arch/arm/include/asm/tlb.h | 6 arch/arm/kernel/atags_proc.c | 8 arch/arm/mm/alignment.c | 14 arch/arm/mm/dma-mapping.c | 2 arch/arm64/Kconfig | 3 arch/arm64/Kconfig.debug | 19 arch/arm64/include/asm/pgtable.h | 2 arch/arm64/include/asm/ptdump.h | 8 arch/arm64/mm/Makefile | 4 arch/arm64/mm/dump.c | 152 ++---- arch/arm64/mm/mmu.c | 4 arch/arm64/mm/ptdump_debugfs.c | 2 arch/ia64/kernel/salinfo.c | 24 - arch/m68k/kernel/bootinfo_proc.c | 8 arch/mips/include/asm/pgtable.h | 5 arch/mips/lasat/picvue_proc.c | 31 - arch/powerpc/Kconfig | 7 arch/powerpc/include/asm/book3s/32/pgalloc.h | 8 arch/powerpc/include/asm/book3s/64/pgalloc.h | 2 arch/powerpc/include/asm/book3s/64/pgtable.h | 3 arch/powerpc/include/asm/nohash/pgalloc.h | 8 arch/powerpc/include/asm/tlb.h | 11 arch/powerpc/kernel/proc_powerpc.c | 10 arch/powerpc/kernel/rtas-proc.c | 70 +-- arch/powerpc/kernel/rtas_flash.c | 34 - arch/powerpc/kernel/rtasd.c | 14 arch/powerpc/mm/book3s64/pgtable.c | 7 arch/powerpc/mm/numa.c | 12 arch/powerpc/platforms/pseries/lpar.c | 24 - arch/powerpc/platforms/pseries/lparcfg.c | 14 arch/powerpc/platforms/pseries/reconfig.c | 8 arch/powerpc/platforms/pseries/scanlog.c | 15 arch/riscv/include/asm/pgtable-64.h | 7 arch/riscv/include/asm/pgtable.h | 7 arch/s390/Kconfig | 4 arch/s390/include/asm/pgtable.h | 2 arch/sh/mm/alignment.c | 17 arch/sparc/Kconfig | 3 arch/sparc/include/asm/pgtable_64.h | 2 arch/sparc/include/asm/tlb_64.h | 11 arch/sparc/kernel/led.c | 15 arch/um/drivers/mconsole_kern.c | 9 arch/um/kernel/exitcode.c | 15 arch/um/kernel/process.c | 15 arch/x86/Kconfig | 3 arch/x86/Kconfig.debug | 20 arch/x86/include/asm/pgtable.h | 10 arch/x86/include/asm/tlb.h | 4 arch/x86/kernel/cpu/mtrr/if.c | 21 arch/x86/mm/Makefile | 4 arch/x86/mm/debug_pagetables.c | 18 arch/x86/mm/dump_pagetables.c | 418 +++++------------- arch/x86/platform/efi/efi_32.c | 2 arch/x86/platform/efi/efi_64.c | 4 arch/x86/platform/uv/tlb_uv.c | 14 arch/xtensa/platforms/iss/simdisk.c | 10 crypto/af_alg.c | 2 drivers/acpi/battery.c | 15 drivers/acpi/proc.c | 15 drivers/acpi/scan.c | 2 drivers/base/memory.c | 9 drivers/block/null_blk_main.c | 58 +- drivers/char/hw_random/bcm2835-rng.c | 2 drivers/char/hw_random/omap-rng.c | 4 drivers/clk/clk.c | 2 drivers/dma/mv_xor_v2.c | 2 drivers/firmware/efi/arm-runtime.c | 2 drivers/gpio/gpiolib-devres.c | 2 drivers/gpio/gpiolib-of.c | 8 drivers/gpio/gpiolib.c | 2 drivers/hwmon/dell-smm-hwmon.c | 15 drivers/i2c/busses/i2c-mv64xxx.c | 5 drivers/i2c/busses/i2c-synquacer.c | 2 drivers/ide/ide-proc.c | 19 drivers/input/input.c | 28 - drivers/isdn/capi/kcapi_proc.c | 6 drivers/macintosh/via-pmu.c | 17 drivers/md/md.c | 15 drivers/misc/sgi-gru/gruprocfs.c | 42 - drivers/mtd/ubi/build.c | 2 drivers/net/wireless/cisco/airo.c | 126 ++--- drivers/net/wireless/intel/ipw2x00/libipw_module.c | 15 drivers/net/wireless/intersil/hostap/hostap_hw.c | 4 drivers/net/wireless/intersil/hostap/hostap_proc.c | 14 drivers/net/wireless/intersil/hostap/hostap_wlan.h | 2 drivers/net/wireless/ray_cs.c | 20 drivers/of/device.c | 2 drivers/parisc/led.c | 17 drivers/pci/controller/pci-tegra.c | 2 drivers/pci/proc.c | 25 - drivers/phy/phy-core.c | 4 drivers/pinctrl/pxa/pinctrl-pxa2xx.c | 1 drivers/platform/x86/thinkpad_acpi.c | 15 drivers/platform/x86/toshiba_acpi.c | 60 +- drivers/pnp/isapnp/proc.c | 9 drivers/pnp/pnpbios/proc.c | 17 drivers/s390/block/dasd_proc.c | 15 drivers/s390/cio/blacklist.c | 14 drivers/s390/cio/css.c | 11 drivers/scsi/esas2r/esas2r_main.c | 9 drivers/scsi/scsi_devinfo.c | 15 drivers/scsi/scsi_proc.c | 29 - drivers/scsi/sg.c | 30 - drivers/spi/spi-orion.c | 3 drivers/staging/rtl8192u/ieee80211/ieee80211_module.c | 14 drivers/tty/sysrq.c | 8 drivers/usb/gadget/function/rndis.c | 17 drivers/video/fbdev/imxfb.c | 2 drivers/video/fbdev/via/viafbdev.c | 105 ++-- drivers/zorro/proc.c | 9 fs/cifs/cifs_debug.c | 108 ++-- fs/cifs/dfs_cache.c | 13 fs/cifs/dfs_cache.h | 2 fs/ext4/super.c | 2 fs/f2fs/node.c | 2 fs/fscache/internal.h | 2 fs/fscache/object-list.c | 11 fs/fscache/proc.c | 2 fs/jbd2/journal.c | 13 fs/jfs/jfs_debug.c | 14 fs/lockd/procfs.c | 12 fs/nfsd/nfsctl.c | 13 fs/nfsd/stats.c | 12 fs/ocfs2/file.c | 14 fs/ocfs2/suballoc.c | 2 fs/proc/cpuinfo.c | 12 fs/proc/generic.c | 38 - fs/proc/inode.c | 76 +-- fs/proc/internal.h | 5 fs/proc/kcore.c | 13 fs/proc/kmsg.c | 14 fs/proc/page.c | 54 +- fs/proc/proc_net.c | 32 - fs/proc/proc_sysctl.c | 2 fs/proc/root.c | 2 fs/proc/stat.c | 12 fs/proc/task_mmu.c | 4 fs/proc/vmcore.c | 10 fs/sysfs/group.c | 2 include/asm-generic/pgtable.h | 20 include/asm-generic/tlb.h | 138 +++-- include/linux/bitmap.h | 8 include/linux/bitops.h | 4 include/linux/cpumask.h | 4 include/linux/memory_hotplug.h | 4 include/linux/mm.h | 6 include/linux/mmzone.h | 10 include/linux/pagewalk.h | 49 +- include/linux/proc_fs.h | 23 include/linux/ptdump.h | 24 - include/linux/seq_file.h | 13 include/linux/slab.h | 1 include/linux/string.h | 1 include/linux/sunrpc/stats.h | 4 ipc/mqueue.c | 123 ++++- ipc/msg.c | 62 +- ipc/sem.c | 66 +- ipc/util.c | 14 kernel/configs.c | 9 kernel/irq/proc.c | 42 - kernel/kallsyms.c | 12 kernel/latencytop.c | 14 kernel/locking/lockdep_proc.c | 15 kernel/module.c | 12 kernel/profile.c | 24 - kernel/sched/psi.c | 48 +- lib/bitmap.c | 195 ++++---- lib/string.c | 17 lib/test_bitmap.c | 105 ++++ mm/Kconfig.debug | 21 mm/Makefile | 1 mm/gup.c | 2 mm/hmm.c | 66 +- mm/memory_hotplug.c | 104 +--- mm/memremap.c | 2 mm/migrate.c | 5 mm/mincore.c | 1 mm/mmu_gather.c | 158 ++++-- mm/page_alloc.c | 75 +-- mm/pagewalk.c | 167 +++++-- mm/ptdump.c | 159 ++++++ mm/slab_common.c | 37 - mm/sparse.c | 10 mm/swapfile.c | 14 net/atm/mpoa_proc.c | 17 net/atm/proc.c | 8 net/core/dev.c | 2 net/core/filter.c | 2 net/core/pktgen.c | 44 - net/ipv4/ipconfig.c | 10 net/ipv4/netfilter/ipt_CLUSTERIP.c | 16 net/ipv4/route.c | 24 - net/netfilter/xt_recent.c | 17 net/sunrpc/auth_gss/svcauth_gss.c | 10 net/sunrpc/cache.c | 45 - net/sunrpc/stats.c | 21 net/xfrm/xfrm_policy.c | 2 samples/kfifo/bytestream-example.c | 11 samples/kfifo/inttype-example.c | 11 samples/kfifo/record-example.c | 11 scripts/coccinelle/free/devm_free.cocci | 4 sound/core/info.c | 34 - sound/soc/codecs/ak4104.c | 3 sound/soc/codecs/cs4270.c | 3 sound/soc/codecs/tlv320aic32x4.c | 6 sound/soc/sunxi/sun4i-spdif.c | 2 tools/include/linux/bitops.h | 9 214 files changed, 2589 insertions(+), 2227 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-02-04 1:33 incoming Andrew Morton @ 2020-02-04 2:27 ` Linus Torvalds 2020-02-04 2:46 ` incoming Andrew Morton 0 siblings, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2020-02-04 2:27 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Tue, Feb 4, 2020 at 1:33 AM Andrew Morton <akpm@linux-foundation.org> wrote: > > The rest of MM and the rest of everything else. What's the base? You've changed your scripts or something, and that information is no longer in your cover letter.. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-02-04 2:27 ` incoming Linus Torvalds @ 2020-02-04 2:46 ` Andrew Morton 2020-02-04 3:11 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2020-02-04 2:46 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, Linux-MM On Tue, 4 Feb 2020 02:27:48 +0000 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Tue, Feb 4, 2020 at 1:33 AM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > The rest of MM and the rest of everything else. > > What's the base? You've changed your scripts or something, and that > information is no longer in your cover letter.. > Crap, sorry, geriatric. d4e9056daedca3891414fe3c91de3449a5dad0f2 ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2020-02-04 2:46 ` incoming Andrew Morton @ 2020-02-04 3:11 ` Linus Torvalds 0 siblings, 0 replies; 348+ messages in thread From: Linus Torvalds @ 2020-02-04 3:11 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Tue, Feb 4, 2020 at 2:46 AM Andrew Morton <akpm@linux-foundation.org> wrote: > > On Tue, 4 Feb 2020 02:27:48 +0000 Linus Torvalds <torvalds@linux-foundation.org> wrote: > > > What's the base? You've changed your scripts or something, and that > > information is no longer in your cover letter.. > > Crap, sorry, geriatric. > > d4e9056daedca3891414fe3c91de3449a5dad0f2 Ok, I've tentatively applied it with the MIME decoding fixes I found, and I'll guess I'll let it build and sit for a while before merging it into my tree. I didn't find anything else odd in there. But... Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-01-31 6:10 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-01-31 6:10 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits Most of -mm and quite a number of other subsystems. MM is fairly quiet this time. Holidays, I assume. 119 patches, based on 39bed42de2e7d74686a2d5a45638d6a5d7e7d473: Subsystems affected by this patch series: hotfixes scripts ocfs2 mm/slub mm/kmemleak mm/debug mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/tracing mm/kasan mm/initialization mm/pagealloc mm/vmscan mm/tools mm/memblock mm/oom-kill mm/hugetlb mm/migration mm/mmap mm/memory-hotplug mm/zswap mm/cleanups mm/zram misc lib binfmt init reiserfs exec dma-mapping kcov Subsystem: hotfixes Andy Shevchenko <andriy.shevchenko@linux.intel.com>: lib/test_bitmap: correct test data offsets for 32-bit "Theodore Ts'o" <tytso@mit.edu>: memcg: fix a crash in wb_workfn when a device disappears Dan Carpenter <dan.carpenter@oracle.com>: mm/mempolicy.c: fix out of bounds write in mpol_parse_str() Pingfan Liu <kernelfans@gmail.com>: mm/sparse.c: reset section's mem_map when fully deactivated Wei Yang <richardw.yang@linux.intel.com>: mm/migrate.c: also overwrite error when it is bigger than zero Dan Williams <dan.j.williams@intel.com>: mm/memory_hotplug: fix remove_memory() lockdep splat Wei Yang <richardw.yang@linux.intel.com>: mm: thp: don't need care deferred split queue in memcg charge move path Yang Shi <yang.shi@linux.alibaba.com>: mm: move_pages: report the number of non-attempted pages Subsystem: scripts Xiong <xndchn@gmail.com>: scripts/spelling.txt: add more spellings to spelling.txt Luca Ceresoli <luca@lucaceresoli.net>: scripts/spelling.txt: add "issus" typo Subsystem: ocfs2 Aditya Pakki <pakki001@umn.edu>: fs: ocfs: remove unnecessary assertion in dlm_migrate_lockres zhengbin <zhengbin13@huawei.com>: ocfs2: remove unneeded semicolons Masahiro Yamada <masahiroy@kernel.org>: ocfs2: make local header paths relative to C files Colin Ian King <colin.king@canonical.com>: ocfs2/dlm: remove redundant assignment to ret Andy Shevchenko <andriy.shevchenko@linux.intel.com>: ocfs2/dlm: move BITS_TO_BYTES() to bitops.h for wider use wangyan <wangyan122@huawei.com>: ocfs2: fix a NULL pointer dereference when call ocfs2_update_inode_fsync_trans() ocfs2: use ocfs2_update_inode_fsync_trans() to access t_tid in handle->h_transaction Subsystem: mm/slub Yu Zhao <yuzhao@google.com>: mm/slub.c: avoid slub allocation while holding list_lock Subsystem: mm/kmemleak He Zhe <zhe.he@windriver.com>: mm/kmemleak: turn kmemleak_lock and object->lock to raw_spinlock_t Subsystem: mm/debug Vlastimil Babka <vbabka@suse.cz>: mm/debug.c: always print flags in dump_page() Subsystem: mm/pagecache Ira Weiny <ira.weiny@intel.com>: mm/filemap.c: clean up filemap_write_and_wait() Subsystem: mm/gup Qiujun Huang <hqjagain@gmail.com>: mm: fix gup_pud_range Wei Yang <richardw.yang@linux.intel.com>: mm/gup.c: use is_vm_hugetlb_page() to check whether to follow huge John Hubbard <jhubbard@nvidia.com>: Patch series "mm/gup: prereqs to track dma-pinned pages: FOLL_PIN", v12: mm/gup: factor out duplicate code from four routines mm/gup: move try_get_compound_head() to top, fix minor issues Dan Williams <dan.j.williams@intel.com>: mm: Cleanup __put_devmap_managed_page() vs ->page_free() John Hubbard <jhubbard@nvidia.com>: mm: devmap: refactor 1-based refcounting for ZONE_DEVICE pages goldish_pipe: rename local pin_user_pages() routine mm: fix get_user_pages_remote()'s handling of FOLL_LONGTERM vfio: fix FOLL_LONGTERM use, simplify get_user_pages_remote() call mm/gup: allow FOLL_FORCE for get_user_pages_fast() IB/umem: use get_user_pages_fast() to pin DMA pages media/v4l2-core: set pages dirty upon releasing DMA buffers mm/gup: introduce pin_user_pages*() and FOLL_PIN goldish_pipe: convert to pin_user_pages() and put_user_page() IB/{core,hw,umem}: set FOLL_PIN via pin_user_pages*(), fix up ODP mm/process_vm_access: set FOLL_PIN via pin_user_pages_remote() drm/via: set FOLL_PIN via pin_user_pages_fast() fs/io_uring: set FOLL_PIN via pin_user_pages() net/xdp: set FOLL_PIN via pin_user_pages() media/v4l2-core: pin_user_pages (FOLL_PIN) and put_user_page() conversion vfio, mm: pin_user_pages (FOLL_PIN) and put_user_page() conversion powerpc: book3s64: convert to pin_user_pages() and put_user_page() mm/gup_benchmark: use proper FOLL_WRITE flags instead of hard-coding "1" mm, tree-wide: rename put_user_page*() to unpin_user_page*() Subsystem: mm/swap Vasily Averin <vvs@virtuozzo.com>: mm/swapfile.c: swap_next should increase position index Subsystem: mm/memcg Kaitao Cheng <pilgrimtao@gmail.com>: mm/memcontrol.c: cleanup some useless code Subsystem: mm/pagemap Li Xinhai <lixinhai.lxh@gmail.com>: mm/page_vma_mapped.c: explicitly compare pfn for normal, hugetlbfs and THP page Subsystem: mm/tracing Junyong Sun <sunjy516@gmail.com>: mm, tracing: print symbol name for kmem_alloc_node call_site events Subsystem: mm/kasan "Gustavo A. R. Silva" <gustavo@embeddedor.com>: lib/test_kasan.c: fix memory leak in kmalloc_oob_krealloc_more() Subsystem: mm/initialization Andy Shevchenko <andriy.shevchenko@linux.intel.com>: mm/early_ioremap.c: use %pa to print resource_size_t variables Subsystem: mm/pagealloc "Kirill A. Shutemov" <kirill@shutemov.name>: mm/page_alloc: skip non present sections on zone initialization David Hildenbrand <david@redhat.com>: mm: remove the memory isolate notifier mm: remove "count" parameter from has_unmovable_pages() Subsystem: mm/vmscan Liu Song <liu.song11@zte.com.cn>: mm/vmscan.c: remove unused return value of shrink_node Alex Shi <alex.shi@linux.alibaba.com>: mm/vmscan: remove prefetch_prev_lru_page mm/vmscan: remove unused RECLAIM_OFF/RECLAIM_ZONE Subsystem: mm/tools Daniel Wagner <dwagner@suse.de>: tools/vm/slabinfo: fix sanity checks enabling Subsystem: mm/memblock Anshuman Khandual <anshuman.khandual@arm.com>: mm/memblock: define memblock_physmem_add() memblock: Use __func__ in remaining memblock_dbg() call sites Subsystem: mm/oom-kill David Rientjes <rientjes@google.com>: mm, oom: dump stack of victim when reaping failed Subsystem: mm/hugetlb Wei Yang <richardw.yang@linux.intel.com>: mm/huge_memory.c: use head to check huge zero page mm/huge_memory.c: use head to emphasize the purpose of page mm/huge_memory.c: reduce critical section protected by split_queue_lock Subsystem: mm/migration Ralph Campbell <rcampbell@nvidia.com>: mm/migrate: remove useless mask of start address mm/migrate: clean up some minor coding style mm/migrate: add stable check in migrate_vma_insert_page() David Rientjes <rientjes@google.com>: mm, thp: fix defrag setting if newline is not used Subsystem: mm/mmap Miaohe Lin <linmiaohe@huawei.com>: mm/mmap.c: get rid of odd jump labels in find_mergeable_anon_vma() Subsystem: mm/memory-hotplug David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: pass in nid to online_pages()": mm/memory_hotplug: pass in nid to online_pages() Qian Cai <cai@lca.pw>: mm/hotplug: silence a lockdep splat with printk() mm/page_isolation: fix potential warning from user Subsystem: mm/zswap Vitaly Wool <vitaly.wool@konsulko.com>: mm/zswap.c: add allocation hysteresis if pool limit is hit Dan Carpenter <dan.carpenter@oracle.com>: zswap: potential NULL dereference on error in init_zswap() Subsystem: mm/cleanups Yu Zhao <yuzhao@google.com>: include/linux/mm.h: clean up obsolete check on space in page->flags Wei Yang <richardw.yang@linux.intel.com>: include/linux/mm.h: remove dead code totalram_pages_set() Anshuman Khandual <anshuman.khandual@arm.com>: include/linux/memory.h: drop fields 'hw' and 'phys_callback' from struct memory_block Hao Lee <haolee.swjtu@gmail.com>: mm: fix comments related to node reclaim Subsystem: mm/zram Taejoon Song <taejoon.song@lge.com>: zram: try to avoid worst-case scenario on same element pages Colin Ian King <colin.king@canonical.com>: drivers/block/zram/zram_drv.c: fix error return codes not being returned in writeback_store Subsystem: misc Akinobu Mita <akinobu.mita@gmail.com>: Patch series "add header file for kelvin to/from Celsius conversion: include/linux/units.h: add helpers for kelvin to/from Celsius conversion ACPI: thermal: switch to use <linux/units.h> helpers platform/x86: asus-wmi: switch to use <linux/units.h> helpers platform/x86: intel_menlow: switch to use <linux/units.h> helpers thermal: int340x: switch to use <linux/units.h> helpers thermal: intel_pch: switch to use <linux/units.h> helpers nvme: hwmon: switch to use <linux/units.h> helpers thermal: remove kelvin to/from Celsius conversion helpers from <linux/thermal.h> iwlegacy: use <linux/units.h> helpers iwlwifi: use <linux/units.h> helpers thermal: armada: remove unused TO_MCELSIUS macro iio: adc: qcom-vadc-common: use <linux/units.h> helpers Subsystem: lib Mikhail Zaslonko <zaslonko@linux.ibm.com>: Patch series "S390 hardware support for kernel zlib", v3: lib/zlib: add s390 hardware support for kernel zlib_deflate s390/boot: rename HEAP_SIZE due to name collision lib/zlib: add s390 hardware support for kernel zlib_inflate s390/boot: add dfltcc= kernel command line parameter lib/zlib: add zlib_deflate_dfltcc_enabled() function btrfs: use larger zlib buffer for s390 hardware compression Nathan Chancellor <natechancellor@gmail.com>: lib/scatterlist.c: adjust indentation in __sg_alloc_table Yury Norov <yury.norov@gmail.com>: uapi: rename ext2_swab() to swab() and share globally in swab.h lib/find_bit.c: join _find_next_bit{_le} lib/find_bit.c: uninline helper _find_next_bit() Subsystem: binfmt Alexey Dobriyan <adobriyan@gmail.com>: fs/binfmt_elf.c: smaller code generation around auxv vector fill fs/binfmt_elf.c: fix ->start_code calculation fs/binfmt_elf.c: don't copy ELF header around fs/binfmt_elf.c: better codegen around current->mm fs/binfmt_elf.c: make BAD_ADDR() unlikely fs/binfmt_elf.c: coredump: allocate core ELF header on stack fs/binfmt_elf.c: coredump: delete duplicated overflow check fs/binfmt_elf.c: coredump: allow process with empty address space to coredump Subsystem: init Arvind Sankar <nivedita@alum.mit.edu>: init/main.c: log arguments and environment passed to init init/main.c: remove unnecessary repair_env_string in do_initcall_level Patch series "init/main.c: minor cleanup/bugfix of envvar handling", v2: init/main.c: fix quoted value handling in unknown_bootoption Christophe Leroy <christophe.leroy@c-s.fr>: init/main.c: fix misleading "This architecture does not have kernel memory protection" message Subsystem: reiserfs Yunfeng Ye <yeyunfeng@huawei.com>: reiserfs: prevent NULL pointer dereference in reiserfs_insert_item() Subsystem: exec Alexey Dobriyan <adobriyan@gmail.com>: execve: warn if process starts with executable stack Subsystem: dma-mapping Andy Shevchenko <andriy.shevchenko@linux.intel.com>: include/linux/io-mapping.h-mapping: use PHYS_PFN() macro in io_mapping_map_atomic_wc() Subsystem: kcov Dmitry Vyukov <dvyukov@google.com>: kcov: ignore fault-inject and stacktrace Documentation/admin-guide/kernel-parameters.txt | 12 Documentation/core-api/index.rst | 1 Documentation/core-api/pin_user_pages.rst | 234 +++++ Documentation/vm/zswap.rst | 13 arch/powerpc/mm/book3s64/iommu_api.c | 14 arch/s390/boot/compressed/decompressor.c | 8 arch/s390/boot/ipl_parm.c | 14 arch/s390/include/asm/setup.h | 7 arch/s390/kernel/setup.c | 14 drivers/acpi/thermal.c | 34 drivers/base/memory.c | 25 drivers/block/zram/zram_drv.c | 10 drivers/gpu/drm/via/via_dmablit.c | 6 drivers/iio/adc/qcom-vadc-common.c | 6 drivers/iio/adc/qcom-vadc-common.h | 1 drivers/infiniband/core/umem.c | 21 drivers/infiniband/core/umem_odp.c | 13 drivers/infiniband/hw/hfi1/user_pages.c | 4 drivers/infiniband/hw/mthca/mthca_memfree.c | 8 drivers/infiniband/hw/qib/qib_user_pages.c | 4 drivers/infiniband/hw/qib/qib_user_sdma.c | 8 drivers/infiniband/hw/usnic/usnic_uiom.c | 4 drivers/infiniband/sw/siw/siw_mem.c | 4 drivers/media/v4l2-core/videobuf-dma-sg.c | 20 drivers/net/ethernet/broadcom/bnx2x/bnx2x_init.h | 1 drivers/net/wireless/intel/iwlegacy/4965-mac.c | 3 drivers/net/wireless/intel/iwlegacy/4965.c | 17 drivers/net/wireless/intel/iwlegacy/common.h | 3 drivers/net/wireless/intel/iwlwifi/dvm/dev.h | 5 drivers/net/wireless/intel/iwlwifi/dvm/devices.c | 6 drivers/nvdimm/pmem.c | 6 drivers/nvme/host/hwmon.c | 13 drivers/platform/goldfish/goldfish_pipe.c | 39 drivers/platform/x86/asus-wmi.c | 7 drivers/platform/x86/intel_menlow.c | 9 drivers/thermal/armada_thermal.c | 2 drivers/thermal/intel/int340x_thermal/int340x_thermal_zone.c | 7 drivers/thermal/intel/intel_pch_thermal.c | 3 drivers/vfio/vfio_iommu_type1.c | 39 fs/binfmt_elf.c | 154 +-- fs/btrfs/compression.c | 2 fs/btrfs/zlib.c | 135 ++ fs/exec.c | 5 fs/fs-writeback.c | 2 fs/io_uring.c | 6 fs/ocfs2/cluster/quorum.c | 2 fs/ocfs2/dlm/Makefile | 2 fs/ocfs2/dlm/dlmast.c | 8 fs/ocfs2/dlm/dlmcommon.h | 4 fs/ocfs2/dlm/dlmconvert.c | 8 fs/ocfs2/dlm/dlmdebug.c | 8 fs/ocfs2/dlm/dlmdomain.c | 8 fs/ocfs2/dlm/dlmlock.c | 8 fs/ocfs2/dlm/dlmmaster.c | 10 fs/ocfs2/dlm/dlmrecovery.c | 10 fs/ocfs2/dlm/dlmthread.c | 8 fs/ocfs2/dlm/dlmunlock.c | 8 fs/ocfs2/dlmfs/Makefile | 2 fs/ocfs2/dlmfs/dlmfs.c | 4 fs/ocfs2/dlmfs/userdlm.c | 6 fs/ocfs2/dlmglue.c | 2 fs/ocfs2/journal.h | 8 fs/ocfs2/namei.c | 3 fs/reiserfs/stree.c | 3 include/linux/backing-dev.h | 10 include/linux/bitops.h | 1 include/linux/fs.h | 6 include/linux/io-mapping.h | 5 include/linux/memblock.h | 7 include/linux/memory.h | 29 include/linux/memory_hotplug.h | 3 include/linux/mm.h | 116 +- include/linux/mmzone.h | 2 include/linux/page-isolation.h | 8 include/linux/swab.h | 1 include/linux/thermal.h | 11 include/linux/units.h | 84 + include/linux/zlib.h | 6 include/trace/events/kmem.h | 4 include/trace/events/writeback.h | 37 include/uapi/linux/swab.h | 10 include/uapi/linux/sysctl.h | 2 init/main.c | 36 kernel/Makefile | 1 lib/Kconfig | 7 lib/Makefile | 2 lib/decompress_inflate.c | 13 lib/find_bit.c | 82 - lib/scatterlist.c | 2 lib/test_bitmap.c | 9 lib/test_kasan.c | 1 lib/zlib_deflate/deflate.c | 85 + lib/zlib_deflate/deflate_syms.c | 1 lib/zlib_deflate/deftree.c | 54 - lib/zlib_deflate/defutil.h | 134 ++ lib/zlib_dfltcc/Makefile | 13 lib/zlib_dfltcc/dfltcc.c | 57 + lib/zlib_dfltcc/dfltcc.h | 155 +++ lib/zlib_dfltcc/dfltcc_deflate.c | 280 ++++++ lib/zlib_dfltcc/dfltcc_inflate.c | 149 +++ lib/zlib_dfltcc/dfltcc_syms.c | 17 lib/zlib_dfltcc/dfltcc_util.h | 123 ++ lib/zlib_inflate/inflate.c | 32 lib/zlib_inflate/inflate.h | 8 lib/zlib_inflate/infutil.h | 18 mm/Makefile | 1 mm/backing-dev.c | 1 mm/debug.c | 18 mm/early_ioremap.c | 8 mm/filemap.c | 34 mm/gup.c | 503 ++++++----- mm/gup_benchmark.c | 9 mm/huge_memory.c | 44 mm/kmemleak.c | 112 +- mm/memblock.c | 22 mm/memcontrol.c | 25 mm/memory_hotplug.c | 24 mm/mempolicy.c | 6 mm/memremap.c | 95 -- mm/migrate.c | 77 + mm/mmap.c | 30 mm/oom_kill.c | 2 mm/page_alloc.c | 83 + mm/page_isolation.c | 69 - mm/page_vma_mapped.c | 12 mm/process_vm_access.c | 32 mm/slub.c | 88 + mm/sparse.c | 2 mm/swap.c | 27 mm/swapfile.c | 2 mm/vmscan.c | 24 mm/zswap.c | 88 + net/xdp/xdp_umem.c | 4 scripts/spelling.txt | 14 tools/testing/selftests/vm/gup_benchmark.c | 6 tools/vm/slabinfo.c | 4 136 files changed, 2790 insertions(+), 1358 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-01-14 0:28 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-01-14 0:28 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 11 MM fixes, based on b3a987b0264d3ddbb24293ebff10eddfc472f653: Vlastimil Babka <vbabka@suse.cz>: mm, thp: tweak reclaim/compaction effort of local-only and all-node allocations David Hildenbrand <david@redhat.com>: mm/memory_hotplug: don't free usage map when removing a re-added early section "Kirill A. Shutemov" <kirill@shutemov.name>: Patch series "Fix two above-47bit hint address vs. THP bugs": mm/huge_memory.c: thp: fix conflict of above-47bit hint address and PMD alignment mm/shmem.c: thp, shmem: fix conflict of above-47bit hint address and PMD alignment Roman Gushchin <guro@fb.com>: mm: memcg/slab: fix percpu slab vmstats flushing Vlastimil Babka <vbabka@suse.cz>: mm, debug_pagealloc: don't rely on static keys too early Wen Yang <wenyang@linux.alibaba.com>: Patch series "use div64_ul() instead of div_u64() if the divisor is: mm/page-writeback.c: avoid potential division by zero in wb_min_max_ratio() mm/page-writeback.c: use div64_ul() for u64-by-unsigned-long divide mm/page-writeback.c: improve arithmetic divisions Adrian Huang <ahuang12@lenovo.com>: mm: memcg/slab: call flush_memcg_workqueue() only if memcg workqueue is valid Yang Shi <yang.shi@linux.alibaba.com>: mm: khugepaged: add trace status description for SCAN_PAGE_HAS_PRIVATE include/linux/mm.h | 18 +++++++++- include/linux/mmzone.h | 5 +-- include/trace/events/huge_memory.h | 3 + init/main.c | 1 mm/huge_memory.c | 38 ++++++++++++++--------- mm/memcontrol.c | 37 +++++----------------- mm/mempolicy.c | 10 ++++-- mm/page-writeback.c | 10 +++--- mm/page_alloc.c | 61 ++++++++++--------------------------- mm/shmem.c | 7 ++-- mm/slab.c | 4 +- mm/slab_common.c | 3 + mm/slub.c | 2 - mm/sparse.c | 9 ++++- mm/vmalloc.c | 4 +- 15 files changed, 102 insertions(+), 110 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2020-01-04 20:55 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2020-01-04 20:55 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 17 fixes, base on 5613970af3f5f8372c596b138bd64f3918513515: David Hildenbrand <david@redhat.com>: mm/memory_hotplug: shrink zones when offlining memory Chanho Min <chanho.min@lge.com>: mm/zsmalloc.c: fix the migrated zspage statistics. Andrey Konovalov <andreyknvl@google.com>: kcov: fix struct layout for kcov_remote_arg Shakeel Butt <shakeelb@google.com>: memcg: account security cred as well to kmemcg Yang Shi <yang.shi@linux.alibaba.com>: mm: move_pages: return valid node id in status if the page is already on the target node Eric Biggers <ebiggers@google.com>: fs/direct-io.c: include fs/internal.h for missing prototype fs/nsfs.c: include headers for missing declarations fs/namespace.c: make to_mnt_ns() static Nick Desaulniers <ndesaulniers@google.com>: hexagon: parenthesize registers in asm predicates hexagon: work around compiler crash Randy Dunlap <rdunlap@infradead.org>: fs/posix_acl.c: fix kernel-doc warnings Ilya Dryomov <idryomov@gmail.com>: mm/oom: fix pgtables units mismatch in Killed process message Navid Emamdoost <navid.emamdoost@gmail.com>: mm/gup: fix memory leak in __gup_benchmark_ioctl Waiman Long <longman@redhat.com>: mm/hugetlb: defer freeing of huge pages if in non-task context Kai Li <li.kai4@h3c.com>: ocfs2: call journal flush to mark journal as empty after journal recovery when mount Gang He <GHe@suse.com>: ocfs2: fix the crash due to call ocfs2_get_dlm_debug once less Nick Desaulniers <ndesaulniers@google.com>: hexagon: define ioremap_uc Documentation/dev-tools/kcov.rst | 10 +++---- arch/arm64/mm/mmu.c | 4 -- arch/hexagon/include/asm/atomic.h | 8 ++--- arch/hexagon/include/asm/bitops.h | 8 ++--- arch/hexagon/include/asm/cmpxchg.h | 2 - arch/hexagon/include/asm/futex.h | 6 ++-- arch/hexagon/include/asm/io.h | 1 arch/hexagon/include/asm/spinlock.h | 20 +++++++------- arch/hexagon/kernel/stacktrace.c | 4 -- arch/hexagon/kernel/vm_entry.S | 2 - arch/ia64/mm/init.c | 4 -- arch/powerpc/mm/mem.c | 3 -- arch/s390/mm/init.c | 4 -- arch/sh/mm/init.c | 4 -- arch/x86/mm/init_32.c | 4 -- arch/x86/mm/init_64.c | 4 -- fs/direct-io.c | 2 + fs/namespace.c | 2 - fs/nsfs.c | 3 ++ fs/ocfs2/dlmglue.c | 1 fs/ocfs2/journal.c | 8 +++++ fs/posix_acl.c | 7 +++- include/linux/memory_hotplug.h | 7 +++- include/uapi/linux/kcov.h | 10 +++---- kernel/cred.c | 6 ++-- mm/gup_benchmark.c | 8 ++++- mm/hugetlb.c | 51 +++++++++++++++++++++++++++++++++++- mm/memory_hotplug.c | 31 +++++++++++---------- mm/memremap.c | 2 - mm/migrate.c | 23 ++++++++++++---- mm/oom_kill.c | 2 - mm/zsmalloc.c | 5 +++ 32 files changed, 166 insertions(+), 90 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2019-12-18 4:50 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2019-12-18 4:50 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 6 fixes based on 2187f215ebaac73ddbd814696d7c7fa34f0c3de0: Andrey Ryabinin <aryabinin@virtuozzo.com>: kasan: fix crashes on access to memory mapped by vm_map_ram() Daniel Axtens <dja@axtens.net>: mm/memory.c: add apply_to_existing_page_range() helper kasan: use apply_to_existing_page_range() for releasing vmalloc shadow kasan: don't assume percpu shadow allocations will succeed Yang Shi <yang.shi@linux.alibaba.com>: mm: vmscan: protect shrinker idr replace with CONFIG_MEMCG Changbin Du <changbin.du@gmail.com>: lib/Kconfig.debug: fix some messed up configurations include/linux/kasan.h | 15 +++-- include/linux/mm.h | 3 + lib/Kconfig.debug | 100 ++++++++++++++++++------------------ mm/kasan/common.c | 36 ++++++++----- mm/memory.c | 136 ++++++++++++++++++++++++++++++++++---------------- mm/vmalloc.c | 133 ++++++++++++++++++++++++++++-------------------- mm/vmscan.c | 2 7 files changed, 260 insertions(+), 165 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2019-12-05 0:48 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2019-12-05 0:48 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm Most of the rest of MM and various other things. Some Kconfig rework still awaits merges of dependent trees from linux-next. 86 patches, based on 63de37476ebd1e9bab6a9e17186dc5aa1da9ea99. Subsystems affected by this patch series: mm/hotfixes mm/memcg mm/vmstat mm/thp procfs sysctl misc notifiers core-kernel bitops lib checkpatch epoll binfmt init rapidio uaccess kcov ubsan ipc bitmap mm/pagemap Subsystem: mm/hotfixes zhong jiang <zhongjiang@huawei.com>: mm/kasan/common.c: fix compile error Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: memcg/slab: wait for !root kmem_cache refcnt killing on root kmem_cache destruction Subsystem: mm/vmstat Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm/vmstat: add helpers to get vmstat item names for each enum type mm/memcontrol: use vmstat names for printing statistics Subsystem: mm/thp Yu Zhao <yuzhao@google.com>: mm/memory.c: replace is_zero_pfn with is_huge_zero_pmd for thp Subsystem: procfs Alexey Dobriyan <adobriyan@gmail.com>: proc: change ->nlink under proc_subdir_lock fs/proc/generic.c: delete useless "len" variable fs/proc/internal.h: shuffle "struct pde_opener" Miaohe Lin <linmiaohe@huawei.com>: include/linux/proc_fs.h: fix confusing macro arg name Krzysztof Kozlowski <krzk@kernel.org>: fs/proc/Kconfig: fix indentation Subsystem: sysctl Alessio Balsini <balsini@android.com>: include/linux/sysctl.h: inline braces for ctl_table and ctl_table_header Subsystem: misc Stephen Boyd <swboyd@chromium.org>: .gitattributes: use 'dts' diff driver for dts files Rikard Falkeborn <rikard.falkeborn@gmail.com>: linux/build_bug.h: change type to int Masahiro Yamada <yamada.masahiro@socionext.com>: linux/scc.h: make uapi linux/scc.h self-contained Krzysztof Kozlowski <krzk@kernel.org>: arch/Kconfig: fix indentation Joe Perches <joe@perches.com>: scripts/get_maintainer.pl: add signatures from Fixes: <badcommit> lines in commit message Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: update comment about simple_strto<foo>() functions auxdisplay: charlcd: deduplicate simple_strtoul() Subsystem: notifiers Xiaoming Ni <nixiaoming@huawei.com>: kernel/notifier.c: intercept duplicate registrations to avoid infinite loops kernel/notifier.c: remove notifier_chain_cond_register() kernel/notifier.c: remove blocking_notifier_chain_cond_register() Subsystem: core-kernel Nathan Chancellor <natechancellor@gmail.com>: kernel/profile.c: use cpumask_available to check for NULL cpumask Joe Perches <joe@perches.com>: kernel/sys.c: avoid copying possible padding bytes in copy_to_user Subsystem: bitops William Breathitt Gray <vilhelm.gray@gmail.com>: bitops: introduce the for_each_set_clump8 macro lib/test_bitmap.c: add for_each_set_clump8 test cases gpio: 104-dio-48e: utilize for_each_set_clump8 macro gpio: 104-idi-48: utilize for_each_set_clump8 macro gpio: gpio-mm: utilize for_each_set_clump8 macro gpio: ws16c48: utilize for_each_set_clump8 macro gpio: pci-idio-16: utilize for_each_set_clump8 macro gpio: pcie-idio-24: utilize for_each_set_clump8 macro gpio: uniphier: utilize for_each_set_clump8 macro gpio: 74x164: utilize the for_each_set_clump8 macro thermal: intel: intel_soc_dts_iosf: Utilize for_each_set_clump8 macro gpio: pisosr: utilize the for_each_set_clump8 macro gpio: max3191x: utilize the for_each_set_clump8 macro gpio: pca953x: utilize the for_each_set_clump8 macro Subsystem: lib Wei Yang <richardw.yang@linux.intel.com>: lib/rbtree: set successor's parent unconditionally lib/rbtree: get successor's color directly Laura Abbott <labbott@redhat.com>: lib/test_meminit.c: add bulk alloc/free tests Trent Piepho <tpiepho@gmail.com>: lib/math/rational.c: fix possible incorrect result from rational fractions helper Huang Shijie <sjhuang@iluvatar.ai>: lib/genalloc.c: export symbol addr_in_gen_pool lib/genalloc.c: rename addr_in_gen_pool to gen_pool_has_addr Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: improve ignoring CamelCase SI style variants like mA checkpatch: reduce is_maintained_obsolete lookup runtime Subsystem: epoll Jason Baron <jbaron@akamai.com>: epoll: simplify ep_poll_safewake() for CONFIG_DEBUG_LOCK_ALLOC Heiher <r@hev.cc>: fs/epoll: remove unnecessary wakeups of nested epoll selftests: add epoll selftests Subsystem: binfmt Alexey Dobriyan <adobriyan@gmail.com>: fs/binfmt_elf.c: delete unused "interp_map_addr" argument fs/binfmt_elf.c: extract elf_read() function Subsystem: init Krzysztof Kozlowski <krzk@kernel.org>: init/Kconfig: fix indentation Subsystem: rapidio "Ben Dooks (Codethink)" <ben.dooks@codethink.co.uk>: drivers/rapidio/rio-driver.c: fix missing include of <linux/rio_drv.h> drivers/rapidio/rio-access.c: fix missing include of <linux/rio_drv.h> Subsystem: uaccess Daniel Vetter <daniel.vetter@ffwll.ch>: drm: limit to INT_MAX in create_blob ioctl Kees Cook <keescook@chromium.org>: uaccess: disallow > INT_MAX copy sizes Subsystem: kcov Andrey Konovalov <andreyknvl@google.com>: Patch series " kcov: collect coverage from usb and vhost", v3: kcov: remote coverage support usb, kcov: collect coverage from hub_event vhost, kcov: collect coverage from vhost_worker Subsystem: ubsan Julien Grall <julien.grall@arm.com>: lib/ubsan: don't serialize UBSAN report Subsystem: ipc Masahiro Yamada <yamada.masahiro@socionext.com>: arch: ipcbuf.h: make uapi asm/ipcbuf.h self-contained arch: msgbuf.h: make uapi asm/msgbuf.h self-contained arch: sembuf.h: make uapi asm/sembuf.h self-contained Subsystem: bitmap Andy Shevchenko <andriy.shevchenko@linux.intel.com>: Patch series "gpio: pca953x: Convert to bitmap (extended) API", v2: lib/test_bitmap: force argument of bitmap_parselist_user() to proper address space lib/test_bitmap: undefine macros after use lib/test_bitmap: name EXP_BYTES properly lib/test_bitmap: rename exp to exp1 to avoid ambiguous name lib/test_bitmap: move exp1 and exp2 upper for others to use lib/test_bitmap: fix comment about this file lib/bitmap: introduce bitmap_replace() helper gpio: pca953x: remove redundant variable and check in IRQ handler gpio: pca953x: use input from regs structure in pca953x_irq_pending() gpio: pca953x: convert to use bitmap API gpio: pca953x: tighten up indentation Subsystem: mm/pagemap Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: remove __ARCH_HAS_4LEVEL_HACK", v13: alpha: use pgtable-nopud instead of 4level-fixup arm: nommu: use pgtable-nopud instead of 4level-fixup c6x: use pgtable-nopud instead of 4level-fixup m68k: nommu: use pgtable-nopud instead of 4level-fixup m68k: mm: use pgtable-nopXd instead of 4level-fixup microblaze: use pgtable-nopmd instead of 4level-fixup nds32: use pgtable-nopmd instead of 4level-fixup parisc: use pgtable-nopXd instead of 4level-fixup Helge Deller <deller@gmx.de>: parisc/hugetlb: use pgtable-nopXd instead of 4level-fixup Mike Rapoport <rppt@linux.ibm.com>: sparc32: use pgtable-nopud instead of 4level-fixup um: remove unused pxx_offset_proc() and addr_pte() functions um: add support for folded p4d page tables mm: remove __ARCH_HAS_4LEVEL_HACK and include/asm-generic/4level-fixup.h .gitattributes | 2 Documentation/core-api/genalloc.rst | 2 Documentation/dev-tools/kcov.rst | 129 arch/Kconfig | 22 arch/alpha/include/asm/mmzone.h | 1 arch/alpha/include/asm/pgalloc.h | 4 arch/alpha/include/asm/pgtable.h | 24 arch/alpha/mm/init.c | 12 arch/arm/include/asm/pgtable.h | 2 arch/arm/mm/dma-mapping.c | 2 arch/c6x/include/asm/pgtable.h | 2 arch/m68k/include/asm/mcf_pgalloc.h | 7 arch/m68k/include/asm/mcf_pgtable.h | 28 arch/m68k/include/asm/mmu_context.h | 12 arch/m68k/include/asm/motorola_pgalloc.h | 4 arch/m68k/include/asm/motorola_pgtable.h | 32 arch/m68k/include/asm/page.h | 9 arch/m68k/include/asm/pgtable_mm.h | 11 arch/m68k/include/asm/pgtable_no.h | 2 arch/m68k/include/asm/sun3_pgalloc.h | 5 arch/m68k/include/asm/sun3_pgtable.h | 18 arch/m68k/kernel/sys_m68k.c | 10 arch/m68k/mm/init.c | 6 arch/m68k/mm/kmap.c | 39 arch/m68k/mm/mcfmmu.c | 16 arch/m68k/mm/motorola.c | 17 arch/m68k/sun3x/dvma.c | 7 arch/microblaze/include/asm/page.h | 3 arch/microblaze/include/asm/pgalloc.h | 16 arch/microblaze/include/asm/pgtable.h | 32 arch/microblaze/kernel/signal.c | 10 arch/microblaze/mm/init.c | 7 arch/microblaze/mm/pgtable.c | 13 arch/mips/include/uapi/asm/msgbuf.h | 1 arch/mips/include/uapi/asm/sembuf.h | 2 arch/nds32/include/asm/page.h | 3 arch/nds32/include/asm/pgalloc.h | 3 arch/nds32/include/asm/pgtable.h | 12 arch/nds32/include/asm/tlb.h | 1 arch/nds32/kernel/pm.c | 4 arch/nds32/mm/fault.c | 16 arch/nds32/mm/init.c | 11 arch/nds32/mm/mm-nds32.c | 6 arch/nds32/mm/proc.c | 26 arch/parisc/include/asm/page.h | 30 arch/parisc/include/asm/pgalloc.h | 41 arch/parisc/include/asm/pgtable.h | 52 arch/parisc/include/asm/tlb.h | 2 arch/parisc/include/uapi/asm/msgbuf.h | 1 arch/parisc/include/uapi/asm/sembuf.h | 1 arch/parisc/kernel/cache.c | 13 arch/parisc/kernel/pci-dma.c | 9 arch/parisc/mm/fixmap.c | 10 arch/parisc/mm/hugetlbpage.c | 18 arch/powerpc/include/uapi/asm/msgbuf.h | 2 arch/powerpc/include/uapi/asm/sembuf.h | 2 arch/s390/include/uapi/asm/ipcbuf.h | 2 arch/sparc/include/asm/pgalloc_32.h | 6 arch/sparc/include/asm/pgtable_32.h | 28 arch/sparc/include/uapi/asm/ipcbuf.h | 2 arch/sparc/include/uapi/asm/msgbuf.h | 2 arch/sparc/include/uapi/asm/sembuf.h | 2 arch/sparc/mm/fault_32.c | 11 arch/sparc/mm/highmem.c | 6 arch/sparc/mm/io-unit.c | 6 arch/sparc/mm/iommu.c | 6 arch/sparc/mm/srmmu.c | 51 arch/um/include/asm/pgtable-2level.h | 1 arch/um/include/asm/pgtable-3level.h | 1 arch/um/include/asm/pgtable.h | 3 arch/um/kernel/mem.c | 8 arch/um/kernel/skas/mmu.c | 12 arch/um/kernel/skas/uaccess.c | 7 arch/um/kernel/tlb.c | 85 arch/um/kernel/trap.c | 4 arch/x86/include/uapi/asm/msgbuf.h | 3 arch/x86/include/uapi/asm/sembuf.h | 2 arch/xtensa/include/uapi/asm/ipcbuf.h | 2 arch/xtensa/include/uapi/asm/msgbuf.h | 2 arch/xtensa/include/uapi/asm/sembuf.h | 1 drivers/auxdisplay/charlcd.c | 34 drivers/base/node.c | 9 drivers/gpio/gpio-104-dio-48e.c | 75 drivers/gpio/gpio-104-idi-48.c | 36 drivers/gpio/gpio-74x164.c | 19 drivers/gpio/gpio-gpio-mm.c | 75 drivers/gpio/gpio-max3191x.c | 19 drivers/gpio/gpio-pca953x.c | 209 drivers/gpio/gpio-pci-idio-16.c | 75 drivers/gpio/gpio-pcie-idio-24.c | 111 drivers/gpio/gpio-pisosr.c | 12 drivers/gpio/gpio-uniphier.c | 13 drivers/gpio/gpio-ws16c48.c | 73 drivers/gpu/drm/drm_property.c | 2 drivers/misc/sram-exec.c | 2 drivers/rapidio/rio-access.c | 2 drivers/rapidio/rio-driver.c | 1 drivers/thermal/intel/intel_soc_dts_iosf.c | 31 drivers/thermal/intel/intel_soc_dts_iosf.h | 2 drivers/usb/core/hub.c | 5 drivers/vhost/vhost.c | 6 drivers/vhost/vhost.h | 1 fs/binfmt_elf.c | 56 fs/eventpoll.c | 52 fs/proc/Kconfig | 8 fs/proc/generic.c | 37 fs/proc/internal.h | 2 include/asm-generic/4level-fixup.h | 39 include/asm-generic/bitops/find.h | 17 include/linux/bitmap.h | 51 include/linux/bitops.h | 12 include/linux/build_bug.h | 4 include/linux/genalloc.h | 2 include/linux/kcov.h | 23 include/linux/kernel.h | 19 include/linux/mm.h | 10 include/linux/notifier.h | 4 include/linux/proc_fs.h | 4 include/linux/rbtree_augmented.h | 6 include/linux/sched.h | 8 include/linux/sysctl.h | 6 include/linux/thread_info.h | 2 include/linux/vmstat.h | 54 include/uapi/asm-generic/ipcbuf.h | 2 include/uapi/asm-generic/msgbuf.h | 2 include/uapi/asm-generic/sembuf.h | 1 include/uapi/linux/kcov.h | 28 include/uapi/linux/scc.h | 1 init/Kconfig | 78 kernel/dma/remap.c | 2 kernel/kcov.c | 547 + kernel/notifier.c | 45 kernel/profile.c | 6 kernel/sys.c | 4 lib/bitmap.c | 12 lib/find_bit.c | 14 lib/genalloc.c | 7 lib/math/rational.c | 63 lib/test_bitmap.c | 206 lib/test_meminit.c | 20 lib/ubsan.c | 64 mm/kasan/common.c | 1 mm/memcontrol.c | 52 mm/memory.c | 10 mm/slab_common.c | 12 mm/vmstat.c | 60 net/sunrpc/rpc_pipe.c | 2 scripts/checkpatch.pl | 13 scripts/get_maintainer.pl | 38 tools/testing/selftests/Makefile | 1 tools/testing/selftests/filesystems/epoll/.gitignore | 1 tools/testing/selftests/filesystems/epoll/Makefile | 7 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 3074 ++++++++++ usr/include/Makefile | 4 154 files changed, 5270 insertions(+), 1360 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2019-12-01 1:47 Andrew Morton 2019-12-01 5:17 ` incoming James Bottomley 2019-12-01 21:07 ` incoming Linus Torvalds 0 siblings, 2 replies; 348+ messages in thread From: Andrew Morton @ 2019-12-01 1:47 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - a small number of updates to scripts/, ocfs2 and fs/buffer.c - most of MM. I still have quite a lot of material (mostly not MM) staged after linux-next due to -next dependencies. I'll send thos across next week as the preprequisites get merged up. 158 patches, based on 32ef9553635ab1236c33951a8bd9b5af1c3b1646. Subsystems affected by this patch series: scripts ocfs2 vfs mm/slab