linux-mm.kvack.org archive mirror
 help / color / mirror / Atom feed
* incoming
@ 2021-05-05  1:32 Andrew Morton
  2021-05-05  1:32 ` [patch 001/143] mm: introduce and use mapping_empty() Andrew Morton
                   ` (140 more replies)
  0 siblings, 141 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:32 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


The remainder of the main mm/ queue.

143 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus
previously sent patches.

Subsystems affected by this patch series:

  mm/pagecache
  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/compaction
  mm/migration
  mm/cma
  mm/ksm
  mm/vmstat
  mm/mmap
  mm/kconfig
  mm/util
  mm/memory-hotplug
  mm/zswap
  mm/zsmalloc
  mm/highmem
  mm/cleanups
  mm/kfence

Subsystem: mm/pagecache

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Remove nrexceptional tracking", v2:
      mm: introduce and use mapping_empty()
      mm: stop accounting shadow entries
      dax: account DAX entries as nrpages
      mm: remove nrexceptional from inode

    Hugh Dickins <hughd@google.com>:
      mm: remove nrexceptional from inode: remove BUG_ON

Subsystem: mm/hugetlb

    Peter Xu <peterx@redhat.com>:
    Patch series "hugetlb: Disable huge pmd unshare for uffd-wp", v4:
      hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share()
      hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled
      mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h
      hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: remove redundant reservation check condition in alloc_huge_page()

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm: generalize HUGETLB_PAGE_SIZE_VARIABLE

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Some cleanups for hugetlb":
      mm/hugetlb: use some helper functions to cleanup code
      mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state()
      mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate()
      mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page()
      mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case
    Patch series "Cleanup and fixup for khugepaged", v2:
      khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps()
      khugepaged: reuse the smp_wmb() inside __SetPageUptodate()
      khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter()
      khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate()
      mm/huge_memory.c: remove unnecessary local variable ret2
    Patch series "Some cleanups for huge_memory", v3:
      mm/huge_memory.c: rework the function vma_adjust_trans_huge()
      mm/huge_memory.c: make get_huge_zero_page() return bool
      mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly
      mm/huge_memory.c: remove redundant PageCompound() check
      mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG
      mm/huge_memory.c: use helper function migration_entry_to_page()

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup for khugepaged":
      khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp()
      khugepaged: remove unnecessary out label in collapse_huge_page()
      khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd()

    Zi Yan <ziy@nvidia.com>:
      mm: huge_memory: a new debugfs interface for splitting THP tests
      mm: huge_memory: debugfs for file-backed THP split

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for hugetlb", v2:
      mm/hugeltb: remove redundant VM_BUG_ON() in region_add()
      mm/hugeltb: simplify the return code of __vma_reservation_common()
      mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages()
      mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts()
      mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages()

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "make hugetlb put_page safe for all calling contexts", v5:
      mm/cma: change cma mutex to irq safe spinlock
      hugetlb: no need to drop hugetlb_lock to call cma_release
      hugetlb: add per-hstate mutex to synchronize user adjustments
      hugetlb: create remove_hugetlb_page() to separate functionality
      hugetlb: call update_and_free_page without hugetlb_lock
      hugetlb: change free_pool_huge_page to remove_pool_huge_page
      hugetlb: make free_huge_page irq safe
      hugetlb: add lockdep_assert_held() calls for hugetlb_lock

    Oscar Salvador <osalvador@suse.de>:
    Patch series "Make alloc_contig_range handle Hugetlb pages", v10:
      mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range
      mm,compaction: let isolate_migratepages_{range,block} return error codes
      mm,hugetlb: drop clearing of flag from prep_new_huge_page
      mm,hugetlb: split prep_new_huge_page functionality
      mm: make alloc_contig_range handle free hugetlb pages
      mm: make alloc_contig_range handle in-use hugetlb pages
      mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig

Subsystem: mm/userfaultfd

    Axel Rasmussen <axelrasmussen@google.com>:
    Patch series "userfaultfd: add minor fault handling", v9:
      userfaultfd: add minor fault registration mode
      userfaultfd: disable huge PMD sharing for MINOR registered VMAs
      userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled
      userfaultfd: add UFFDIO_CONTINUE ioctl
      userfaultfd: update documentation to describe minor fault handling
      userfaultfd/selftests: add test exercising minor fault handling

Subsystem: mm/vmscan

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: move RECLAIM* bits to uapi header
      mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks

    Yang Shi <shy828301@gmail.com>:
    Patch series "Make shrinker's nr_deferred memcg aware", v10:
      mm: vmscan: use nid from shrink_control for tracepoint
      mm: vmscan: consolidate shrinker_maps handling code
      mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation
      mm: vmscan: remove memcg_shrinker_map_size
      mm: vmscan: use kvfree_rcu instead of call_rcu
      mm: memcontrol: rename shrinker_map to shrinker_info
      mm: vmscan: add shrinker_info_protected() helper
      mm: vmscan: use a new flag to indicate shrinker is registered
      mm: vmscan: add per memcg shrinker nr_deferred
      mm: vmscan: use per memcg nr_deferred of shrinker
      mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers
      mm: memcontrol: reparent nr_deferred when memcg offline
      mm: vmscan: shrink deferred objects proportional to priority

Subsystem: mm/compaction

    Pintu Kumar <pintu@codeaurora.org>:
      mm/compaction: remove unused variable sysctl_compact_memory

    Charan Teja Reddy <charante@codeaurora.org>:
      mm: compaction: update the COMPACT[STALL|FAIL] events properly

Subsystem: mm/migration

    Minchan Kim <minchan@kernel.org>:
      mm: disable LRU pagevec during the migration temporarily
      mm: replace migrate_[prep|finish] with lru_cache_[disable|enable]
      mm: fs: invalidate BH LRU during page migration

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for mm/migrate.c", v3:
      mm/migrate.c: make putback_movable_page() static
      mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case
      mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page()
      mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole()
      Revert "mm: migrate: skip shared exec THP for NUMA balancing"

Subsystem: mm/cma

    Minchan Kim <minchan@kernel.org>:
      mm: vmstat: add cma statistics

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: cma: use pr_err_ratelimited for CMA warning

    Liam Mark <lmark@codeaurora.org>:
      mm: cma: add trace events for CMA alloc perf testing

    Minchan Kim <minchan@kernel.org>:
      mm: cma: support sysfs
      mm: cma: add the CMA instance name to cma trace events
      mm: use proper type for cma_[alloc|release]

Subsystem: mm/ksm

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for ksm":
      ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search()
      ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()
      ksm: remove dedicated macro KSM_FLAG_MASK
      ksm: fix potential missing rmap_item for stable_node

    Chengyang Fan <cy.fan@huawei.com>:
      mm/ksm: remove unused parameter from remove_trailing_rmap_items()

Subsystem: mm/vmstat

    Hugh Dickins <hughd@google.com>:
      mm: restore node stat checking in /proc/sys/vm/stat_refresh
      mm: no more EINVAL from /proc/sys/vm/stat_refresh
      mm: /proc/sys/vm/stat_refresh skip checking known negative stats
      mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats

    Saravanan D <saravanand@fb.com>:
      x86/mm: track linear mapping split events

Subsystem: mm/mmap

    Liam Howlett <liam.howlett@oracle.com>:
      mm/mmap.c: don't unlock VMAs in remap_file_pages()

Subsystem: mm/kconfig

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm: some config cleanups", v2:
      mm: generalize ARCH_HAS_CACHE_LINE_SIZE
      mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
      mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE]
      mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION
      mm: drop redundant ARCH_ENABLE_SPLIT_PMD_PTLOCK
      mm: drop redundant HAVE_ARCH_TRANSPARENT_HUGEPAGE

Subsystem: mm/util

    Joe Perches <joe@perches.com>:
      mm/util.c: reduce mem_dump_obj() object size

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      mm/util.c: fix typo

Subsystem: mm/memory-hotplug

    Pavel Tatashin <pasha.tatashin@soleen.com>:
    Patch series "prohibit pinning pages in ZONE_MOVABLE", v11:
      mm/gup: don't pin migrated cma pages in movable zone
      mm/gup: check every subpage of a compound page during isolation
      mm/gup: return an error on migration failure
      mm/gup: check for isolation errors
      mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN
      mm: apply per-task gfp constraints in fast path
      mm: honor PF_MEMALLOC_PIN for all movable pages
      mm/gup: do not migrate zero page
      mm/gup: migrate pinned pages out of movable zone
      memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning
      mm/gup: change index type to long as it counts pages
      mm/gup: longterm pin migration cleanup
      selftests/vm: gup_test: fix test flag
      selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages

    Mel Gorman <mgorman@techsingularity.net>:
      mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove

    Oscar Salvador <osalvador@suse.de>:
    Patch series "Allocate memmap from hotadded memory (per device)", v10:
      drivers/base/memory: introduce memory_block_{online,offline}
      mm,memory_hotplug: relax fully spanned sections check

    David Hildenbrand <david@redhat.com>:
      mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count()

    Oscar Salvador <osalvador@suse.de>:
      mm,memory_hotplug: allocate memmap from the added memory range
      acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported
      mm,memory_hotplug: add kernel boot option to enable memmap_on_memory
      x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
      arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE

Subsystem: mm/zswap

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/zswap.c: switch from strlcpy to strscpy

Subsystem: mm/zsmalloc

    zhouchuangao <zhouchuangao@vivo.com>:
      mm/zsmalloc: use BUG_ON instead of if condition followed by BUG.

Subsystem: mm/highmem

    Ira Weiny <ira.weiny@intel.com>:
    Patch series "btrfs: Convert kmap/memset/kunmap to memzero_user()":
      iov_iter: lift memzero_page() to highmem.h
      btrfs: use memzero_page() instead of open coded kmap pattern

    songqiang <songqiang@uniontech.com>:
      mm/highmem.c: fix coding style issue

Subsystem: mm/cleanups

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/mempool: minor coding style tweaks

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      mm/process_vm_access.c: remove duplicate include

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: zero guard page after out-of-bounds access
    Patch series "kfence: optimize timer scheduling", v2:
      kfence: await for allocation using wait_event
      kfence: maximize allocation wait timeout duration
      kfence: use power-efficient work queue to run delayed work

 Documentation/ABI/testing/sysfs-kernel-mm-cma     |   25 
 Documentation/admin-guide/kernel-parameters.txt   |   17 
 Documentation/admin-guide/mm/memory-hotplug.rst   |    9 
 Documentation/admin-guide/mm/userfaultfd.rst      |  105 +-
 arch/arc/Kconfig                                  |    9 
 arch/arm/Kconfig                                  |   10 
 arch/arm64/Kconfig                                |   34 
 arch/arm64/mm/hugetlbpage.c                       |    7 
 arch/ia64/Kconfig                                 |   14 
 arch/ia64/mm/hugetlbpage.c                        |    3 
 arch/mips/Kconfig                                 |    6 
 arch/mips/mm/hugetlbpage.c                        |    4 
 arch/parisc/Kconfig                               |    5 
 arch/parisc/mm/hugetlbpage.c                      |    2 
 arch/powerpc/Kconfig                              |   17 
 arch/powerpc/mm/hugetlbpage.c                     |    3 
 arch/powerpc/platforms/Kconfig.cputype            |   16 
 arch/riscv/Kconfig                                |    5 
 arch/s390/Kconfig                                 |   12 
 arch/s390/mm/hugetlbpage.c                        |    2 
 arch/sh/Kconfig                                   |    7 
 arch/sh/mm/Kconfig                                |    8 
 arch/sh/mm/hugetlbpage.c                          |    2 
 arch/sparc/mm/hugetlbpage.c                       |    2 
 arch/x86/Kconfig                                  |   33 
 arch/x86/mm/pat/set_memory.c                      |    8 
 drivers/acpi/acpi_memhotplug.c                    |    5 
 drivers/base/memory.c                             |  105 ++
 fs/Kconfig                                        |    5 
 fs/block_dev.c                                    |    2 
 fs/btrfs/compression.c                            |    5 
 fs/btrfs/extent_io.c                              |   22 
 fs/btrfs/inode.c                                  |   33 
 fs/btrfs/reflink.c                                |    6 
 fs/btrfs/zlib.c                                   |    5 
 fs/btrfs/zstd.c                                   |    5 
 fs/buffer.c                                       |   36 
 fs/dax.c                                          |    8 
 fs/gfs2/glock.c                                   |    3 
 fs/hugetlbfs/inode.c                              |    9 
 fs/inode.c                                        |   11 
 fs/proc/task_mmu.c                                |    3 
 fs/userfaultfd.c                                  |  149 +++
 include/linux/buffer_head.h                       |    4 
 include/linux/cma.h                               |    4 
 include/linux/compaction.h                        |    1 
 include/linux/fs.h                                |    2 
 include/linux/gfp.h                               |    2 
 include/linux/highmem.h                           |    7 
 include/linux/huge_mm.h                           |    3 
 include/linux/hugetlb.h                           |   37 
 include/linux/memcontrol.h                        |   27 
 include/linux/memory.h                            |    8 
 include/linux/memory_hotplug.h                    |   15 
 include/linux/memremap.h                          |    2 
 include/linux/migrate.h                           |   11 
 include/linux/mm.h                                |   28 
 include/linux/mmzone.h                            |   20 
 include/linux/pagemap.h                           |    5 
 include/linux/pgtable.h                           |   12 
 include/linux/sched.h                             |    2 
 include/linux/sched/mm.h                          |   27 
 include/linux/shrinker.h                          |    7 
 include/linux/swap.h                              |   21 
 include/linux/userfaultfd_k.h                     |   55 +
 include/linux/vm_event_item.h                     |    8 
 include/trace/events/cma.h                        |   92 +-
 include/trace/events/migrate.h                    |   25 
 include/trace/events/mmflags.h                    |    7 
 include/uapi/linux/mempolicy.h                    |    7 
 include/uapi/linux/userfaultfd.h                  |   36 
 init/Kconfig                                      |    5 
 kernel/sysctl.c                                   |    2 
 lib/Kconfig.kfence                                |    1 
 lib/iov_iter.c                                    |    8 
 mm/Kconfig                                        |   28 
 mm/Makefile                                       |    6 
 mm/cma.c                                          |   70 +
 mm/cma.h                                          |   25 
 mm/cma_debug.c                                    |    8 
 mm/cma_sysfs.c                                    |  112 ++
 mm/compaction.c                                   |  113 ++
 mm/filemap.c                                      |   24 
 mm/frontswap.c                                    |   12 
 mm/gup.c                                          |  264 +++---
 mm/gup_test.c                                     |   29 
 mm/gup_test.h                                     |    3 
 mm/highmem.c                                      |   11 
 mm/huge_memory.c                                  |  326 +++++++-
 mm/hugetlb.c                                      |  843 ++++++++++++++--------
 mm/hugetlb_cgroup.c                               |    9 
 mm/internal.h                                     |   10 
 mm/kfence/core.c                                  |   61 +
 mm/khugepaged.c                                   |   63 -
 mm/ksm.c                                          |   17 
 mm/list_lru.c                                     |    6 
 mm/memcontrol.c                                   |  137 ---
 mm/memory_hotplug.c                               |  220 +++++
 mm/mempolicy.c                                    |   16 
 mm/mempool.c                                      |    2 
 mm/migrate.c                                      |  103 --
 mm/mlock.c                                        |    4 
 mm/mmap.c                                         |   18 
 mm/oom_kill.c                                     |    2 
 mm/page_alloc.c                                   |   83 +-
 mm/process_vm_access.c                            |    1 
 mm/shmem.c                                        |    2 
 mm/sparse.c                                       |    4 
 mm/swap.c                                         |   69 +
 mm/swap_state.c                                   |    4 
 mm/swapfile.c                                     |    4 
 mm/truncate.c                                     |   19 
 mm/userfaultfd.c                                  |   39 -
 mm/util.c                                         |   26 
 mm/vmalloc.c                                      |    2 
 mm/vmscan.c                                       |  543 +++++++++-----
 mm/vmstat.c                                       |   45 -
 mm/workingset.c                                   |    1 
 mm/zsmalloc.c                                     |    6 
 mm/zswap.c                                        |    2 
 tools/testing/selftests/vm/.gitignore             |    1 
 tools/testing/selftests/vm/Makefile               |    1 
 tools/testing/selftests/vm/gup_test.c             |   38 
 tools/testing/selftests/vm/split_huge_page_test.c |  400 ++++++++++
 tools/testing/selftests/vm/userfaultfd.c          |  164 ++++
 125 files changed, 3596 insertions(+), 1668 deletions(-)



^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 001/143] mm: introduce and use mapping_empty()
  2021-05-05  1:32 incoming Andrew Morton
@ 2021-05-05  1:32 ` Andrew Morton
  2021-05-05  1:32 ` [patch 002/143] mm: stop accounting shadow entries Andrew Morton
                   ` (139 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:32 UTC (permalink / raw)
  To: akpm, hannes, linux-mm, mm-commits, torvalds, vishal.l.verma,
	willy

From: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Subject: mm: introduce and use mapping_empty()

Patch series "Remove nrexceptional tracking", v2.

We actually use nrexceptional for very little these days.  It's a minor
pain to keep in sync with nrpages, but the pain becomes much bigger with
the THP patches because we don't know how many indices a shadow entry
occupies.  It's easier to just remove it than keep it accurate.

Also, we save 8 bytes per inode which is nothing to sneeze at; on my
laptop, it would improve shmem_inode_cache from 22 to 23 objects per
16kB, and inode_cache from 26 to 27 objects.  Combined, that saves
a megabyte of memory from a combined usage of 25MB for both caches.
Unfortunately, ext4 doesn't cross a magic boundary, so it doesn't save
any memory for ext4.


This patch (of 4):

Instead of checking the two counters (nrpages and nrexceptional), we can
just check whether i_pages is empty.

Link: https://lkml.kernel.org/r/20201026151849.24232-1-willy@infradead.org
Link: https://lkml.kernel.org/r/20201026151849.24232-2-willy@infradead.org
Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Tested-by: Vishal Verma <vishal.l.verma@intel.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 fs/block_dev.c          |    2 +-
 fs/dax.c                |    2 +-
 fs/gfs2/glock.c         |    3 +--
 include/linux/pagemap.h |    5 +++++
 mm/truncate.c           |   18 +++---------------
 5 files changed, 11 insertions(+), 19 deletions(-)

--- a/fs/block_dev.c~mm-introduce-and-use-mapping_empty
+++ a/fs/block_dev.c
@@ -79,7 +79,7 @@ static void kill_bdev(struct block_devic
 {
 	struct address_space *mapping = bdev->bd_inode->i_mapping;
 
-	if (mapping->nrpages == 0 && mapping->nrexceptional == 0)
+	if (mapping_empty(mapping))
 		return;
 
 	invalidate_bh_lrus();
--- a/fs/dax.c~mm-introduce-and-use-mapping_empty
+++ a/fs/dax.c
@@ -965,7 +965,7 @@ int dax_writeback_mapping_range(struct a
 	if (WARN_ON_ONCE(inode->i_blkbits != PAGE_SHIFT))
 		return -EIO;
 
-	if (!mapping->nrexceptional || wbc->sync_mode != WB_SYNC_ALL)
+	if (mapping_empty(mapping) || wbc->sync_mode != WB_SYNC_ALL)
 		return 0;
 
 	trace_dax_writeback_range(inode, xas.xa_index, end_index);
--- a/fs/gfs2/glock.c~mm-introduce-and-use-mapping_empty
+++ a/fs/gfs2/glock.c
@@ -273,8 +273,7 @@ static void __gfs2_glock_put(struct gfs2
 	if (mapping) {
 		truncate_inode_pages_final(mapping);
 		if (!gfs2_withdrawn(sdp))
-			GLOCK_BUG_ON(gl, mapping->nrpages ||
-				     mapping->nrexceptional);
+			GLOCK_BUG_ON(gl, !mapping_empty(mapping));
 	}
 	trace_gfs2_glock_put(gl);
 	sdp->sd_lockstruct.ls_ops->lm_put_lock(gl);
--- a/include/linux/pagemap.h~mm-introduce-and-use-mapping_empty
+++ a/include/linux/pagemap.h
@@ -18,6 +18,11 @@
 
 struct pagevec;
 
+static inline bool mapping_empty(struct address_space *mapping)
+{
+	return xa_empty(&mapping->i_pages);
+}
+
 /*
  * Bits in mapping->flags.
  */
--- a/mm/truncate.c~mm-introduce-and-use-mapping_empty
+++ a/mm/truncate.c
@@ -295,7 +295,7 @@ void truncate_inode_pages_range(struct a
 	pgoff_t		index;
 	int		i;
 
-	if (mapping->nrpages == 0 && mapping->nrexceptional == 0)
+	if (mapping_empty(mapping))
 		goto out;
 
 	/* Offsets within partial pages */
@@ -440,9 +440,6 @@ EXPORT_SYMBOL(truncate_inode_pages);
  */
 void truncate_inode_pages_final(struct address_space *mapping)
 {
-	unsigned long nrexceptional;
-	unsigned long nrpages;
-
 	/*
 	 * Page reclaim can not participate in regular inode lifetime
 	 * management (can't call iput()) and thus can race with the
@@ -452,16 +449,7 @@ void truncate_inode_pages_final(struct a
 	 */
 	mapping_set_exiting(mapping);
 
-	/*
-	 * When reclaim installs eviction entries, it increases
-	 * nrexceptional first, then decreases nrpages.  Make sure we see
-	 * this in the right order or we might miss an entry.
-	 */
-	nrpages = mapping->nrpages;
-	smp_rmb();
-	nrexceptional = mapping->nrexceptional;
-
-	if (nrpages || nrexceptional) {
+	if (!mapping_empty(mapping)) {
 		/*
 		 * As truncation uses a lockless tree lookup, cycle
 		 * the tree lock to make sure any ongoing tree
@@ -633,7 +621,7 @@ int invalidate_inode_pages2_range(struct
 	int ret2 = 0;
 	int did_range_unmap = 0;
 
-	if (mapping->nrpages == 0 && mapping->nrexceptional == 0)
+	if (mapping_empty(mapping))
 		goto out;
 
 	pagevec_init(&pvec);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 002/143] mm: stop accounting shadow entries
  2021-05-05  1:32 incoming Andrew Morton
  2021-05-05  1:32 ` [patch 001/143] mm: introduce and use mapping_empty() Andrew Morton
@ 2021-05-05  1:32 ` Andrew Morton
  2021-05-05  1:32 ` [patch 003/143] dax: account DAX entries as nrpages Andrew Morton
                   ` (138 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:32 UTC (permalink / raw)
  To: akpm, hannes, linux-mm, mm-commits, torvalds, vishal.l.verma,
	willy

From: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Subject: mm: stop accounting shadow entries

We no longer need to keep track of how many shadow entries are present in
a mapping.  This saves a few writes to the inode and memory barriers.

Link: https://lkml.kernel.org/r/20201026151849.24232-3-willy@infradead.org
Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Tested-by: Vishal Verma <vishal.l.verma@intel.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/filemap.c    |   13 -------------
 mm/swap_state.c |    4 ----
 mm/truncate.c   |    1 -
 mm/workingset.c |    1 -
 4 files changed, 19 deletions(-)

--- a/mm/filemap.c~mm-stop-accounting-shadow-entries
+++ a/mm/filemap.c
@@ -142,17 +142,6 @@ static void page_cache_delete(struct add
 
 	page->mapping = NULL;
 	/* Leave page->index set: truncation lookup relies upon it */
-
-	if (shadow) {
-		mapping->nrexceptional += nr;
-		/*
-		 * Make sure the nrexceptional update is committed before
-		 * the nrpages update so that final truncate racing
-		 * with reclaim does not see both counters 0 at the
-		 * same time and miss a shadow entry.
-		 */
-		smp_wmb();
-	}
 	mapping->nrpages -= nr;
 }
 
@@ -925,8 +914,6 @@ noinline int __add_to_page_cache_locked(
 		if (xas_error(&xas))
 			goto unlock;
 
-		if (old)
-			mapping->nrexceptional--;
 		mapping->nrpages++;
 
 		/* hugetlb pages do not participate in page cache accounting */
--- a/mm/swap_state.c~mm-stop-accounting-shadow-entries
+++ a/mm/swap_state.c
@@ -132,7 +132,6 @@ int add_to_swap_cache(struct page *page,
 			xas_store(&xas, page);
 			xas_next(&xas);
 		}
-		address_space->nrexceptional -= nr_shadows;
 		address_space->nrpages += nr;
 		__mod_node_page_state(page_pgdat(page), NR_FILE_PAGES, nr);
 		__mod_lruvec_page_state(page, NR_SWAPCACHE, nr);
@@ -172,8 +171,6 @@ void __delete_from_swap_cache(struct pag
 		xas_next(&xas);
 	}
 	ClearPageSwapCache(page);
-	if (shadow)
-		address_space->nrexceptional += nr;
 	address_space->nrpages -= nr;
 	__mod_node_page_state(page_pgdat(page), NR_FILE_PAGES, -nr);
 	__mod_lruvec_page_state(page, NR_SWAPCACHE, -nr);
@@ -275,7 +272,6 @@ void clear_shadow_from_swap_cache(int ty
 			xas_store(&xas, NULL);
 			nr_shadows++;
 		}
-		address_space->nrexceptional -= nr_shadows;
 		xa_unlock_irq(&address_space->i_pages);
 
 		/* search the next swapcache until we meet end */
--- a/mm/truncate.c~mm-stop-accounting-shadow-entries
+++ a/mm/truncate.c
@@ -40,7 +40,6 @@ static inline void __clear_shadow_entry(
 	if (xas_load(&xas) != entry)
 		return;
 	xas_store(&xas, NULL);
-	mapping->nrexceptional--;
 }
 
 static void clear_shadow_entry(struct address_space *mapping, pgoff_t index,
--- a/mm/workingset.c~mm-stop-accounting-shadow-entries
+++ a/mm/workingset.c
@@ -554,7 +554,6 @@ static enum lru_status shadow_lru_isolat
 		goto out_invalid;
 	if (WARN_ON_ONCE(node->count != node->nr_values))
 		goto out_invalid;
-	mapping->nrexceptional -= node->nr_values;
 	xa_delete_node(node, workingset_update_node);
 	__inc_lruvec_kmem_state(node, WORKINGSET_NODERECLAIM);
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 003/143] dax: account DAX entries as nrpages
  2021-05-05  1:32 incoming Andrew Morton
  2021-05-05  1:32 ` [patch 001/143] mm: introduce and use mapping_empty() Andrew Morton
  2021-05-05  1:32 ` [patch 002/143] mm: stop accounting shadow entries Andrew Morton
@ 2021-05-05  1:32 ` Andrew Morton
  2021-05-05  1:32 ` [patch 004/143] mm: remove nrexceptional from inode Andrew Morton
                   ` (137 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:32 UTC (permalink / raw)
  To: akpm, hannes, linux-mm, mm-commits, torvalds, vishal.l.verma,
	willy

From: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Subject: dax: account DAX entries as nrpages

Simplify mapping_needs_writeback() by accounting DAX entries as pages
instead of exceptional entries.

Link: https://lkml.kernel.org/r/20201026151849.24232-4-willy@infradead.org
Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Tested-by: Vishal Verma <vishal.l.verma@intel.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 fs/dax.c     |    6 +++---
 mm/filemap.c |    3 ---
 2 files changed, 3 insertions(+), 6 deletions(-)

--- a/fs/dax.c~dax-account-dax-entries-as-nrpages
+++ a/fs/dax.c
@@ -525,7 +525,7 @@ retry:
 		dax_disassociate_entry(entry, mapping, false);
 		xas_store(xas, NULL);	/* undo the PMD join */
 		dax_wake_entry(xas, entry, true);
-		mapping->nrexceptional--;
+		mapping->nrpages -= PG_PMD_NR;
 		entry = NULL;
 		xas_set(xas, index);
 	}
@@ -541,7 +541,7 @@ retry:
 		dax_lock_entry(xas, entry);
 		if (xas_error(xas))
 			goto out_unlock;
-		mapping->nrexceptional++;
+		mapping->nrpages += 1UL << order;
 	}
 
 out_unlock:
@@ -661,7 +661,7 @@ static int __dax_invalidate_entry(struct
 		goto out;
 	dax_disassociate_entry(entry, mapping, trunc);
 	xas_store(&xas, NULL);
-	mapping->nrexceptional--;
+	mapping->nrpages -= 1UL << dax_entry_order(entry);
 	ret = 1;
 out:
 	put_unlocked_entry(&xas, entry);
--- a/mm/filemap.c~dax-account-dax-entries-as-nrpages
+++ a/mm/filemap.c
@@ -618,9 +618,6 @@ EXPORT_SYMBOL(filemap_fdatawait_keep_err
 /* Returns true if writeback might be needed or already in progress. */
 static bool mapping_needs_writeback(struct address_space *mapping)
 {
-	if (dax_mapping(mapping))
-		return mapping->nrexceptional;
-
 	return mapping->nrpages;
 }
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 004/143] mm: remove nrexceptional from inode
  2021-05-05  1:32 incoming Andrew Morton
                   ` (2 preceding siblings ...)
  2021-05-05  1:32 ` [patch 003/143] dax: account DAX entries as nrpages Andrew Morton
@ 2021-05-05  1:32 ` Andrew Morton
  2021-05-05  1:32 ` [patch 005/143] mm: remove nrexceptional from inode: remove BUG_ON Andrew Morton
                   ` (136 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:32 UTC (permalink / raw)
  To: akpm, hannes, linux-mm, mm-commits, torvalds, vishal.l.verma,
	willy

From: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Subject: mm: remove nrexceptional from inode

We no longer track anything in nrexceptional, so remove it, saving 8 bytes
per inode.

Link: https://lkml.kernel.org/r/20201026151849.24232-5-willy@infradead.org
Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Tested-by: Vishal Verma <vishal.l.verma@intel.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 fs/inode.c         |    2 +-
 include/linux/fs.h |    2 --
 2 files changed, 1 insertion(+), 3 deletions(-)

--- a/fs/inode.c~mm-remove-nrexceptional-from-inode
+++ a/fs/inode.c
@@ -529,7 +529,7 @@ void clear_inode(struct inode *inode)
 	 */
 	xa_lock_irq(&inode->i_data.i_pages);
 	BUG_ON(inode->i_data.nrpages);
-	BUG_ON(inode->i_data.nrexceptional);
+	BUG_ON(!mapping_empty(&inode->i_data));
 	xa_unlock_irq(&inode->i_data.i_pages);
 	BUG_ON(!list_empty(&inode->i_data.private_list));
 	BUG_ON(!(inode->i_state & I_FREEING));
--- a/include/linux/fs.h~mm-remove-nrexceptional-from-inode
+++ a/include/linux/fs.h
@@ -442,7 +442,6 @@ int pagecache_write_end(struct file *, s
  * @i_mmap: Tree of private and shared mappings.
  * @i_mmap_rwsem: Protects @i_mmap and @i_mmap_writable.
  * @nrpages: Number of page entries, protected by the i_pages lock.
- * @nrexceptional: Shadow or DAX entries, protected by the i_pages lock.
  * @writeback_index: Writeback starts here.
  * @a_ops: Methods.
  * @flags: Error bits and flags (AS_*).
@@ -463,7 +462,6 @@ struct address_space {
 	struct rb_root_cached	i_mmap;
 	struct rw_semaphore	i_mmap_rwsem;
 	unsigned long		nrpages;
-	unsigned long		nrexceptional;
 	pgoff_t			writeback_index;
 	const struct address_space_operations *a_ops;
 	unsigned long		flags;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 005/143] mm: remove nrexceptional from inode: remove BUG_ON
  2021-05-05  1:32 incoming Andrew Morton
                   ` (3 preceding siblings ...)
  2021-05-05  1:32 ` [patch 004/143] mm: remove nrexceptional from inode Andrew Morton
@ 2021-05-05  1:32 ` Andrew Morton
  2021-05-05  1:33 ` [patch 006/143] hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share() Andrew Morton
                   ` (135 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:32 UTC (permalink / raw)
  To: akpm, hughd, linux-mm, mm-commits, torvalds, willy

From: Hugh Dickins <hughd@google.com>
Subject: mm: remove nrexceptional from inode: remove BUG_ON

clear_inode()'s BUG_ON(!mapping_empty(&inode->i_data)) is unsafe: we know
of two ways in which nodes can and do (on rare occasions) get left behind.
Until those are fixed, do not BUG_ON() nor even WARN_ON().  Yes, this
will then leak those nodes (or the next user of the struct inode may use
them); but this has been happening for years, and the new
BUG_ON(!mapping_empty) was only guilty of revealing that.  A proper fix
will follow, but no hurry.

Link: https://lkml.kernel.org/r/alpine.LSU.2.11.2104292229380.16080@eggly.anvils
Signed-off-by: Hugh Dickins <hughd@google.com>
Cc: Matthew Wilcox <willy@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 fs/inode.c |    9 ++++++++-
 1 file changed, 8 insertions(+), 1 deletion(-)

--- a/fs/inode.c~mm-remove-nrexceptional-from-inode-remove-bug_on
+++ a/fs/inode.c
@@ -529,7 +529,14 @@ void clear_inode(struct inode *inode)
 	 */
 	xa_lock_irq(&inode->i_data.i_pages);
 	BUG_ON(inode->i_data.nrpages);
-	BUG_ON(!mapping_empty(&inode->i_data));
+	/*
+	 * Almost always, mapping_empty(&inode->i_data) here; but there are
+	 * two known and long-standing ways in which nodes may get left behind
+	 * (when deep radix-tree node allocation failed partway; or when THP
+	 * collapse_file() failed). Until those two known cases are cleaned up,
+	 * or a cleanup function is called here, do not BUG_ON(!mapping_empty),
+	 * nor even WARN_ON(!mapping_empty).
+	 */
 	xa_unlock_irq(&inode->i_data.i_pages);
 	BUG_ON(!list_empty(&inode->i_data.private_list));
 	BUG_ON(!(inode->i_state & I_FREEING));
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 006/143] hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (4 preceding siblings ...)
  2021-05-05  1:32 ` [patch 005/143] mm: remove nrexceptional from inode: remove BUG_ON Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 007/143] hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled Andrew Morton
                   ` (134 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
	axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
	dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
	mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
	peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
	steven.price, torvalds, vbabka, viro, walken, willy, ying.huang

From: Peter Xu <peterx@redhat.com>
Subject: hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share()

Patch series "hugetlb: Disable huge pmd unshare for uffd-wp", v4.

This series tries to disable huge pmd unshare of hugetlbfs backed memory
for uffd-wp.  Although uffd-wp of hugetlbfs is still during rfc stage, the
idea of this series may be needed for multiple tasks (Axel's uffd minor
fault series, and Mike's soft dirty series), so I picked it out from the
larger series.


This patch (of 4):

It is a preparation work to be able to behave differently in the per
architecture huge_pte_alloc() according to different VMA attributes.

Pass it deeper into huge_pmd_share() so that we can avoid the find_vma() call.

[peterx@redhat.com: build fix]
  Link: https://lkml.kernel.org/r/20210304164653.GB397383@xz-x1Link: https://lkml.kernel.org/r/20210218230633.15028-1-peterx@redhat.com
Link: https://lkml.kernel.org/r/20210218230633.15028-2-peterx@redhat.com
Signed-off-by: Peter Xu <peterx@redhat.com>
Suggested-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Axel Rasmussen <axelrasmussen@google.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/arm64/mm/hugetlbpage.c   |    4 ++--
 arch/ia64/mm/hugetlbpage.c    |    3 ++-
 arch/mips/mm/hugetlbpage.c    |    4 ++--
 arch/parisc/mm/hugetlbpage.c  |    2 +-
 arch/powerpc/mm/hugetlbpage.c |    3 ++-
 arch/s390/mm/hugetlbpage.c    |    2 +-
 arch/sh/mm/hugetlbpage.c      |    2 +-
 arch/sparc/mm/hugetlbpage.c   |    2 +-
 include/linux/hugetlb.h       |    5 +++--
 mm/hugetlb.c                  |   15 ++++++++-------
 mm/userfaultfd.c              |    2 +-
 11 files changed, 24 insertions(+), 20 deletions(-)

--- a/arch/arm64/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/arm64/mm/hugetlbpage.c
@@ -252,7 +252,7 @@ void set_huge_swap_pte_at(struct mm_stru
 		set_pte(ptep, pte);
 }
 
-pte_t *huge_pte_alloc(struct mm_struct *mm,
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
 		      unsigned long addr, unsigned long sz)
 {
 	pgd_t *pgdp;
@@ -286,7 +286,7 @@ pte_t *huge_pte_alloc(struct mm_struct *
 	} else if (sz == PMD_SIZE) {
 		if (IS_ENABLED(CONFIG_ARCH_WANT_HUGE_PMD_SHARE) &&
 		    pud_none(READ_ONCE(*pudp)))
-			ptep = huge_pmd_share(mm, addr, pudp);
+			ptep = huge_pmd_share(mm, vma, addr, pudp);
 		else
 			ptep = (pte_t *)pmd_alloc(mm, pudp, addr);
 	} else if (sz == (CONT_PMD_SIZE)) {
--- a/arch/ia64/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/ia64/mm/hugetlbpage.c
@@ -25,7 +25,8 @@ unsigned int hpage_shift = HPAGE_SHIFT_D
 EXPORT_SYMBOL(hpage_shift);
 
 pte_t *
-huge_pte_alloc(struct mm_struct *mm, unsigned long addr, unsigned long sz)
+huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
+	       unsigned long addr, unsigned long sz)
 {
 	unsigned long taddr = htlbpage_to_page(addr);
 	pgd_t *pgd;
--- a/arch/mips/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/mips/mm/hugetlbpage.c
@@ -21,8 +21,8 @@
 #include <asm/tlb.h>
 #include <asm/tlbflush.h>
 
-pte_t *huge_pte_alloc(struct mm_struct *mm, unsigned long addr,
-		      unsigned long sz)
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
+		      unsigned long addr, unsigned long sz)
 {
 	pgd_t *pgd;
 	p4d_t *p4d;
--- a/arch/parisc/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/parisc/mm/hugetlbpage.c
@@ -44,7 +44,7 @@ hugetlb_get_unmapped_area(struct file *f
 }
 
 
-pte_t *huge_pte_alloc(struct mm_struct *mm,
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
 			unsigned long addr, unsigned long sz)
 {
 	pgd_t *pgd;
--- a/arch/powerpc/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/powerpc/mm/hugetlbpage.c
@@ -106,7 +106,8 @@ static int __hugepte_alloc(struct mm_str
  * At this point we do the placement change only for BOOK3S 64. This would
  * possibly work on other subarchs.
  */
-pte_t *huge_pte_alloc(struct mm_struct *mm, unsigned long addr, unsigned long sz)
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
+		      unsigned long addr, unsigned long sz)
 {
 	pgd_t *pg;
 	p4d_t *p4;
--- a/arch/s390/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/s390/mm/hugetlbpage.c
@@ -189,7 +189,7 @@ pte_t huge_ptep_get_and_clear(struct mm_
 	return pte;
 }
 
-pte_t *huge_pte_alloc(struct mm_struct *mm,
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
 			unsigned long addr, unsigned long sz)
 {
 	pgd_t *pgdp;
--- a/arch/sh/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/sh/mm/hugetlbpage.c
@@ -21,7 +21,7 @@
 #include <asm/tlbflush.h>
 #include <asm/cacheflush.h>
 