mm/slub mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/memfd mm/memory-failure mm/memory-hotplug mm/sparsemem mm/vmalloc mm/kasan mm/pagealloc mm/vmscan mm/proc mm/z3fold mm/mempolicy mm/memblock mm/hugetlbfs mm/hugetlb mm/migration mm/thp mm/cma mm/autonuma mm/page-poison mm/mmap mm/madvise mm/userfaultfd mm/shmem mm/cleanups mm/support Subsystem: scripts Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ocfs2 Ding Xiang <dingxiang@cmss.chinamobile.com>: ocfs2: fix passing zero to 'PTR_ERR' warning Subsystem: vfs Saurav Girepunje <saurav.girepunje@gmail.com>: fs/buffer.c: fix use true/false for bool type Ben Dooks <ben.dooks@codethink.co.uk>: fs/buffer.c: include internal.h for missing declarations Subsystem: mm/slab Pengfei Li <lpf.vector@gmail.com>: Patch series "mm, slab: Make kmalloc_info[] contain all types of names", v6: mm, slab: make kmalloc_info[] contain all types of names mm, slab: remove unused kmalloc_size() mm, slab_common: use enum kmalloc_cache_type to iterate over kmalloc caches Subsystem: mm/slub Miles Chen <miles.chen@mediatek.com>: mm: slub: print the offset of fault addresses Yu Zhao <yuzhao@google.com>: mm/slub.c: update comments mm/slub.c: clean up validate_slab() Subsystem: mm/pagecache Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm/filemap.c: remove redundant cache invalidation after async direct-io write fs/direct-io.c: keep dio_warn_stale_pagecache() when CONFIG_BLOCK=n mm/filemap.c: warn if stale pagecache is left after direct write Subsystem: mm/gup zhong jiang <zhongjiang@huawei.com>: mm/gup.c: allow CMA migration to propagate errors back to caller Liu Xiang <liuxiang_1999@126.com>: mm/gup.c: fix comments of __get_user_pages() and get_user_pages_remote() Subsystem: mm/swap Naohiro Aota <naohiro.aota@wdc.com>: mm, swap: disallow swapon() on zoned block devices Fengguang Wu <fengguang.wu@intel.com>: mm/swap.c: trivial mark_page_accessed() cleanup Subsystem: mm/memcg Yafang Shao <laoar.shao@gmail.com>: mm, memcg: clean up reclaim iter array Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: remove dead code from memory_max_write() mm: memcontrol: try harder to set a new memory.high Hao Lee <haolee.swjtu@gmail.com>: include/linux/memcontrol.h: fix comments based on per-node memcg Shakeel Butt <shakeelb@google.com>: mm: vmscan: memcontrol: remove mem_cgroup_select_victim_node() Chris Down <chris@chrisdown.name>: Documentation/admin-guide/cgroup-v2.rst: document why inactive_X + active_X may not equal X Subsystem: mm/pagemap Johannes Weiner <hannes@cmpxchg.org>: mm: drop mmap_sem before calling balance_dirty_pages() in write fault "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: shmem: pin the file in shmem_fault() if mmap_sem is dropped "Joel Fernandes (Google)" <joel@joelfernandes.org>: mm: emit tracepoint when RSS changes rss_stat: add support to detect RSS updates of external mm Wei Yang <richardw.yang@linux.intel.com>: mm/mmap.c: remove a never-triggered warning in __vma_adjust() Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm/swap.c: piggyback lru_add_drain_all() calls Wei Yang <richardw.yang@linux.intel.com>: mm/mmap.c: prev could be retrieved from vma->vm_prev mm/mmap.c: __vma_unlink_prev() is not necessary now mm/mmap.c: extract __vma_unlink_list() as counterpart for __vma_link_list() mm/mmap.c: rb_parent is not necessary in __vma_link_list() mm/rmap.c: don't reuse anon_vma if we just want a copy mm/rmap.c: reuse mergeable anon_vma as parent when fork Gaowei Pu <pugaowei@gmail.com>: mm/mmap.c: use IS_ERR_VALUE to check return value of get_unmapped_area Vineet Gupta <Vineet.Gupta1@synopsys.com>: Patch series "elide extraneous generated code for folded p4d/pud/pmd", v3: ARC: mm: remove __ARCH_USE_5LEVEL_HACK asm-generic/tlb: stub out pud_free_tlb() if nopud ... asm-generic/tlb: stub out p4d_free_tlb() if nop4d ... asm-generic/tlb: stub out pmd_free_tlb() if nopmd asm-generic/mm: stub out p{4,u}d_clear_bad() if __PAGETABLE_P{4,U}D_FOLDED Miles Chen <miles.chen@mediatek.com>: mm/rmap.c: fix outdated comment in page_get_anon_vma() Yang Shi <yang.shi@linux.alibaba.com>: mm/rmap.c: use VM_BUG_ON_PAGE() in __page_check_anon_rmap() Thomas Hellstrom <thellstrom@vmware.com>: mm: move the backup x_devmap() functions to asm-generic/pgtable.h mm/memory.c: fix a huge pud insertion race during faulting Steven Price <steven.price@arm.com>: Patch series "Generic page walk and ptdump", v15: mm: add generic p?d_leaf() macros arc: mm: add p?d_leaf() definitions arm: mm: add p?d_leaf() definitions arm64: mm: add p?d_leaf() definitions mips: mm: add p?d_leaf() definitions powerpc: mm: add p?d_leaf() definitions riscv: mm: add p?d_leaf() definitions s390: mm: add p?d_leaf() definitions sparc: mm: add p?d_leaf() definitions x86: mm: add p?d_leaf() definitions mm: pagewalk: add p4d_entry() and pgd_entry() mm: pagewalk: allow walking without vma mm: pagewalk: add test_p?d callbacks mm: pagewalk: add 'depth' parameter to pte_hole x86: mm: point to struct seq_file from struct pg_state x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct x86: mm: convert ptdump_walk_pgd_level_core() to take an mm_struct mm: add generic ptdump x86: mm: convert dump_pagetables to use walk_page_range arm64: mm: convert mm/dump.c to use walk_page_range() arm64: mm: display non-present entries in ptdump mm: ptdump: reduce level numbers by 1 in note_page() Subsystem: mm/memfd Nicolas Geoffray <ngeoffray@google.com>: mm, memfd: fix COW issue on MAP_PRIVATE and F_SEAL_FUTURE_WRITE mappings "Joel Fernandes (Google)" <joel@joelfernandes.org>: memfd: add test for COW on MAP_PRIVATE and F_SEAL_FUTURE_WRITE mappings Subsystem: mm/memory-failure Jane Chu <jane.chu@oracle.com>: mm/memory-failure.c clean up around tk pre-allocation Naoya Horiguchi <nao.horiguchi@gmail.com>: mm, soft-offline: convert parameter to pfn Yunfeng Ye <yeyunfeng@huawei.com>: mm/memory-failure.c: use page_shift() in add_to_kill() Subsystem: mm/memory-hotplug Anshuman Khandual <anshuman.khandual@arm.com>: mm/hotplug: reorder memblock_[free|remove]() calls in try_remove_memory() Alastair D'Silva <alastair@d-silva.org>: mm/memory_hotplug.c: add a bounds check to __add_pages() David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: Export generic_online_page()": mm/memory_hotplug: export generic_online_page() hv_balloon: use generic_online_page() mm/memory_hotplug: remove __online_page_free() and __online_page_increment_counters() Patch series "mm: Memory offlining + page isolation cleanups", v2: mm/page_alloc.c: don't set pages PageReserved() when offlining mm/page_isolation.c: convert SKIP_HWPOISON to MEMORY_OFFLINE "Ben Dooks (Codethink)" <ben.dooks@codethink.co.uk>: include/linux/memory_hotplug.h: move definitions of {set,clear}_zone_contiguous David Hildenbrand <david@redhat.com>: drivers/base/memory.c: drop the mem_sysfs_mutex mm/memory_hotplug.c: don't allow to online/offline memory blocks with holes Subsystem: mm/sparsemem Vincent Whitchurch <vincent.whitchurch@axis.com>: mm/sparse: consistently do not zero memmap Ilya Leoshkevich <iii@linux.ibm.com>: mm/sparse.c: mark populate_section_memmap as __meminit Michal Hocko <mhocko@suse.com>: mm/sparse.c: do not waste pre allocated memmap space Subsystem: mm/vmalloc Liu Xiang <liuxiang_1999@126.com>: mm/vmalloc.c: remove unnecessary highmem_mask from parameter of gfpflags_allow_blocking() "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: remove preempt_disable/enable when doing preloading mm/vmalloc: respect passed gfp_mask when doing preloading mm/vmalloc: add more comments to the adjust_va_to_fit_type() Anders Roxell <anders.roxell@linaro.org>: selftests: vm: add fragment CONFIG_TEST_VMALLOC "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: rework vmap_area_lock Subsystem: mm/kasan Daniel Axtens <dja@axtens.net>: Patch series "kasan: support backing vmalloc space with real shadow: kasan: support backing vmalloc space with real shadow memory kasan: add test for vmalloc fork: support VMAP_STACK with KASAN_VMALLOC x86/kasan: support KASAN_VMALLOC Subsystem: mm/pagealloc Anshuman Khandual <anshuman.khandual@arm.com>: mm/page_alloc: add alloc_contig_pages() Mel Gorman <mgorman@techsingularity.net>: mm, pcp: share common code between memory hotplug and percpu sysctl handler mm, pcpu: make zone pcp updates and reset internal to the mm Hao Lee <haolee.swjtu@gmail.com>: include/linux/mmzone.h: fix comment for ISOLATE_UNMAPPED macro lijiazi <jqqlijiazi@gmail.com>: mm/page_alloc.c: print reserved_highatomic info Subsystem: mm/vmscan Andrey Ryabinin <aryabinin@virtuozzo.com>: mm/vmscan: remove unused lru_pages argument Yang Shi <yang.shi@linux.alibaba.com>: mm/vmscan.c: remove unused scan_control parameter from pageout() Johannes Weiner <hannes@cmpxchg.org>: Patch series "mm: vmscan: cgroup-related cleanups": mm: vmscan: simplify lruvec_lru_size() mm: clean up and clarify lruvec lookup procedure mm: vmscan: move inactive_list_is_low() swap check to the caller mm: vmscan: naming fixes: global_reclaim() and sane_reclaim() mm: vmscan: replace shrink_node() loop with a retry jump mm: vmscan: turn shrink_node_memcg() into shrink_lruvec() mm: vmscan: split shrink_node() into node part and memcgs part mm: vmscan: harmonize writeback congestion tracking for nodes & memcgs Patch series "mm: fix page aging across multiple cgroups": mm: vmscan: move file exhaustion detection to the node level mm: vmscan: detect file thrashing at the reclaim root mm: vmscan: enforce inactive:active ratio at the reclaim root Xianting Tian <xianting_tian@126.com>: mm/vmscan.c: fix typo in comment Subsystem: mm/proc Johannes Weiner <hannes@cmpxchg.org>: kernel: sysctl: make drop_caches write-only Subsystem: mm/z3fold Vitaly Wool <vitaly.wool@konsulko.com>: mm/z3fold.c: add inter-page compaction Subsystem: mm/mempolicy Li Xinhai <lixinhai.lxh@gmail.com>: Patch series "mm: Fix checking unmapped holes for mbind", v4: mm/mempolicy.c: check range first in queue_pages_test_walk mm/mempolicy.c: fix checking unmapped holes for mbind Subsystem: mm/memblock Cao jin <caoj.fnst@cn.fujitsu.com>: mm/memblock.c: cleanup doc mm/memblock: correct doc for function Yunfeng Ye <yeyunfeng@huawei.com>: mm: support memblock alloc on the exact node for sparse_buffer_init() Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: hugetlbfs: hugetlb_fault_mutex_hash() cleanup mm/hugetlbfs: fix error handling when setting up mounts Patch series "hugetlbfs: convert macros to static inline, fix sparse warning": powerpc/mm: remove pmd_huge/pud_huge stubs and include hugetlb.h hugetlbfs: convert macros to static inline, fix sparse warning Piotr Sarna <p.sarna@tlen.pl>: hugetlbfs: add O_TMPFILE support Waiman Long <longman@redhat.com>: hugetlbfs: take read_lock on i_mmap for PMD sharing Subsystem: mm/hugetlb Mina Almasry <almasrymina@google.com>: hugetlb: region_chg provides only cache entry hugetlb: remove duplicated code Wei Yang <richardw.yang@linux.intel.com>: hugetlb: remove unused hstate in hugetlb_fault_mutex_hash() Zhigang Lu <tonnylu@tencent.com>: mm/hugetlb: avoid looping to the same hugepage if !pages and !vmas zhong jiang <zhongjiang@huawei.com>: mm/huge_memory.c: split_huge_pages_fops should be defined with DEFINE_DEBUGFS_ATTRIBUTE Subsystem: mm/migration Yang Shi <yang.shi@linux.alibaba.com>: mm/migrate.c: handle freed page at the first place Subsystem: mm/thp "Kirill A. Shutemov" <kirill@shutemov.name>: mm, thp: do not queue fully unmapped pages for deferred split Song Liu <songliubraving@fb.com>: mm/thp: flush file for !is_shmem PageDirty() case in collapse_file() Subsystem: mm/cma Yunfeng Ye <yeyunfeng@huawei.com>: mm/cma.c: switch to bitmap_zalloc() for cma bitmap allocation zhong jiang <zhongjiang@huawei.com>: mm/cma_debug.c: use DEFINE_DEBUGFS_ATTRIBUTE to define debugfs fops Subsystem: mm/autonuma Huang Ying <ying.huang@intel.com>: autonuma: fix watermark checking in migrate_balanced_pgdat() autonuma: reduce cache footprint when scanning page tables Subsystem: mm/page-poison zhong jiang <zhongjiang@huawei.com>: mm/hwpoison-inject: use DEFINE_DEBUGFS_ATTRIBUTE to define debugfs fops Subsystem: mm/mmap Wei Yang <richardw.yang@linux.intel.com>: mm/mmap.c: make vma_merge() comment more easy to understand Subsystem: mm/madvise Yunfeng Ye <yeyunfeng@huawei.com>: mm/madvise.c: replace with page_size() in madvise_inject_error() Wei Yang <richardw.yang@linux.intel.com>: mm/madvise.c: use PAGE_ALIGN[ED] for range checking Subsystem: mm/userfaultfd Wei Yang <richardw.yang@linux.intel.com>: userfaultfd: use vma_pagesize for all huge page size calculation userfaultfd: remove unnecessary WARN_ON() in __mcopy_atomic_hugetlb() userfaultfd: wrap the common dst_vma check into an inlined function Andrea Arcangeli <aarcange@redhat.com>: fs/userfaultfd.c: wp: clear VM_UFFD_MISSING or VM_UFFD_WP during userfaultfd_register() Mike Rapoport <rppt@linux.ibm.com>: userfaultfd: require CAP_SYS_PTRACE for UFFD_FEATURE_EVENT_FORK Subsystem: mm/shmem Colin Ian King <colin.king@canonical.com>: mm/shmem.c: make array 'values' static const, makes object smaller Yang Shi <yang.shi@linux.alibaba.com>: mm: shmem: use proper gfp flags for shmem_writepage() Chen Jun <chenjun102@huawei.com>: mm/shmem.c: cast the type of unmap_start to u64 Subsystem: mm/cleanups Hao Lee <haolee.swjtu@gmail.com>: mm: fix struct member name in function comments Wei Yang <richardw.yang@linux.intel.com>: mm: fix typos in comments when calling __SetPageUptodate() Souptick Joarder <jrdr.linux@gmail.com>: mm/memory_hotplug.c: remove __online_page_set_limits() Krzysztof Kozlowski <krzk@kernel.org>: mm/Kconfig: fix indentation Randy Dunlap <rdunlap@infradead.org>: mm/Kconfig: fix trivial help text punctuation Subsystem: mm/support Minchan Kim <minchan@google.com>: mm/page_io.c: annotate refault stalls from swap_readpage Documentation/admin-guide/cgroup-v2.rst | 7 Documentation/dev-tools/kasan.rst | 63 + arch/Kconfig | 9 arch/arc/include/asm/pgtable.h | 2 arch/arc/mm/fault.c | 10 arch/arc/mm/highmem.c | 4 arch/arm/include/asm/pgtable-2level.h | 1 arch/arm/include/asm/pgtable-3level.h | 1 arch/arm64/Kconfig | 1 arch/arm64/Kconfig.debug | 19 arch/arm64/include/asm/pgtable.h | 2 arch/arm64/include/asm/ptdump.h | 8 arch/arm64/mm/Makefile | 4 arch/arm64/mm/dump.c | 148 +--- arch/arm64/mm/mmu.c | 4 arch/arm64/mm/ptdump_debugfs.c | 2 arch/mips/include/asm/pgtable.h | 5 arch/powerpc/include/asm/book3s/64/pgtable-4k.h | 3 arch/powerpc/include/asm/book3s/64/pgtable-64k.h | 3 arch/powerpc/include/asm/book3s/64/pgtable.h | 30 arch/powerpc/mm/book3s64/radix_pgtable.c | 1 arch/riscv/include/asm/pgtable-64.h | 7 arch/riscv/include/asm/pgtable.h | 7 arch/s390/include/asm/pgtable.h | 2 arch/sparc/include/asm/pgtable_64.h | 2 arch/x86/Kconfig | 2 arch/x86/Kconfig.debug | 20 arch/x86/include/asm/pgtable.h | 10 arch/x86/mm/Makefile | 4 arch/x86/mm/debug_pagetables.c | 8 arch/x86/mm/dump_pagetables.c | 431 +++--------- arch/x86/mm/kasan_init_64.c | 61 + arch/x86/platform/efi/efi_32.c | 2 arch/x86/platform/efi/efi_64.c | 4 drivers/base/memory.c | 40 - drivers/firmware/efi/arm-runtime.c | 2 drivers/hv/hv_balloon.c | 4 drivers/xen/balloon.c | 1 fs/buffer.c | 6 fs/direct-io.c | 21 fs/hugetlbfs/inode.c | 67 + fs/ocfs2/acl.c | 4 fs/proc/task_mmu.c | 4 fs/userfaultfd.c | 21 include/asm-generic/4level-fixup.h | 1 include/asm-generic/5level-fixup.h | 1 include/asm-generic/pgtable-nop4d.h | 2 include/asm-generic/pgtable-nopmd.h | 2 include/asm-generic/pgtable-nopud.h | 2 include/asm-generic/pgtable.h | 71 ++ include/asm-generic/tlb.h | 4 include/linux/fs.h | 6 include/linux/gfp.h | 2 include/linux/hugetlb.h | 142 +++- include/linux/kasan.h | 31 include/linux/memblock.h | 3 include/linux/memcontrol.h | 51 - include/linux/memory_hotplug.h | 11 include/linux/mm.h | 42 - include/linux/mmzone.h | 34 include/linux/moduleloader.h | 2 include/linux/page-isolation.h | 4 include/linux/pagewalk.h | 42 - include/linux/ptdump.h | 22 include/linux/slab.h | 20 include/linux/string.h | 2 include/linux/swap.h | 2 include/linux/vmalloc.h | 12 include/trace/events/kmem.h | 53 + kernel/events/uprobes.c | 2 kernel/fork.c | 4 kernel/sysctl.c | 2 lib/Kconfig.kasan | 16 lib/test_kasan.c | 26 lib/vsprintf.c | 40 - mm/Kconfig | 40 - mm/Kconfig.debug | 21 mm/Makefile | 1 mm/cma.c | 6 mm/cma_debug.c | 10 mm/filemap.c | 56 - mm/gup.c | 40 - mm/hmm.c | 8 mm/huge_memory.c | 2 mm/hugetlb.c | 298 ++------ mm/hwpoison-inject.c | 4 mm/internal.h | 27 mm/kasan/common.c | 233 ++++++ mm/kasan/generic_report.c | 3 mm/kasan/kasan.h | 1 mm/khugepaged.c | 18 mm/madvise.c | 14 mm/memblock.c | 113 ++- mm/memcontrol.c | 167 ---- mm/memory-failure.c | 61 - mm/memory.c | 56 + mm/memory_hotplug.c | 86 +- mm/mempolicy.c | 59 + mm/migrate.c | 21 mm/mincore.c | 1 mm/mmap.c | 75 -- mm/mprotect.c | 8 mm/mremap.c | 4 mm/nommu.c | 10 mm/page_alloc.c | 137 +++ mm/page_io.c | 15 mm/page_isolation.c | 12 mm/pagewalk.c | 126 ++- mm/pgtable-generic.c | 9 mm/ptdump.c | 167 ++++ mm/rmap.c | 65 + mm/shmem.c | 29 mm/slab.c | 7 mm/slab.h | 6 mm/slab_common.c | 101 +- mm/slub.c | 36 - mm/sparse.c | 22 mm/swap.c | 29 mm/swapfile.c | 7 mm/userfaultfd.c | 77 +- mm/util.c | 22 mm/vmalloc.c | 196 +++-- mm/vmscan.c | 798 +++++++++++------------ mm/workingset.c | 75 +- mm/z3fold.c | 375 ++++++++-- scripts/spelling.txt | 28 tools/testing/selftests/memfd/memfd_test.c | 36 + tools/testing/selftests/vm/config | 1 128 files changed, 3409 insertions(+), 2121 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2019-12-01 1:47 incoming Andrew Morton @ 2019-12-01 5:17 ` James Bottomley 2019-12-01 21:07 ` incoming Linus Torvalds 1 sibling, 0 replies; 348+ messages in thread From: James Bottomley @ 2019-12-01 5:17 UTC (permalink / raw) To: Andrew Morton, Linus Torvalds; +Cc: mm-commits, linux-mm On Sat, 2019-11-30 at 17:47 -0800, Andrew Morton wrote: > - a small number of updates to scripts/, ocfs2 and fs/buffer.c > > - most of MM. I still have quite a lot of material (mostly not MM) > staged after linux-next due to -next dependencies. I'll send thos > across next week as the preprequisites get merged up. > > 158 patches, based on 32ef9553635ab1236c33951a8bd9b5af1c3b1646. Hey, Andrew, would it be at all possible for you to thread these patches under something like this incoming message? The selfish reason I'm asking is so I can mark the thread as read instead of having to do it individually for 158 messages ... my thumb would thank you for this. Regards, James ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2019-12-01 1:47 incoming Andrew Morton 2019-12-01 5:17 ` incoming James Bottomley @ 2019-12-01 21:07 ` Linus Torvalds 2019-12-02 8:21 ` incoming Steven Price 1 sibling, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2019-12-01 21:07 UTC (permalink / raw) To: Andrew Morton, Steven Price; +Cc: mm-commits, Linux-MM On Sat, Nov 30, 2019 at 5:47 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > Steven Price <steven.price@arm.com>: > Patch series "Generic page walk and ptdump", v15: > mm: add generic p?d_leaf() macros > arc: mm: add p?d_leaf() definitions > arm: mm: add p?d_leaf() definitions > arm64: mm: add p?d_leaf() definitions > mips: mm: add p?d_leaf() definitions > powerpc: mm: add p?d_leaf() definitions > riscv: mm: add p?d_leaf() definitions > s390: mm: add p?d_leaf() definitions > sparc: mm: add p?d_leaf() definitions > x86: mm: add p?d_leaf() definitions > mm: pagewalk: add p4d_entry() and pgd_entry() > mm: pagewalk: allow walking without vma > mm: pagewalk: add test_p?d callbacks > mm: pagewalk: add 'depth' parameter to pte_hole > x86: mm: point to struct seq_file from struct pg_state > x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct > x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct > x86: mm: convert ptdump_walk_pgd_level_core() to take an mm_struct > mm: add generic ptdump > x86: mm: convert dump_pagetables to use walk_page_range > arm64: mm: convert mm/dump.c to use walk_page_range() > arm64: mm: display non-present entries in ptdump > mm: ptdump: reduce level numbers by 1 in note_page() I've dropped these, and since they clearly weren't ready I don't want to see them re-sent for 5.5. If somebody figures out the bug, trying again for 5.6 sounds fine. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2019-12-01 21:07 ` incoming Linus Torvalds @ 2019-12-02 8:21 ` Steven Price 0 siblings, 0 replies; 348+ messages in thread From: Steven Price @ 2019-12-02 8:21 UTC (permalink / raw) To: Linus Torvalds; +Cc: Andrew Morton, mm-commits@vger.kernel.org, Linux-MM On Sun, Dec 01, 2019 at 09:07:47PM +0000, Linus Torvalds wrote: > On Sat, Nov 30, 2019 at 5:47 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > Steven Price <steven.price@arm.com>: > > Patch series "Generic page walk and ptdump", v15: > > mm: add generic p?d_leaf() macros > > arc: mm: add p?d_leaf() definitions > > arm: mm: add p?d_leaf() definitions > > arm64: mm: add p?d_leaf() definitions > > mips: mm: add p?d_leaf() definitions > > powerpc: mm: add p?d_leaf() definitions > > riscv: mm: add p?d_leaf() definitions > > s390: mm: add p?d_leaf() definitions > > sparc: mm: add p?d_leaf() definitions > > x86: mm: add p?d_leaf() definitions > > mm: pagewalk: add p4d_entry() and pgd_entry() > > mm: pagewalk: allow walking without vma > > mm: pagewalk: add test_p?d callbacks > > mm: pagewalk: add 'depth' parameter to pte_hole > > x86: mm: point to struct seq_file from struct pg_state > > x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct > > x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct > > x86: mm: convert ptdump_walk_pgd_level_core() to take an mm_struct > > mm: add generic ptdump > > x86: mm: convert dump_pagetables to use walk_page_range > > arm64: mm: convert mm/dump.c to use walk_page_range() > > arm64: mm: display non-present entries in ptdump > > mm: ptdump: reduce level numbers by 1 in note_page() > > I've dropped these, and since they clearly weren't ready I don't want > to see them re-sent for 5.5. Sorry about this, I'll try to track down the cause of this and hopefully resubmit for 5.6. Thanks, Steve > If somebody figures out the bug, trying again for 5.6 sounds fine. > > Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2019-11-22 1:53 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2019-11-22 1:53 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 4 fixes, based on 81429eb8d9ca40b0c65bb739d29fa856c5d5e958: Vincent Whitchurch <vincent.whitchurch@axis.com>: mm/sparse: consistently do not zero memmap Joseph Qi <joseph.qi@linux.alibaba.com>: Revert "fs: ocfs2: fix possible null-pointer dereferences in ocfs2_xa_prepare_entry()" David Hildenbrand <david@redhat.com>: mm/memory_hotplug: don't access uninitialized memmaps in shrink_zone_span() Andrey Ryabinin <aryabinin@virtuozzo.com>: mm/ksm.c: don't WARN if page is still mapped in remove_stable_node() fs/ocfs2/xattr.c | 56 ++++++++++++++++++++++++++++++---------------------- mm/ksm.c | 14 ++++++------- mm/memory_hotplug.c | 16 ++++++++++++-- mm/sparse.c | 2 - 4 files changed, 54 insertions(+), 34 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2019-11-16 1:34 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2019-11-16 1:34 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 11 fixes, based on 875fef493f21e54d20d71a581687990aaa50268c: Yang Shi <yang.shi@linux.alibaba.com>: mm: mempolicy: fix the wrong return value and potential pages leak of mbind zhong jiang <zhongjiang@huawei.com>: mm: fix trying to reclaim unevictable lru page when calling madvise_pageout Lasse Collin <lasse.collin@tukaani.org>: lib/xz: fix XZ_DYNALLOC to avoid useless memory reallocations Roman Gushchin <guro@fb.com>: mm: memcg: switch to css_tryget() in get_mem_cgroup_from_mm() mm: hugetlb: switch to css_tryget() in hugetlb_cgroup_charge_cgroup() Laura Abbott <labbott@redhat.com>: mm: slub: really fix slab walking for init_on_free Song Liu <songliubraving@fb.com>: mm,thp: recheck each page before collapsing file THP David Hildenbrand <david@redhat.com>: mm/memory_hotplug: fix try_offline_node() Vinayak Menon <vinmenon@codeaurora.org>: mm/page_io.c: do not free shared swap slots Ralph Campbell <rcampbell@nvidia.com>: mm/debug.c: __dump_page() prints an extra line mm/debug.c: PageAnon() is true for PageKsm() pages drivers/base/memory.c | 36 ++++++++++++++++++++++++++++++++++++ include/linux/memory.h | 1 + lib/xz/xz_dec_lzma2.c | 1 + mm/debug.c | 33 ++++++++++++++++++--------------- mm/hugetlb_cgroup.c | 2 +- mm/khugepaged.c | 28 ++++++++++++++++------------ mm/madvise.c | 16 ++++++++++++---- mm/memcontrol.c | 2 +- mm/memory_hotplug.c | 47 +++++++++++++++++++++++++++++------------------ mm/mempolicy.c | 14 +++++++++----- mm/page_io.c | 6 +++--- mm/slub.c | 39 +++++++++------------------------------ 12 files changed, 136 insertions(+), 89 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2019-11-06 5:16 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2019-11-06 5:16 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 17 fixes, based on 26bc672134241a080a83b2ab9aa8abede8d30e1c: Shakeel Butt <shakeelb@google.com>: mm: memcontrol: fix NULL-ptr deref in percpu stats flush John Hubbard <jhubbard@nvidia.com>: mm/gup_benchmark: fix MAP_HUGETLB case Mel Gorman <mgorman@techsingularity.net>: mm, meminit: recalculate pcpu batch and high limits after init completes Yang Shi <yang.shi@linux.alibaba.com>: mm: thp: handle page cache THP correctly in PageTransCompoundMap Shuning Zhang <sunny.s.zhang@oracle.com>: ocfs2: protect extent tree in ocfs2_prepare_inode_for_write() Jason Gunthorpe <jgg@mellanox.com>: mm/mmu_notifiers: use the right return code for WARN_ON Michal Hocko <mhocko@suse.com>: mm, vmstat: hide /proc/pagetypeinfo from normal users mm, vmstat: reduce zone->lock holding time by /proc/pagetypeinfo Ville Syrjälä <ville.syrjala@linux.intel.com>: mm/khugepaged: fix might_sleep() warn with CONFIG_HIGHPTE=y Johannes Weiner <hannes@cmpxchg.org>: mm/page_alloc.c: ratelimit allocation failure warnings more aggressively Vitaly Wool <vitaly.wool@konsulko.com>: zswap: add Vitaly to the maintainers list Kevin Hao <haokexin@gmail.com>: dump_stack: avoid the livelock of the dump_lock Song Liu <songliubraving@fb.com>: MAINTAINERS: update information for "MEMORY MANAGEMENT" Roman Gushchin <guro@fb.com>: mm: slab: make page_cgroup_ino() to recognize non-compound slab pages properly Ilya Leoshkevich <iii@linux.ibm.com>: scripts/gdb: fix debugging modules compiled with hot/cold partitioning David Hildenbrand <david@redhat.com>: mm/memory_hotplug: fix updating the node span Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: fix network errors from failing __GFP_ATOMIC charges MAINTAINERS | 5 + fs/ocfs2/file.c | 125 ++++++++++++++++++++++------- include/linux/mm.h | 5 - include/linux/mm_types.h | 5 + include/linux/page-flags.h | 20 ++++ lib/dump_stack.c | 7 + mm/khugepaged.c | 7 - mm/memcontrol.c | 23 +++-- mm/memory_hotplug.c | 8 + mm/mmu_notifier.c | 2 mm/page_alloc.c | 17 ++- mm/slab.h | 4 mm/vmstat.c | 25 ++++- scripts/gdb/linux/symbols.py | 3 tools/testing/selftests/vm/gup_benchmark.c | 2 15 files changed, 197 insertions(+), 61 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2019-10-19 3:19 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2019-10-19 3:19 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm Rather a lot of fixes, almost all affecting mm/. 26 patches, based on b9959c7a347d6adbb558fba7e36e9fef3cba3b07: David Hildenbrand <david@redhat.com>: drivers/base/memory.c: don't access uninitialized memmaps in soft_offline_page_store() fs/proc/page.c: don't access uninitialized memmaps in fs/proc/page.c mm/memory-failure.c: don't access uninitialized memmaps in memory_failure() Joel Colledge <joel.colledge@linbit.com>: scripts/gdb: fix lx-dmesg when CONFIG_PRINTK_CALLER is set Qian Cai <cai@lca.pw>: mm/page_owner: don't access uninitialized memmaps when reading /proc/pagetypeinfo David Hildenbrand <david@redhat.com>: mm/memory_hotplug: don't access uninitialized memmaps in shrink_pgdat_span() "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "mm/memory_hotplug: Shrink zones before removing memory", v6: mm/memunmap: don't access uninitialized memmap in memunmap_pages() Roman Gushchin <guro@fb.com>: mm: memcg/slab: fix panic in __free_slab() caused by premature memcg pointer release Chengguang Xu <cgxu519@mykernel.net>: ocfs2: fix error handling in ocfs2_setattr() John Hubbard <jhubbard@nvidia.com>: mm/gup_benchmark: add a missing "w" to getopt string mm/gup: fix a misnamed "write" argument, and a related bug Honglei Wang <honglei.wang@oracle.com>: mm: memcg: get number of pages on the LRU list in memcgroup base on lru_zone_size Mike Rapoport <rppt@linux.ibm.com>: mm: memblock: do not enforce current limit for memblock_phys* family David Hildenbrand <david@redhat.com>: hugetlbfs: don't access uninitialized memmaps in pfn_range_valid_gigantic() Yi Li <yilikernel@gmail.com>: ocfs2: fix panic due to ocfs2_wq is null Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm/memcontrol: update lruvec counters in mem_cgroup_move_account Chenwandun <chenwandun@huawei.com>: zram: fix race between backing_dev_show and backing_dev_store Ben Dooks <ben.dooks@codethink.co.uk>: mm: include <linux/huge_mm.h> for is_vma_temporary_stack mm/filemap.c: include <linux/ramfs.h> for generic_file_vm_ops definition "Ben Dooks (Codethink)" <ben.dooks@codethink.co.uk>: mm/init-mm.c: include <linux/mman.h> for vm_committed_as_batch "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: Patch series "Fixes for THP in page cache", v2: proc/meminfo: fix output alignment mm/thp: fix node page state in split_huge_page_to_list() William Kucharski <william.kucharski@oracle.com>: mm/vmscan.c: support removing arbitrary sized pages from mapping "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: mm/thp: allow dropping THP from page cache Song Liu <songliubraving@fb.com>: kernel/events/uprobes.c: only do FOLL_SPLIT_PMD for uprobe register Ilya Leoshkevich <iii@linux.ibm.com>: scripts/gdb: fix debugging modules on s390 drivers/base/memory.c | 3 + drivers/block/zram/zram_drv.c | 5 + fs/ocfs2/file.c | 2 fs/ocfs2/journal.c | 3 - fs/ocfs2/localalloc.c | 3 - fs/proc/meminfo.c | 4 - fs/proc/page.c | 28 ++++++---- kernel/events/uprobes.c | 13 ++++- mm/filemap.c | 1 mm/gup.c | 14 +++-- mm/huge_memory.c | 9 ++- mm/hugetlb.c | 5 - mm/init-mm.c | 1 mm/memblock.c | 6 +- mm/memcontrol.c | 18 ++++--- mm/memory-failure.c | 14 +++-- mm/memory_hotplug.c | 74 ++++++----------------------- mm/memremap.c | 11 ++-- mm/page_owner.c | 5 + mm/rmap.c | 1 mm/slab_common.c | 9 +-- mm/truncate.c | 12 ++++ mm/vmscan.c | 14 ++--- scripts/gdb/linux/dmesg.py | 16 ++++-- scripts/gdb/linux/symbols.py | 8 ++- scripts/gdb/linux/utils.py | 25 +++++---- tools/testing/selftests/vm/gup_benchmark.c | 2 27 files changed, 166 insertions(+), 140 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2019-10-14 21:11 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2019-10-14 21:11 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm The usual shower of hotfixes and some followups to the recently merged page_owner enhancements. 16 patches, based on 2abd839aa7e615f2bbc50c8ba7deb9e40d186768. Subsystems affected by this patch series: Vlastimil Babka <vbabka@suse.cz>: Patch series "followups to debug_pagealloc improvements through page_owner", v3: mm, page_owner: fix off-by-one error in __set_page_owner_handle() mm, page_owner: decouple freeing stack trace from debug_pagealloc mm, page_owner: rename flag indicating that page is allocated Qian Cai <cai@lca.pw>: mm/slub: fix a deadlock in show_slab_objects() Eric Biggers <ebiggers@google.com>: lib/generic-radix-tree.c: add kmemleak annotations Alexander Potapenko <glider@google.com>: mm/slub.c: init_on_free=1 should wipe freelist ptr for bulk allocations lib/test_meminit: add a kmem_cache_alloc_bulk() test David Rientjes <rientjes@google.com>: mm, hugetlb: allow hugepage allocations to reclaim as needed Vlastimil Babka <vbabka@suse.cz>: mm, compaction: fix wrong pfn handling in __reset_isolation_pfn() Randy Dunlap <rdunlap@infradead.org>: fs/direct-io.c: fix kernel-doc warning fs/libfs.c: fix kernel-doc warning fs/fs-writeback.c: fix kernel-doc warning bitmap.h: fix kernel-doc warning and typo xarray.h: fix kernel-doc warning mm/slab.c: fix kernel-doc warning for __ksize() Jane Chu <jane.chu@oracle.com>: mm/memory-failure: poison read receives SIGKILL instead of SIGBUS if mmaped more than once Documentation/dev-tools/kasan.rst | 3 ++ fs/direct-io.c | 3 -- fs/fs-writeback.c | 2 - fs/libfs.c | 3 -- include/linux/bitmap.h | 3 +- include/linux/page_ext.h | 10 ++++++ include/linux/xarray.h | 4 +- lib/generic-radix-tree.c | 32 +++++++++++++++++----- lib/test_meminit.c | 27 ++++++++++++++++++ mm/compaction.c | 7 ++-- mm/memory-failure.c | 22 ++++++++------- mm/page_alloc.c | 6 ++-- mm/page_ext.c | 23 ++++++--------- mm/page_owner.c | 55 +++++++++++++------------------------- mm/slab.c | 3 ++ mm/slub.c | 35 ++++++++++++++++++------ 16 files changed, 152 insertions(+), 86 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2019-10-07 0:57 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2019-10-07 0:57 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm The usual shower of hotfixes. Chris's memcg patches aren't actually fixes - they're mature but a few niggling review issues were late to arrive. The ocfs2 fixes are quite old - those took some time to get reviewer attention. 18 patches, based on 4ea655343ce4180fe9b2c7ec8cb8ef9884a47901. Subsystems affected by this patch series: ocfs2 hotfixes mm/memcg mm/slab-generic Subsystem: ocfs2 Jia Guo <guojia12@huawei.com>: ocfs2: clear zero in unaligned direct IO Jia-Ju Bai <baijiaju1990@gmail.com>: fs: ocfs2: fix possible null-pointer dereferences in ocfs2_xa_prepare_entry() fs: ocfs2: fix a possible null-pointer dereference in ocfs2_write_end_nolock() fs: ocfs2: fix a possible null-pointer dereference in ocfs2_info_scan_inode_alloc() Subsystem: hotfixes Will Deacon <will@kernel.org>: panic: ensure preemption is disabled during panic() Anshuman Khandual <anshuman.khandual@arm.com>: mm/memremap: drop unused SECTION_SIZE and SECTION_MASK Tejun Heo <tj@kernel.org>: writeback: fix use-after-free in finish_writeback_work() Yi Wang <wang.yi59@zte.com.cn>: mm: fix -Wmissing-prototypes warnings Baoquan He <bhe@redhat.com>: memcg: only record foreign writebacks with dirty pages when memcg is not disabled Michal Hocko <mhocko@suse.com>: kernel/sysctl.c: do not override max_threads provided by userspace Vitaly Wool <vitalywool@gmail.com>: mm/z3fold.c: claim page in the beginning of free Qian Cai <cai@lca.pw>: mm/page_alloc.c: fix a crash in free_pages_prepare() Dan Carpenter <dan.carpenter@oracle.com>: mm/vmpressure.c: fix a signedness bug in vmpressure_register_event() Subsystem: mm/memcg Chris Down <chris@chrisdown.name>: mm, memcg: proportional memory.{low,min} reclaim mm, memcg: make memory.emin the baseline for utilisation determination mm, memcg: make scan aggression always exclude protection Subsystem: mm/slab-generic Vlastimil Babka <vbabka@suse.cz>: Patch series "guarantee natural alignment for kmalloc()", v2: mm, sl[ou]b: improve memory accounting mm, sl[aou]b: guarantee natural alignment for kmalloc(power-of-two) Documentation/admin-guide/cgroup-v2.rst | 20 +- Documentation/core-api/memory-allocation.rst | 4 fs/fs-writeback.c | 9 - fs/ocfs2/aops.c | 25 +++ fs/ocfs2/ioctl.c | 2 fs/ocfs2/xattr.c | 56 +++---- include/linux/memcontrol.h | 67 ++++++--- include/linux/slab.h | 4 kernel/fork.c | 4 kernel/panic.c | 1 mm/memcontrol.c | 5 mm/memremap.c | 2 mm/page_alloc.c | 8 - mm/shuffle.c | 2 mm/slab_common.c | 19 ++ mm/slob.c | 62 ++++++-- mm/slub.c | 14 + mm/sparse.c | 2 mm/vmpressure.c | 20 +- mm/vmscan.c | 198 +++++++++++++++++---------- mm/z3fold.c | 10 + 21 files changed, 363 insertions(+), 171 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2019-09-25 23:45 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2019-09-25 23:45 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - almost all of the rest of -mm - various other subsystems 76 patches, based on 351c8a09b00b5c51c8f58b016fffe51f87e2d820: Subsystems affected by this patch series: memcg misc core-kernel lib checkpatch reiserfs fat fork cpumask kexec uaccess kconfig kgdb bug ipc lzo kasan madvise cleanups pagemap Subsystem: memcg Michal Hocko <mhocko@suse.com>: memcg, kmem: do not fail __GFP_NOFAIL charges Subsystem: misc Masahiro Yamada <yamada.masahiro@socionext.com>: linux/coff.h: add include guard Subsystem: core-kernel Valdis Kletnieks <valdis.kletnieks@vt.edu>: kernel/elfcore.c: include proper prototypes Subsystem: lib Michel Lespinasse <walken@google.com>: rbtree: avoid generating code twice for the cached versions (tools copy) Patch series "make RB_DECLARE_CALLBACKS more generic", v3: augmented rbtree: add comments for RB_DECLARE_CALLBACKS macro augmented rbtree: add new RB_DECLARE_CALLBACKS_MAX macro augmented rbtree: rework the RB_DECLARE_CALLBACKS macro definition Joe Perches <joe@perches.com>: kernel-doc: core-api: include string.h into core-api Qian Cai <cai@lca.pw>: include/trace/events/writeback.h: fix -Wstringop-truncation warnings Kees Cook <keescook@chromium.org>: strscpy: reject buffer sizes larger than INT_MAX Valdis Kletnieks <valdis.kletnieks@vt.edu>: lib/generic-radix-tree.c: make 2 functions static inline lib/extable.c: add missing prototypes Stephen Boyd <swboyd@chromium.org>: lib/hexdump: make print_hex_dump_bytes() a nop on !DEBUG builds Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: don't interpret stack dumps as commit IDs checkpatch: improve SPDX license checking Matteo Croce <mcroce@redhat.com>: checkpatch.pl: warn on invalid commit id Brendan Jackman <brendan.jackman@bluwireless.co.uk>: checkpatch: exclude sizeof sub-expressions from MACRO_ARG_REUSE Joe Perches <joe@perches.com>: checkpatch: prefer __section over __attribute__((section(...))) checkpatch: allow consecutive close braces Sean Christopherson <sean.j.christopherson@intel.com>: checkpatch: remove obsolete period from "ambiguous SHA1" query Joe Perches <joe@perches.com>: checkpatch: make git output use LANGUAGE=en_US.utf8 Subsystem: reiserfs Jia-Ju Bai <baijiaju1990@gmail.com>: fs: reiserfs: remove unnecessary check of bh in remove_from_transaction() zhengbin <zhengbin13@huawei.com>: fs/reiserfs/journal.c: remove set but not used variables fs/reiserfs/stree.c: remove set but not used variables fs/reiserfs/lbalance.c: remove set but not used variables fs/reiserfs/objectid.c: remove set but not used variables fs/reiserfs/prints.c: remove set but not used variables fs/reiserfs/fix_node.c: remove set but not used variables fs/reiserfs/do_balan.c: remove set but not used variables Jason Yan <yanaijie@huawei.com>: fs/reiserfs/journal.c: remove set but not used variable fs/reiserfs/do_balan.c: remove set but not used variable Subsystem: fat Markus Elfring <elfring@users.sourceforge.net>: fat: delete an unnecessary check before brelse() Subsystem: fork Sai Praneeth Prakhya <sai.praneeth.prakhya@intel.com>: fork: improve error message for corrupted page tables Subsystem: cpumask Alexey Dobriyan <adobriyan@gmail.com>: cpumask: nicer for_each_cpumask_and() signature Subsystem: kexec Tetsuo Handa <penguin-kernel@I-love.SAKURA.ne.jp>: kexec: bail out upon SIGKILL when allocating memory. Vasily Gorbik <gor@linux.ibm.com>: kexec: restore arch_kexec_kernel_image_probe declaration Subsystem: uaccess Kees Cook <keescook@chromium.org>: uaccess: add missing __must_check attributes Subsystem: kconfig Masahiro Yamada <yamada.masahiro@socionext.com>: compiler: enable CONFIG_OPTIMIZE_INLINING forcibly Subsystem: kgdb Douglas Anderson <dianders@chromium.org>: kgdb: don't use a notifier to enter kgdb at panic; call directly scripts/gdb: handle split debug Subsystem: bug Kees Cook <keescook@chromium.org>: Patch series "Clean up WARN() "cut here" handling", v2: bug: refactor away warn_slowpath_fmt_taint() bug: rename __WARN_printf_taint() to __WARN_printf() bug: consolidate warn_slowpath_fmt() usage bug: lift "cut here" out of __warn() bug: clean up helper macros to remove __WARN_TAINT() bug: consolidate __WARN_FLAGS usage bug: move WARN_ON() "cut here" into exception handler Subsystem: ipc Markus Elfring <elfring@users.sourceforge.net>: ipc/mqueue.c: delete an unnecessary check before the macro call dev_kfree_skb() ipc/mqueue: improve exception handling in do_mq_notify() "Joel Fernandes (Google)" <joel@joelfernandes.org>: ipc/sem.c: convert to use built-in RCU list checking Subsystem: lzo Dave Rodgman <dave.rodgman@arm.com>: lib/lzo/lzo1x_compress.c: fix alignment bug in lzo-rle Subsystem: kasan Andrey Konovalov <andreyknvl@google.com>: Patch series "arm64: untag user pointers passed to the kernel", v19: lib: untag user pointers in strn*_user mm: untag user pointers passed to memory syscalls mm: untag user pointers in mm/gup.c mm: untag user pointers in get_vaddr_frames fs/namespace: untag user pointers in copy_mount_options userfaultfd: untag user pointers drm/amdgpu: untag user pointers drm/radeon: untag user pointers in radeon_gem_userptr_ioctl media/v4l2-core: untag user pointers in videobuf_dma_contig_user_get tee/shm: untag user pointers in tee_shm_register vfio/type1: untag user pointers in vaddr_get_pfn Catalin Marinas <catalin.marinas@arm.com>: mm: untag user pointers in mmap/munmap/mremap/brk Subsystem: madvise Minchan Kim <minchan@kernel.org>: Patch series "Introduce MADV_COLD and MADV_PAGEOUT", v7: mm: introduce MADV_COLD mm: change PAGEREF_RECLAIM_CLEAN with PAGE_REFRECLAIM mm: introduce MADV_PAGEOUT mm: factor out common parts between MADV_COLD and MADV_PAGEOUT Subsystem: cleanups Mike Rapoport <rppt@linux.ibm.com>: hexagon: drop empty and unused free_initrd_mem Denis Efremov <efremov@linux.com>: checkpatch: check for nested (un)?likely() calls xen/events: remove unlikely() from WARN() condition fs: remove unlikely() from WARN_ON() condition wimax/i2400m: remove unlikely() from WARN*() condition xfs: remove unlikely() from WARN_ON() condition IB/hfi1: remove unlikely() from IS_ERR*() condition ntfs: remove (un)?likely() from IS_ERR() conditions Subsystem: pagemap Mark Rutland <mark.rutland@arm.com>: mm: treewide: clarify pgtable_page_{ctor,dtor}() naming Documentation/core-api/kernel-api.rst | 3 Documentation/vm/split_page_table_lock.rst | 10 arch/alpha/include/uapi/asm/mman.h | 3 arch/arc/include/asm/pgalloc.h | 4 arch/arm/include/asm/tlb.h | 2 arch/arm/mm/mmu.c | 2 arch/arm64/include/asm/tlb.h | 2 arch/arm64/mm/mmu.c | 2 arch/csky/include/asm/pgalloc.h | 2 arch/hexagon/include/asm/pgalloc.h | 2 arch/hexagon/mm/init.c | 13 arch/m68k/include/asm/mcf_pgalloc.h | 6 arch/m68k/include/asm/motorola_pgalloc.h | 6 arch/m68k/include/asm/sun3_pgalloc.h | 2 arch/mips/include/asm/pgalloc.h | 2 arch/mips/include/uapi/asm/mman.h | 3 arch/nios2/include/asm/pgalloc.h | 2 arch/openrisc/include/asm/pgalloc.h | 6 arch/parisc/include/uapi/asm/mman.h | 3 arch/powerpc/mm/pgtable-frag.c | 6 arch/riscv/include/asm/pgalloc.h | 2 arch/s390/mm/pgalloc.c | 6 arch/sh/include/asm/pgalloc.h | 2 arch/sparc/include/asm/pgtable_64.h | 5 arch/sparc/mm/init_64.c | 4 arch/sparc/mm/srmmu.c | 4 arch/um/include/asm/pgalloc.h | 2 arch/unicore32/include/asm/tlb.h | 2 arch/x86/mm/pat_rbtree.c | 19 arch/x86/mm/pgtable.c | 2 arch/xtensa/include/asm/pgalloc.h | 4 arch/xtensa/include/uapi/asm/mman.h | 3 drivers/block/drbd/drbd_interval.c | 29 - drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gpuvm.