-pte_t *huge_pte_alloc(struct mm_struct *mm,
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
 			unsigned long addr, unsigned long sz)
 {
 	pgd_t *pgd;
--- a/arch/sparc/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/sparc/mm/hugetlbpage.c
@@ -279,7 +279,7 @@ unsigned long pud_leaf_size(pud_t pud) {
 unsigned long pmd_leaf_size(pmd_t pmd) { return 1UL << tte_to_shift(*(pte_t *)&pmd); }
 unsigned long pte_leaf_size(pte_t pte) { return 1UL << tte_to_shift(pte); }
 
-pte_t *huge_pte_alloc(struct mm_struct *mm,
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
 			unsigned long addr, unsigned long sz)
 {
 	pgd_t *pgd;
--- a/include/linux/hugetlb.h~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/include/linux/hugetlb.h
@@ -152,7 +152,8 @@ void hugetlb_fix_reserve_counts(struct i
 extern struct mutex *hugetlb_fault_mutex_table;
 u32 hugetlb_fault_mutex_hash(struct address_space *mapping, pgoff_t idx);
 
-pte_t *huge_pmd_share(struct mm_struct *mm, unsigned long addr, pud_t *pud);
+pte_t *huge_pmd_share(struct mm_struct *mm, struct vm_area_struct *vma,
+		      unsigned long addr, pud_t *pud);
 
 struct address_space *hugetlb_page_mapping_lock_write(struct page *hpage);
 
@@ -161,7 +162,7 @@ extern struct list_head huge_boot_pages;
 
 /* arch callbacks */
 
-pte_t *huge_pte_alloc(struct mm_struct *mm,
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
 			unsigned long addr, unsigned long sz);
 pte_t *huge_pte_offset(struct mm_struct *mm,
 		       unsigned long addr, unsigned long sz);
--- a/mm/hugetlb.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/mm/hugetlb.c
@@ -3795,7 +3795,7 @@ int copy_hugetlb_page_range(struct mm_st
 		src_pte = huge_pte_offset(src, addr, sz);
 		if (!src_pte)
 			continue;
-		dst_pte = huge_pte_alloc(dst, addr, sz);
+		dst_pte = huge_pte_alloc(dst, vma, addr, sz);
 		if (!dst_pte) {
 			ret = -ENOMEM;
 			break;
@@ -4563,7 +4563,7 @@ vm_fault_t hugetlb_fault(struct mm_struc
 	 */
 	mapping = vma->vm_file->f_mapping;
 	i_mmap_lock_read(mapping);
-	ptep = huge_pte_alloc(mm, haddr, huge_page_size(h));
+	ptep = huge_pte_alloc(mm, vma, haddr, huge_page_size(h));
 	if (!ptep) {
 		i_mmap_unlock_read(mapping);
 		return VM_FAULT_OOM;
@@ -5370,9 +5370,9 @@ void adjust_range_if_pmd_sharing_possibl
  * if !vma_shareable check at the beginning of the routine. i_mmap_rwsem is
  * only required for subsequent processing.
  */
-pte_t *huge_pmd_share(struct mm_struct *mm, unsigned long addr, pud_t *pud)
+pte_t *huge_pmd_share(struct mm_struct *mm, struct vm_area_struct *vma,
+		      unsigned long addr, pud_t *pud)
 {
-	struct vm_area_struct *vma = find_vma(mm, addr);
 	struct address_space *mapping = vma->vm_file->f_mapping;
 	pgoff_t idx = ((addr - vma->vm_start) >> PAGE_SHIFT) +
 			vma->vm_pgoff;
@@ -5450,7 +5450,8 @@ int huge_pmd_unshare(struct mm_struct *m
 }
 #define want_pmd_share()	(1)
 #else /* !CONFIG_ARCH_WANT_HUGE_PMD_SHARE */
-pte_t *huge_pmd_share(struct mm_struct *mm, unsigned long addr, pud_t *pud)
+pte_t *huge_pmd_share(struct mm_struct *mm, struct vm_area_struct *vma,
+		      unsigned long addr, pud_t *pud)
 {
 	return NULL;
 }
@@ -5469,7 +5470,7 @@ void adjust_range_if_pmd_sharing_possibl
 #endif /* CONFIG_ARCH_WANT_HUGE_PMD_SHARE */
 
 #ifdef CONFIG_ARCH_WANT_GENERAL_HUGETLB
-pte_t *huge_pte_alloc(struct mm_struct *mm,
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
 			unsigned long addr, unsigned long sz)
 {
 	pgd_t *pgd;
@@ -5488,7 +5489,7 @@ pte_t *huge_pte_alloc(struct mm_struct *
 		} else {
 			BUG_ON(sz != PMD_SIZE);
 			if (want_pmd_share() && pud_none(*pud))
-				pte = huge_pmd_share(mm, addr, pud);
+				pte = huge_pmd_share(mm, vma, addr, pud);
 			else
 				pte = (pte_t *)pmd_alloc(mm, pud, addr);
 		}
--- a/mm/userfaultfd.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/mm/userfaultfd.c
@@ -290,7 +290,7 @@ retry:
 		mutex_lock(&hugetlb_fault_mutex_table[hash]);
 
 		err = -ENOMEM;
-		dst_pte = huge_pte_alloc(dst_mm, dst_addr, vma_hpagesize);
+		dst_pte = huge_pte_alloc(dst_mm, dst_vma, dst_addr, vma_hpagesize);
 		if (!dst_pte) {
 			mutex_unlock(&hugetlb_fault_mutex_table[hash]);
 			i_mmap_unlock_read(mapping);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 007/143] hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled
  2021-05-05  1:32 incoming Andrew Morton
                   ` (5 preceding siblings ...)
  2021-05-05  1:33 ` [patch 006/143] hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share() Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 008/143] mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h Andrew Morton
                   ` (133 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
	axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
	dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
	mike.kravetz, mingo, mkoutny, mm-commits, mpe, naresh.kamboju,
	npiggin, oupton, peterx, rientjes, rostedt, rppt, ruprecht, shawn,
	shli, steven.price, torvalds, vbabka, viro, walken, willy,
	ying.huang

From: Peter Xu <peterx@redhat.com>
Subject: hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled

Huge pmd sharing could bring problem to userfaultfd.  The thing is that
userfaultfd is running its logic based on the special bits on page table
entries, however the huge pmd sharing could potentially share page table
entries for different address ranges.  That could cause issues on either:

  - When sharing huge pmd page tables for an uffd write protected range, the
    newly mapped huge pmd range will also be write protected unexpectedly, or,

  - When we try to write protect a range of huge pmd shared range, we'll first
    do huge_pmd_unshare() in hugetlb_change_protection(), however that also
    means the UFFDIO_WRITEPROTECT could be silently skipped for the shared
    region, which could lead to data loss.

Since at it, a few other things are done altogether:

  - Move want_pmd_share() from mm/hugetlb.c into linux/hugetlb.h, because
    that's definitely something that arch code would like to use too

  - ARM64 currently directly check against CONFIG_ARCH_WANT_HUGE_PMD_SHARE when
    trying to share huge pmd.  Switch to the want_pmd_share() helper.

Since at it, move vma_shareable() from huge_pmd_share() into want_pmd_share().

[peterx@redhat.com: fix build with !ARCH_WANT_HUGE_PMD_SHARE]
  Link: https://lkml.kernel.org/r/20210310185359.88297-1-peterx@redhat.com
Link: https://lkml.kernel.org/r/20210218231202.15426-1-peterx@redhat.com
Signed-off-by: Peter Xu <peterx@redhat.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: Axel Rasmussen <axelrasmussen@google.com>
Tested-by: Naresh Kamboju <naresh.kamboju@linaro.org>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/arm64/mm/hugetlbpage.c   |    3 +--
 include/linux/hugetlb.h       |    2 ++
 include/linux/userfaultfd_k.h |    9 +++++++++
 mm/hugetlb.c                  |   22 ++++++++++++++++------
 4 files changed, 28 insertions(+), 8 deletions(-)

--- a/arch/arm64/mm/hugetlbpage.c~hugetlb-userfaultfd-forbid-huge-pmd-sharing-when-uffd-enabled
+++ a/arch/arm64/mm/hugetlbpage.c
@@ -284,8 +284,7 @@ pte_t *huge_pte_alloc(struct mm_struct *
 		 */
 		ptep = pte_alloc_map(mm, pmdp, addr);
 	} else if (sz == PMD_SIZE) {
-		if (IS_ENABLED(CONFIG_ARCH_WANT_HUGE_PMD_SHARE) &&
-		    pud_none(READ_ONCE(*pudp)))
+		if (want_pmd_share(vma, addr) && pud_none(READ_ONCE(*pudp)))
 			ptep = huge_pmd_share(mm, vma, addr, pudp);
 		else
 			ptep = (pte_t *)pmd_alloc(mm, pudp, addr);
--- a/include/linux/hugetlb.h~hugetlb-userfaultfd-forbid-huge-pmd-sharing-when-uffd-enabled
+++ a/include/linux/hugetlb.h
@@ -1040,4 +1040,6 @@ static inline __init void hugetlb_cma_ch
 }
 #endif
 
+bool want_pmd_share(struct vm_area_struct *vma, unsigned long addr);
+
 #endif /* _LINUX_HUGETLB_H */
--- a/include/linux/userfaultfd_k.h~hugetlb-userfaultfd-forbid-huge-pmd-sharing-when-uffd-enabled
+++ a/include/linux/userfaultfd_k.h
@@ -52,6 +52,15 @@ static inline bool is_mergeable_vm_userf
 	return vma->vm_userfaultfd_ctx.ctx == vm_ctx.ctx;
 }
 
+/*
+ * Never enable huge pmd sharing on uffd-wp registered vmas, because uffd-wp
+ * protect information is per pgtable entry.
+ */
+static inline bool uffd_disable_huge_pmd_share(struct vm_area_struct *vma)
+{
+	return vma->vm_flags & VM_UFFD_WP;
+}
+
 static inline bool userfaultfd_missing(struct vm_area_struct *vma)
 {
 	return vma->vm_flags & VM_UFFD_MISSING;
--- a/mm/hugetlb.c~hugetlb-userfaultfd-forbid-huge-pmd-sharing-when-uffd-enabled
+++ a/mm/hugetlb.c
@@ -5326,6 +5326,15 @@ static bool vma_shareable(struct vm_area
 	return false;
 }
 
+bool want_pmd_share(struct vm_area_struct *vma, unsigned long addr)
+{
+#ifdef CONFIG_USERFAULTFD
+	if (uffd_disable_huge_pmd_share(vma))
+		return false;
+#endif
+	return vma_shareable(vma, addr);
+}
+
 /*
  * Determine if start,end range within vma could be mapped by shared pmd.
  * If yes, adjust start and end to cover range associated with possible
@@ -5382,9 +5391,6 @@ pte_t *huge_pmd_share(struct mm_struct *
 	pte_t *pte;
 	spinlock_t *ptl;
 
-	if (!vma_shareable(vma, addr))
-		return (pte_t *)pmd_alloc(mm, pud, addr);
-
 	i_mmap_assert_locked(mapping);
 	vma_interval_tree_foreach(svma, &mapping->i_mmap, idx, idx) {
 		if (svma == vma)
@@ -5448,7 +5454,7 @@ int huge_pmd_unshare(struct mm_struct *m
 	*addr = ALIGN(*addr, HPAGE_SIZE * PTRS_PER_PTE) - HPAGE_SIZE;
 	return 1;
 }
-#define want_pmd_share()	(1)
+
 #else /* !CONFIG_ARCH_WANT_HUGE_PMD_SHARE */
 pte_t *huge_pmd_share(struct mm_struct *mm, struct vm_area_struct *vma,
 		      unsigned long addr, pud_t *pud)
@@ -5466,7 +5472,11 @@ void adjust_range_if_pmd_sharing_possibl
 				unsigned long *start, unsigned long *end)
 {
 }
-#define want_pmd_share()	(0)
+
+bool want_pmd_share(struct vm_area_struct *vma, unsigned long addr)
+{
+	return false;
+}
 #endif /* CONFIG_ARCH_WANT_HUGE_PMD_SHARE */
 
 #ifdef CONFIG_ARCH_WANT_GENERAL_HUGETLB
@@ -5488,7 +5498,7 @@ pte_t *huge_pte_alloc(struct mm_struct *
 			pte = (pte_t *)pud;
 		} else {
 			BUG_ON(sz != PMD_SIZE);
-			if (want_pmd_share() && pud_none(*pud))
+			if (want_pmd_share(vma, addr) && pud_none(*pud))
 				pte = huge_pmd_share(mm, vma, addr, pud);
 			else
 				pte = (pte_t *)pmd_alloc(mm, pud, addr);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 008/143] mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h
  2021-05-05  1:32 incoming Andrew Morton
                   ` (6 preceding siblings ...)
  2021-05-05  1:33 ` [patch 007/143] hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 009/143] hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp Andrew Morton
                   ` (132 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
	axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
	dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
	mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
	peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
	steven.price, torvalds, vbabka, viro, walken, willy, ying.huang

From: Peter Xu <peterx@redhat.com>
Subject: mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h

Prepare for it to be called outside of mm/hugetlb.c.

Link: https://lkml.kernel.org/r/20210218231204.15474-1-peterx@redhat.com
Signed-off-by: Peter Xu <peterx@redhat.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: Axel Rasmussen <axelrasmussen@google.com>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/hugetlb.h |    8 ++++++++
 mm/hugetlb.c            |    8 --------
 2 files changed, 8 insertions(+), 8 deletions(-)

--- a/include/linux/hugetlb.h~mm-hugetlb-move-flush_hugetlb_tlb_range-into-hugetlbh
+++ a/include/linux/hugetlb.h
@@ -1042,4 +1042,12 @@ static inline __init void hugetlb_cma_ch
 
 bool want_pmd_share(struct vm_area_struct *vma, unsigned long addr);
 
+#ifndef __HAVE_ARCH_FLUSH_HUGETLB_TLB_RANGE
+/*
+ * ARCHes with special requirements for evicting HUGETLB backing TLB entries can
+ * implement this.
+ */
+#define flush_hugetlb_tlb_range(vma, addr, end)	flush_tlb_range(vma, addr, end)
+#endif
+
 #endif /* _LINUX_HUGETLB_H */
--- a/mm/hugetlb.c~mm-hugetlb-move-flush_hugetlb_tlb_range-into-hugetlbh
+++ a/mm/hugetlb.c
@@ -4996,14 +4996,6 @@ long follow_hugetlb_page(struct mm_struc
 	return i ? i : err;
 }
 
-#ifndef __HAVE_ARCH_FLUSH_HUGETLB_TLB_RANGE
-/*
- * ARCHes with special requirements for evicting HUGETLB backing TLB entries can
- * implement this.
- */
-#define flush_hugetlb_tlb_range(vma, addr, end)	flush_tlb_range(vma, addr, end)
-#endif
-
 unsigned long hugetlb_change_protection(struct vm_area_struct *vma,
 		unsigned long address, unsigned long end, pgprot_t newprot)
 {
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 009/143] hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp
  2021-05-05  1:32 incoming Andrew Morton
                   ` (7 preceding siblings ...)
  2021-05-05  1:33 ` [patch 008/143] mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 010/143] mm/hugetlb: remove redundant reservation check condition in alloc_huge_page() Andrew Morton
                   ` (131 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
	axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
	dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
	mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
	peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
	steven.price, torvalds, vbabka, viro, walken, willy, ying.huang

From: Peter Xu <peterx@redhat.com>
Subject: hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp

Huge pmd sharing for hugetlbfs is racy with userfaultfd-wp because
userfaultfd-wp is always based on pgtable entries, so they cannot be
shared.

Walk the hugetlb range and unshare all such mappings if there is, right
before UFFDIO_REGISTER will succeed and return to userspace.

This will pair with want_pmd_share() in hugetlb code so that huge pmd
sharing is completely disabled for userfaultfd-wp registered range.

Link: https://lkml.kernel.org/r/20210218231206.15524-1-peterx@redhat.com
Signed-off-by: Peter Xu <peterx@redhat.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Axel Rasmussen <axelrasmussen@google.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Matthew Wilcox (Oracle) <willy@infradead.org>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 fs/userfaultfd.c        |    4 ++
 include/linux/hugetlb.h |    3 ++
 mm/hugetlb.c            |   51 ++++++++++++++++++++++++++++++++++++++
 3 files changed, 58 insertions(+)

--- a/fs/userfaultfd.c~hugetlb-userfaultfd-unshare-all-pmds-for-hugetlbfs-when-register-wp
+++ a/fs/userfaultfd.c
@@ -15,6 +15,7 @@
 #include <linux/sched/signal.h>
 #include <linux/sched/mm.h>
 #include <linux/mm.h>
+#include <linux/mmu_notifier.h>
 #include <linux/poll.h>
 #include <linux/slab.h>
 #include <linux/seq_file.h>
@@ -1449,6 +1450,9 @@ static int userfaultfd_register(struct u
 		vma->vm_flags = new_flags;
 		vma->vm_userfaultfd_ctx.ctx = ctx;
 
+		if (is_vm_hugetlb_page(vma) && uffd_disable_huge_pmd_share(vma))
+			hugetlb_unshare_all_pmds(vma);
+
 	skip:
 		prev = vma;
 		start = vma->vm_end;
--- a/include/linux/hugetlb.h~hugetlb-userfaultfd-unshare-all-pmds-for-hugetlbfs-when-register-wp
+++ a/include/linux/hugetlb.h
@@ -188,6 +188,7 @@ unsigned long hugetlb_change_protection(
 		unsigned long address, unsigned long end, pgprot_t newprot);
 
 bool is_hugetlb_entry_migration(pte_t pte);
+void hugetlb_unshare_all_pmds(struct vm_area_struct *vma);
 
 #else /* !CONFIG_HUGETLB_PAGE */
 
@@ -369,6 +370,8 @@ static inline vm_fault_t hugetlb_fault(s
 	return 0;
 }
 
+static inline void hugetlb_unshare_all_pmds(struct vm_area_struct *vma) { }
+
 #endif /* !CONFIG_HUGETLB_PAGE */
 /*
  * hugepages at page global directory. If arch support
--- a/mm/hugetlb.c~hugetlb-userfaultfd-unshare-all-pmds-for-hugetlbfs-when-register-wp
+++ a/mm/hugetlb.c
@@ -5691,6 +5691,57 @@ void move_hugetlb_state(struct page *old
 	}
 }
 
+/*
+ * This function will unconditionally remove all the shared pmd pgtable entries
+ * within the specific vma for a hugetlbfs memory range.
+ */
+void hugetlb_unshare_all_pmds(struct vm_area_struct *vma)
+{
+	struct hstate *h = hstate_vma(vma);
+	unsigned long sz = huge_page_size(h);
+	struct mm_struct *mm = vma->vm_mm;
+	struct mmu_notifier_range range;
+	unsigned long address, start, end;
+	spinlock_t *ptl;
+	pte_t *ptep;
+
+	if (!(vma->vm_flags & VM_MAYSHARE))
+		return;
+
+	start = ALIGN(vma->vm_start, PUD_SIZE);
+	end = ALIGN_DOWN(vma->vm_end, PUD_SIZE);
+
+	if (start >= end)
+		return;
+
+	/*
+	 * No need to call adjust_range_if_pmd_sharing_possible(), because
+	 * we have already done the PUD_SIZE alignment.
+	 */
+	mmu_notifier_range_init(&range, MMU_NOTIFY_CLEAR, 0, vma, mm,
+				start, end);
+	mmu_notifier_invalidate_range_start(&range);
+	i_mmap_lock_write(vma->vm_file->f_mapping);
+	for (address = start; address < end; address += PUD_SIZE) {
+		unsigned long tmp = address;
+
+		ptep = huge_pte_offset(mm, address, sz);
+		if (!ptep)
+			continue;
+		ptl = huge_pte_lock(h, mm, ptep);
+		/* We don't want 'address' to be changed */
+		huge_pmd_unshare(mm, vma, &tmp, ptep);
+		spin_unlock(ptl);
+	}
+	flush_hugetlb_tlb_range(vma, start, end);
+	i_mmap_unlock_write(vma->vm_file->f_mapping);
+	/*
+	 * No need to call mmu_notifier_invalidate_range(), see
+	 * Documentation/vm/mmu_notifier.rst.
+	 */
+	mmu_notifier_invalidate_range_end(&range);
+}
+
 #ifdef CONFIG_CMA
 static bool cma_reserve_called __initdata;
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 010/143] mm/hugetlb: remove redundant reservation check condition in alloc_huge_page()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (8 preceding siblings ...)
  2021-05-05  1:33 ` [patch 009/143] hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 011/143] mm: generalize HUGETLB_PAGE_SIZE_VARIABLE Andrew Morton
                   ` (130 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugetlb: remove redundant reservation check condition in alloc_huge_page()

vma_resv_map(vma) checks if a reserve map is associated with the vma.  The
routine vma_needs_reservation() will check vma_resv_map(vma) and return 1
if no reserv map is present.  map_chg is set to the return value of
vma_needs_reservation().  Therefore, !vma_resv_map(vma) is redundant in
the expression:

	map_chg || avoid_reserve || !vma_resv_map(vma);

Remove the redundant check.

[Thanks Mike Kravetz for reshaping this commit message!]

Link: https://lkml.kernel.org/r/20210301104726.45159-1-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/mm/hugetlb.c~mm-hugetlb-remove-redundant-reservation-check-condition-in-alloc_huge_page
+++ a/mm/hugetlb.c
@@ -2316,7 +2316,7 @@ struct page *alloc_huge_page(struct vm_a
 
 	/* If this allocation is not consuming a reservation, charge it now.
 	 */
-	deferred_reserve = map_chg || avoid_reserve || !vma_resv_map(vma);
+	deferred_reserve = map_chg || avoid_reserve;
 	if (deferred_reserve) {
 		ret = hugetlb_cgroup_charge_cgroup_rsvd(
 			idx, pages_per_huge_page(h), &h_cg);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 011/143] mm: generalize HUGETLB_PAGE_SIZE_VARIABLE
  2021-05-05  1:32 incoming Andrew Morton
                   ` (9 preceding siblings ...)
  2021-05-05  1:33 ` [patch 010/143] mm/hugetlb: remove redundant reservation check condition in alloc_huge_page() Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 012/143] mm/hugetlb: use some helper functions to cleanup code Andrew Morton
                   ` (129 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: akpm, anshuman.khandual, benh, christophe.leroy, hch, linux-mm,
	mike.kravetz, mm-commits, mpe, paulus, torvalds

From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: generalize HUGETLB_PAGE_SIZE_VARIABLE

HUGETLB_PAGE_SIZE_VARIABLE need not be defined for each individual
platform subscribing it.  Instead just make it generic.

Link: https://lkml.kernel.org/r/1614914928-22039-1-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Suggested-by: Christoph Hellwig <hch@lst.de>
Reviewed-by: Christoph Hellwig <hch@lst.de>
Acked-by: Michael Ellerman <mpe@ellerman.id.au>	[powerpc]
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Christophe Leroy <christophe.leroy@csgroup.eu>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/ia64/Kconfig    |    6 +-----
 arch/powerpc/Kconfig |    6 +-----
 mm/Kconfig           |    7 +++++++
 3 files changed, 9 insertions(+), 10 deletions(-)

--- a/arch/ia64/Kconfig~mm-generalize-hugetlb_page_size_variable
+++ a/arch/ia64/Kconfig
@@ -32,6 +32,7 @@ config IA64
 	select TTY
 	select HAVE_ARCH_TRACEHOOK
 	select HAVE_VIRT_CPU_ACCOUNTING
+	select HUGETLB_PAGE_SIZE_VARIABLE if HUGETLB_PAGE
 	select VIRT_TO_BUS
 	select GENERIC_IRQ_PROBE
 	select GENERIC_PENDING_IRQ if SMP
@@ -82,11 +83,6 @@ config STACKTRACE_SUPPORT
 config GENERIC_LOCKBREAK
 	def_bool n
 
-config HUGETLB_PAGE_SIZE_VARIABLE
-	bool
-	depends on HUGETLB_PAGE
-	default y
-
 config GENERIC_CALIBRATE_DELAY
 	bool
 	default y
--- a/arch/powerpc/Kconfig~mm-generalize-hugetlb_page_size_variable
+++ a/arch/powerpc/Kconfig
@@ -232,6 +232,7 @@ config PPC
 	select HAVE_HARDLOCKUP_DETECTOR_PERF	if PERF_EVENTS && HAVE_PERF_EVENTS_NMI && !HAVE_HARDLOCKUP_DETECTOR_ARCH
 	select HAVE_PERF_REGS
 	select HAVE_PERF_USER_STACK_DUMP
+	select HUGETLB_PAGE_SIZE_VARIABLE	if PPC_BOOK3S_64 && HUGETLB_PAGE
 	select MMU_GATHER_RCU_TABLE_FREE
 	select MMU_GATHER_PAGE_SIZE
 	select HAVE_REGS_AND_STACK_ACCESS_API
@@ -416,11 +417,6 @@ config HIGHMEM
 
 source "kernel/Kconfig.hz"
 
-config HUGETLB_PAGE_SIZE_VARIABLE
-	bool
-	depends on HUGETLB_PAGE && PPC_BOOK3S_64
-	default y
-
 config MATH_EMULATION
 	bool "Math emulation"
 	depends on 4xx || PPC_8xx || PPC_MPC832x || BOOKE
--- a/mm/Kconfig~mm-generalize-hugetlb_page_size_variable
+++ a/mm/Kconfig
@@ -273,6 +273,13 @@ config ARCH_ENABLE_HUGEPAGE_MIGRATION
 config ARCH_ENABLE_THP_MIGRATION
 	bool
 
+config HUGETLB_PAGE_SIZE_VARIABLE
+	def_bool n
+	help
+	  Allows the pageblock_order value to be dynamic instead of just standard
+	  HUGETLB_PAGE_ORDER when there are multiple HugeTLB page sizes available
+	  on a platform.
+
 config CONTIG_ALLOC
 	def_bool (MEMORY_ISOLATION && COMPACTION) || CMA
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 012/143] mm/hugetlb: use some helper functions to cleanup code
  2021-05-05  1:32 incoming Andrew Morton
                   ` (10 preceding siblings ...)
  2021-05-05  1:33 ` [patch 011/143] mm: generalize HUGETLB_PAGE_SIZE_VARIABLE Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 013/143] mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state() Andrew Morton
                   ` (128 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugetlb: use some helper functions to cleanup code

Patch series "Some cleanups for hugetlb".

This series contains cleanups to remove unnecessary VM_BUG_ON_PAGE, use
helper function and so on.  I also collect some previous patches into this
series in case they are forgotten.


This patch (of 5):

We could use pages_per_huge_page to get the number of pages per hugepage,
use get_hstate_idx to calculate hstate index, and use hstate_is_gigantic
to check if a hstate is gigantic to make code more succinct.

Link: https://lkml.kernel.org/r/20210308112809.26107-1-linmiaohe@huawei.com
Link: https://lkml.kernel.org/r/20210308112809.26107-2-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 fs/hugetlbfs/inode.c |    2 +-
 mm/hugetlb.c         |    6 +++---
 2 files changed, 4 insertions(+), 4 deletions(-)

--- a/fs/hugetlbfs/inode.c~mm-hugetlb-use-some-helper-functions-to-cleanup-code
+++ a/fs/hugetlbfs/inode.c
@@ -1435,7 +1435,7 @@ static int get_hstate_idx(int page_size_
 
 	if (!h)
 		return -1;
-	return h - hstates;
+	return hstate_index(h);
 }
 
 /*
--- a/mm/hugetlb.c~mm-hugetlb-use-some-helper-functions-to-cleanup-code
+++ a/mm/hugetlb.c
@@ -1273,7 +1273,7 @@ static void free_gigantic_page(struct pa
 static struct page *alloc_gigantic_page(struct hstate *h, gfp_t gfp_mask,
 		int nid, nodemask_t *nodemask)
 {
-	unsigned long nr_pages = 1UL << huge_page_order(h);
+	unsigned long nr_pages = pages_per_huge_page(h);
 	if (nid == NUMA_NO_NODE)
 		nid = numa_mem_id();
 
@@ -3267,10 +3267,10 @@ static int __init hugepages_setup(char *
 
 	/*
 	 * Global state is always initialized later in hugetlb_init.
-	 * But we need to allocate >= MAX_ORDER hstates here early to still
+	 * But we need to allocate gigantic hstates here early to still
 	 * use the bootmem allocator.
 	 */
-	if (hugetlb_max_hstate && parsed_hstate->order >= MAX_ORDER)
+	if (hugetlb_max_hstate && hstate_is_gigantic(parsed_hstate))
 		hugetlb_hstate_alloc_pages(parsed_hstate);
 
 	last_mhp = mhp;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 013/143] mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (11 preceding siblings ...)
  2021-05-05  1:33 ` [patch 012/143] mm/hugetlb: use some helper functions to cleanup code Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 014/143] mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate() Andrew Morton
                   ` (127 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state()

We should not transfer the per-node surplus state when we do not cross the
node in order to save some cpu cycles

Link: https://lkml.kernel.org/r/20210308112809.26107-3-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |    6 ++++++
 1 file changed, 6 insertions(+)

--- a/mm/hugetlb.c~mm-hugetlb-optimize-the-surplus-state-transfer-code-in-move_hugetlb_state
+++ a/mm/hugetlb.c
@@ -5682,6 +5682,12 @@ void move_hugetlb_state(struct page *old
 		SetHPageTemporary(oldpage);
 		ClearHPageTemporary(newpage);
 
+		/*
+		 * There is no need to transfer the per-node surplus state
+		 * when we do not cross the node.
+		 */
+		if (new_nid == old_nid)
+			return;
 		spin_lock(&hugetlb_lock);
 		if (h->surplus_huge_pages_node[old_nid]) {
 			h->surplus_huge_pages_node[old_nid]--;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 014/143] mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (12 preceding siblings ...)
  2021-05-05  1:33 ` [patch 013/143] mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state() Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 015/143] mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page() Andrew Morton
                   ` (126 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate()

!PageHuge(oldhpage) is implicitly checked in page_hstate() above, so we
remove this explicit one.

Link: https://lkml.kernel.org/r/20210308112809.26107-4-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb_cgroup.c |    1 -
 1 file changed, 1 deletion(-)

--- a/mm/hugetlb_cgroup.c~hugetlb_cgroup-remove-unnecessary-vm_bug_on_page-in-hugetlb_cgroup_migrate
+++ a/mm/hugetlb_cgroup.c
@@ -784,7 +784,6 @@ void hugetlb_cgroup_migrate(struct page
 	if (hugetlb_cgroup_disabled())
 		return;
 
-	VM_BUG_ON_PAGE(!PageHuge(oldhpage), oldhpage);
 	spin_lock(&hugetlb_lock);
 	h_cg = hugetlb_cgroup_from_page(oldhpage);
 	h_cg_rsvd = hugetlb_cgroup_from_page_rsvd(oldhpage);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 015/143] mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (13 preceding siblings ...)
  2021-05-05  1:33 ` [patch 014/143] mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate() Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 016/143] mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case Andrew Morton
                   ` (125 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page()

Rework the error handling code when alloc_huge_page() failed to remove
some duplicated code and simplify the code slightly.

Link: https://lkml.kernel.org/r/20210308112809.26107-5-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |    9 +++------
 1 file changed, 3 insertions(+), 6 deletions(-)

--- a/mm/hugetlb.c~mm-hugetlb-simplify-the-code-when-alloc_huge_page-failed-in-hugetlb_no_page
+++ a/mm/hugetlb.c
@@ -4395,13 +4395,10 @@ retry:
 			 * sure there really is no pte entry.
 			 */
 			ptl = huge_pte_lock(h, mm, ptep);
-			if (!huge_pte_none(huge_ptep_get(ptep))) {
-				ret = 0;
-				spin_unlock(ptl);
-				goto out;
-			}
+			ret = 0;
+			if (huge_pte_none(huge_ptep_get(ptep)))
+				ret = vmf_error(PTR_ERR(page));
 			spin_unlock(ptl);
-			ret = vmf_error(PTR_ERR(page));
 			goto out;
 		}
 		clear_huge_page(page, address, pages_per_huge_page(h));
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 016/143] mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case
  2021-05-05  1:32 incoming Andrew Morton
                   ` (14 preceding siblings ...)
  2021-05-05  1:33 ` [patch 015/143] mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page() Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 017/143] khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps() Andrew Morton
                   ` (124 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case

The fault_mutex hashing overhead can be avoided in truncate_op case
because page faults can not race with truncation in this routine.  So
calculate hash for fault_mutex only in !truncate_op case to save some cpu
cycles.

Link: https://lkml.kernel.org/r/20210308112809.26107-6-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 fs/hugetlbfs/inode.c |    4 ++--
 1 file changed, 2 insertions(+), 2 deletions(-)

--- a/fs/hugetlbfs/inode.c~mm-hugetlb-avoid-calculating-fault_mutex_hash-in-truncate_op-case
+++ a/fs/hugetlbfs/inode.c
@@ -482,10 +482,9 @@ static void remove_inode_hugepages(struc
 
 		for (i = 0; i < pagevec_count(&pvec); ++i) {
 			struct page *page = pvec.pages[i];
-			u32 hash;
+			u32 hash = 0;
 
 			index = page->index;
-			hash = hugetlb_fault_mutex_hash(mapping, index);
 			if (!truncate_op) {
 				/*
 				 * Only need to hold the fault mutex in the
@@ -493,6 +492,7 @@ static void remove_inode_hugepages(struc
 				 * page faults.  Races are not possible in the
 				 * case of truncation.
 				 */
+				hash = hugetlb_fault_mutex_hash(mapping, index);
 				mutex_lock(&hugetlb_fault_mutex_table[hash]);
 			}
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 017/143] khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (15 preceding siblings ...)
  2021-05-05  1:33 ` [patch 016/143] mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 018/143] khugepaged: reuse the smp_wmb() inside __SetPageUptodate() Andrew Morton
                   ` (123 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: akpm, dan.carpenter, ebru.akagunduz, kirill.shutemov, linmiaohe,
	linux-mm, mike.kravetz, mm-commits, riel, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps()

Patch series "Cleanup and fixup for khugepaged", v2.

This series contains cleanups to remove unneeded return value, use helper
function and so on.  And there is one fix to correct the wrong result
value for trace_mm_collapse_huge_page_isolate().


This patch (of 4):

The return value of khugepaged_collapse_pte_mapped_thps() is never checked
since it's introduced.  We should remove such unneeded return value.

Link: https://lkml.kernel.org/r/20210306032947.35921-1-linmiaohe@huawei.com
Link: https://lkml.kernel.org/r/20210306032947.35921-2-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Cc: Rik van Riel <riel@redhat.com>
Cc: Ebru Akagunduz <ebru.akagunduz@gmail.com>
Cc: Dan Carpenter <dan.carpenter@oracle.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/khugepaged.c |   10 ++++------
 1 file changed, 4 insertions(+), 6 deletions(-)

--- a/mm/khugepaged.c~khugepaged-remove-unneeded-return-value-of-khugepaged_collapse_pte_mapped_thps
+++ a/mm/khugepaged.c
@@ -1533,16 +1533,16 @@ abort:
 	goto drop_hpage;
 }
 
-static int khugepaged_collapse_pte_mapped_thps(struct mm_slot *mm_slot)
+static void khugepaged_collapse_pte_mapped_thps(struct mm_slot *mm_slot)
 {
 	struct mm_struct *mm = mm_slot->mm;
 	int i;
 
 	if (likely(mm_slot->nr_pte_mapped_thp == 0))
-		return 0;
+		return;
 
 	if (!mmap_write_trylock(mm))
-		return -EBUSY;
+		return;
 
 	if (unlikely(khugepaged_test_exit(mm)))
 		goto out;
@@ -1553,7 +1553,6 @@ static int khugepaged_collapse_pte_mappe
 out:
 	mm_slot->nr_pte_mapped_thp = 0;
 	mmap_write_unlock(mm);
-	return 0;
 }
 
 static void retract_page_tables(struct address_space *mapping, pgoff_t pgoff)
@@ -2057,9 +2056,8 @@ static void khugepaged_scan_file(struct
 	BUILD_BUG();
 }
 
-static int khugepaged_collapse_pte_mapped_thps(struct mm_slot *mm_slot)
+static void khugepaged_collapse_pte_mapped_thps(struct mm_slot *mm_slot)
 {
-	return 0;
 }
 #endif
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 018/143] khugepaged: reuse the smp_wmb() inside __SetPageUptodate()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (16 preceding siblings ...)
  2021-05-05  1:33 ` [patch 017/143] khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps() Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 019/143] khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter() Andrew Morton
                   ` (122 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: akpm, dan.carpenter, ebru.akagunduz, kirill.shutemov, linmiaohe,
	linux-mm, mike.kravetz, mm-commits, riel, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: khugepaged: reuse the smp_wmb() inside __SetPageUptodate()

smp_wmb() is needed to avoid the copy_huge_page writes to become visible
after the set_pmd_at() write here.  But we can reuse the smp_wmb() inside
__SetPageUptodate() to remove this redundant one.

Link: https://lkml.kernel.org/r/20210306032947.35921-3-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Cc: Dan Carpenter <dan.carpenter@oracle.com>
Cc: Ebru Akagunduz <ebru.akagunduz@gmail.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Rik van Riel <riel@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/khugepaged.c |   13 ++++++-------
 1 file changed, 6 insertions(+), 7 deletions(-)

--- a/mm/khugepaged.c~khugepaged-reuse-the-smp_wmb-inside-__setpageuptodate
+++ a/mm/khugepaged.c
@@ -1183,19 +1183,18 @@ static void collapse_huge_page(struct mm
 	__collapse_huge_page_copy(pte, new_page, vma, address, pte_ptl,
 			&compound_pagelist);
 	pte_unmap(pte);
+	/*
+	 * spin_lock() below is not the equivalent of smp_wmb(), but
+	 * the smp_wmb() inside __SetPageUptodate() can be reused to
+	 * avoid the copy_huge_page writes to become visible after
+	 * the set_pmd_at() write.
+	 */
 	__SetPageUptodate(new_page);
 	pgtable = pmd_pgtable(_pmd);
 
 	_pmd = mk_huge_pmd(new_page, vma->vm_page_prot);
 	_pmd = maybe_pmd_mkwrite(pmd_mkdirty(_pmd), vma);
 
-	/*
-	 * spin_lock() below is not the equivalent of smp_wmb(), so
-	 * this is needed to avoid the copy_huge_page writes to become
-	 * visible after the set_pmd_at() write.
-	 */
-	smp_wmb();
-
 	spin_lock(pmd_ptl);
 	BUG_ON(!pmd_none(*pmd));
 	page_add_new_anon_rmap(new_page, vma, address, true);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 019/143] khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (17 preceding siblings ...)
  2021-05-05  1:33 ` [patch 018/143] khugepaged: reuse the smp_wmb() inside __SetPageUptodate() Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 020/143] khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate() Andrew Morton
                   ` (121 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: akpm, dan.carpenter, ebru.akagunduz, kirill.shutemov, linmiaohe,
	linux-mm, mike.kravetz, mm-commits, riel, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter()

Commit 4d45e75a9955 ("mm: remove the now-unnecessary mmget_still_valid()
hack") have made khugepaged_test_exit() suitable for check mm->mm_users
against 0.  Use this helper here.