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_gem.c | 2 drivers/gpu/drm/radeon/radeon_gem.c | 2 drivers/infiniband/hw/hfi1/verbs.c | 2 drivers/media/v4l2-core/videobuf-dma-contig.c | 9 drivers/net/wimax/i2400m/tx.c | 3 drivers/tee/tee_shm.c | 1 drivers/vfio/vfio_iommu_type1.c | 2 drivers/xen/events/events_base.c | 2 fs/fat/dir.c | 4 fs/namespace.c | 2 fs/ntfs/mft.c | 12 fs/ntfs/namei.c | 2 fs/ntfs/runlist.c | 2 fs/ntfs/super.c | 2 fs/open.c | 2 fs/reiserfs/do_balan.c | 15 fs/reiserfs/fix_node.c | 6 fs/reiserfs/journal.c | 22 fs/reiserfs/lbalance.c | 3 fs/reiserfs/objectid.c | 3 fs/reiserfs/prints.c | 3 fs/reiserfs/stree.c | 4 fs/userfaultfd.c | 22 fs/xfs/xfs_buf.c | 4 include/asm-generic/bug.h | 71 +- include/asm-generic/pgalloc.h | 8 include/linux/cpumask.h | 14 include/linux/interval_tree_generic.h | 22 include/linux/kexec.h | 2 include/linux/kgdb.h | 2 include/linux/mm.h | 4 include/linux/mm_types_task.h | 4 include/linux/printk.h | 22 include/linux/rbtree_augmented.h | 114 +++- include/linux/string.h | 5 include/linux/swap.h | 2 include/linux/thread_info.h | 2 include/linux/uaccess.h | 21 include/trace/events/writeback.h | 38 - include/uapi/asm-generic/mman-common.h | 3 include/uapi/linux/coff.h | 5 ipc/mqueue.c | 22 ipc/sem.c | 3 kernel/debug/debug_core.c | 31 - kernel/elfcore.c | 1 kernel/fork.c | 16 kernel/kexec_core.c | 2 kernel/panic.c | 48 - lib/Kconfig.debug | 4 lib/bug.c | 11 lib/extable.c | 1 lib/generic-radix-tree.c | 4 lib/hexdump.c | 21 lib/lzo/lzo1x_compress.c | 14 lib/rbtree_test.c | 37 - lib/string.c | 12 lib/strncpy_from_user.c | 3 lib/strnlen_user.c | 3 mm/frame_vector.c | 2 mm/gup.c | 4 mm/internal.h | 2 mm/madvise.c | 562 ++++++++++++++++------- mm/memcontrol.c | 10 mm/mempolicy.c | 3 mm/migrate.c | 2 mm/mincore.c | 2 mm/mlock.c | 4 mm/mmap.c | 34 - mm/mprotect.c | 2 mm/mremap.c | 13 mm/msync.c | 2 mm/oom_kill.c | 2 mm/swap.c | 42 + mm/vmalloc.c | 5 mm/vmscan.c | 62 ++ scripts/checkpatch.pl | 69 ++ scripts/gdb/linux/symbols.py | 4 tools/include/linux/rbtree.h | 71 +- tools/include/linux/rbtree_augmented.h | 145 +++-- tools/lib/rbtree.c | 37 - 114 files changed, 1195 insertions(+), 754 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2019-09-23 22:31 Andrew Morton 2019-09-24 0:55 ` incoming Linus Torvalds 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2019-09-23 22:31 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - a few hot fixes - ocfs2 updates - almost all of -mm, as below. 134 patches, based on 619e17cf75dd58905aa67ccd494a6ba5f19d6cc6: Subsystems affected by this patch series: hotfixes ocfs2 slab-generic slab slub kmemleak kasan cleanups debug pagecache memcg gup pagemap memory-hotplug sparsemem vmalloc initialization z3fold compaction mempolicy oom-kill hugetlb migration thp mmap madvise shmem zswap zsmalloc Subsystem: hotfixes OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>: fat: work around race with userspace's read via blockdev while mounting Vitaly Wool <vitalywool@gmail.com>: Revert "mm/z3fold.c: fix race between migration and destruction" Arnd Bergmann <arnd@arndb.de>: mm: add dummy can_do_mlock() helper Vitaly Wool <vitalywool@gmail.com>: z3fold: fix retry mechanism in page reclaim Greg Thelen <gthelen@google.com>: kbuild: clean compressed initramfs image Subsystem: ocfs2 Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: use jbd2_inode dirty range scoping jbd2: remove jbd2_journal_inode_add_[write|wait] Greg Kroah-Hartman <gregkh@linuxfoundation.org>: ocfs2: further debugfs cleanups Guozhonghua <guozhonghua@h3c.com>: ocfs2: remove unused ocfs2_calc_tree_trunc_credits() ocfs2: remove unused ocfs2_orphan_scan_exit() declaration zhengbin <zhengbin13@huawei.com>: fs/ocfs2/namei.c: remove set but not used variables fs/ocfs2/file.c: remove set but not used variables fs/ocfs2/dir.c: remove set but not used variables Markus Elfring <elfring@users.sourceforge.net>: ocfs2: delete unnecessary checks before brelse() Changwei Ge <gechangwei@live.cn>: ocfs2: wait for recovering done after direct unlock request ocfs2: checkpoint appending truncate log transaction before flushing Colin Ian King <colin.king@canonical.com>: ocfs2: fix spelling mistake "ambigous" -> "ambiguous" Subsystem: slab-generic Waiman Long <longman@redhat.com>: mm, slab: extend slab/shrink to shrink all memcg caches Subsystem: slab Waiman Long <longman@redhat.com>: mm, slab: move memcg_cache_params structure to mm/slab.h Subsystem: slub Qian Cai <cai@lca.pw>: mm/slub.c: fix -Wunused-function compiler warnings Subsystem: kmemleak Nicolas Boichat <drinkcat@chromium.org>: kmemleak: increase DEBUG_KMEMLEAK_EARLY_LOG_SIZE default to 16K Catalin Marinas <catalin.marinas@arm.com>: Patch series "mm: kmemleak: Use a memory pool for kmemleak object: mm: kmemleak: make the tool tolerant to struct scan_area allocation failures mm: kmemleak: simple memory allocation pool for kmemleak objects mm: kmemleak: use the memory pool for early allocations Qian Cai <cai@lca.pw>: mm/kmemleak.c: record the current memory pool size mm/kmemleak: increase the max mem pool to 1M Subsystem: kasan Walter Wu <walter-zh.wu@mediatek.com>: kasan: add memory corruption identification for software tag-based mode Mark Rutland <mark.rutland@arm.com>: lib/test_kasan.c: add roundtrip tests Subsystem: cleanups Christophe JAILLET <christophe.jaillet@wanadoo.fr>: mm/page_poison.c: fix a typo in a comment YueHaibing <yuehaibing@huawei.com>: mm/rmap.c: remove set but not used variable 'cstart' Matthew Wilcox (Oracle) <willy@infradead.org>: Patch series "Make working with compound pages easier", v2: mm: introduce page_size() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: introduce page_shift() Matthew Wilcox (Oracle) <willy@infradead.org>: mm: introduce compound_nr() Yu Zhao <yuzhao@google.com>: mm: replace list_move_tail() with add_page_to_lru_list_tail() Subsystem: debug Vlastimil Babka <vbabka@suse.cz>: Patch series "debug_pagealloc improvements through page_owner", v2: mm, page_owner: record page owner for each subpage mm, page_owner: keep owner info when freeing the page mm, page_owner, debug_pagealloc: save and dump freeing stack trace Subsystem: pagecache Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm/filemap.c: don't initiate writeback if mapping has no dirty pages mm/filemap.c: rewrite mapping_needs_writeback in less fancy manner "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: page cache: store only head pages in i_pages Subsystem: memcg Chris Down <chris@chrisdown.name>: mm, memcg: throttle allocators when failing reclaim over memory.high Roman Gushchin <guro@fb.com>: mm: memcontrol: switch to rcu protection in drain_all_stock() Johannes Weiner <hannes@cmpxchg.org>: mm: vmscan: do not share cgroup iteration between reclaimers Subsystem: gup [11~From: John Hubbard <jhubbard@nvidia.com>: Patch series "mm/gup: add make_dirty arg to put_user_pages_dirty_lock()",: mm/gup: add make_dirty arg to put_user_pages_dirty_lock() John Hubbard <jhubbard@nvidia.com>: drivers/gpu/drm/via: convert put_page() to put_user_page*() net/xdp: convert put_page() to put_user_page*() Subsystem: pagemap Wei Yang <richardw.yang@linux.intel.com>: mm: remove redundant assignment of entry Minchan Kim <minchan@kernel.org>: mm: release the spinlock on zap_pte_range Nicholas Piggin <npiggin@gmail.com>: Patch series "mm: remove quicklist page table caches": mm: remove quicklist page table caches Mike Rapoport <rppt@linux.ibm.com>: ia64: switch to generic version of pte allocation sh: switch to generic version of pte allocation microblaze: switch to generic version of pte allocation mm: consolidate pgtable_cache_init() and pgd_cache_init() Kefeng Wang <wangkefeng.wang@huawei.com>: mm: do not hash address in print_bad_pte() Subsystem: memory-hotplug David Hildenbrand <david@redhat.com>: mm/memory_hotplug: remove move_pfn_range() drivers/base/node.c: simplify unregister_memory_block_under_nodes() drivers/base/memory.c: fixup documentation of removable/phys_index/block_size_bytes driver/base/memory.c: validate memory block size early drivers/base/memory.c: don't store end_section_nr in memory blocks Wei Yang <richardw.yang@linux.intel.com>: mm/memory_hotplug.c: prevent memory leak when reusing pgdat David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: online_pages() cleanups", v2: mm/memory_hotplug.c: use PFN_UP / PFN_DOWN in walk_system_ram_range() mm/memory_hotplug: drop PageReserved() check in online_pages_range() mm/memory_hotplug: simplify online_pages_range() mm/memory_hotplug: make sure the pfn is aligned to the order when onlining mm/memory_hotplug: online_pages cannot be 0 in online_pages() Alastair D'Silva <alastair@d-silva.org>: Patch series "Add bounds check for Hotplugged memory", v3: mm/memory_hotplug.c: add a bounds check to check_hotplug_memory_range() mm/memremap.c: add a bounds check in devm_memremap_pages() Souptick Joarder <jrdr.linux@gmail.com>: mm/memory_hotplug.c: s/is/if Subsystem: sparsemem Lecopzer Chen <lecopzer.chen@mediatek.com>: mm/sparse.c: fix memory leak of sparsemap_buf in aligned memory mm/sparse.c: fix ALIGN() without power of 2 in sparse_buffer_alloc() Wei Yang <richardw.yang@linux.intel.com>: mm/sparse.c: use __nr_to_section(section_nr) to get mem_section Alastair D'Silva <alastair@d-silva.org>: mm/sparse.c: don't manually decrement num_poisoned_pages "Alastair D'Silva" <alastair@d-silva.org>: mm/sparse.c: remove NULL check in clear_hwpoisoned_pages() Subsystem: vmalloc "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: do not keep unpurged areas in the busy tree Pengfei Li <lpf.vector@gmail.com>: mm/vmalloc: modify struct vmap_area to reduce its size Austin Kim <austindh.kim@gmail.com>: mm/vmalloc.c: move 'area->pages' after if statement Subsystem: initialization Mike Rapoport <rppt@linux.ibm.com>: mm: use CPU_BITS_NONE to initialize init_mm.cpu_bitmask Qian Cai <cai@lca.pw>: mm: silence -Woverride-init/initializer-overrides Subsystem: z3fold Vitaly Wool <vitalywool@gmail.com>: z3fold: fix memory leak in kmem cache Subsystem: compaction Yafang Shao <laoar.shao@gmail.com>: mm/compaction.c: clear total_{migrate,free}_scanned before scanning a new zone Pengfei Li <lpf.vector@gmail.com>: mm/compaction.c: remove unnecessary zone parameter in isolate_migratepages() Subsystem: mempolicy Kefeng Wang <wangkefeng.wang@huawei.com>: mm/mempolicy.c: remove unnecessary nodemask check in kernel_migrate_pages() Subsystem: oom-kill Joel Savitz <jsavitz@redhat.com>: mm/oom_kill.c: add task UID to info message on an oom kill Tetsuo Handa <penguin-kernel@i-love.sakura.ne.jp>: memcg, oom: don't require __GFP_FS when invoking memcg OOM killer Edward Chron <echron@arista.com>: mm/oom: add oom_score_adj and pgtables to Killed process message Yi Wang <wang.yi59@zte.com.cn>: mm/oom_kill.c: fix oom_cpuset_eligible() comment Michal Hocko <mhocko@suse.com>: mm, oom: consider present pages for the node size Qian Cai <cai@lca.pw>: mm/memcontrol.c: fix a -Wunused-function warning Michal Hocko <mhocko@suse.com>: memcg, kmem: deprecate kmem.limit_in_bytes Subsystem: hugetlb Hillf Danton <hdanton@sina.com>: Patch series "address hugetlb page allocation stalls", v2: mm, reclaim: make should_continue_reclaim perform dryrun detection Vlastimil Babka <vbabka@suse.cz>: mm, reclaim: cleanup should_continue_reclaim() mm, compaction: raise compaction priority after it withdrawns Mike Kravetz <mike.kravetz@oracle.com>: hugetlbfs: don't retry when pool page allocations start to fail Subsystem: migration Pingfan Liu <kernelfans@gmail.com>: mm/migrate.c: clean up useless code in migrate_vma_collect_pmd() Subsystem: thp Kefeng Wang <wangkefeng.wang@huawei.com>: thp: update split_huge_page_pmd() comment Song Liu <songliubraving@fb.com>: Patch series "Enable THP for text section of non-shmem files", v10;: filemap: check compound_head(page)->mapping in filemap_fault() filemap: check compound_head(page)->mapping in pagecache_get_page() filemap: update offset check in filemap_fault() mm,thp: stats for file backed THP khugepaged: rename collapse_shmem() and khugepaged_scan_shmem() mm,thp: add read-only THP support for (non-shmem) FS mm,thp: avoid writes to file with THP in pagecache Yang Shi <yang.shi@linux.alibaba.com>: Patch series "Make deferred split shrinker memcg aware", v6: mm: thp: extract split_queue_* into a struct mm: move mem_cgroup_uncharge out of __page_cache_release() mm: shrinker: make shrinker not depend on memcg kmem mm: thp: make deferred split shrinker memcg aware Song Liu <songliubraving@fb.com>: Patch series "THP aware uprobe", v13: mm: move memcmp_pages() and pages_identical() uprobe: use original page when all uprobes are removed mm, thp: introduce FOLL_SPLIT_PMD uprobe: use FOLL_SPLIT_PMD instead of FOLL_SPLIT khugepaged: enable collapse pmd for pte-mapped THP uprobe: collapse THP pmd after removing all uprobes Subsystem: mmap Alexandre Ghiti <alex@ghiti.fr>: Patch series "Provide generic top-down mmap layout functions", v6: mm, fs: move randomize_stack_top from fs to mm arm64: make use of is_compat_task instead of hardcoding this test arm64: consider stack randomization for mmap base only when necessary arm64, mm: move generic mmap layout functions to mm arm64, mm: make randomization selected by generic topdown mmap layout arm: properly account for stack randomization and stack guard gap arm: use STACK_TOP when computing mmap base address arm: use generic mmap top-down layout and brk randomization mips: properly account for stack randomization and stack guard gap mips: use STACK_TOP when computing mmap base address mips: adjust brk randomization offset to fit generic version mips: replace arch specific way to determine 32bit task with generic version mips: use generic mmap top-down layout and brk randomization riscv: make mmap allocation top-down by default Wei Yang <richardw.yang@linux.intel.com>: mm/mmap.c: refine find_vma_prev() with rb_last() Ivan Khoronzhuk <ivan.khoronzhuk@linaro.org>: mm: mmap: increase sockets maximum memory size pgoff for 32bits Subsystem: madvise Mike Rapoport <rppt@linux.ibm.com>: mm/madvise: reduce code duplication in error handling paths Subsystem: shmem Miles Chen <miles.chen@mediatek.com>: shmem: fix obsolete comment in shmem_getpage_gfp() Subsystem: zswap Hui Zhu <teawaterz@linux.alibaba.com>: zpool: add malloc_support_movable to zpool_driver zswap: use movable memory if zpool support allocate movable memory Vitaly Wool <vitalywool@gmail.com>: zswap: do not map same object twice Subsystem: zsmalloc Qian Cai <cai@lca.pw>: mm/zsmalloc.c: fix a -Wunused-function warning Documentation/ABI/testing/sysfs-kernel-slab | 13 Documentation/admin-guide/cgroup-v1/memory.rst | 4 Documentation/admin-guide/kernel-parameters.txt | 2 arch/Kconfig | 11 arch/alpha/include/asm/pgalloc.h | 2 arch/alpha/include/asm/pgtable.h | 5 arch/arc/include/asm/pgalloc.h | 1 arch/arc/include/asm/pgtable.h | 5 arch/arm/Kconfig | 1 arch/arm/include/asm/pgalloc.h | 2 arch/arm/include/asm/pgtable-nommu.h | 5 arch/arm/include/asm/pgtable.h | 2 arch/arm/include/asm/processor.h | 2 arch/arm/kernel/process.c | 5 arch/arm/mm/flush.c | 7 arch/arm/mm/mmap.c | 80 ----- arch/arm64/Kconfig | 2 arch/arm64/include/asm/pgalloc.h | 2 arch/arm64/include/asm/pgtable.h | 2 arch/arm64/include/asm/processor.h | 2 arch/arm64/kernel/process.c | 8 arch/arm64/mm/flush.c | 3 arch/arm64/mm/mmap.c | 84 ----- arch/arm64/mm/pgd.c | 2 arch/c6x/include/asm/pgtable.h | 5 arch/csky/include/asm/pgalloc.h | 2 arch/csky/include/asm/pgtable.h | 5 arch/h8300/include/asm/pgtable.h | 6 arch/hexagon/include/asm/pgalloc.h | 2 arch/hexagon/include/asm/pgtable.h | 3 arch/hexagon/mm/Makefile | 2 arch/hexagon/mm/pgalloc.c | 10 arch/ia64/Kconfig | 4 arch/ia64/include/asm/pgalloc.h | 64 ---- arch/ia64/include/asm/pgtable.h | 5 arch/ia64/mm/init.c | 2 arch/m68k/include/asm/pgtable_mm.h | 7 arch/m68k/include/asm/pgtable_no.h | 7 arch/microblaze/include/asm/pgalloc.h | 128 -------- arch/microblaze/include/asm/pgtable.h | 7 arch/microblaze/mm/pgtable.c | 4 arch/mips/Kconfig | 2 arch/mips/include/asm/pgalloc.h | 2 arch/mips/include/asm/pgtable.h | 5 arch/mips/include/asm/processor.h | 5 arch/mips/mm/mmap.c | 124 +------- arch/nds32/include/asm/pgalloc.h | 2 arch/nds32/include/asm/pgtable.h | 2 arch/nios2/include/asm/pgalloc.h | 2 arch/nios2/include/asm/pgtable.h | 2 arch/openrisc/include/asm/pgalloc.h | 2 arch/openrisc/include/asm/pgtable.h | 5 arch/parisc/include/asm/pgalloc.h | 2 arch/parisc/include/asm/pgtable.h | 2 arch/powerpc/include/asm/pgalloc.h | 2 arch/powerpc/include/asm/pgtable.h | 1 arch/powerpc/mm/book3s64/hash_utils.c | 2 arch/powerpc/mm/book3s64/iommu_api.c | 7 arch/powerpc/mm/hugetlbpage.c | 2 arch/riscv/Kconfig | 12 arch/riscv/include/asm/pgalloc.h | 4 arch/riscv/include/asm/pgtable.h | 5 arch/s390/include/asm/pgtable.h | 6 arch/sh/include/asm/pgalloc.h | 56 --- arch/sh/include/asm/pgtable.h | 5 arch/sh/mm/Kconfig | 3 arch/sh/mm/nommu.c | 4 arch/sparc/include/asm/pgalloc_32.h | 2 arch/sparc/include/asm/pgalloc_64.h | 2 arch/sparc/include/asm/pgtable_32.h | 5 arch/sparc/include/asm/pgtable_64.h | 1 arch/sparc/mm/init_32.c | 1 arch/um/include/asm/pgalloc.h | 2 arch/um/include/asm/pgtable.h | 2 arch/unicore32/include/asm/pgalloc.h | 2 arch/unicore32/include/asm/pgtable.h | 2 arch/x86/include/asm/pgtable_32.h | 2 arch/x86/include/asm/pgtable_64.h | 3 arch/x86/mm/pgtable.c | 6 arch/xtensa/include/asm/pgtable.h | 1 arch/xtensa/include/asm/tlbflush.h | 3 drivers/base/memory.c | 44 +- drivers/base/node.c | 55 +-- drivers/crypto/chelsio/chtls/chtls_io.c | 5 drivers/gpu/drm/via/via_dmablit.c | 10 drivers/infiniband/core/umem.c | 5 drivers/infiniband/hw/hfi1/user_pages.c | 5 drivers/infiniband/hw/qib/qib_user_pages.c | 5 drivers/infiniband/hw/usnic/usnic_uiom.c | 5 drivers/infiniband/sw/siw/siw_mem.c | 10 drivers/staging/android/ion/ion_system_heap.c | 4 drivers/target/tcm_fc/tfc_io.c | 3 drivers/vfio/vfio_iommu_spapr_tce.c | 8 fs/binfmt_elf.c | 20 - fs/fat/dir.c | 13 fs/fat/fatent.c | 3 fs/inode.c | 3 fs/io_uring.c | 2 fs/jbd2/journal.c | 2 fs/jbd2/transaction.c | 12 fs/ocfs2/alloc.c | 20 + fs/ocfs2/aops.c | 13 fs/ocfs2/blockcheck.c | 26 - fs/ocfs2/cluster/heartbeat.c | 109 +------ fs/ocfs2/dir.c | 3 fs/ocfs2/dlm/dlmcommon.h | 1 fs/ocfs2/dlm/dlmdebug.c | 55 --- fs/ocfs2/dlm/dlmdebug.h | 16 - fs/ocfs2/dlm/dlmdomain.c | 7 fs/ocfs2/dlm/dlmunlock.c | 23 + fs/ocfs2/dlmglue.c | 29 - fs/ocfs2/extent_map.c | 3 fs/ocfs2/file.c | 13 fs/ocfs2/inode.c | 2 fs/ocfs2/journal.h | 42 -- fs/ocfs2/namei.c | 2 fs/ocfs2/ocfs2.h | 3 fs/ocfs2/super.c | 10 fs/open.c | 8 fs/proc/meminfo.c | 8 fs/proc/task_mmu.c | 6 include/asm-generic/pgalloc.h | 5 include/asm-generic/pgtable.h | 7 include/linux/compaction.h | 22 + include/linux/fs.h | 32 ++ include/linux/huge_mm.h | 9 include/linux/hugetlb.h | 2 include/linux/jbd2.h | 2 include/linux/khugepaged.h | 12 include/linux/memcontrol.h | 23 - include/linux/memory.h | 7 include/linux/memory_hotplug.h | 1 include/linux/mm.h | 37 ++ include/linux/mm_types.h | 1 include/linux/mmzone.h | 14 include/linux/page_ext.h | 1 include/linux/pagemap.h | 10 include/linux/quicklist.h | 94 ------ include/linux/shrinker.h | 7 include/linux/slab.h | 62 ---- include/linux/vmalloc.h | 20 - include/linux/zpool.h | 3 init/main.c | 6 kernel/events/uprobes.c | 81 ++++- kernel/resource.c | 4 kernel/sched/idle.c | 1 kernel/sysctl.c | 6 lib/Kconfig.debug | 15 lib/Kconfig.kasan | 8 lib/iov_iter.c | 2 lib/show_mem.c | 5 lib/test_kasan.c | 41 ++ mm/Kconfig | 16 - mm/Kconfig.debug | 4 mm/Makefile | 4 mm/compaction.c | 50 +-- mm/filemap.c | 168 ++++------ mm/gup.c | 125 +++----- mm/huge_memory.c | 129 ++++++-- mm/hugetlb.c | 89 +++++ mm/hugetlb_cgroup.c | 2 mm/init-mm.c | 2 mm/kasan/common.c | 32 +- mm/kasan/kasan.h | 14 mm/kasan/report.c | 44 ++ mm/kasan/tags_report.c | 24 + mm/khugepaged.c | 372 ++++++++++++++++++++---- mm/kmemleak.c | 338 +++++---------------- mm/ksm.c | 18 - mm/madvise.c | 52 +-- mm/memcontrol.c | 188 ++++++++++-- mm/memfd.c | 2 mm/memory.c | 21 + mm/memory_hotplug.c | 120 ++++--- mm/mempolicy.c | 4 mm/memremap.c | 5 mm/migrate.c | 13 mm/mmap.c | 12 mm/mmu_gather.c | 2 mm/nommu.c | 2 mm/oom_kill.c | 30 + mm/page_alloc.c | 27 + mm/page_owner.c | 127 +++++--- mm/page_poison.c | 2 mm/page_vma_mapped.c | 3 mm/quicklist.c | 103 ------ mm/rmap.c | 25 - mm/shmem.c | 12 mm/slab.h | 64 ++++ mm/slab_common.c | 37 ++ mm/slob.c | 2 mm/slub.c | 22 - mm/sparse.c | 25 + mm/swap.c | 16 - mm/swap_state.c | 6 mm/util.c | 126 +++++++- mm/vmalloc.c | 84 +++-- mm/vmscan.c | 163 ++++------ mm/vmstat.c | 2 mm/z3fold.c | 154 ++------- mm/zpool.c | 16 + mm/zsmalloc.c | 23 - mm/zswap.c | 15 net/xdp/xdp_umem.c | 9 net/xdp/xsk.c | 2 usr/Makefile | 3 206 files changed, 2385 insertions(+), 2533 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2019-09-23 22:31 incoming Andrew Morton @ 2019-09-24 0:55 ` Linus Torvalds 2019-09-24 4:31 ` incoming Andrew Morton 0 siblings, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2019-09-24 0:55 UTC (permalink / raw) To: Andrew Morton, David Rientjes, Vlastimil Babka, Michal Hocko, Andrea Arcangeli Cc: mm-commits, Linux-MM On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > - almost all of -mm, as below. I was hoping that we could at least test the THP locality thing? Is it in your queue at all, or am I supposed to just do it myself? Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2019-09-24 0:55 ` incoming Linus Torvalds @ 2019-09-24 4:31 ` Andrew Morton 2019-09-24 7:48 ` incoming Michal Hocko 0 siblings, 1 reply; 348+ messages in thread From: Andrew Morton @ 2019-09-24 4:31 UTC (permalink / raw) To: Linus Torvalds Cc: David Rientjes, Vlastimil Babka, Michal Hocko, Andrea Arcangeli, mm-commits, Linux-MM On Mon, 23 Sep 2019 17:55:24 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > - almost all of -mm, as below. > > I was hoping that we could at least test the THP locality thing? Is it > in your queue at all, or am I supposed to just do it myself? > Confused. I saw a privately emailed patch from David which nobody seems to have tested yet. I parked that for consideration after -rc1. Or are you referring to something else? This thing keeps stalling. It would be nice to push this along and get something nailed down which we can at least get into 5.4-rc, perhaps with a backport-this tag? ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2019-09-24 4:31 ` incoming Andrew Morton @ 2019-09-24 7:48 ` Michal Hocko 2019-09-24 15:34 ` incoming Linus Torvalds 2019-09-24 19:55 ` incoming Vlastimil Babka 0 siblings, 2 replies; 348+ messages in thread From: Michal Hocko @ 2019-09-24 7:48 UTC (permalink / raw) To: Andrew Morton Cc: Linus Torvalds, David Rientjes, Vlastimil Babka, Andrea Arcangeli, mm-commits, Linux-MM On Mon 23-09-19 21:31:53, Andrew Morton wrote: > On Mon, 23 Sep 2019 17:55:24 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > > > On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > > > - almost all of -mm, as below. > > > > I was hoping that we could at least test the THP locality thing? Is it > > in your queue at all, or am I supposed to just do it myself? > > > > Confused. I saw a privately emailed patch from David which nobody > seems to have tested yet. I parked that for consideration after -rc1. > Or are you referring to something else? > > This thing keeps stalling. It would be nice to push this along and get > something nailed down which we can at least get into 5.4-rc, perhaps > with a backport-this tag? The patch proposed by David is really non trivial wrt. potential side effects. I have provided my review feedback [1] and it didn't get any reaction. I really believe that we need to debug this properly. A reproducer would be useful for others to work on that. There is a more fundamental problem here and we need to address it rather than to duck tape it and whack a mole afterwards. [1] http://lkml.kernel.org/r/20190909193020.GD2063@dhcp22.suse.cz -- Michal Hocko SUSE Labs ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2019-09-24 7:48 ` incoming Michal Hocko @ 2019-09-24 15:34 ` Linus Torvalds 2019-09-25 6:36 ` incoming Michal Hocko 2019-09-24 19:55 ` incoming Vlastimil Babka 1 sibling, 1 reply; 348+ messages in thread From: Linus Torvalds @ 2019-09-24 15:34 UTC (permalink / raw) To: Michal Hocko Cc: Andrew Morton, David Rientjes, Vlastimil Babka, Andrea Arcangeli, mm-commits, Linux-MM On Tue, Sep 24, 2019 at 12:48 AM Michal Hocko <mhocko@kernel.org> wrote: > > The patch proposed by David is really non trivial wrt. potential side > effects. The thing is, that's not an argument when we know that the current state is garbage and has a lot of these non-trivial side effects that are bad. So the patch by David _fixes_ a non-trivial bad side effect. You can't then say "there may be other non-trivial side effects that I don't even know about" as an argument for saying it's bad. David at least has numbers and an argument for his patch. Linus ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2019-09-24 15:34 ` incoming Linus Torvalds @ 2019-09-25 6:36 ` Michal Hocko 0 siblings, 0 replies; 348+ messages in thread From: Michal Hocko @ 2019-09-25 6:36 UTC (permalink / raw) To: Linus Torvalds Cc: Andrew Morton, David Rientjes, Vlastimil Babka, Andrea Arcangeli, mm-commits, Linux-MM On Tue 24-09-19 08:34:20, Linus Torvalds wrote: > On Tue, Sep 24, 2019 at 12:48 AM Michal Hocko <mhocko@kernel.org> wrote: > > > > The patch proposed by David is really non trivial wrt. potential side > > effects. > > The thing is, that's not an argument when we know that the current > state is garbage and has a lot of these non-trivial side effects that > are bad. > > So the patch by David _fixes_ a non-trivial bad side effect. > > You can't then say "there may be other non-trivial side effects that I > don't even know about" as an argument for saying it's bad. David at > least has numbers and an argument for his patch. All I am saying is that I am not able to wrap my head around this patch to provide a competent Ack. I also believe that the fix is targetting a wrong layer of the problem as explained in my review feedback. Appart from reclaim/compaction interaction mentioned by Vlastimil, it seems that it is an overly eager fallback to a remote node in the fast path that is causing a large part of the problem as well. Kcompactd is not eager enough to keep high order allocations ready for the fast path. This is not specific to THP we have many other high order allocations which are going to follow the same pattern, likely not visible in any counters but still having performance implications. Let's discuss technical details in the respective email thread -- Michal Hocko SUSE Labs ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2019-09-24 7:48 ` incoming Michal Hocko 2019-09-24 15:34 ` incoming Linus Torvalds @ 2019-09-24 19:55 ` Vlastimil Babka 1 sibling, 0 replies; 348+ messages in thread From: Vlastimil Babka @ 2019-09-24 19:55 UTC (permalink / raw) To: Michal Hocko, Andrew Morton Cc: Linus Torvalds, David Rientjes, Andrea Arcangeli, mm-commits, Linux-MM On 9/24/19 9:48 AM, Michal Hocko wrote: > On Mon 23-09-19 21:31:53, Andrew Morton wrote: >> On Mon, 23 Sep 2019 17:55:24 -0700 Linus Torvalds >> <torvalds@linux-foundation.org> wrote: >> >>> On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton >>> <akpm@linux-foundation.org> wrote: >>>> >>>> - almost all of -mm, as below. >>> >>> I was hoping that we could at least test the THP locality thing? >>> Is it in your queue at all, or am I supposed to just do it >>> myself? >>> >> >> Confused. I saw a privately emailed patch from David which nobody >> seems to have tested yet. I parked that for consideration after >> -rc1. Or are you referring to something else? >> >> This thing keeps stalling. It would be nice to push this along and >> get something nailed down which we can at least get into 5.4-rc, >> perhaps with a backport-this tag? > > The patch proposed by David is really non trivial wrt. potential > side effects. I have provided my review feedback [1] and it didn't > get any reaction. I really believe that we need to debug this > properly. A reproducer would be useful for others to work on that. > > There is a more fundamental problem here and we need to address it > rather than to duck tape it and whack a mole afterwards. I believe we found a problem when investigating over-reclaim in this thread [1] where it seems madvised THP allocation attempt can result in 4MB reclaimed, if there is a small zone such as ZONE_DMA on the node. As it happens, the patch "[patch 090/134] mm, reclaim: make should_continue_reclaim perform dryrun detection" in Andrew's pile should change this 4MB to 32 pages reclaimed (as a side-effect), but that has to be tested. I'm also working on a patch to not reclaim even those few pages. Of course there might be more fundamental issues with reclaim/compaction interaction, but this one seems to become hopefully clear now. [1] https://lore.kernel.org/linux-mm/4b4ba042-3741-7b16-2292-198c569da2aa@profihost.ag/ > [1] http://lkml.kernel.org/r/20190909193020.GD2063@dhcp22.suse.cz > ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2019-08-30 23:04 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2019-08-30 23:04 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 7 fixes, based on 846d2db3e00048da3f650e0cfb0b8d67669cec3e: Roman Gushchin <guro@fb.com>: mm: memcontrol: flush percpu slab vmstats on kmem offlining Andrew Morton <akpm@linux-foundation.org>: mm/zsmalloc.c: fix build when CONFIG_COMPACTION=n Roman Gushchin <guro@fb.com>: mm, memcg: partially revert "mm/memcontrol.c: keep local VM counters in sync with the hierarchical ones" "Gustavo A. R. Silva" <gustavo@embeddedor.com>: mm/z3fold.c: fix lock/unlock imbalance in z3fold_page_isolate Dmitry Safonov <dima@arista.com>: mailmap: add aliases for Dmitry Safonov Michal Hocko <mhocko@suse.com>: mm, memcg: do not set reclaim_state on soft limit reclaim Shakeel Butt <shakeelb@google.com>: mm: memcontrol: fix percpu vmstats and vmevents flush .mailmap | 3 ++ include/linux/mmzone.h | 5 ++-- mm/memcontrol.c | 53 ++++++++++++++++++++++++++++++++----------------- mm/vmscan.c | 5 ++-- mm/z3fold.c | 1 mm/zsmalloc.c | 2 + 6 files changed, 47 insertions(+), 22 deletions(-) ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2019-08-25 0:54 Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2019-08-25 0:54 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 11 fixes, based on 361469211f876e67d7ca3d3d29e6d1c3e313d0f1: Henry Burns <henryburns@google.com>: mm/z3fold.c: fix race between migration and destruction David Rientjes <rientjes@google.com>: mm, page_alloc: move_freepages should not examine struct page of reserved memory Qian Cai <cai@lca.pw>: parisc: fix compilation errrors Roman Gushchin <guro@fb.com>: mm: memcontrol: flush percpu vmstats before releasing memcg mm: memcontrol: flush percpu vmevents before releasing memcg Jason Xing <kerneljasonxing@linux.alibaba.com>: psi: get poll_work to run when calling poll syscall next time Oleg Nesterov <oleg@redhat.com>: userfaultfd_release: always remove uffd flags and clear vm_userfaultfd_ctx Vlastimil Babka <vbabka@suse.cz>: mm, page_owner: handle THP splits correctly Henry Burns <henryburns@google.com>: mm/zsmalloc.c: migration can leave pages in ZS_EMPTY indefinitely mm/zsmalloc.c: fix race condition in zs_destroy_pool Andrey Ryabinin <aryabinin@virtuozzo.com>: mm/kasan: fix false positive invalid-free reports with CONFIG_KASAN_SW_TAGS=y ^ permalink raw reply [flat|nested] 348+ messages in thread
[parent not found: <20190716162536.bb52b8f34a8ecf5331a86a42@linux-foundation.org>]
* Re: incoming [not found] <20190716162536.bb52b8f34a8ecf5331a86a42@linux-foundation.org> @ 2019-07-17 8:47 ` Vlastimil Babka 2019-07-17 8:57 ` incoming Bhaskar Chowdhury 2019-07-17 16:13 ` incoming Linus Torvalds 0 siblings, 2 replies; 348+ messages in thread From: Vlastimil Babka @ 2019-07-17 8:47 UTC (permalink / raw) To: linux-kernel, Linus Torvalds Cc: linux-mm, Jonathan Corbet, Thorsten Leemhuis, LKML On 7/17/19 1:25 AM, Andrew Morton wrote: > > Most of the rest of MM and just about all of the rest of everything > else. Hi, as I've mentioned at LSF/MM [1], I think it would be nice if mm pull requests had summaries similar to other subsystems. I see they are now more structured (thanks!), but they are now probably hitting the limit of what scripting can do to produce a high-level summary for human readers (unless patch authors themselves provide a blurb that can be extracted later?). So I've tried now to provide an example what I had in mind, below. Maybe it's too concise - if there were "larger" features in this pull request, they would probably benefit from more details. I'm CCing the known (to me) consumers of these mails to judge :) Note I've only covered mm, and core stuff that I think will be interesting to wide audience (change in LIST_POISON2 value? I'm sure as hell glad to know about that one :) Feel free to include this in the merge commit, if you find it useful. Thanks, Vlastimil [1] https://lwn.net/Articles/787705/ ----- - z3fold fixes and enhancements by Henry Burns and Vitaly Wool - more accurate reclaimed slab caches calculations by Yafang Shao - fix MAP_UNINITIALIZED UAPI symbol to not depend on config, by Christoph Hellwig - !CONFIG_MMU fixes by Christoph Hellwig - new novmcoredd parameter to omit device dumps from vmcore, by Kairui Song - new test_meminit module for testing heap and pagealloc initialization, by Alexander Potapenko - ioremap improvements for huge mappings, by Anshuman Khandual - generalize kprobe page fault handling, by Anshuman Khandual - device-dax hotplug fixes and improvements, by Pavel Tatashin - enable synchronous DAX fault on powerpc, by Aneesh Kumar K.V - add pte_devmap() support for arm64, by Robin Murphy - unify locked_vm accounting with a helper, by Daniel Jordan - several misc fixes core/lib - new typeof_member() macro including some users, by Alexey Dobriyan - make BIT() and GENMASK() available in asm, by Masahiro Yamada - changed LIST_POISON2 on x86_64 to 0xdead000000000122 for better code generation, by Alexey Dobriyan - rbtree code size optimizations, by Michel Lespinasse - convert struct pid count to refcount_t, by Joel Fernandes get_maintainer.pl - add --no-moderated switch to skip moderated ML's, by Joe Perches ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2019-07-17 8:47 ` incoming Vlastimil Babka @ 2019-07-17 8:57 ` Bhaskar Chowdhury 2019-07-17 16:13 ` incoming Linus Torvalds 1 sibling, 0 replies; 348+ messages in thread From: Bhaskar Chowdhury @ 2019-07-17 8:57 UTC (permalink / raw) To: Vlastimil Babka Cc: linux-kernel, Linus Torvalds, linux-mm, Jonathan Corbet, Thorsten Leemhuis [-- Attachment #1: Type: text/plain, Size: 2496 bytes --] Cool !! On 10:47 Wed 17 Jul , Vlastimil Babka wrote: >On 7/17/19 1:25 AM, Andrew Morton wrote: >> >> Most of the rest of MM and just about all of the rest of everything >> else. > >Hi, > >as I've mentioned at LSF/MM [1], I think it would be nice if mm pull >requests had summaries similar to other subsystems. I see they are now >more structured (thanks!), but they are now probably hitting the limit >of what scripting can do to produce a high-level summary for human >readers (unless patch authors themselves provide a blurb that can be >extracted later?). > >So I've tried now to provide an example what I had in mind, below. Maybe >it's too concise - if there were "larger" features in this pull request, >they would probably benefit from more details. I'm CCing the known (to >me) consumers of these mails to judge :) Note I've only covered mm, and >core stuff that I think will be interesting to wide audience (change in >LIST_POISON2 value? I'm sure as hell glad to know about that one :) > >Feel free to include this in the merge commit, if you find it useful. > >Thanks, >Vlastimil > >[1] https://lwn.net/Articles/787705/ > >----- > >- z3fold fixes and enhancements by Henry Burns and Vitaly Wool >- more accurate reclaimed slab caches calculations by Yafang Shao >- fix MAP_UNINITIALIZED UAPI symbol to not depend on config, by >Christoph Hellwig >- !CONFIG_MMU fixes by Christoph Hellwig >- new novmcoredd parameter to omit device dumps from vmcore, by Kairui Song >- new test_meminit module for testing heap and pagealloc initialization, >by Alexander Potapenko >- ioremap improvements for huge mappings, by Anshuman Khandual >- generalize kprobe page fault handling, by Anshuman Khandual >- device-dax hotplug fixes and improvements, by Pavel Tatashin >- enable synchronous DAX fault on powerpc, by Aneesh Kumar K.V >- add pte_devmap() support for arm64, by Robin Murphy >- unify locked_vm accounting with a helper, by Daniel Jordan >- several misc fixes > >core/lib >- new typeof_member() macro including some users, by Alexey Dobriyan >- make BIT() and GENMASK() available in asm, by Masahiro Yamada >- changed LIST_POISON2 on x86_64 to 0xdead000000000122 for better code >generation, by Alexey Dobriyan >- rbtree code size optimizations, by Michel Lespinasse >- convert struct pid count to refcount_t, by Joel Fernandes > >get_maintainer.pl >- add --no-moderated switch to skip moderated ML's, by Joe Perches > > [-- Attachment #2: signature.asc --] [-- Type: application/pgp-signature, Size: 488 bytes --] ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2019-07-17 8:47 ` incoming Vlastimil Babka 2019-07-17 8:57 ` incoming Bhaskar Chowdhury @ 2019-07-17 16:13 ` Linus Torvalds 2019-07-17 17:09 ` incoming Christian Brauner 2019-07-17 18:13 ` incoming Vlastimil Babka 1 sibling, 2 replies; 348+ messages in thread From: Linus Torvalds @ 2019-07-17 16:13 UTC (permalink / raw) To: Vlastimil Babka Cc: Linux List Kernel Mailing, linux-mm, Jonathan Corbet, Thorsten Leemhuis On Wed, Jul 17, 2019 at 1:47 AM Vlastimil Babka <vbabka@suse.cz> wrote: > > So I've tried now to provide an example what I had in mind, below. I'll take it as a trial. I added one-line notes about coda and the PTRACE_GET_SYSCALL_INFO interface too. I do hope that eventually I'll just get pull requests, and they'll have more of a "theme" than this all (*) Linus (*) Although in many ways, the theme for Andrew is "falls through the cracks otherwise" so I'm not really complaining. This has been working for years and years. ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2019-07-17 16:13 ` incoming Linus Torvalds @ 2019-07-17 17:09 ` Christian Brauner 2019-07-17 18:13 ` incoming Vlastimil Babka 1 sibling, 0 replies; 348+ messages in thread From: Christian Brauner @ 2019-07-17 17:09 UTC (permalink / raw) To: Linus Torvalds Cc: Vlastimil Babka, Linux List Kernel Mailing, linux-mm, Jonathan Corbet, Thorsten Leemhuis On Wed, Jul 17, 2019 at 09:13:26AM -0700, Linus Torvalds wrote: > On Wed, Jul 17, 2019 at 1:47 AM Vlastimil Babka <vbabka@suse.cz> wrote: > > > > So I've tried now to provide an example what I had in mind, below. > > I'll take it as a trial. I added one-line notes about coda and the > PTRACE_GET_SYSCALL_INFO interface too. > > I do hope that eventually I'll just get pull requests, and they'll > have more of a "theme" than this all (*) > > Linus > > (*) Although in many ways, the theme for Andrew is "falls through the > cracks otherwise" so I'm not really complaining. This has been working I put all pid{fd}/clone{3} which is mostly related to pid.c, exit.c, fork.c into my tree and try to give it a consistent theme for the prs I sent. And that at least from my perspective that worked and was pretty easy to coordinate with Andrew. That should hopefully make it a little easier to theme the -mm tree overall going forward. ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2019-07-17 16:13 ` incoming Linus Torvalds 2019-07-17 17:09 ` incoming Christian Brauner @ 2019-07-17 18:13 ` Vlastimil Babka 1 sibling, 0 replies; 348+ messages in thread From: Vlastimil Babka @ 2019-07-17 18:13 UTC (permalink / raw) To: Linus Torvalds Cc: Linux List Kernel Mailing, linux-mm, Jonathan Corbet, Thorsten Leemhuis On 7/17/19 6:13 PM, Linus Torvalds wrote: > On Wed, Jul 17, 2019 at 1:47 AM Vlastimil Babka <vbabka@suse.cz> wrote: >> >> So I've tried now to provide an example what I had in mind, below. > > I'll take it as a trial. I added one-line notes about coda and the > PTRACE_GET_SYSCALL_INFO interface too. Thanks. > I do hope that eventually I'll just get pull requests, Very much agree, that was also discussed at length in the LSF/MM mm process session I've linked. > and they'll > have more of a "theme" than this all (*) I'll check if the first patch bomb would be more amenable to that, as I plan to fill in the mm part for 5.3 on LinuxChanges wiki, but for a merge commit it's too late. > Linus > > (*) Although in many ways, the theme for Andrew is "falls through the > cracks otherwise" so I'm not really complaining. This has been working > for years and years. Nevermind the misc stuff that much, but I think mm itself is more important and deserves what other subsystems have. ^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming @ 2007-05-02 22:02 Andrew Morton 2007-05-02 22:31 ` incoming Benjamin Herrenschmidt ` (2 more replies) 0 siblings, 3 replies; 348+ messages in thread From: Andrew Morton @ 2007-05-02 22:02 UTC (permalink / raw) To: Linus Torvalds Cc: Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm So this is what I have lined up for the first mm->2.6.22 batch. I won't be sending it off for another 12-24 hours yet. To give people time for final comment and to give me time to see if it actually works. - A few serial bits. - A few pcmcia bits. - Some of the MM queue. Includes: - An enhancement to /proc/pid/smaps to permit monitoring of a running program's working set. There's another patchset which builds on this quite a lot from Matt Mackall, but it's not quite ready yet. - The SLUB allocator. It's pretty green but I do want to push ahead with this pretty aggressively with a view to replacing slab altogether. If it ends up not working out then we should remove slub altogether again, but I doubt if that will occur. If SLUB isn't in good shape by 2.6.22 we should hide it in Kconfig to prevent people from hitting known problems. It'll remain EXPERIMENTAL. - generic pagetable quicklist management. We have x86_64 and ia64 and sparc64 implementations, but I'll only include David's sparc64 implementation here. I'll send the x86_64 and ia64 implementations through maintainers. - Various random MM bits - Benh's teach-get_unmapped_area-about-MAP_FIXED changes - madvise(MADV_FREE) This means I'm holding back Mel's page allocator work, and Andy's lumpy-reclaim. A shame in a way - I have high hopes for lumpy reclaim against the moveable zone, but these things are not to be done lightly. A few MM things have been held back awaiting subsystem tree merges (probably x86 - I didn't check). - One little security patch - the blackfin architecture - small h8300 update - small alpha update - swsusp updates - m68k bits - cris udpates - Lots of UML updates - v850, xtensa slab-introduce-krealloc.patch at91_cf-minor-fix.patch add-new_id-to-pcmcia-drivers.patch ide-cs-recognize-2gb-compactflash-from-transcend.patch serial-driver-pmc-msp71xx.patch rm9000-serial-driver.patch serial-define-fixed_port-flag-for-serial_core.patch serial-use-resource_size_t-for-serial-port-io-addresses.patch mpsc-serial-driver-tx-locking.patch 8250_pci-fix-pci-must_checks.patch serial-serial_core-use-pr_debug.patch add-apply_to_page_range-which-applies-a-function-to-a-pte-range.patch safer-nr_node_ids-and-nr_node_ids-determination-and-initial.patch use-zvc-counters-to-establish-exact-size-of-dirtyable-pages.patch proper-prototype-for-hugetlb_get_unmapped_area.patch mm-remove-gcc-workaround.patch slab-ensure-cache_alloc_refill-terminates.patch mm-make-read_cache_page-synchronous.patch fs-buffer-dont-pageuptodate-without-page-locked.patch allow-oom_adj-of-saintly-processes.patch introduce-config_has_dma.patch mm-slabc-proper-prototypes.patch add-pfn_valid_within-helper-for-sub-max_order-hole-detection.patch mm-simplify-filemap_nopage.patch add-unitialized_var-macro-for-suppressing-gcc-warnings.patch i386-add-ptep_test_and_clear_dirtyyoung.patch i386-use-pte_update_defer-in-ptep_test_and_clear_dirtyyoung.patch smaps-extract-pmd-walker-from-smaps-code.patch smaps-add-pages-referenced-count-to-smaps.patch smaps-add-clear_refs-file-to-clear-reference.patch readahead-improve-heuristic-detecting-sequential-reads.patch readahead-code-cleanup.patch slab-use-num_possible_cpus-in-enable_cpucache.patch slab-dont-allocate-empty-shared-caches.patch slab-numa-kmem_cache-diet.patch do-not-disable-interrupts-when-reading-min_free_kbytes.patch slab-mark-set_up_list3s-__init.patch cpusets-allow-tif_memdie-threads-to-allocate-anywhere.patch i386-use-page-allocator-to-allocate-thread_info-structure.patch slub-core.patch make-page-private-usable-in-compound-pages-v1.patch optimize-compound_head-by-avoiding-a-shared-page.patch add-virt_to_head_page-and-consolidate-code-in-slab-and-slub.patch slub-fix-object-tracking.patch slub-enable-tracking-of-full-slabs.patch slub-validation-of-slabs-metadata-and-guard-zones.patch slub-add-min_partial.patch slub-add-ability-to-list-alloc--free-callers-per-slab.patch slub-free-slabs-and-sort-partial-slab-lists-in-kmem_cache_shrink.patch slub-remove-object-activities-out-of-checking-functions.patch slub-user-documentation.patch slub-add-slabinfo-tool.patch quicklists-for-page-table-pages.patch quicklist-support-for-sparc64.patch slob-handle-slab_panic-flag.patch include-kern_-constant-in-printk-calls-in-mm-slabc.patch mm-madvise-avoid-exclusive-mmap_sem.patch mm-remove-destroy_dirty_buffers-from-invalidate_bdev.patch mm-optimize-kill_bdev.patch mm-optimize-acorn-partition-truncate.patch slab-allocators-remove-obsolete-slab_must_hwcache_align.patch kmem_cache-simplify-slab-cache-creation.patch slab-allocators-remove-multiple-alignment-specifications.patch fault-injection-fix-failslab-with-config_numa.patch mm-fix-handling-of-panic_on_oom-when-cpusets-are-in-use.patch oom-fix-constraint-deadlock.patch get_unmapped_area-handles-map_fixed-on-powerpc.patch get_unmapped_area-handles-map_fixed-on-alpha.patch get_unmapped_area-handles-map_fixed-on-arm.patch get_unmapped_area-handles-map_fixed-on-frv.patch get_unmapped_area-handles-map_fixed-on-i386.patch get_unmapped_area-handles-map_fixed-on-ia64.patch get_unmapped_area-handles-map_fixed-on-parisc.patch get_unmapped_area-handles-map_fixed-on-sparc64.patch get_unmapped_area-handles-map_fixed-on-x86_64.patch get_unmapped_area-handles-map_fixed-in-hugetlbfs.patch get_unmapped_area-handles-map_fixed-in-generic-code.patch get_unmapped_area-doesnt-need-hugetlbfs-hacks-anymore.patch slab-allocators-remove-slab_debug_initial-flag.patch slab-allocators-remove-slab_ctor_atomic.patch slab-allocators-remove-useless-__gfp_no_grow-flag.patch lazy-freeing-of-memory-through-madv_free.patch restore-madv_dontneed-to-its-original-linux-behaviour.patch hugetlbfs-add-null-check-in-hugetlb_zero_setup.patch slob-fix-page-order-calculation-on-not-4kb-page.patch page-migration-only-migrate-pages-if-allocation-in-the-highest-zone-is-possible.patch return-eperm-not-echild-on-security_task_wait-failure.patch blackfin-arch.patch driver_bfin_serial_core.patch blackfin-on-chip-ethernet-mac-controller-driver.patch blackfin-patch-add-blackfin-support-in-smc91x.patch blackfin-on-chip-rtc-controller-driver.patch blackfin-blackfin-on-chip-spi-controller-driver.patch convert-h8-300-to-generic-timekeeping.patch h8300-generic-irq.patch h8300-add-zimage-support.patch round_up-macro-cleanup-in-arch-alpha-kernel-osf_sysc.patch alpha-fix-bootp-image-creation.patch alpha-prctl-macros.patch srmcons-fix-kmallocgfp_kernel-inside-spinlock.patch arm26-remove-useless-config-option-generic_bust_spinlock.patch fix-refrigerator-vs-thaw_process-race.patch swsusp-use-inline-functions-for-changing-page-flags.patch swsusp-do-not-use-page-flags.patch mm-remove-unused-page-flags.patch swsusp-fix-error-paths-in-snapshot_open.patch swsusp-use-gfp_kernel-for-creating-basic-data-structures.patch freezer-remove-pf_nofreeze-from-handle_initrd.patch swsusp-use-rbtree-for-tracking-allocated-swap.patch freezer-fix-racy-usage-of-try_to_freeze-in-kswapd.patch remove-software_suspend.patch power-management-change-sys-power-disk-display.patch kconfig-mentioneds-hibernation-not-just-swsusp.patch swsusp-fix-snapshot_release.patch swsusp-free-more-memory.patch remove-unused-header-file-arch-m68k-atari-atasoundh.patch spin_lock_unlocked-cleanup-in-arch-m68k.patch remove-unused-header-file-drivers-serial-crisv10h.patch cris-check-for-memory-allocation.patch cris-remove-code-related-to-pre-22-kernel.patch uml-delete-unused-code.patch uml-formatting-fixes.patch uml-host_info-tidying.patch uml-mark-tt-mode-code-for-future-removal.patch uml-print-coredump-limits.patch uml-handle-block-device-hotplug-errors.patch uml-driver-formatting-fixes.patch uml-driver-formatting-fixes-fix.patch uml-network-interface-hotplug-error-handling.patch array_size-check-for-type.patch uml-move-sigio-testing-to-sigioc.patch uml-create-archh.patch uml-create-as-layouth.patch uml-move-remaining-useful-contents-of-user_utilh.patch uml-remove-user_utilh.patch uml-add-missing-__init-declarations.patch remove-unused-header-file-arch-um-kernel-tt-include-mode_kern-tth.patch uml-improve-checking-and-diagnostics-of-ethernet-macs.patch uml-eliminate-temporary-buffer-in-eth_configure.patch uml-replace-one-element-array-with-zero-element-array.patch uml-fix-umid-in-xterm-titles.patch uml-speed-up-exec.patch uml-no-locking-needed-in-tlsc.patch uml-tidy-processc.patch uml-remove-page_size.patch uml-kernel_thread-shouldnt-panic.patch uml-tidy-fault-code.patch uml-kernel-segfaults-should-dump-proper-registers.patch uml-comment-early-boot-locking.patch uml-irq-locking-commentary.patch uml-delete-host_frame_size.patch uml-drivers-get-release-methods.patch uml-dump-registers-on-ptrace-or-wait-failure.patch uml-speed-up-page-table-walking.patch uml-remove-unused-x86_64-code.patch uml-start-fixing-os_read_file-and-os_write_file.patch uml-tidy-libc-code.patch uml-convert-libc-layer-to-call-read-and-write.patch uml-batch-i-o-requests.patch uml-send-pointers-instead-of-structures-to-i-o-thread.patch uml-send-pointers-instead-of-structures-to-i-o-thread-fix.patch uml-dump-core-on-panic.patch uml-dont-try-to-handle-signals-on-initial-process-stack.patch uml-change-remaining-callers-of-os_read_write_file.patch uml-formatting-fixes-around-os_read_write_file-callers.patch uml-remove-debugging-remnants.patch uml-rename-os_read_write_file_k-back-to-os_read_write_file.patch uml-aio-deadlock-avoidance.patch uml-speed-page-fault-path.patch uml-eliminate-a-piece-of-debugging-code.patch uml-more-page-fault-path-trimming.patch uml-only-flush-areas-covered-by-vma.patch uml-out-of-tmpfs-space-error-clarification.patch uml-virtualized-time-fix.patch uml-fix-prototypes.patch v850-generic-timekeeping-conversion.patch xtensa-strlcpy-is-smart-enough.patch -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2007-05-02 22:02 incoming Andrew Morton @ 2007-05-02 22:31 ` Benjamin Herrenschmidt 2007-05-03 7:55 ` incoming Russell King 2007-05-04 13:37 ` incoming Greg KH 2 siblings, 0 replies; 348+ messages in thread From: Benjamin Herrenschmidt @ 2007-05-02 22:31 UTC (permalink / raw) To: Andrew Morton Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, linux-kernel, linux-mm On Wed, 2007-05-02 at 15:02 -0700, Andrew Morton wrote: > So this is what I have lined up for the first mm->2.6.22 batch. I won't be > sending it off for another 12-24 hours yet. To give people time for final > comment and to give me time to see if it actually works. Thanks. I have some powerpc bits that depend on that stuff that will go through Paulus after these show up in git and I've rebased. Cheers, Ben. -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2007-05-02 22:02 incoming Andrew Morton 2007-05-02 22:31 ` incoming Benjamin Herrenschmidt @ 2007-05-03 7:55 ` Russell King 2007-05-03 8:05 ` incoming Andrew Morton 2007-05-04 13:37 ` incoming Greg KH 2 siblings, 1 reply; 348+ messages in thread From: Russell King @ 2007-05-03 7:55 UTC (permalink / raw) To: Andrew Morton Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote: > So this is what I have lined up for the first mm->2.6.22 batch. I won't be > sending it off for another 12-24 hours yet. To give people time for final > comment and to give me time to see if it actually works. I assume you're going to update this list with my comments I sent yesterday? -- Russell King Linux kernel 2.6 ARM Linux - http://www.arm.linux.org.uk/ maintainer of: -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2007-05-03 7:55 ` incoming Russell King @ 2007-05-03 8:05 ` Andrew Morton 0 siblings, 0 replies; 348+ messages in thread From: Andrew Morton @ 2007-05-03 8:05 UTC (permalink / raw) To: Russell King Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm On Thu, 3 May 2007 08:55:43 +0100 Russell King <rmk+lkml@arm.linux.org.uk> wrote: > On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote: > > So this is what I have lined up for the first mm->2.6.22 batch. I won't be > > sending it off for another 12-24 hours yet. To give people time for final > > comment and to give me time to see if it actually works. > > I assume you're going to update this list with my comments I sent > yesterday? > Serial drivers? Well you saw me drop a bunch of them. I now have: serial-driver-pmc-msp71xx.patch rm9000-serial-driver.patch serial-define-fixed_port-flag-for-serial_core.patch mpsc-serial-driver-tx-locking.patch serial-serial_core-use-pr_debug.patch I'll also be holding off on MADV_FREE - Nick has some performance things to share and I'm assuming they're not as good as he'd like. -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2007-05-02 22:02 incoming Andrew Morton 2007-05-02 22:31 ` incoming Benjamin Herrenschmidt 2007-05-03 7:55 ` incoming Russell King @ 2007-05-04 13:37 ` Greg KH 2007-05-04 16:14 ` incoming Andrew Morton 2 siblings, 1 reply; 348+ messages in thread From: Greg KH @ 2007-05-04 13:37 UTC (permalink / raw) To: Andrew Morton Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote: > - One little security patch Care to cc: linux-stable with it so we can do a new 2.6.21 release with it if needed? thanks, greg k-h -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2007-05-04 13:37 ` incoming Greg KH @ 2007-05-04 16:14 ` Andrew Morton 2007-05-04 17:02 ` incoming Greg KH 2007-05-04 18:57 ` incoming Roland McGrath 0 siblings, 2 replies; 348+ messages in thread From: Andrew Morton @ 2007-05-04 16:14 UTC (permalink / raw) To: Greg KH Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm, Roland McGrath, Stephen Smalley On Fri, 4 May 2007 06:37:28 -0700 Greg KH <greg@kroah.com> wrote: > On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote: > > - One little security patch > > Care to cc: linux-stable with it so we can do a new 2.6.21 release with > it if needed? > Ah. The patch affects security code, but it doesn't actually address any insecurity. I didn't think it was needed for -stable? From: Roland McGrath <roland@redhat.com> wait* syscalls return -ECHILD even when an individual PID of a live child was requested explicitly, when security_task_wait denies the operation. This means that something like a broken SELinux policy can produce an unexpected failure that looks just like a bug with wait or ptrace or something. This patch makes do_wait return -EACCES (or other appropriate error returned from security_task_wait() instead of -ECHILD if some children were ruled out solely because security_task_wait failed. [jmorris@namei.org: switch error code to EACCES] Signed-off-by: Roland McGrath <roland@redhat.com> Cc: Stephen Smalley <sds@tycho.nsa.gov> Cc: Chris Wright <chrisw@sous-sol.org> Cc: James Morris <jmorris@namei.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- kernel/exit.c | 17 +++++++++++++++-- 1 files changed, 15 insertions(+), 2 deletions(-) diff -puN kernel/exit.c~return-eperm-not-echild-on-security_task_wait-failure kernel/exit.c --- a/kernel/exit.c~return-eperm-not-echild-on-security_task_wait-failure +++ a/kernel/exit.c @@ -1033,6 +1033,8 @@ asmlinkage void sys_exit_group(int error static int eligible_child(pid_t pid, int options, struct task_struct *p) { + int err; + if (pid > 0) { if (p->pid != pid) return 0; @@ -1066,8 +1068,9 @@ static int eligible_child(pid_t pid, int if (delay_group_leader(p)) return 2; - if (security_task_wait(p)) - return 0; + err = security_task_wait(p); + if (err) + return err; return 1; } @@ -1449,6 +1452,7 @@ static long do_wait(pid_t pid, int optio DECLARE_WAITQUEUE(wait, current); struct task_struct *tsk; int flag, retval; + int allowed, denied; add_wait_queue(¤t->signal->wait_chldexit,&wait); repeat: @@ -1457,6 +1461,7 @@ repeat: * match our criteria, even if we are not able to reap it yet. */ flag = 0; + allowed = denied = 0; current->state = TASK_INTERRUPTIBLE; read_lock(&tasklist_lock); tsk = current; @@ -1472,6 +1477,12 @@ repeat: if (!ret) continue; + if (unlikely(ret < 0)) { + denied = ret; + continue; + } + allowed = 1; + switch (p->state) { case TASK_TRACED: /* @@ -1570,6 +1581,8 @@ check_continued: goto repeat; } retval = -ECHILD; + if (unlikely(denied) && !allowed) + retval = denied; end: current->state = TASK_RUNNING; remove_wait_queue(¤t->signal->wait_chldexit,&wait); _ -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2007-05-04 16:14 ` incoming Andrew Morton @ 2007-05-04 17:02 ` Greg KH 2007-05-04 18:57 ` incoming Roland McGrath 1 sibling, 0 replies; 348+ messages in thread From: Greg KH @ 2007-05-04 17:02 UTC (permalink / raw) To: Andrew Morton Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm, Roland McGrath, Stephen Smalley On Fri, May 04, 2007 at 09:14:34AM -0700, Andrew Morton wrote: > On Fri, 4 May 2007 06:37:28 -0700 Greg KH <greg@kroah.com> wrote: > > > On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote: > > > - One little security patch > > > > Care to cc: linux-stable with it so we can do a new 2.6.21 release with > > it if needed? > > > > Ah. The patch affects security code, but it doesn't actually address any > insecurity. I didn't think it was needed for -stable? Ah, ok, I read "security" as fixing a insecure problem, my mistake :) thanks, greg k-h -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2007-05-04 16:14 ` incoming Andrew Morton 2007-05-04 17:02 ` incoming Greg KH @ 2007-05-04 18:57 ` Roland McGrath 2007-05-04 19:24 ` incoming Greg KH 1 sibling, 1 reply; 348+ messages in thread From: Roland McGrath @ 2007-05-04 18:57 UTC (permalink / raw) To: Andrew Morton Cc: Greg KH, Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm, Stephen Smalley > Ah. The patch affects security code, but it doesn't actually address any > insecurity. I didn't think it was needed for -stable? I would not recommend it for -stable. It is an ABI change for the case of a security refusal. Thanks, Roland -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2007-05-04 18:57 ` incoming Roland McGrath @ 2007-05-04 19:24 ` Greg KH 2007-05-04 19:29 ` incoming Roland McGrath 0 siblings, 1 reply; 348+ messages in thread From: Greg KH @ 2007-05-04 19:24 UTC (permalink / raw) To: Roland McGrath Cc: Andrew Morton, Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm, Stephen Smalley On Fri, May 04, 2007 at 11:57:21AM -0700, Roland McGrath wrote: > > Ah. The patch affects security code, but it doesn't actually address any > > insecurity. I didn't think it was needed for -stable? > > I would not recommend it for -stable. > It is an ABI change for the case of a security refusal. ABI changes are not a problem for -stable, so don't let that stop anyone :) thanks, greg k-h -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming 2007-05-04 19:24 ` incoming Greg KH @ 2007-05-04 19:29 ` Roland McGrath 0 siblings, 0 replies; 348+ messages in thread From: Roland McGrath @ 2007-05-04 19:29 UTC (permalink / raw) To: Greg KH Cc: Andrew Morton, Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm, Stephen Smalley > ABI changes are not a problem for -stable, so don't let that stop anyone > :) In fact this is the harmless sort (changes only the error code of a failure case) that might actually go in if there were any important reason. But the smiley stands. Thanks, Roland -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 348+ messages in thread