Link: https://lkml.kernel.org/r/20210306032947.35921-4-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Cc: Dan Carpenter <dan.carpenter@oracle.com>
Cc: Ebru Akagunduz <ebru.akagunduz@gmail.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Rik van Riel <riel@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/khugepaged.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/mm/khugepaged.c~khugepaged-use-helper-khugepaged_test_exit-in-__khugepaged_enter
+++ a/mm/khugepaged.c
@@ -481,7 +481,7 @@ int __khugepaged_enter(struct mm_struct
 		return -ENOMEM;
 
 	/* __khugepaged_exit() must not run from under us */
-	VM_BUG_ON_MM(atomic_read(&mm->mm_users) == 0, mm);
+	VM_BUG_ON_MM(khugepaged_test_exit(mm), mm);
 	if (unlikely(test_and_set_bit(MMF_VM_HUGEPAGE, &mm->flags))) {
 		free_mm_slot(mm_slot);
 		return 0;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 020/143] khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (18 preceding siblings ...)
  2021-05-05  1:33 ` [patch 019/143] khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter() Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 021/143] mm/huge_memory.c: remove unnecessary local variable ret2 Andrew Morton
                   ` (120 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: akpm, dan.carpenter, ebru.akagunduz, kirill.shutemov, linmiaohe,
	linux-mm, mike.kravetz, mm-commits, riel, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate()

In writable and !referenced case, the result value should be
SCAN_LACK_REFERENCED_PAGE for trace_mm_collapse_huge_page_isolate()
instead of default 0 (SCAN_FAIL) here.

Link: https://lkml.kernel.org/r/20210306032947.35921-5-linmiaohe@huawei.com
Fixes: 7d2eba0557c1 ("mm: add tracepoint for scanning pages")
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Cc: Dan Carpenter <dan.carpenter@oracle.com>
Cc: Ebru Akagunduz <ebru.akagunduz@gmail.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Rik van Riel <riel@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/khugepaged.c |   18 +++++++++---------
 1 file changed, 9 insertions(+), 9 deletions(-)

--- a/mm/khugepaged.c~khugepaged-fix-wrong-result-value-for-trace_mm_collapse_huge_page_isolate
+++ a/mm/khugepaged.c
@@ -716,17 +716,17 @@ next:
 		if (pte_write(pteval))
 			writable = true;
 	}
-	if (likely(writable)) {
-		if (likely(referenced)) {
-			result = SCAN_SUCCEED;
-			trace_mm_collapse_huge_page_isolate(page, none_or_zero,
-							    referenced, writable, result);
-			return 1;
-		}
-	} else {
+
+	if (unlikely(!writable)) {
 		result = SCAN_PAGE_RO;
+	} else if (unlikely(!referenced)) {
+		result = SCAN_LACK_REFERENCED_PAGE;
+	} else {
+		result = SCAN_SUCCEED;
+		trace_mm_collapse_huge_page_isolate(page, none_or_zero,
+						    referenced, writable, result);
+		return 1;
 	}
-
 out:
 	release_pte_pages(pte, _pte, compound_pagelist);
 	trace_mm_collapse_huge_page_isolate(page, none_or_zero,
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 021/143] mm/huge_memory.c: remove unnecessary local variable ret2
  2021-05-05  1:32 incoming Andrew Morton
                   ` (19 preceding siblings ...)
  2021-05-05  1:33 ` [patch 020/143] khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate() Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 022/143] mm/huge_memory.c: rework the function vma_adjust_trans_huge() Andrew Morton
                   ` (119 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/huge_memory.c: remove unnecessary local variable ret2

There is no need to use a new local variable ret2 to get the return value
of handle_userfault(). Use ret directly to make code more succinct.

Link: https://lkml.kernel.org/r/20210210072409.60587-1-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Andrew Morton <akpm@linux-foundation.org>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/huge_memory.c |    8 +++-----
 1 file changed, 3 insertions(+), 5 deletions(-)

--- a/mm/huge_memory.c~mm-huge_memoryc-remove-unnecessary-local-variable-ret2
+++ a/mm/huge_memory.c
@@ -624,14 +624,12 @@ static vm_fault_t __do_huge_pmd_anonymou
 
 		/* Deliver the page fault to userland */
 		if (userfaultfd_missing(vma)) {
-			vm_fault_t ret2;
-
 			spin_unlock(vmf->ptl);
 			put_page(page);
 			pte_free(vma->vm_mm, pgtable);
-			ret2 = handle_userfault(vmf, VM_UFFD_MISSING);
-			VM_BUG_ON(ret2 & VM_FAULT_FALLBACK);
-			return ret2;
+			ret = handle_userfault(vmf, VM_UFFD_MISSING);
+			VM_BUG_ON(ret & VM_FAULT_FALLBACK);
+			return ret;
 		}
 
 		entry = mk_huge_pmd(page, vma->vm_page_prot);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 022/143] mm/huge_memory.c: rework the function vma_adjust_trans_huge()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (20 preceding siblings ...)
  2021-05-05  1:33 ` [patch 021/143] mm/huge_memory.c: remove unnecessary local variable ret2 Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 023/143] mm/huge_memory.c: make get_huge_zero_page() return bool Andrew Morton
                   ` (118 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx,
	rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken,
	william.kucharski, willy, yang.shi, yulei.kernel, ziy

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/huge_memory.c: rework the function vma_adjust_trans_huge()

Patch series "Some cleanups for huge_memory", v3.

This series contains cleanups to rework some function logics to make it
more readable, use helper function and so on.  More details can be found
in the respective changelogs.


This patch (of 6):

The current implementation of vma_adjust_trans_huge() contains some
duplicated codes.  Add helper function to get rid of these codes to make
it more succinct.

Link: https://lkml.kernel.org/r/20210318122722.13135-1-linmiaohe@huawei.com
Link: https://lkml.kernel.org/r/20210318122722.13135-2-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Zi Yan <ziy@nvidia.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: William Kucharski <william.kucharski@oracle.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Peter Xu <peterx@redhat.com>
Cc: yuleixzhang <yulei.kernel@gmail.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org>
Cc: Yang Shi <yang.shi@linux.alibaba.com>
Cc: Wei Yang <richard.weiyang@linux.alibaba.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/huge_memory.c |   44 +++++++++++++++++++-------------------------
 1 file changed, 19 insertions(+), 25 deletions(-)

--- a/mm/huge_memory.c~mm-huge_memoryc-rework-the-function-vma_adjust_trans_huge
+++ a/mm/huge_memory.c
@@ -2301,44 +2301,38 @@ void split_huge_pmd_address(struct vm_ar
 	__split_huge_pmd(vma, pmd, address, freeze, page);
 }
 
+static inline void split_huge_pmd_if_needed(struct vm_area_struct *vma, unsigned long address)
+{
+	/*
+	 * If the new address isn't hpage aligned and it could previously
+	 * contain an hugepage: check if we need to split an huge pmd.
+	 */
+	if (!IS_ALIGNED(address, HPAGE_PMD_SIZE) &&
+	    range_in_vma(vma, ALIGN_DOWN(address, HPAGE_PMD_SIZE),
+			 ALIGN(address, HPAGE_PMD_SIZE)))
+		split_huge_pmd_address(vma, address, false, NULL);
+}
+
 void vma_adjust_trans_huge(struct vm_area_struct *vma,
 			     unsigned long start,
 			     unsigned long end,
 			     long adjust_next)
 {
-	/*
-	 * If the new start address isn't hpage aligned and it could
-	 * previously contain an hugepage: check if we need to split
-	 * an huge pmd.
-	 */
-	if (start & ~HPAGE_PMD_MASK &&
-	    (start & HPAGE_PMD_MASK) >= vma->vm_start &&
-	    (start & HPAGE_PMD_MASK) + HPAGE_PMD_SIZE <= vma->vm_end)
-		split_huge_pmd_address(vma, start, false, NULL);
+	/* Check if we need to split start first. */
+	split_huge_pmd_if_needed(vma, start);
 
-	/*
-	 * If the new end address isn't hpage aligned and it could
-	 * previously contain an hugepage: check if we need to split
-	 * an huge pmd.
-	 */
-	if (end & ~HPAGE_PMD_MASK &&
-	    (end & HPAGE_PMD_MASK) >= vma->vm_start &&
-	    (end & HPAGE_PMD_MASK) + HPAGE_PMD_SIZE <= vma->vm_end)
-		split_huge_pmd_address(vma, end, false, NULL);
+	/* Check if we need to split end next. */
+	split_huge_pmd_if_needed(vma, end);
 
 	/*
-	 * If we're also updating the vma->vm_next->vm_start, if the new
-	 * vm_next->vm_start isn't hpage aligned and it could previously
-	 * contain an hugepage: check if we need to split an huge pmd.
+	 * If we're also updating the vma->vm_next->vm_start,
+	 * check if we need to split it.
 	 */
 	if (adjust_next > 0) {
 		struct vm_area_struct *next = vma->vm_next;
 		unsigned long nstart = next->vm_start;
 		nstart += adjust_next;
-		if (nstart & ~HPAGE_PMD_MASK &&
-		    (nstart & HPAGE_PMD_MASK) >= next->vm_start &&
-		    (nstart & HPAGE_PMD_MASK) + HPAGE_PMD_SIZE <= next->vm_end)
-			split_huge_pmd_address(next, nstart, false, NULL);
+		split_huge_pmd_if_needed(next, nstart);
 	}
 }
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 023/143] mm/huge_memory.c: make get_huge_zero_page() return bool
  2021-05-05  1:32 incoming Andrew Morton
                   ` (21 preceding siblings ...)
  2021-05-05  1:33 ` [patch 022/143] mm/huge_memory.c: rework the function vma_adjust_trans_huge() Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:33 ` [patch 024/143] mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly Andrew Morton
                   ` (117 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx,
	rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken,
	william.kucharski, willy, yang.shi, yulei.kernel, ziy

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/huge_memory.c: make get_huge_zero_page() return bool

It's guaranteed that huge_zero_page will not be NULL if huge_zero_refcount
is increased successfully.  When READ_ONCE(huge_zero_page) is returned,
there must be a huge_zero_page and it can be replaced with returning
'true' when we do not care about the value of huge_zero_page.  We can thus
make it return bool to save READ_ONCE cpu cycles as the return value is
just used to check if huge_zero_page exists.

Link: https://lkml.kernel.org/r/20210318122722.13135-3-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Zi Yan <ziy@nvidia.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Michel Lespinasse <walken@google.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Wei Yang <richard.weiyang@linux.alibaba.com>
Cc: William Kucharski <william.kucharski@oracle.com>
Cc: Yang Shi <yang.shi@linux.alibaba.com>
Cc: yuleixzhang <yulei.kernel@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/huge_memory.c |    8 ++++----
 1 file changed, 4 insertions(+), 4 deletions(-)

--- a/mm/huge_memory.c~mm-huge_memoryc-make-get_huge_zero_page-return-bool
+++ a/mm/huge_memory.c
@@ -77,18 +77,18 @@ bool transparent_hugepage_enabled(struct
 	return false;
 }
 
-static struct page *get_huge_zero_page(void)
+static bool get_huge_zero_page(void)
 {
 	struct page *zero_page;
 retry:
 	if (likely(atomic_inc_not_zero(&huge_zero_refcount)))
-		return READ_ONCE(huge_zero_page);
+		return true;
 
 	zero_page = alloc_pages((GFP_TRANSHUGE | __GFP_ZERO) & ~__GFP_MOVABLE,
 			HPAGE_PMD_ORDER);
 	if (!zero_page) {
 		count_vm_event(THP_ZERO_PAGE_ALLOC_FAILED);
-		return NULL;
+		return false;
 	}
 	count_vm_event(THP_ZERO_PAGE_ALLOC);
 	preempt_disable();
@@ -101,7 +101,7 @@ retry:
 	/* We take additional reference here. It will be put back by shrinker */
 	atomic_set(&huge_zero_refcount, 2);
 	preempt_enable();
-	return READ_ONCE(huge_zero_page);
+	return true;
 }
 
 static void put_huge_zero_page(void)
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 024/143] mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly
  2021-05-05  1:32 incoming Andrew Morton
                   ` (22 preceding siblings ...)
  2021-05-05  1:33 ` [patch 023/143] mm/huge_memory.c: make get_huge_zero_page() return bool Andrew Morton
@ 2021-05-05  1:33 ` Andrew Morton
  2021-05-05  1:34 ` [patch 025/143] mm/huge_memory.c: remove redundant PageCompound() check Andrew Morton
                   ` (116 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:33 UTC (permalink / raw)
  To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx,
	rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken,
	william.kucharski, willy, yang.shi, yulei.kernel, ziy

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly

The current code that checks if migrating misplaced transhuge page is
needed is pretty hard to follow.  Rework it and add a comment to make its
logic more clear and improve readability.

Link: https://lkml.kernel.org/r/20210318122722.13135-4-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Zi Yan <ziy@nvidia.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Michel Lespinasse <walken@google.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Wei Yang <richard.weiyang@linux.alibaba.com>
Cc: William Kucharski <william.kucharski@oracle.com>
Cc: Yang Shi <yang.shi@linux.alibaba.com>
Cc: yuleixzhang <yulei.kernel@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/huge_memory.c |   11 +++++------
 1 file changed, 5 insertions(+), 6 deletions(-)

--- a/mm/huge_memory.c~mm-huge_memoryc-rework-the-function-do_huge_pmd_numa_page-slightly
+++ a/mm/huge_memory.c
@@ -1462,12 +1462,6 @@ vm_fault_t do_huge_pmd_numa_page(struct
 	 */
 	page_locked = trylock_page(page);
 	target_nid = mpol_misplaced(page, vma, haddr);
-	if (target_nid == NUMA_NO_NODE) {
-		/* If the page was locked, there are no parallel migrations */
-		if (page_locked)
-			goto clear_pmdnuma;
-	}
-
 	/* Migration could have started since the pmd_trans_migrating check */
 	if (!page_locked) {
 		page_nid = NUMA_NO_NODE;
@@ -1476,6 +1470,11 @@ vm_fault_t do_huge_pmd_numa_page(struct
 		spin_unlock(vmf->ptl);
 		put_and_wait_on_page_locked(page, TASK_UNINTERRUPTIBLE);
 		goto out;
+	} else if (target_nid == NUMA_NO_NODE) {
+		/* There are no parallel migrations and page is in the right
+		 * node. Clear the numa hinting info in this pmd.
+		 */
+		goto clear_pmdnuma;
 	}
 
 	/*
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 025/143] mm/huge_memory.c: remove redundant PageCompound() check
  2021-05-05  1:32 incoming Andrew Morton
                   ` (23 preceding siblings ...)
  2021-05-05  1:33 ` [patch 024/143] mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 026/143] mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG Andrew Morton
                   ` (115 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx,
	rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken,
	william.kucharski, willy, yang.shi, yulei.kernel, ziy

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/huge_memory.c: remove redundant PageCompound() check

The !PageCompound() check limits the page must be head or tail while
!PageHead() further limits it to page head only.  So !PageHead() check is
equivalent here.

Link: https://lkml.kernel.org/r/20210318122722.13135-5-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Michel Lespinasse <walken@google.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Wei Yang <richard.weiyang@linux.alibaba.com>
Cc: William Kucharski <william.kucharski@oracle.com>
Cc: Yang Shi <yang.shi@linux.alibaba.com>
Cc: yuleixzhang <yulei.kernel@gmail.com>
Cc: Zi Yan <ziy@nvidia.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/huge_memory.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/mm/huge_memory.c~mm-huge_memoryc-remove-redundant-pagecompound-check
+++ a/mm/huge_memory.c
@@ -1291,7 +1291,7 @@ vm_fault_t do_huge_pmd_wp_page(struct vm
 	}
 
 	page = pmd_page(orig_pmd);
-	VM_BUG_ON_PAGE(!PageCompound(page) || !PageHead(page), page);
+	VM_BUG_ON_PAGE(!PageHead(page), page);
 
 	/* Lock page for reuse_swap_page() */
 	if (!trylock_page(page)) {
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 026/143] mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG
  2021-05-05  1:32 incoming Andrew Morton
                   ` (24 preceding siblings ...)
  2021-05-05  1:34 ` [patch 025/143] mm/huge_memory.c: remove redundant PageCompound() check Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 027/143] mm/huge_memory.c: use helper function migration_entry_to_page() Andrew Morton
                   ` (114 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx,
	rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken,
	william.kucharski, willy, yang.shi, yulei.kernel, ziy

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG

Commit 4958e4d86ecb ("mm: thp: remove debug_cow switch") forgot to remove
TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG macro.  Remove it here.

Link: https://lkml.kernel.org/r/20210318122722.13135-6-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Zi Yan <ziy@nvidia.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Michel Lespinasse <walken@google.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Wei Yang <richard.weiyang@linux.alibaba.com>
Cc: William Kucharski <william.kucharski@oracle.com>
Cc: Yang Shi <yang.shi@linux.alibaba.com>
Cc: yuleixzhang <yulei.kernel@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/huge_mm.h |    3 ---
 1 file changed, 3 deletions(-)

--- a/include/linux/huge_mm.h~mm-huge_memoryc-remove-unused-macro-transparent_hugepage_debug_cow_flag
+++ a/include/linux/huge_mm.h
@@ -87,9 +87,6 @@ enum transparent_hugepage_flag {
 	TRANSPARENT_HUGEPAGE_DEFRAG_REQ_MADV_FLAG,
 	TRANSPARENT_HUGEPAGE_DEFRAG_KHUGEPAGED_FLAG,
 	TRANSPARENT_HUGEPAGE_USE_ZERO_PAGE_FLAG,
-#ifdef CONFIG_DEBUG_VM
-	TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG,
-#endif
 };
 
 struct kobject;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 027/143] mm/huge_memory.c: use helper function migration_entry_to_page()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (25 preceding siblings ...)
  2021-05-05  1:34 ` [patch 026/143] mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 028/143] mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable Andrew Morton
                   ` (113 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx,
	rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken,
	william.kucharski, willy, yang.shi, yulei.kernel, ziy

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/huge_memory.c: use helper function migration_entry_to_page()

It's more recommended to use helper function migration_entry_to_page() to
get the page via migration entry.  We can also enjoy the PageLocked()
check there.

Link: https://lkml.kernel.org/r/20210318122722.13135-7-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Michel Lespinasse <walken@google.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Wei Yang <richard.weiyang@linux.alibaba.com>
Cc: William Kucharski <william.kucharski@oracle.com>
Cc: Yang Shi <yang.shi@linux.alibaba.com>
Cc: yuleixzhang <yulei.kernel@gmail.com>
Cc: Zi Yan <ziy@nvidia.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/huge_memory.c |    4 ++--
 1 file changed, 2 insertions(+), 2 deletions(-)

--- a/mm/huge_memory.c~mm-huge_memoryc-use-helper-function-migration_entry_to_page
+++ a/mm/huge_memory.c
@@ -1693,7 +1693,7 @@ int zap_huge_pmd(struct mmu_gather *tlb,
 
 			VM_BUG_ON(!is_pmd_migration_entry(orig_pmd));
 			entry = pmd_to_swp_entry(orig_pmd);
-			page = pfn_to_page(swp_offset(entry));
+			page = migration_entry_to_page(entry);
 			flush_needed = 0;
 		} else
 			WARN_ONCE(1, "Non present huge pmd without pmd migration enabled!");
@@ -2101,7 +2101,7 @@ static void __split_huge_pmd_locked(stru
 		swp_entry_t entry;
 
 		entry = pmd_to_swp_entry(old_pmd);
-		page = pfn_to_page(swp_offset(entry));
+		page = migration_entry_to_page(entry);
 		write = is_write_migration_entry(entry);
 		young = false;
 		soft_dirty = pmd_swp_soft_dirty(old_pmd);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 028/143] mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable
  2021-05-05  1:32 incoming Andrew Morton
                   ` (26 preceding siblings ...)
  2021-05-05  1:34 ` [patch 027/143] mm/huge_memory.c: use helper function migration_entry_to_page() Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 029/143] khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp() Andrew Morton
                   ` (112 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, kirill.shutemov, linux-mm, mike.kravetz, mm-commits,
	torvalds, yanfei.xu

From: Yanfei Xu <yanfei.xu@windriver.com>
Subject: mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable

READ_ONCE() is more selective and lightweight.  It is more appropriate
that using a READ_ONCE() for the certain variable to prevent the compiler
from reordering.

Link: https://lkml.kernel.org/r/20210323092730.247583-1-yanfei.xu@windriver.com
Signed-off-by: Yanfei Xu <yanfei.xu@windriver.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/khugepaged.c |    4 +---
 1 file changed, 1 insertion(+), 3 deletions(-)

--- a/mm/khugepaged.c~khugepaged-raplace-barrier-with-read_once-for-a-selective-variable
+++ a/mm/khugepaged.c
@@ -2202,11 +2202,9 @@ static void khugepaged_do_scan(void)
 {
 	struct page *hpage = NULL;
 	unsigned int progress = 0, pass_through_head = 0;
-	unsigned int pages = khugepaged_pages_to_scan;
+	unsigned int pages = READ_ONCE(khugepaged_pages_to_scan);
 	bool wait = true;
 
-	barrier(); /* write khugepaged_pages_to_scan to local stack */
-
 	lru_add_drain_all();
 
 	while (progress < pages) {
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 029/143] khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (27 preceding siblings ...)
  2021-05-05  1:34 ` [patch 028/143] mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 030/143] khugepaged: remove unnecessary out label in collapse_huge_page() Andrew Morton
                   ` (111 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds,
	ziy

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp()

Patch series "Cleanup for khugepaged".

This series contains cleanups to remove unnecessary out label and
meaningless !pte_present() check.  Also use helper function to simplify
the code.  More details can be found in the respective changelogs.


This patch (of 3):

We could use helper function range_in_vma() to check whether the desired
range is inside the vma to simplify the code.

Link: https://lkml.kernel.org/r/20210325135647.64106-1-linmiaohe@huawei.com
Link: https://lkml.kernel.org/r/20210325135647.64106-2-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Zi Yan <ziy@nvidia.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/khugepaged.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/mm/khugepaged.c~khugepaged-use-helper-function-range_in_vma-in-collapse_pte_mapped_thp
+++ a/mm/khugepaged.c
@@ -1446,7 +1446,7 @@ void collapse_pte_mapped_thp(struct mm_s
 	int i;
 
 	if (!vma || !vma->vm_file ||
-	    vma->vm_start > haddr || vma->vm_end < haddr + HPAGE_PMD_SIZE)
+	    !range_in_vma(vma, haddr, haddr + HPAGE_PMD_SIZE))
 		return;
 
 	/*
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 030/143] khugepaged: remove unnecessary out label in collapse_huge_page()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (28 preceding siblings ...)
  2021-05-05  1:34 ` [patch 029/143] khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp() Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 031/143] khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd() Andrew Morton
                   ` (110 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds,
	ziy

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: khugepaged: remove unnecessary out label in collapse_huge_page()

The out label here is unneeded because it just goes to out_up_write label.
Remove it to make code more concise.

Link: https://lkml.kernel.org/r/20210325135647.64106-3-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Zi Yan <ziy@nvidia.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/khugepaged.c |    8 +++-----
 1 file changed, 3 insertions(+), 5 deletions(-)

--- a/mm/khugepaged.c~khugepaged-remove-unnecessary-out-label-in-collapse_huge_page
+++ a/mm/khugepaged.c
@@ -1128,10 +1128,10 @@ static void collapse_huge_page(struct mm
 	mmap_write_lock(mm);
 	result = hugepage_vma_revalidate(mm, address, &vma);
 	if (result)
-		goto out;
+		goto out_up_write;
 	/* check if the pmd is still valid */
 	if (mm_find_pmd(mm, address) != pmd)
-		goto out;
+		goto out_up_write;
 
 	anon_vma_lock_write(vma->anon_vma);
 
@@ -1171,7 +1171,7 @@ static void collapse_huge_page(struct mm
 		spin_unlock(pmd_ptl);
 		anon_vma_unlock_write(vma->anon_vma);
 		result = SCAN_FAIL;
-		goto out;
+		goto out_up_write;
 	}
 
 	/*
@@ -1215,8 +1215,6 @@ out_nolock:
 		mem_cgroup_uncharge(*hpage);
 	trace_mm_collapse_huge_page(mm, isolated, result);
 	return;
-out:
-	goto out_up_write;
 }
 
 static int khugepaged_scan_pmd(struct mm_struct *mm,
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 031/143] khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (29 preceding siblings ...)
  2021-05-05  1:34 ` [patch 030/143] khugepaged: remove unnecessary out label in collapse_huge_page() Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 032/143] mm: huge_memory: a new debugfs interface for splitting THP tests Andrew Morton
                   ` (109 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds,
	ziy

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd()

We know it must meet the !is_swap_pte() and !pte_none() condition if we
reach here. Since !is_swap_pte() indicates pte_none() or pte_present()
is met, it's guaranteed that pte must be present here.

Link: https://lkml.kernel.org/r/20210325135647.64106-4-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Zi Yan <ziy@nvidia.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/khugepaged.c |    4 ----
 1 file changed, 4 deletions(-)

--- a/mm/khugepaged.c~khugepaged-remove-meaningless-pte_present-check-in-khugepaged_scan_pmd
+++ a/mm/khugepaged.c
@@ -1271,10 +1271,6 @@ static int khugepaged_scan_pmd(struct mm
 				goto out_unmap;
 			}
 		}
-		if (!pte_present(pteval)) {
-			result = SCAN_PTE_NON_PRESENT;
-			goto out_unmap;
-		}
 		if (pte_uffd_wp(pteval)) {
 			/*
 			 * Don't collapse the page if any of the small
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 032/143] mm: huge_memory: a new debugfs interface for splitting THP tests
  2021-05-05  1:32 incoming Andrew Morton
                   ` (30 preceding siblings ...)
  2021-05-05  1:34 ` [patch 031/143] khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd() Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 033/143] mm: huge_memory: debugfs for file-backed THP split Andrew Morton
                   ` (108 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, david, jhubbard, kirill.shutemov, linux-mm, mika.penttila,
	mm-commits, rientjes, sandipan, shuah, shy828301, torvalds, willy,
	ziy

From: Zi Yan <ziy@nvidia.com>
Subject: mm: huge_memory: a new debugfs interface for splitting THP tests

We did not have a direct user interface of splitting the compound page
backing a THP and there is no need unless we want to expose the THP
implementation details to users.  Make <debugfs>/split_huge_pages accept a
new command to do that.

By writing "<pid>,<vaddr_start>,<vaddr_end>" to
<debugfs>/split_huge_pages, THPs within the given virtual address range
from the process with the given pid are split. It is used to test
split_huge_page function. In addition, a selftest program is added to
tools/testing/selftests/vm to utilize the interface by splitting
PMD THPs and PTE-mapped THPs.

This does not change the old behavior, i.e., writing 1 to the interface
to split all THPs in the system.

Link: https://lkml.kernel.org/r/20210331235309.332292-1-zi.yan@sent.com
Signed-off-by: Zi Yan <ziy@nvidia.com>
Reviewed-by: Yang Shi <shy828301@gmail.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: "Kirill A . Shutemov" <kirill.shutemov@linux.intel.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mika Penttila <mika.penttila@nextfour.com>
Cc: Sandipan Das <sandipan@linux.ibm.com>
Cc: Shuah Khan <shuah@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/huge_memory.c                                  |  155 +++++
 tools/testing/selftests/vm/.gitignore             |    1 
 tools/testing/selftests/vm/Makefile               |    1 
 tools/testing/selftests/vm/split_huge_page_test.c |  318 ++++++++++++
 4 files changed, 467 insertions(+), 8 deletions(-)

--- a/mm/huge_memory.c~mm-huge_memory-a-new-debugfs-interface-for-splitting-thp-tests
+++ a/mm/huge_memory.c
@@ -7,6 +7,7 @@
 
 #include <linux/mm.h>
 #include <linux/sched.h>
+#include <linux/sched/mm.h>
 #include <linux/sched/coredump.h>
 #include <linux/sched/numa_balancing.h>
 #include <linux/highmem.h>
@@ -2915,16 +2916,14 @@ static struct shrinker deferred_split_sh
 };
 
 #ifdef CONFIG_DEBUG_FS
-static int split_huge_pages_set(void *data, u64 val)
+static void split_huge_pages_all(void)
 {
 	struct zone *zone;
 	struct page *page;
 	unsigned long pfn, max_zone_pfn;
 	unsigned long total = 0, split = 0;
 
-	if (val != 1)
-		return -EINVAL;
-
+	pr_debug("Split all THPs\n");
 	for_each_populated_zone(zone) {
 		max_zone_pfn = zone_end_pfn(zone);
 		for (pfn = zone->zone_start_pfn; pfn < max_zone_pfn; pfn++) {
@@ -2948,15 +2947,155 @@ static int split_huge_pages_set(void *da
 			unlock_page(page);
 next:
 			put_page(page);
+			cond_resched();
 		}
 	}
 
-	pr_info("%lu of %lu THP split\n", split, total);
+	pr_debug("%lu of %lu THP split\n", split, total);
+}
 
-	return 0;
+static inline bool vma_not_suitable_for_thp_split(struct vm_area_struct *vma)
+{
+	return vma_is_special_huge(vma) || (vma->vm_flags & VM_IO) ||
+		    is_vm_hugetlb_page(vma);
+}
+
+static int split_huge_pages_pid(int pid, unsigned long vaddr_start,
+				unsigned long vaddr_end)
+{
+	int ret = 0;
+	struct task_struct *task;
+	struct mm_struct *mm;
+	unsigned long total = 0, split = 0;
+	unsigned long addr;
+
+	vaddr_start &= PAGE_MASK;
+	vaddr_end &= PAGE_MASK;
+
+	/* Find the task_struct from pid */
+	rcu_read_lock();
+	task = find_task_by_vpid(pid);
+	if (!task) {
+		rcu_read_unlock();
+		ret = -ESRCH;
+		goto out;
+	}
+	get_task_struct(task);
+	rcu_read_unlock();
+
+	/* Find the mm_struct */
+	mm = get_task_mm(task);
+	put_task_struct(task);
+
+	if (!mm) {
+		ret = -EINVAL;
+		goto out;
+	}
+
+	pr_debug("Split huge pages in pid: %d, vaddr: [0x%lx - 0x%lx]\n",
+		 pid, vaddr_start, vaddr_end);
+
+	mmap_read_lock(mm);
+	/*
+	 * always increase addr by PAGE_SIZE, since we could have a PTE page
+	 * table filled with PTE-mapped THPs, each of which is distinct.
+	 */
+	for (addr = vaddr_start; addr < vaddr_end; addr += PAGE_SIZE) {
+		struct vm_area_struct *vma = find_vma(mm, addr);
+		unsigned int follflags;
+		struct page *page;
+
+		if (!vma || addr < vma->vm_start)
+			break;
+
+		/* skip special VMA and hugetlb VMA */
+		if (vma_not_suitable_for_thp_split(vma)) {
+			addr = vma->vm_end;
+			continue;
+		}
+
+		/* FOLL_DUMP to ignore special (like zero) pages */
+		follflags = FOLL_GET | FOLL_DUMP;
+		page = follow_page(vma, addr, follflags);
+
+		if (IS_ERR(page))
+			continue;
+		if (!page)
+			continue;
+
+		if (!is_transparent_hugepage(page))
+			goto next;
+
+		total++;
+		if (!can_split_huge_page(compound_head(page), NULL))
+			goto next;
+
+		if (!trylock_page(page))
+			goto next;
+
+		if (!split_huge_page(page))
+			split++;
+
+		unlock_page(page);
+next:
+		put_page(page);
+		cond_resched();
+	}
+	mmap_read_unlock(mm);
+	mmput(mm);
+
+	pr_debug("%lu of %lu THP split\n", split, total);
+
+out:
+	return ret;
 }
-DEFINE_DEBUGFS_ATTRIBUTE(split_huge_pages_fops, NULL, split_huge_pages_set,
-		"%llu\n");
+
+#define MAX_INPUT_BUF_SZ 255
+
+static ssize_t split_huge_pages_write(struct file *file, const char __user *buf,
+				size_t count, loff_t *ppops)
+{
+	static DEFINE_MUTEX(split_debug_mutex);
+	ssize_t ret;
+	char input_buf[MAX_INPUT_BUF_SZ]; /* hold pid, start_vaddr, end_vaddr */
+	int pid;
+	unsigned long vaddr_start, vaddr_end;
+
+	ret = mutex_lock_interruptible(&split_debug_mutex);
+	if (ret)
+		return ret;
+
+	ret = -EFAULT;
+
+	memset(input_buf, 0, MAX_INPUT_BUF_SZ);
+	if (copy_from_user(input_buf, buf, min_t(size_t, count, MAX_INPUT_BUF_SZ)))
+		goto out;
+
+	input_buf[MAX_INPUT_BUF_SZ - 1] = '\0';
+	ret = sscanf(input_buf, "%d,0x%lx,0x%lx", &pid, &vaddr_start, &vaddr_end);
+	if (ret == 1 && pid == 1) {
+		split_huge_pages_all();
+		ret = strlen(input_buf);
+		goto out;
+	} else if (ret != 3) {
+		ret = -EINVAL;
+		goto out;
+	}
+
+	ret = split_huge_pages_pid(pid, vaddr_start, vaddr_end);
+	if (!ret)
+		ret = strlen(input_buf);
+out:
+	mutex_unlock(&split_debug_mutex);
+	return ret;
+
+}
+
+static const struct file_operations split_huge_pages_fops = {
+	.owner	 = THIS_MODULE,
+	.write	 = split_huge_pages_write,
+	.llseek  = no_llseek,
+};
 
 static int __init split_huge_pages_debugfs(void)
 {
--- a/tools/testing/selftests/vm/.gitignore~mm-huge_memory-a-new-debugfs-interface-for-splitting-thp-tests
+++ a/tools/testing/selftests/vm/.gitignore
@@ -22,3 +22,4 @@ map_fixed_noreplace
 write_to_hugetlbfs
 hmm-tests
 local_config.*
+split_huge_page_test
--- a/tools/testing/selftests/vm/Makefile~mm-huge_memory-a-new-debugfs-interface-for-splitting-thp-tests
+++ a/tools/testing/selftests/vm/Makefile
@@ -42,6 +42,7 @@ TEST_GEN_FILES += on-fault-limit
 TEST_GEN_FILES += thuge-gen
 TEST_GEN_FILES += transhuge-stress
 TEST_GEN_FILES += userfaultfd
+TEST_GEN_FILES += split_huge_page_test
 