end of thread, other threads:[~2022-04-27 19:41 UTC | newest] Thread overview: 348+ messages (download: mbox.gz follow: Atom feed -- links below jump to the message on this page -- 2021-05-05 1:32 incoming Andrew Morton 2021-05-05 1:32 ` [patch 001/143] mm: introduce and use mapping_empty() Andrew Morton 2021-05-05 1:32 ` [patch 002/143] mm: stop accounting shadow entries Andrew Morton 2021-05-05 1:32 ` [patch 003/143] dax: account DAX entries as nrpages Andrew Morton 2021-05-05 1:32 ` [patch 004/143] mm: remove nrexceptional from inode Andrew Morton 2021-05-05 1:32 ` [patch 005/143] mm: remove nrexceptional from inode: remove BUG_ON Andrew Morton 2021-05-05 1:33 ` [patch 006/143] hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share() Andrew Morton 2021-05-05 1:33 ` [patch 007/143] hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled Andrew Morton 2021-05-05 1:33 ` [patch 008/143] mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h Andrew Morton 2021-05-05 1:33 ` [patch 009/143] hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp Andrew Morton 2021-05-05 1:33 ` [patch 010/143] mm/hugetlb: remove redundant reservation check condition in alloc_huge_page() Andrew Morton 2021-05-05 1:33 ` [patch 011/143] mm: generalize HUGETLB_PAGE_SIZE_VARIABLE Andrew Morton 2021-05-05 1:33 ` [patch 012/143] mm/hugetlb: use some helper functions to cleanup code Andrew Morton 2021-05-05 1:33 ` [patch 013/143] mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state() Andrew Morton 2021-05-05 1:33 ` [patch 014/143] mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate() Andrew Morton 2021-05-05 1:33 ` [patch 015/143] mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page() Andrew Morton 2021-05-05 1:33 ` [patch 016/143] mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case Andrew Morton 2021-05-05 1:33 ` [patch 017/143] khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps() Andrew Morton 2021-05-05 1:33 ` [patch 018/143] khugepaged: reuse the smp_wmb() inside __SetPageUptodate() Andrew Morton 2021-05-05 1:33 ` [patch 019/143] khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter() Andrew Morton 2021-05-05 1:33 ` [patch 020/143] khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate() Andrew Morton 2021-05-05 1:33 ` [patch 021/143] mm/huge_memory.c: remove unnecessary local variable ret2 Andrew Morton 2021-05-05 1:33 ` [patch 022/143] mm/huge_memory.c: rework the function vma_adjust_trans_huge() Andrew Morton 2021-05-05 1:33 ` [patch 023/143] mm/huge_memory.c: make get_huge_zero_page() return bool Andrew Morton 2021-05-05 1:33 ` [patch 024/143] mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly Andrew Morton 2021-05-05 1:34 ` [patch 025/143] mm/huge_memory.c: remove redundant PageCompound() check Andrew Morton 2021-05-05 1:34 ` [patch 026/143] mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG Andrew Morton 2021-05-05 1:34 ` [patch 027/143] mm/huge_memory.c: use helper function migration_entry_to_page() Andrew Morton 2021-05-05 1:34 ` [patch 028/143] mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable Andrew Morton 2021-05-05 1:34 ` [patch 029/143] khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp() Andrew Morton 2021-05-05 1:34 ` [patch 030/143] khugepaged: remove unnecessary out label in collapse_huge_page() Andrew Morton 2021-05-05 1:34 ` [patch 031/143] khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd() Andrew Morton 2021-05-05 1:34 ` [patch 032/143] mm: huge_memory: a new debugfs interface for splitting THP tests Andrew Morton 2021-05-05 1:34 ` [patch 033/143] mm: huge_memory: debugfs for file-backed THP split Andrew Morton 2021-05-05 1:34 ` [patch 034/143] mm/hugeltb: remove redundant VM_BUG_ON() in region_add() Andrew Morton 2021-05-05 1:34 ` [patch 035/143] mm/hugeltb: simplify the return code of __vma_reservation_common() Andrew Morton 2021-05-05 1:34 ` [patch 036/143] mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages() Andrew Morton 2021-05-05 1:34 ` [patch 037/143] mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts() Andrew Morton 2021-05-05 1:34 ` [patch 038/143] mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages() Andrew Morton 2021-05-05 1:34 ` [patch 039/143] mm/cma: change cma mutex to irq safe spinlock Andrew Morton 2021-05-05 1:34 ` [patch 040/143] hugetlb: no need to drop hugetlb_lock to call cma_release Andrew Morton 2021-05-05 1:34 ` [patch 041/143] hugetlb: add per-hstate mutex to synchronize user adjustments Andrew Morton 2021-05-05 1:34 ` [patch 042/143] hugetlb: create remove_hugetlb_page() to separate functionality Andrew Morton 2021-05-05 1:34 ` [patch 043/143] hugetlb: call update_and_free_page without hugetlb_lock Andrew Morton 2021-05-05 1:35 ` [patch 044/143] hugetlb: change free_pool_huge_page to remove_pool_huge_page Andrew Morton 2021-05-05 1:35 ` [patch 045/143] hugetlb: make free_huge_page irq safe Andrew Morton 2021-05-05 1:35 ` [patch 046/143] hugetlb: add lockdep_assert_held() calls for hugetlb_lock Andrew Morton 2021-05-05 1:35 ` [patch 047/143] mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range Andrew Morton 2021-05-05 1:35 ` [patch 048/143] mm,compaction: let isolate_migratepages_{range,block} return error codes Andrew Morton 2021-05-05 1:35 ` [patch 049/143] mm,hugetlb: drop clearing of flag from prep_new_huge_page Andrew Morton 2021-05-05 1:35 ` [patch 050/143] mm,hugetlb: split prep_new_huge_page functionality Andrew Morton 2021-05-05 1:35 ` [patch 051/143] mm: make alloc_contig_range handle free hugetlb pages Andrew Morton 2021-05-05 1:35 ` [patch 052/143] mm: make alloc_contig_range handle in-use " Andrew Morton 2021-05-05 1:35 ` [patch 053/143] mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig Andrew Morton 2021-05-05 1:35 ` [patch 054/143] userfaultfd: add minor fault registration mode Andrew Morton 2021-05-05 1:35 ` [patch 055/143] userfaultfd: disable huge PMD sharing for MINOR registered VMAs Andrew Morton 2021-05-05 1:35 ` [patch 056/143] userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled Andrew Morton 2021-05-05 1:35 ` [patch 057/143] userfaultfd: add UFFDIO_CONTINUE ioctl Andrew Morton 2021-05-05 1:35 ` [patch 058/143] userfaultfd: update documentation to describe minor fault handling Andrew Morton 2021-05-05 1:35 ` [patch 059/143] userfaultfd/selftests: add test exercising " Andrew Morton 2021-05-05 1:36 ` [patch 060/143] mm/vmscan: move RECLAIM* bits to uapi header Andrew Morton 2021-05-05 1:36 ` [patch 061/143] mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks Andrew Morton 2021-05-05 1:36 ` [patch 062/143] mm: vmscan: use nid from shrink_control for tracepoint Andrew Morton 2021-05-05 1:36 ` [patch 063/143] mm: vmscan: consolidate shrinker_maps handling code Andrew Morton 2021-05-05 1:36 ` [patch 064/143] mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation Andrew Morton 2021-05-05 1:36 ` [patch 065/143] mm: vmscan: remove memcg_shrinker_map_size Andrew Morton 2021-05-05 1:36 ` [patch 066/143] mm: vmscan: use kvfree_rcu instead of call_rcu Andrew Morton 2021-05-05 1:36 ` [patch 067/143] mm: memcontrol: rename shrinker_map to shrinker_info Andrew Morton 2021-05-05 1:36 ` [patch 068/143] mm: vmscan: add shrinker_info_protected() helper Andrew Morton 2021-05-05 1:36 ` [patch 069/143] mm: vmscan: use a new flag to indicate shrinker is registered Andrew Morton 2021-05-05 1:36 ` [patch 070/143] mm: vmscan: add per memcg shrinker nr_deferred Andrew Morton 2021-05-05 1:36 ` [patch 071/143] mm: vmscan: use per memcg nr_deferred of shrinker Andrew Morton 2021-05-05 1:36 ` [patch 072/143] mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers Andrew Morton 2021-05-05 1:36 ` [patch 073/143] mm: memcontrol: reparent nr_deferred when memcg offline Andrew Morton 2021-05-05 1:36 ` [patch 074/143] mm: vmscan: shrink deferred objects proportional to priority Andrew Morton 2021-05-05 1:36 ` [patch 075/143] mm/compaction: remove unused variable sysctl_compact_memory Andrew Morton 2021-05-05 1:36 ` [patch 076/143] mm: compaction: update the COMPACT[STALL|FAIL] events properly Andrew Morton 2021-05-05 1:36 ` [patch 077/143] mm: disable LRU pagevec during the migration temporarily Andrew Morton 2021-05-05 1:36 ` [patch 078/143] mm: replace migrate_[prep|finish] with lru_cache_[disable|enable] Andrew Morton 2021-05-05 1:37 ` [patch 079/143] mm: fs: invalidate BH LRU during page migration Andrew Morton 2021-05-05 1:37 ` [patch 080/143] mm/migrate.c: make putback_movable_page() static Andrew Morton 2021-05-05 1:37 ` [patch 081/143] mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case Andrew Morton 2021-05-05 1:37 ` [patch 082/143] mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page() Andrew Morton 2021-05-05 1:37 ` [patch 083/143] mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole() Andrew Morton 2021-05-05 1:37 ` [patch 084/143] Revert "mm: migrate: skip shared exec THP for NUMA balancing" Andrew Morton 2021-05-05 1:37 ` [patch 085/143] mm: vmstat: add cma statistics Andrew Morton 2021-05-05 1:37 ` [patch 086/143] mm: cma: use pr_err_ratelimited for CMA warning Andrew Morton 2021-05-05 1:37 ` [patch 087/143] mm: cma: add trace events for CMA alloc perf testing Andrew Morton 2021-05-05 1:37 ` [patch 088/143] mm: cma: support sysfs Andrew Morton 2021-05-05 1:37 ` [patch 089/143] mm: cma: add the CMA instance name to cma trace events Andrew Morton 2021-05-05 1:37 ` [patch 090/143] mm: use proper type for cma_[alloc|release] Andrew Morton 2021-05-05 1:37 ` [patch 091/143] ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search() Andrew Morton 2021-05-05 1:37 ` [patch 092/143] ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree() Andrew Morton 2021-05-05 1:37 ` [patch 093/143] ksm: remove dedicated macro KSM_FLAG_MASK Andrew Morton 2021-05-05 1:37 ` [patch 094/143] ksm: fix potential missing rmap_item for stable_node Andrew Morton 2021-05-05 1:37 ` [patch 095/143] mm/ksm: remove unused parameter from remove_trailing_rmap_items() Andrew Morton 2021-05-05 1:37 ` [patch 096/143] mm: restore node stat checking in /proc/sys/vm/stat_refresh Andrew Morton 2021-05-05 1:37 ` [patch 097/143] mm: no more EINVAL from /proc/sys/vm/stat_refresh Andrew Morton 2021-05-05 1:37 ` [patch 098/143] mm: /proc/sys/vm/stat_refresh skip checking known negative stats Andrew Morton 2021-05-05 1:38 ` [patch 099/143] mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats Andrew Morton 2021-05-05 1:38 ` [patch 100/143] x86/mm: track linear mapping split events Andrew Morton 2021-05-05 1:38 ` [patch 101/143] mm/mmap.c: don't unlock VMAs in remap_file_pages() Andrew Morton 2021-05-05 1:38 ` [patch 102/143] mm: generalize ARCH_HAS_CACHE_LINE_SIZE Andrew Morton 2021-05-05 1:38 ` [patch 104/143] mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] Andrew Morton 2021-05-05 1:38 ` [patch 105/143] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION Andrew Morton 2021-05-05 1:38 ` [patch 108/143] mm/util.c: reduce mem_dump_obj() object size Andrew Morton 2021-05-05 1:38 ` [patch 109/143] mm/util.c: fix typo Andrew Morton 2021-05-05 1:38 ` [patch 110/143] mm/gup: don't pin migrated cma pages in movable zone Andrew Morton 2021-05-05 1:38 ` [patch 111/143] mm/gup: check every subpage of a compound page during isolation Andrew Morton 2021-05-05 1:38 ` [patch 112/143] mm/gup: return an error on migration failure Andrew Morton 2021-05-05 1:38 ` [patch 113/143] mm/gup: check for isolation errors Andrew Morton 2021-05-05 1:38 ` [patch 114/143] mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN Andrew Morton 2021-05-05 1:38 ` [patch 115/143] mm: apply per-task gfp constraints in fast path Andrew Morton 2021-05-05 1:39 ` [patch 116/143] mm: honor PF_MEMALLOC_PIN for all movable pages Andrew Morton 2021-05-05 1:39 ` [patch 117/143] mm/gup: do not migrate zero page Andrew Morton 2021-05-05 1:39 ` [patch 118/143] mm/gup: migrate pinned pages out of movable zone Andrew Morton 2021-05-05 1:39 ` [patch 119/143] memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning Andrew Morton 2021-05-05 1:39 ` [patch 120/143] mm/gup: change index type to long as it counts pages Andrew Morton 2021-05-05 1:39 ` [patch 121/143] mm/gup: longterm pin migration cleanup Andrew Morton 2021-05-05 1:39 ` [patch 122/143] selftests/vm: gup_test: fix test flag Andrew Morton 2021-05-05 1:39 ` [patch 123/143] selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages Andrew Morton 2021-05-05 1:39 ` [patch 124/143] mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove Andrew Morton 2021-05-05 1:39 ` [patch 125/143] drivers/base/memory: introduce memory_block_{online,offline} Andrew Morton 2021-05-05 1:39 ` [patch 126/143] mm,memory_hotplug: relax fully spanned sections check Andrew Morton 2021-05-05 1:39 ` [patch 127/143] mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count() Andrew Morton 2021-05-05 1:39 ` [patch 128/143] mm,memory_hotplug: allocate memmap from the added memory range Andrew Morton 2021-05-05 1:39 ` [patch 129/143] acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported Andrew Morton 2021-05-05 1:39 ` [patch 130/143] mm,memory_hotplug: add kernel boot option to enable memmap_on_memory Andrew Morton 2021-05-05 1:39 ` [patch 131/143] x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE Andrew Morton 2021-05-05 1:39 ` [patch 132/143] arm64/Kconfig: " Andrew Morton 2021-05-05 1:39 ` [patch 133/143] mm/zswap.c: switch from strlcpy to strscpy Andrew Morton 2021-05-05 1:40 ` [patch 134/143] mm/zsmalloc: use BUG_ON instead of if condition followed by BUG Andrew Morton 2021-05-05 1:40 ` [patch 135/143] iov_iter: lift memzero_page() to highmem.h Andrew Morton 2021-05-05 1:40 ` [patch 136/143] btrfs: use memzero_page() instead of open coded kmap pattern Andrew Morton 2021-05-05 1:40 ` [patch 137/143] mm/highmem.c: fix coding style issue Andrew Morton 2021-05-05 1:40 ` [patch 138/143] mm/mempool: minor coding style tweaks Andrew Morton 2021-05-05 1:40 ` [patch 139/143] mm/process_vm_access.c: remove duplicate include Andrew Morton 2021-05-05 1:40 ` [patch 140/143] kfence: zero guard page after out-of-bounds access Andrew Morton 2021-05-05 1:40 ` [patch 141/143] kfence: await for allocation using wait_event Andrew Morton 2021-05-05 1:40 ` [patch 142/143] kfence: maximize allocation wait timeout duration Andrew Morton 2021-05-05 1:40 ` [patch 143/143] kfence: use power-efficient work queue to run delayed work Andrew Morton 2021-05-05 1:47 ` incoming Linus Torvalds 2021-05-05 3:16 ` incoming Andrew Morton 2021-05-05 17:10 ` incoming Linus Torvalds 2021-05-05 17:44 ` incoming Andrew Morton 2021-05-06 3:19 ` incoming Anshuman Khandual -- strict thread matches above, loose matches on Subject: below -- 2022-04-27 19:41 incoming Andrew Morton 2022-04-21 23:35 incoming Andrew Morton 2022-04-15 2:12 incoming Andrew Morton 2022-04-08 20:08 incoming Andrew Morton 2022-04-01 18:27 incoming Andrew Morton 2022-04-01 18:20 incoming Andrew Morton 2022-04-01 18:27 ` incoming Andrew Morton 2022-03-25 1:07 incoming Andrew Morton 2022-03-23 23:04 incoming Andrew Morton 2022-03-22 21:38 incoming Andrew Morton 2022-03-16 23:14 incoming Andrew Morton 2022-03-05 4:28 incoming Andrew Morton 2022-02-26 3:10 incoming Andrew Morton 2022-02-12 0:27 incoming Andrew Morton 2022-02-12 2:02 ` incoming Linus Torvalds 2022-02-12 5:24 ` incoming Andrew Morton 2022-02-04 4:48 incoming Andrew Morton 2022-01-29 21:40 incoming Andrew Morton 2022-01-29 2:13 incoming Andrew Morton 2022-01-29 4:25 ` incoming Matthew Wilcox 2022-01-29 6:23 ` incoming Andrew Morton 2022-01-22 6:10 incoming Andrew Morton 2022-01-20 2:07 incoming Andrew Morton 2022-01-14 22:02 incoming Andrew Morton 2021-12-31 4:12 incoming Andrew Morton 2021-12-25 5:11 incoming Andrew Morton 2021-12-10 22:45 incoming Andrew Morton 2021-11-20 0:42 incoming Andrew Morton 2021-11-11 4:32 incoming Andrew Morton 2021-11-09 2:30 incoming Andrew Morton 2021-11-05 20:34 incoming Andrew Morton 2021-10-28 21:35 incoming Andrew Morton 2021-10-18 22:14 incoming Andrew Morton 2021-09-24 22:42 incoming Andrew Morton 2021-09-10 3:09 incoming Andrew Morton 2021-09-10 17:11 ` incoming Kees Cook 2021-09-10 20:13 ` incoming Kees Cook 2021-09-09 1:08 incoming Andrew Morton 2021-09-08 22:17 incoming Andrew Morton 2021-09-08 2:52 incoming Andrew Morton 2021-09-08 8:57 ` incoming Vlastimil Babka 2021-09-02 21:48 incoming Andrew Morton 2021-09-02 21:49 ` incoming Andrew Morton 2021-08-25 19:17 incoming Andrew Morton 2021-08-20 2:03 incoming Andrew Morton 2021-08-13 23:53 incoming Andrew Morton 2021-07-29 21:52 incoming Andrew Morton 2021-07-23 22:49 incoming Andrew Morton 2021-07-15 4:26 incoming Andrew Morton 2021-07-08 0:59 incoming Andrew Morton 2021-07-01 1:46 incoming Andrew Morton 2021-07-03 0:28 ` incoming Linus Torvalds 2021-07-03 1:06 ` incoming Linus Torvalds 2021-06-29 2:32 incoming Andrew Morton 2021-06-25 1:38 incoming Andrew Morton 2021-06-16 1:22 incoming Andrew Morton 2021-06-05 3:00 incoming Andrew Morton 2021-05-23 0:41 incoming Andrew Morton 2021-05-15 0:26 incoming Andrew Morton 2021-05-07 1:01 incoming Andrew Morton 2021-05-07 7:12 ` incoming Linus Torvalds 2021-04-30 5:52 incoming Andrew Morton 2021-04-23 21:28 incoming Andrew Morton 2021-04-16 22:45 incoming Andrew Morton 2021-04-09 20:26 incoming Andrew Morton 2021-03-25 4:36 incoming Andrew Morton 2021-03-13 5:06 incoming Andrew Morton 2021-02-26 1:14 incoming Andrew Morton 2021-02-26 17:55 ` incoming Linus Torvalds 2021-02-26 19:16 ` incoming Andrew Morton 2021-02-24 19:58 incoming Andrew Morton 2021-02-24 21:30 ` incoming Linus Torvalds 2021-02-24 21:37 ` incoming Linus Torvalds 2021-02-25 8:53 ` incoming Arnd Bergmann 2021-02-25 9:12 ` incoming Andrey Ryabinin 2021-02-25 11:07 ` incoming Walter Wu 2021-02-13 4:52 incoming Andrew Morton 2021-02-09 21:41 incoming Andrew Morton 2021-02-10 19:30 ` incoming Linus Torvalds 2021-02-05 2:31 incoming Andrew Morton 2021-01-24 5:00 incoming Andrew Morton 2021-01-12 23:48 incoming Andrew Morton 2021-01-15 23:32 ` incoming Linus Torvalds 2020-12-29 23:13 incoming Andrew Morton 2020-12-22 19:58 incoming Andrew Morton 2020-12-22 21:43 ` incoming Linus Torvalds 2020-12-18 22:00 incoming Andrew Morton 2020-12-16 4:41 incoming Andrew Morton 2020-12-15 20:32 incoming Andrew Morton 2020-12-15 21:00 ` incoming Linus Torvalds 2020-12-15 22:48 ` incoming Linus Torvalds 2020-12-15 22:49 ` incoming Linus Torvalds 2020-12-15 22:55 ` incoming Andrew Morton 2020-12-15 3:02 incoming Andrew Morton 2020-12-15 3:25 ` incoming Linus Torvalds 2020-12-15 3:30 ` incoming Linus Torvalds 2020-12-15 14:04 ` incoming Konstantin Ryabitsev 2020-12-11 21:35 incoming Andrew Morton 2020-12-06 6:14 incoming Andrew Morton 2020-11-22 6:16 incoming Andrew Morton 2020-11-14 6:51 incoming Andrew Morton 2020-11-02 1:06 incoming Andrew Morton 2020-10-17 23:13 incoming Andrew Morton 2020-10-16 2:40 incoming Andrew Morton 2020-10-16 3:03 ` incoming Andrew Morton 2020-10-13 23:46 incoming Andrew Morton 2020-10-11 6:15 incoming Andrew Morton 2020-10-03 5:20 incoming Andrew Morton 2020-09-26 4:17 incoming Andrew Morton 2020-09-19 4:19 incoming Andrew Morton 2020-09-04 23:34 incoming Andrew Morton 2020-08-21 0:41 incoming Andrew Morton 2020-08-15 0:29 incoming Andrew Morton 2020-08-12 1:29 incoming Andrew Morton 2020-08-07 6:16 incoming Andrew Morton 2020-07-24 4:14 incoming Andrew Morton 2020-07-03 22:14 incoming Andrew Morton 2020-06-26 3:28 incoming Andrew Morton 2020-06-26 6:51 ` incoming Linus Torvalds 2020-06-26 7:31 ` incoming Linus Torvalds 2020-06-26 17:39 ` incoming Konstantin Ryabitsev 2020-06-26 17:40 ` incoming Konstantin Ryabitsev 2020-06-12 0:30 incoming Andrew Morton 2020-06-11 1:40 incoming Andrew Morton 2020-06-09 4:29 incoming Andrew Morton 2020-06-09 16:58 ` incoming Linus Torvalds 2020-06-08 4:35 incoming Andrew Morton 2020-06-04 23:45 incoming Andrew Morton 2020-06-03 22:55 incoming Andrew Morton 2020-06-02 20:09 incoming Andrew Morton 2020-06-02 4:44 incoming Andrew Morton 2020-06-02 20:08 ` incoming Andrew Morton 2020-06-02 20:45 ` incoming Linus Torvalds 2020-06-02 21:38 ` incoming Andrew Morton 2020-06-02 22:18 ` incoming Linus Torvalds 2020-05-28 5:20 incoming Andrew Morton 2020-05-28 20:10 ` incoming Linus Torvalds 2020-05-29 20:31 ` incoming Andrew Morton 2020-05-29 20:38 ` incoming Linus Torvalds 2020-05-29 21:12 ` incoming Andrew Morton 2020-05-29 21:20 ` incoming Linus Torvalds 2020-05-23 5:22 incoming Andrew Morton 2020-05-14 0:50 incoming Andrew Morton 2020-05-08 1:35 incoming Andrew Morton 2020-04-21 1:13 incoming Andrew Morton 2020-04-12 7:41 incoming Andrew Morton 2020-04-10 21:30 incoming Andrew Morton 2020-04-07 3:02 incoming Andrew Morton 2020-04-02 4:01 incoming Andrew Morton 2020-03-29 2:14 incoming Andrew Morton 2020-03-22 1:19 incoming Andrew Morton 2020-03-06 6:27 incoming Andrew Morton 2020-02-21 4:00 incoming Andrew Morton 2020-02-21 4:03 ` incoming Andrew Morton 2020-02-21 18:21 ` incoming Linus Torvalds 2020-02-21 18:32 ` incoming Konstantin Ryabitsev 2020-02-27 9:59 ` incoming Vlastimil Babka 2020-02-21 19:33 ` incoming Linus Torvalds 2020-02-04 1:33 incoming Andrew Morton 2020-02-04 2:27 ` incoming Linus Torvalds 2020-02-04 2:46 ` incoming Andrew Morton 2020-02-04 3:11 ` incoming Linus Torvalds 2020-01-31 6:10 incoming Andrew Morton 2020-01-14 0:28 incoming Andrew Morton 2020-01-04 20:55 incoming Andrew Morton 2019-12-18 4:50 incoming Andrew Morton 2019-12-05 0:48 incoming Andrew Morton 2019-12-01 1:47 incoming Andrew Morton 2019-12-01 5:17 ` incoming James Bottomley 2019-12-01 21:07 ` incoming Linus Torvalds 2019-12-02 8:21 ` incoming Steven Price 2019-11-22 1:53 incoming Andrew Morton 2019-11-16 1:34 incoming Andrew Morton 2019-11-06 5:16 incoming Andrew Morton 2019-10-19 3:19 incoming Andrew Morton 2019-10-14 21:11 incoming Andrew Morton 2019-10-07 0:57 incoming Andrew Morton 2019-09-25 23:45 incoming Andrew Morton 2019-09-23 22:31 incoming Andrew Morton 2019-09-24 0:55 ` incoming Linus Torvalds 2019-09-24 4:31 ` incoming Andrew Morton 2019-09-24 7:48 ` incoming Michal Hocko 2019-09-24 15:34 ` incoming Linus Torvalds 2019-09-25 6:36 ` incoming Michal Hocko 2019-09-24 19:55 ` incoming Vlastimil Babka 2019-08-30 23:04 incoming Andrew Morton 2019-08-25 0:54 incoming Andrew Morton [not found] <20190716162536.bb52b8f34a8ecf5331a86a42@linux-foundation.org> 2019-07-17 8:47 ` incoming Vlastimil Babka 2019-07-17 8:57 ` incoming Bhaskar Chowdhury 2019-07-17 16:13 ` incoming Linus Torvalds 2019-07-17 17:09 ` incoming Christian Brauner 2019-07-17 18:13 ` incoming Vlastimil Babka 2007-05-02 22:02 incoming Andrew Morton 2007-05-02 22:31 ` incoming Benjamin Herrenschmidt 2007-05-03 7:55 ` incoming Russell King 2007-05-03 8:05 ` incoming Andrew Morton 2007-05-04 13:37 ` incoming Greg KH 2007-05-04 16:14 ` incoming Andrew Morton 2007-05-04 17:02 ` incoming Greg KH 2007-05-04 18:57 ` incoming Roland McGrath 2007-05-04 19:24 ` incoming Greg KH 2007-05-04 19:29 ` incoming Roland McGrath
This is a public inbox, see mirroring instructions for how to clone and mirror all data and code used for this inbox; as well as URLs for NNTP newsgroup(s).