 ifeq ($(MACHINE),x86_64)
 CAN_BUILD_I386 := $(shell ./../x86/check_cc.sh $(CC) ../x86/trivial_32bit_program.c -m32)
--- /dev/null
+++ a/tools/testing/selftests/vm/split_huge_page_test.c
@@ -0,0 +1,318 @@
+// SPDX-License-Identifier: GPL-2.0
+/*
+ * A test of splitting PMD THPs and PTE-mapped THPs from a specified virtual
+ * address range in a process via <debugfs>/split_huge_pages interface.
+ */
+
+#define _GNU_SOURCE
+#include <stdio.h>
+#include <stdlib.h>
+#include <unistd.h>
+#include <inttypes.h>
+#include <string.h>
+#include <fcntl.h>
+#include <sys/mman.h>
+#include <malloc.h>
+#include <stdbool.h>
+
+uint64_t pagesize;
+unsigned int pageshift;
+uint64_t pmd_pagesize;
+
+#define PMD_SIZE_PATH "/sys/kernel/mm/transparent_hugepage/hpage_pmd_size"
+#define SPLIT_DEBUGFS "/sys/kernel/debug/split_huge_pages"
+#define SMAP_PATH "/proc/self/smaps"
+#define INPUT_MAX 80
+
+#define PFN_MASK     ((1UL<<55)-1)
+#define KPF_THP      (1UL<<22)
+
+int is_backed_by_thp(char *vaddr, int pagemap_file, int kpageflags_file)
+{
+	uint64_t paddr;
+	uint64_t page_flags;
+
+	if (pagemap_file) {
+		pread(pagemap_file, &paddr, sizeof(paddr),
+			((long)vaddr >> pageshift) * sizeof(paddr));
+
+		if (kpageflags_file) {
+			pread(kpageflags_file, &page_flags, sizeof(page_flags),
+				(paddr & PFN_MASK) * sizeof(page_flags));
+
+			return !!(page_flags & KPF_THP);
+		}
+	}
+	return 0;
+}
+
+
+static uint64_t read_pmd_pagesize(void)
+{
+	int fd;
+	char buf[20];
+	ssize_t num_read;
+
+	fd = open(PMD_SIZE_PATH, O_RDONLY);
+	if (fd == -1) {
+		perror("Open hpage_pmd_size failed");
+		exit(EXIT_FAILURE);
+	}
+	num_read = read(fd, buf, 19);
+	if (num_read < 1) {
+		close(fd);
+		perror("Read hpage_pmd_size failed");
+		exit(EXIT_FAILURE);
+	}
+	buf[num_read] = '\0';
+	close(fd);
+
+	return strtoul(buf, NULL, 10);
+}
+
+static int write_file(const char *path, const char *buf, size_t buflen)
+{
+	int fd;
+	ssize_t numwritten;
+
+	fd = open(path, O_WRONLY);
+	if (fd == -1)
+		return 0;
+
+	numwritten = write(fd, buf, buflen - 1);
+	close(fd);
+	if (numwritten < 1)
+		return 0;
+
+	return (unsigned int) numwritten;
+}
+
+static void write_debugfs(int pid, uint64_t vaddr_start, uint64_t vaddr_end)
+{
+	char input[INPUT_MAX];
+	int ret;
+
+	ret = snprintf(input, INPUT_MAX, "%d,0x%lx,0x%lx", pid, vaddr_start,
+			vaddr_end);
+	if (ret >= INPUT_MAX) {
+		printf("%s: Debugfs input is too long\n", __func__);
+		exit(EXIT_FAILURE);
+	}
+
+	if (!write_file(SPLIT_DEBUGFS, input, ret + 1)) {
+		perror(SPLIT_DEBUGFS);
+		exit(EXIT_FAILURE);
+	}
+}
+
+#define MAX_LINE_LENGTH 500
+
+static bool check_for_pattern(FILE *fp, const char *pattern, char *buf)
+{
+	while (fgets(buf, MAX_LINE_LENGTH, fp) != NULL) {
+		if (!strncmp(buf, pattern, strlen(pattern)))
+			return true;
+	}
+	return false;
+}
+
+static uint64_t check_huge(void *addr)
+{
+	uint64_t thp = 0;
+	int ret;
+	FILE *fp;
+	char buffer[MAX_LINE_LENGTH];
+	char addr_pattern[MAX_LINE_LENGTH];
+
+	ret = snprintf(addr_pattern, MAX_LINE_LENGTH, "%08lx-",
+		       (unsigned long) addr);
+	if (ret >= MAX_LINE_LENGTH) {
+		printf("%s: Pattern is too long\n", __func__);
+		exit(EXIT_FAILURE);
+	}
+
+
+	fp = fopen(SMAP_PATH, "r");
+	if (!fp) {
+		printf("%s: Failed to open file %s\n", __func__, SMAP_PATH);
+		exit(EXIT_FAILURE);
+	}
+	if (!check_for_pattern(fp, addr_pattern, buffer))
+		goto err_out;
+
+	/*
+	 * Fetch the AnonHugePages: in the same block and check the number of
+	 * hugepages.
+	 */
+	if (!check_for_pattern(fp, "AnonHugePages:", buffer))
+		goto err_out;
+
+	if (sscanf(buffer, "AnonHugePages:%10ld kB", &thp) != 1) {
+		printf("Reading smap error\n");
+		exit(EXIT_FAILURE);
+	}
+
+err_out:
+	fclose(fp);
+	return thp;
+}
+
+void split_pmd_thp(void)
+{
+	char *one_page;
+	size_t len = 4 * pmd_pagesize;
+	uint64_t thp_size;
+	size_t i;
+
+	one_page = memalign(pmd_pagesize, len);
+
+	if (!one_page) {
+		printf("Fail to allocate memory\n");
+		exit(EXIT_FAILURE);
+	}
+
+	madvise(one_page, len, MADV_HUGEPAGE);
+
+	for (i = 0; i < len; i++)
+		one_page[i] = (char)i;
+
+	thp_size = check_huge(one_page);
+	if (!thp_size) {
+		printf("No THP is allocated\n");
+		exit(EXIT_FAILURE);
+	}
+
+	/* split all THPs */
+	write_debugfs(getpid(), (uint64_t)one_page, (uint64_t)one_page + len);
+
+	for (i = 0; i < len; i++)
+		if (one_page[i] != (char)i) {
+			printf("%ld byte corrupted\n", i);
+			exit(EXIT_FAILURE);
+		}
+
+
+	thp_size = check_huge(one_page);
+	if (thp_size) {
+		printf("Still %ld kB AnonHugePages not split\n", thp_size);
+		exit(EXIT_FAILURE);
+	}
+
+	printf("Split huge pages successful\n");
+	free(one_page);
+}
+
+void split_pte_mapped_thp(void)
+{
+	char *one_page, *pte_mapped, *pte_mapped2;
+	size_t len = 4 * pmd_pagesize;
+	uint64_t thp_size;
+	size_t i;
+	const char *pagemap_template = "/proc/%d/pagemap";
+	const char *kpageflags_proc = "/proc/kpageflags";
+	char pagemap_proc[255];
+	int pagemap_fd;
+	int kpageflags_fd;
+
+	if (snprintf(pagemap_proc, 255, pagemap_template, getpid()) < 0) {
+		perror("get pagemap proc error");
+		exit(EXIT_FAILURE);
+	}
+	pagemap_fd = open(pagemap_proc, O_RDONLY);
+
+	if (pagemap_fd == -1) {
+		perror("read pagemap:");
+		exit(EXIT_FAILURE);
+	}
+
+	kpageflags_fd = open(kpageflags_proc, O_RDONLY);
+
+	if (kpageflags_fd == -1) {
+		perror("read kpageflags:");
+		exit(EXIT_FAILURE);
+	}
+
+	one_page = mmap((void *)(1UL << 30), len, PROT_READ | PROT_WRITE,
+			MAP_ANONYMOUS | MAP_PRIVATE, -1, 0);
+
+	madvise(one_page, len, MADV_HUGEPAGE);
+
+	for (i = 0; i < len; i++)
+		one_page[i] = (char)i;
+
+	thp_size = check_huge(one_page);
+	if (!thp_size) {
+		printf("No THP is allocated\n");
+		exit(EXIT_FAILURE);
+	}
+
+	/* remap the first pagesize of first THP */
+	pte_mapped = mremap(one_page, pagesize, pagesize, MREMAP_MAYMOVE);
+
+	/* remap the Nth pagesize of Nth THP */
+	for (i = 1; i < 4; i++) {
+		pte_mapped2 = mremap(one_page + pmd_pagesize * i + pagesize * i,
+				     pagesize, pagesize,
+				     MREMAP_MAYMOVE|MREMAP_FIXED,
+				     pte_mapped + pagesize * i);
+		if (pte_mapped2 == (char *)-1) {
+			perror("mremap failed");
+			exit(EXIT_FAILURE);
+		}
+	}
+
+	/* smap does not show THPs after mremap, use kpageflags instead */
+	thp_size = 0;
+	for (i = 0; i < pagesize * 4; i++)
+		if (i % pagesize == 0 &&
+		    is_backed_by_thp(&pte_mapped[i], pagemap_fd, kpageflags_fd))
+			thp_size++;
+
+	if (thp_size != 4) {
+		printf("Some THPs are missing during mremap\n");
+		exit(EXIT_FAILURE);
+	}
+
+	/* split all remapped THPs */
+	write_debugfs(getpid(), (uint64_t)pte_mapped,
+		      (uint64_t)pte_mapped + pagesize * 4);
+
+	/* smap does not show THPs after mremap, use kpageflags instead */
+	thp_size = 0;
+	for (i = 0; i < pagesize * 4; i++) {
+		if (pte_mapped[i] != (char)i) {
+			printf("%ld byte corrupted\n", i);
+			exit(EXIT_FAILURE);
+		}
+		if (i % pagesize == 0 &&
+		    is_backed_by_thp(&pte_mapped[i], pagemap_fd, kpageflags_fd))
+			thp_size++;
+	}
+
+	if (thp_size) {
+		printf("Still %ld THPs not split\n", thp_size);
+		exit(EXIT_FAILURE);
+	}
+
+	printf("Split PTE-mapped huge pages successful\n");
+	munmap(one_page, len);
+	close(pagemap_fd);
+	close(kpageflags_fd);
+}
+
+int main(int argc, char **argv)
+{
+	if (geteuid() != 0) {
+		printf("Please run the benchmark as root\n");
+		exit(EXIT_FAILURE);
+	}
+
+	pagesize = getpagesize();
+	pageshift = ffs(pagesize) - 1;
+	pmd_pagesize = read_pmd_pagesize();
+
+	split_pmd_thp();
+	split_pte_mapped_thp();
+
+	return 0;
+}
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 033/143] mm: huge_memory: debugfs for file-backed THP split
  2021-05-05  1:32 incoming Andrew Morton
                   ` (31 preceding siblings ...)
  2021-05-05  1:34 ` [patch 032/143] mm: huge_memory: a new debugfs interface for splitting THP tests Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 034/143] mm/hugeltb: remove redundant VM_BUG_ON() in region_add() Andrew Morton
                   ` (107 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, david, jhubbard, kirill.shutemov, linux-mm, mika.penttila,
	mm-commits, rientjes, sandipan, shuah, shy828301, torvalds, willy,
	ziy

From: Zi Yan <ziy@nvidia.com>
Subject: mm: huge_memory: debugfs for file-backed THP split

Further extend <debugfs>/split_huge_pages to accept
"<path>,<pgoff_start>,<pgoff_end>" for file-backed THP split tests since
tmpfs may have file backed by THP that mapped nowhere.

Update selftest program to test file-backed THP split too.

Link: https://lkml.kernel.org/r/20210331235309.332292-2-zi.yan@sent.com
Signed-off-by: Zi Yan <ziy@nvidia.com>
Suggested-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Reviewed-by: Yang Shi <shy828301@gmail.com>
Cc: "Kirill A . Shutemov" <kirill.shutemov@linux.intel.com>
Cc: Shuah Khan <shuah@kernel.org>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Sandipan Das <sandipan@linux.ibm.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: Mika Penttila <mika.penttila@nextfour.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Matthew Wilcox <willy@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/huge_memory.c                                  |   90 +++++++++++-
 tools/testing/selftests/vm/split_huge_page_test.c |   82 ++++++++++
 2 files changed, 166 insertions(+), 6 deletions(-)

--- a/mm/huge_memory.c~mm-huge_memory-debugfs-for-file-backed-thp-split
+++ a/mm/huge_memory.c
@@ -3050,6 +3050,65 @@ out:
 	return ret;
 }
 
+static int split_huge_pages_in_file(const char *file_path, pgoff_t off_start,
+				pgoff_t off_end)
+{
+	struct filename *file;
+	struct file *candidate;
+	struct address_space *mapping;
+	int ret = -EINVAL;
+	pgoff_t index;
+	int nr_pages = 1;
+	unsigned long total = 0, split = 0;
+
+	file = getname_kernel(file_path);
+	if (IS_ERR(file))
+		return ret;
+
+	candidate = file_open_name(file, O_RDONLY, 0);
+	if (IS_ERR(candidate))
+		goto out;
+
+	pr_debug("split file-backed THPs in file: %s, page offset: [0x%lx - 0x%lx]\n",
+		 file_path, off_start, off_end);
+
+	mapping = candidate->f_mapping;
+
+	for (index = off_start; index < off_end; index += nr_pages) {
+		struct page *fpage = pagecache_get_page(mapping, index,
+						FGP_ENTRY | FGP_HEAD, 0);
+
+		nr_pages = 1;
+		if (xa_is_value(fpage) || !fpage)
+			continue;
+
+		if (!is_transparent_hugepage(fpage))
+			goto next;
+
+		total++;
+		nr_pages = thp_nr_pages(fpage);
+
+		if (!trylock_page(fpage))
+			goto next;
+
+		if (!split_huge_page(fpage))
+			split++;
+
+		unlock_page(fpage);
+next:
+		put_page(fpage);
+		cond_resched();
+	}
+
+	filp_close(candidate, NULL);
+	ret = 0;
+
+	pr_debug("%lu of %lu file-backed THP split\n", split, total);
+out:
+	putname(file);
+	return ret;
+}
+
 #define MAX_INPUT_BUF_SZ 255
 
 static ssize_t split_huge_pages_write(struct file *file, const char __user *buf,
@@ -3057,7 +3116,8 @@ static ssize_t split_huge_pages_write(st
 {
 	static DEFINE_MUTEX(split_debug_mutex);
 	ssize_t ret;
-	char input_buf[MAX_INPUT_BUF_SZ]; /* hold pid, start_vaddr, end_vaddr */
+	/* hold pid, start_vaddr, end_vaddr or file_path, off_start, off_end */
+	char input_buf[MAX_INPUT_BUF_SZ];
 	int pid;
 	unsigned long vaddr_start, vaddr_end;
 
@@ -3072,6 +3132,34 @@ static ssize_t split_huge_pages_write(st
 		goto out;
 
 	input_buf[MAX_INPUT_BUF_SZ - 1] = '\0';
+
+	if (input_buf[0] == '/') {
+		char *tok;
+		char *buf = input_buf;
+		char file_path[MAX_INPUT_BUF_SZ];
+		pgoff_t off_start = 0, off_end = 0;
+		size_t input_len = strlen(input_buf);
+
+		tok = strsep(&buf, ",");
+		if (tok) {
+			strncpy(file_path, tok, MAX_INPUT_BUF_SZ);
+		} else {
+			ret = -EINVAL;
+			goto out;
+		}
+
+		ret = sscanf(buf, "0x%lx,0x%lx", &off_start, &off_end);
+		if (ret != 2) {
+			ret = -EINVAL;
+			goto out;
+		}
+		ret = split_huge_pages_in_file(file_path, off_start, off_end);
+		if (!ret)
+			ret = input_len;
+
+		goto out;
+	}
+
 	ret = sscanf(input_buf, "%d,0x%lx,0x%lx", &pid, &vaddr_start, &vaddr_end);
 	if (ret == 1 && pid == 1) {
 		split_huge_pages_all();
--- a/tools/testing/selftests/vm/split_huge_page_test.c~mm-huge_memory-debugfs-for-file-backed-thp-split
+++ a/tools/testing/selftests/vm/split_huge_page_test.c
@@ -7,11 +7,13 @@
 #define _GNU_SOURCE
 #include <stdio.h>
 #include <stdlib.h>
+#include <stdarg.h>
 #include <unistd.h>
 #include <inttypes.h>
 #include <string.h>
 #include <fcntl.h>
 #include <sys/mman.h>
+#include <sys/mount.h>
 #include <malloc.h>
 #include <stdbool.h>
 
@@ -24,6 +26,9 @@ uint64_t pmd_pagesize;
 #define SMAP_PATH "/proc/self/smaps"
 #define INPUT_MAX 80
 
+#define PID_FMT "%d,0x%lx,0x%lx"
+#define PATH_FMT "%s,0x%lx,0x%lx"
+
 #define PFN_MASK     ((1UL<<55)-1)
 #define KPF_THP      (1UL<<22)
 
@@ -87,13 +92,16 @@ static int write_file(const char *path,
 	return (unsigned int) numwritten;
 }
 
-static void write_debugfs(int pid, uint64_t vaddr_start, uint64_t vaddr_end)
+static void write_debugfs(const char *fmt, ...)
 {
 	char input[INPUT_MAX];
 	int ret;
+	va_list argp;
+
+	va_start(argp, fmt);
+	ret = vsnprintf(input, INPUT_MAX, fmt, argp);
+	va_end(argp);
 
-	ret = snprintf(input, INPUT_MAX, "%d,0x%lx,0x%lx", pid, vaddr_start,
-			vaddr_end);
 	if (ret >= INPUT_MAX) {
 		printf("%s: Debugfs input is too long\n", __func__);
 		exit(EXIT_FAILURE);
@@ -183,7 +191,8 @@ void split_pmd_thp(void)
 	}
 
 	/* split all THPs */
-	write_debugfs(getpid(), (uint64_t)one_page, (uint64_t)one_page + len);
+	write_debugfs(PID_FMT, getpid(), (uint64_t)one_page,
+		(uint64_t)one_page + len);
 
 	for (i = 0; i < len; i++)
 		if (one_page[i] != (char)i) {
@@ -274,7 +283,7 @@ void split_pte_mapped_thp(void)
 	}
 
 	/* split all remapped THPs */
-	write_debugfs(getpid(), (uint64_t)pte_mapped,
+	write_debugfs(PID_FMT, getpid(), (uint64_t)pte_mapped,
 		      (uint64_t)pte_mapped + pagesize * 4);
 
 	/* smap does not show THPs after mremap, use kpageflags instead */
@@ -300,6 +309,68 @@ void split_pte_mapped_thp(void)
 	close(kpageflags_fd);
 }
 
+void split_file_backed_thp(void)
+{
+	int status;
+	int fd;
+	ssize_t num_written;
+	char tmpfs_template[] = "/tmp/thp_split_XXXXXX";
+	const char *tmpfs_loc = mkdtemp(tmpfs_template);
+	char testfile[INPUT_MAX];
+	uint64_t pgoff_start = 0, pgoff_end = 1024;
+
+	printf("Please enable pr_debug in split_huge_pages_in_file() if you need more info.\n");
+
+	status = mount("tmpfs", tmpfs_loc, "tmpfs", 0, "huge=always,size=4m");
+
+	if (status) {
+		printf("Unable to create a tmpfs for testing\n");
+		exit(EXIT_FAILURE);
+	}
+
+	status = snprintf(testfile, INPUT_MAX, "%s/thp_file", tmpfs_loc);
+	if (status >= INPUT_MAX) {
+		printf("Fail to create file-backed THP split testing file\n");
+		goto cleanup;
+	}
+
+	fd = open(testfile, O_CREAT|O_WRONLY);
+	if (fd == -1) {
+		perror("Cannot open testing file\n");
+		goto cleanup;
+	}
+
+	/* write something to the file, so a file-backed THP can be allocated */
+	num_written = write(fd, tmpfs_loc, sizeof(tmpfs_loc));
+	close(fd);
+
+	if (num_written < 1) {
+		printf("Fail to write data to testing file\n");
+		goto cleanup;
+	}
+
+	/* split the file-backed THP */
+	write_debugfs(PATH_FMT, testfile, pgoff_start, pgoff_end);
+
+	status = unlink(testfile);
+	if (status)
+		perror("Cannot remove testing file\n");
+
+cleanup:
+	status = umount(tmpfs_loc);
+	if (status) {
+		printf("Unable to umount %s\n", tmpfs_loc);
+		exit(EXIT_FAILURE);
+	}
+	status = rmdir(tmpfs_loc);
+	if (status) {
+		perror("cannot remove tmp dir");
+		exit(EXIT_FAILURE);
+	}
+
+	printf("file-backed THP split test done, please check dmesg for more information\n");
+}
+
 int main(int argc, char **argv)
 {
 	if (geteuid() != 0) {
@@ -313,6 +384,7 @@ int main(int argc, char **argv)
 
 	split_pmd_thp();
 	split_pte_mapped_thp();
+	split_file_backed_thp();
 
 	return 0;
 }
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 034/143] mm/hugeltb: remove redundant VM_BUG_ON() in region_add()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (32 preceding siblings ...)
  2021-05-05  1:34 ` [patch 033/143] mm: huge_memory: debugfs for file-backed THP split Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 035/143] mm/hugeltb: simplify the return code of __vma_reservation_common() Andrew Morton
                   ` (106 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, linfeilong, linmiaohe, linux-mm, mike.kravetz, mm-commits,
	torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugeltb: remove redundant VM_BUG_ON() in region_add()

Patch series "Cleanup and fixup for hugetlb", v2.

This series contains cleanups to remove redundant VM_BUG_ON() and simplify
the return code.  Also this handles the error case in
hugetlb_fix_reserve_counts() correctly.  More details can be found in the
respective changelogs.


This patch (of 5):

The same VM_BUG_ON() check is already done in the callee.  Remove this
extra one to simplify the code slightly.

Link: https://lkml.kernel.org/r/20210410072348.20437-1-linmiaohe@huawei.com
Link: https://lkml.kernel.org/r/20210410072348.20437-2-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Feilong Lin <linfeilong@huawei.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |    1 -
 1 file changed, 1 deletion(-)

--- a/mm/hugetlb.c~mm-hugeltb-remove-redundant-vm_bug_on-in-region_add
+++ a/mm/hugetlb.c
@@ -553,7 +553,6 @@ retry:
 	resv->adds_in_progress -= in_regions_needed;
 
 	spin_unlock(&resv->lock);
-	VM_BUG_ON(add < 0);
 	return add;
 }
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 035/143] mm/hugeltb: simplify the return code of __vma_reservation_common()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (33 preceding siblings ...)
  2021-05-05  1:34 ` [patch 034/143] mm/hugeltb: remove redundant VM_BUG_ON() in region_add() Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 036/143] mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages() Andrew Morton
                   ` (105 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, linfeilong, linmiaohe, linux-mm, mike.kravetz, mm-commits,
	torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugeltb: simplify the return code of __vma_reservation_common()

It's guaranteed that the vma is associated with a resv_map, i.e.  either
VM_MAYSHARE or HPAGE_RESV_OWNER, when the code reaches here or we would
have returned via !resv check above.  So it's unneeded to check whether
HPAGE_RESV_OWNER is set here.  Simplify the return code to make it more
clear.

Link: https://lkml.kernel.org/r/20210410072348.20437-3-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Feilong Lin <linfeilong@huawei.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |   41 ++++++++++++++++++++---------------------
 1 file changed, 20 insertions(+), 21 deletions(-)

--- a/mm/hugetlb.c~mm-hugeltb-simplify-the-return-code-of-__vma_reservation_common
+++ a/mm/hugetlb.c
@@ -2174,27 +2174,26 @@ static long __vma_reservation_common(str
 
 	if (vma->vm_flags & VM_MAYSHARE)
 		return ret;
-	else if (is_vma_resv_set(vma, HPAGE_RESV_OWNER) && ret >= 0) {
-		/*
-		 * In most cases, reserves always exist for private mappings.
-		 * However, a file associated with mapping could have been
-		 * hole punched or truncated after reserves were consumed.
-		 * As subsequent fault on such a range will not use reserves.
-		 * Subtle - The reserve map for private mappings has the
-		 * opposite meaning than that of shared mappings.  If NO
-		 * entry is in the reserve map, it means a reservation exists.
-		 * If an entry exists in the reserve map, it means the
-		 * reservation has already been consumed.  As a result, the
-		 * return value of this routine is the opposite of the
-		 * value returned from reserve map manipulation routines above.
-		 */
-		if (ret)
-			return 0;
-		else
-			return 1;
-	}
-	else
-		return ret < 0 ? ret : 0;
+	/*
+	 * We know private mapping must have HPAGE_RESV_OWNER set.
+	 *
+	 * In most cases, reserves always exist for private mappings.
+	 * However, a file associated with mapping could have been
+	 * hole punched or truncated after reserves were consumed.
+	 * As subsequent fault on such a range will not use reserves.
+	 * Subtle - The reserve map for private mappings has the
+	 * opposite meaning than that of shared mappings.  If NO
+	 * entry is in the reserve map, it means a reservation exists.
+	 * If an entry exists in the reserve map, it means the
+	 * reservation has already been consumed.  As a result, the
+	 * return value of this routine is the opposite of the
+	 * value returned from reserve map manipulation routines above.
+	 */
+	if (ret > 0)
+		return 0;
+	if (ret == 0)
+		return 1;
+	return ret;
 }
 
 static long vma_needs_reservation(struct hstate *h,
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 036/143] mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (34 preceding siblings ...)
  2021-05-05  1:34 ` [patch 035/143] mm/hugeltb: simplify the return code of __vma_reservation_common() Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 037/143] mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts() Andrew Morton
                   ` (104 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, linfeilong, linmiaohe, linux-mm, mike.kravetz, mm-commits,
	torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages()

The resv_map could be NULL since this routine can be called in the evict
inode path for all hugetlbfs inodes and we will have chg = 0 in this case.
But (chg - freed) won't go negative as Mike pointed out:

 "If resv_map is NULL, then no hugetlb pages can be allocated/associated
  with the file.  As a result, remove_inode_hugepages will never find any
  huge pages associated with the inode and the passed value 'freed' will
  always be zero."

Add a comment clarifying this to make it clear and also avoid confusion.

Link: https://lkml.kernel.org/r/20210410072348.20437-4-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Feilong Lin <linfeilong@huawei.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |    3 +++
 1 file changed, 3 insertions(+)

--- a/mm/hugetlb.c~mm-hugeltb-clarify-chg-freed-wont-go-negative-in-hugetlb_unreserve_pages
+++ a/mm/hugetlb.c
@@ -5267,6 +5267,9 @@ long hugetlb_unreserve_pages(struct inod
 	/*
 	 * If the subpool has a minimum size, the number of global
 	 * reservations to be released may be adjusted.
+	 *
+	 * Note that !resv_map implies freed == 0. So (chg - freed)
+	 * won't go negative.
 	 */
 	gbl_reserve = hugepage_subpool_put_pages(spool, (chg - freed));
 	hugetlb_acct_memory(h, -gbl_reserve);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 037/143] mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (35 preceding siblings ...)
  2021-05-05  1:34 ` [patch 036/143] mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages() Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 038/143] mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages() Andrew Morton
                   ` (103 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, linfeilong, linmiaohe, linux-mm, mike.kravetz, mm-commits,
	torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts()

A rare out of memory error would prevent removal of the reserve map region
for a page.  hugetlb_fix_reserve_counts() handles this rare case to avoid
dangling with incorrect counts.  Unfortunately, hugepage_subpool_get_pages
and hugetlb_acct_memory could possibly fail too.  We should correctly
handle these cases.

Link: https://lkml.kernel.org/r/20210410072348.20437-5-linmiaohe@huawei.com
Fixes: b5cec28d36f5 ("hugetlbfs: truncate_hugepages() takes a range of pages")
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Feilong Lin <linfeilong@huawei.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |   11 +++++++++--
 1 file changed, 9 insertions(+), 2 deletions(-)

--- a/mm/hugetlb.c~mm-hugeltb-handle-the-error-case-in-hugetlb_fix_reserve_counts
+++ a/mm/hugetlb.c
@@ -742,13 +742,20 @@ void hugetlb_fix_reserve_counts(struct i
 {
 	struct hugepage_subpool *spool = subpool_inode(inode);
 	long rsv_adjust;
+	bool reserved = false;
 
 	rsv_adjust = hugepage_subpool_get_pages(spool, 1);
-	if (rsv_adjust) {
+	if (rsv_adjust > 0) {
 		struct hstate *h = hstate_inode(inode);
 
-		hugetlb_acct_memory(h, 1);
+		if (!hugetlb_acct_memory(h, 1))
+			reserved = true;
+	} else if (!rsv_adjust) {
+		reserved = true;
 	}
+
+	if (!reserved)
+		pr_warn("hugetlb: Huge Page Reserved count may go negative.\n");
 }
 
 /*
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 038/143] mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (36 preceding siblings ...)
  2021-05-05  1:34 ` [patch 037/143] mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts() Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 039/143] mm/cma: change cma mutex to irq safe spinlock Andrew Morton
                   ` (102 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, linfeilong, linmiaohe, linux-mm, mike.kravetz, mm-commits,
	torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages()

The local variable pseudo_vma is not used anymore.

Link: https://lkml.kernel.org/r/20210410072348.20437-6-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Feilong Lin <linfeilong@huawei.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 fs/hugetlbfs/inode.c |    3 ---
 1 file changed, 3 deletions(-)

--- a/fs/hugetlbfs/inode.c~mm-hugetlb-remove-unused-variable-pseudo_vma-in-remove_inode_hugepages
+++ a/fs/hugetlbfs/inode.c
@@ -463,14 +463,11 @@ static void remove_inode_hugepages(struc
 	struct address_space *mapping = &inode->i_data;
 	const pgoff_t start = lstart >> huge_page_shift(h);
 	const pgoff_t end = lend >> huge_page_shift(h);
-	struct vm_area_struct pseudo_vma;
 	struct pagevec pvec;
 	pgoff_t next, index;
 	int i, freed = 0;
 	bool truncate_op = (lend == LLONG_MAX);
 
-	vma_init(&pseudo_vma, current->mm);
-	pseudo_vma.vm_flags = (VM_HUGETLB | VM_MAYSHARE | VM_SHARED);
 	pagevec_init(&pvec);
 	next = start;
 	while (next < end) {
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 039/143] mm/cma: change cma mutex to irq safe spinlock
  2021-05-05  1:32 incoming Andrew Morton
                   ` (37 preceding siblings ...)
  2021-05-05  1:34 ` [patch 038/143] mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages() Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 040/143] hugetlb: no need to drop hugetlb_lock to call cma_release Andrew Morton
                   ` (101 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
	iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
	mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
	peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
	will, willy

From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: mm/cma: change cma mutex to irq safe spinlock

Patch series "make hugetlb put_page safe for all calling contexts", v5.

This effort is the result a recent bug report [1].  Syzbot found a
potential deadlock in the hugetlb put_page/free_huge_page_path.  WARNING:
SOFTIRQ-safe -> SOFTIRQ-unsafe lock order detected Since the
free_huge_page_path already has code to 'hand off' page free requests to a
workqueue, a suggestion was proposed to make the in_irq() detection
accurate by always enabling PREEMPT_COUNT [2].  The outcome of that
discussion was that the hugetlb put_page path (free_huge_page) path should
be properly fixed and safe for all calling contexts.


This patch (of 8):

cma_release is currently a sleepable operatation because the bitmap
manipulation is protected by cma->lock mutex.  Hugetlb code which relies
on cma_release for CMA backed (giga) hugetlb pages, however, needs to be
irq safe.

The lock doesn't protect any sleepable operation so it can be changed to a
(irq aware) spin lock.  The bitmap processing should be quite fast in
typical case but if cma sizes grow to TB then we will likely need to
replace the lock by a more optimized bitmap implementation.

Link: https://lkml.kernel.org/r/20210409205254.242291-1-mike.kravetz@oracle.com
Link: https://lkml.kernel.org/r/20210409205254.242291-2-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Muchun Song <songmuchun@bytedance.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Miaohe Lin <linmiaohe@huawei.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/cma.c       |   18 +++++++++---------
 mm/cma.h       |    2 +-
 mm/cma_debug.c |    8 ++++----
 3 files changed, 14 insertions(+), 14 deletions(-)

--- a/mm/cma.c~mm-cma-change-cma-mutex-to-irq-safe-spinlock
+++ a/mm/cma.c
@@ -24,7 +24,6 @@
 #include <linux/memblock.h>
 #include <linux/err.h>
 #include <linux/mm.h>
-#include <linux/mutex.h>
 #include <linux/sizes.h>
 #include <linux/slab.h>
 #include <linux/log2.h>
@@ -83,13 +82,14 @@ static void cma_clear_bitmap(struct cma
 			     unsigned int count)
 {
 	unsigned long bitmap_no, bitmap_count;
+	unsigned long flags;
 
 	bitmap_no = (pfn - cma->base_pfn) >> cma->order_per_bit;
 	bitmap_count = cma_bitmap_pages_to_bits(cma, count);
 
-	mutex_lock(&cma->lock);
+	spin_lock_irqsave(&cma->lock, flags);
 	bitmap_clear(cma->bitmap, bitmap_no, bitmap_count);
-	mutex_unlock(&cma->lock);
+	spin_unlock_irqrestore(&cma->lock, flags);
 }
 
 static void __init cma_activate_area(struct cma *cma)
@@ -118,7 +118,7 @@ static void __init cma_activate_area(str
 	     pfn += pageblock_nr_pages)
 		init_cma_reserved_pageblock(pfn_to_page(pfn));
 
-	mutex_init(&cma->lock);
+	spin_lock_init(&cma->lock);
 
 #ifdef CONFIG_CMA_DEBUGFS
 	INIT_HLIST_HEAD(&cma->mem_head);
@@ -392,7 +392,7 @@ static void cma_debug_show_areas(struct
 	unsigned long nr_part, nr_total = 0;
 	unsigned long nbits = cma_bitmap_maxno(cma);
 
-	mutex_lock(&cma->lock);
+	spin_lock_irq(&cma->lock);
 	pr_info("number of available pages: ");
 	for (;;) {
 		next_zero_bit = find_next_zero_bit(cma->bitmap, nbits, start);
@@ -407,7 +407,7 @@ static void cma_debug_show_areas(struct
 		start = next_zero_bit + nr_zero;
 	}
 	pr_cont("=> %lu free of %lu total pages\n", nr_total, cma->count);
-	mutex_unlock(&cma->lock);
+	spin_unlock_irq(&cma->lock);
 }
 #else
 static inline void cma_debug_show_areas(struct cma *cma) { }
@@ -452,12 +452,12 @@ struct page *cma_alloc(struct cma *cma,
 		return NULL;
 
 	for (;;) {
-		mutex_lock(&cma->lock);
+		spin_lock_irq(&cma->lock);
 		bitmap_no = bitmap_find_next_zero_area_off(cma->bitmap,
 				bitmap_maxno, start, bitmap_count, mask,
 				offset);
 		if (bitmap_no >= bitmap_maxno) {
-			mutex_unlock(&cma->lock);
+			spin_unlock_irq(&cma->lock);
 			break;
 		}
 		bitmap_set(cma->bitmap, bitmap_no, bitmap_count);
@@ -466,7 +466,7 @@ struct page *cma_alloc(struct cma *cma,
 		 * our exclusive use. If the migration fails we will take the
 		 * lock again and unmark it.
 		 */
-		mutex_unlock(&cma->lock);
+		spin_unlock_irq(&cma->lock);
 
 		pfn = cma->base_pfn + (bitmap_no << cma->order_per_bit);
 		ret = alloc_contig_range(pfn, pfn + count, MIGRATE_CMA,
--- a/mm/cma_debug.c~mm-cma-change-cma-mutex-to-irq-safe-spinlock
+++ a/mm/cma_debug.c
@@ -36,10 +36,10 @@ static int cma_used_get(void *data, u64
 	struct cma *cma = data;
 	unsigned long used;
 
-	mutex_lock(&cma->lock);
+	spin_lock_irq(&cma->lock);
 	/* pages counter is smaller than sizeof(int) */
 	used = bitmap_weight(cma->bitmap, (int)cma_bitmap_maxno(cma));
-	mutex_unlock(&cma->lock);
+	spin_unlock_irq(&cma->lock);
 	*val = (u64)used << cma->order_per_bit;
 
 	return 0;
@@ -53,7 +53,7 @@ static int cma_maxchunk_get(void *data,
 	unsigned long start, end = 0;
 	unsigned long bitmap_maxno = cma_bitmap_maxno(cma);
 
-	mutex_lock(&cma->lock);
+	spin_lock_irq(&cma->lock);
 	for (;;) {
 		start = find_next_zero_bit(cma->bitmap, bitmap_maxno, end);
 		if (start >= bitmap_maxno)
@@ -61,7 +61,7 @@ static int cma_maxchunk_get(void *data,
 		end = find_next_bit(cma->bitmap, bitmap_maxno, start);
 		maxchunk = max(end - start, maxchunk);
 	}
-	mutex_unlock(&cma->lock);
+	spin_unlock_irq(&cma->lock);
 	*val = (u64)maxchunk << cma->order_per_bit;
 
 	return 0;
--- a/mm/cma.h~mm-cma-change-cma-mutex-to-irq-safe-spinlock
+++ a/mm/cma.h
@@ -9,7 +9,7 @@ struct cma {
 	unsigned long   count;
 	unsigned long   *bitmap;
 	unsigned int order_per_bit; /* Order of pages represented by one bit */
-	struct mutex    lock;
+	spinlock_t	lock;
 #ifdef CONFIG_CMA_DEBUGFS
 	struct hlist_head mem_head;
 	spinlock_t mem_head_lock;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 040/143] hugetlb: no need to drop hugetlb_lock to call cma_release
  2021-05-05  1:32 incoming Andrew Morton
                   ` (38 preceding siblings ...)
  2021-05-05  1:34 ` [patch 039/143] mm/cma: change cma mutex to irq safe spinlock Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 041/143] hugetlb: add per-hstate mutex to synchronize user adjustments Andrew Morton
                   ` (100 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
	iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
	mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
	peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
	will, willy

From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: hugetlb: no need to drop hugetlb_lock to call cma_release

Now that cma_release is non-blocking and irq safe, there is no need to
drop hugetlb_lock before calling.

Link: https://lkml.kernel.org/r/20210409205254.242291-3-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Roman Gushchin <guro@fb.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Miaohe Lin <linmiaohe@huawei.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |    6 ------
 1 file changed, 6 deletions(-)

--- a/mm/hugetlb.c~hugetlb-no-need-to-drop-hugetlb_lock-to-call-cma_release
+++ a/mm/hugetlb.c
@@ -1355,14 +1355,8 @@ static void update_and_free_page(struct
 	set_compound_page_dtor(page, NULL_COMPOUND_DTOR);
 	set_page_refcounted(page);
 	if (hstate_is_gigantic(h)) {
-		/*
-		 * Temporarily drop the hugetlb_lock, because
-		 * we might block in free_gigantic_page().
-		 */
-		spin_unlock(&hugetlb_lock);
 		destroy_compound_gigantic_page(page, huge_page_order(h));
 		free_gigantic_page(page, huge_page_order(h));
-		spin_lock(&hugetlb_lock);
 	} else {
 		__free_pages(page, huge_page_order(h));
 	}
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 041/143] hugetlb: add per-hstate mutex to synchronize user adjustments
  2021-05-05  1:32 incoming Andrew Morton
                   ` (39 preceding siblings ...)
  2021-05-05  1:34 ` [patch 040/143] hugetlb: no need to drop hugetlb_lock to call cma_release Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 042/143] hugetlb: create remove_hugetlb_page() to separate functionality Andrew Morton
                   ` (99 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
	iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
	mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
	peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
	will, willy

From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: hugetlb: add per-hstate mutex to synchronize user adjustments

The helper routine hstate_next_node_to_alloc accesses and modifies the
hstate variable next_nid_to_alloc.  The helper is used by the routines
alloc_pool_huge_page and adjust_pool_surplus.  adjust_pool_surplus is
called with hugetlb_lock held.  However, alloc_pool_huge_page can not be
called with the hugetlb lock held as it will call the page allocator.  Two
instances of alloc_pool_huge_page could be run in parallel or
alloc_pool_huge_page could run in parallel with adjust_pool_surplus which
may result in the variable next_nid_to_alloc becoming invalid for the
caller and pages being allocated on the wrong node.

Both alloc_pool_huge_page and adjust_pool_surplus are only called from the
routine set_max_huge_pages after boot.  set_max_huge_pages is only called
as the reusult of a user writing to the proc/sysfs nr_hugepages, or
nr_hugepages_mempolicy file to adjust the number of hugetlb pages.

It makes little sense to allow multiple adjustment to the number of
hugetlb pages in parallel.  Add a mutex to the hstate and use it to only
allow one hugetlb page adjustment at a time.  This will synchronize
modifications to the next_nid_to_alloc variable.

Link: https://lkml.kernel.org/r/20210409205254.242291-4-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Muchun Song <songmuchun@bytedance.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/hugetlb.h |    1 +
 mm/hugetlb.c            |    8 ++++++++
 2 files changed, 9 insertions(+)

--- a/include/linux/hugetlb.h~hugetlb-add-per-hstate-mutex-to-synchronize-user-adjustments
+++ a/include/linux/hugetlb.h
@@ -559,6 +559,7 @@ HPAGEFLAG(Freed, freed)
 #define HSTATE_NAME_LEN 32
 /* Defines one hugetlb page size */
 struct hstate {
+	struct mutex resize_lock;
 	int next_nid_to_alloc;
 	int next_nid_to_free;
 	unsigned int order;
--- a/mm/hugetlb.c~hugetlb-add-per-hstate-mutex-to-synchronize-user-adjustments
+++ a/mm/hugetlb.c
@@ -2621,6 +2621,11 @@ static int set_max_huge_pages(struct hst
 	else
 		return -ENOMEM;
 
+	/*
+	 * resize_lock mutex prevents concurrent adjustments to number of
+	 * pages in hstate via the proc/sysfs interfaces.
+	 */
+	mutex_lock(&h->resize_lock);
 	spin_lock(&hugetlb_lock);
 
 	/*
@@ -2653,6 +2658,7 @@ static int set_max_huge_pages(struct hst
 	if (hstate_is_gigantic(h) && !IS_ENABLED(CONFIG_CONTIG_ALLOC)) {
 		if (count > persistent_huge_pages(h)) {
 			spin_unlock(&hugetlb_lock);
+			mutex_unlock(&h->resize_lock);
 			NODEMASK_FREE(node_alloc_noretry);
 			return -EINVAL;
 		}
@@ -2727,6 +2733,7 @@ static int set_max_huge_pages(struct hst
 out:
 	h->max_huge_pages = persistent_huge_pages(h);
 	spin_unlock(&hugetlb_lock);
+	mutex_unlock(&h->resize_lock);
 
 	NODEMASK_FREE(node_alloc_noretry);
 
@@ -3214,6 +3221,7 @@ void __init hugetlb_add_hstate(unsigned
 	BUG_ON(hugetlb_max_hstate >= HUGE_MAX_HSTATE);
 	BUG_ON(order == 0);
 	h = &hstates[hugetlb_max_hstate++];
+	mutex_init(&h->resize_lock);
 	h->order = order;
 	h->mask = ~(huge_page_size(h) - 1);
 	for (i = 0; i < MAX_NUMNODES; ++i)
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 042/143] hugetlb: create remove_hugetlb_page() to separate functionality
  2021-05-05  1:32 incoming Andrew Morton
                   ` (40 preceding siblings ...)
  2021-05-05  1:34 ` [patch 041/143] hugetlb: add per-hstate mutex to synchronize user adjustments Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:34 ` [patch 043/143] hugetlb: call update_and_free_page without hugetlb_lock Andrew Morton
                   ` (98 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
	iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
	mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
	peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
	will, willy

From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: hugetlb: create remove_hugetlb_page() to separate functionality

The new remove_hugetlb_page() routine is designed to remove a hugetlb page
from hugetlbfs processing.  It will remove the page from the active or
free list, update global counters and set the compound page destructor to
NULL so that PageHuge() will return false for the 'page'.  After this
call, the 'page' can be treated as a normal compound page or a collection
of base size pages.

update_and_free_page no longer decrements h->nr_huge_pages{_node} as this
is performed in remove_hugetlb_page.  The only functionality performed by
update_and_free_page is to free the base pages to the lower level
allocators.

update_and_free_page is typically called after remove_hugetlb_page.

remove_hugetlb_page is to be called with the hugetlb_lock held.

Creating this routine and separating functionality is in preparation for
restructuring code to reduce lock hold times.  This commit should not
introduce any changes to functionality.

Link: https://lkml.kernel.org/r/20210409205254.242291-5-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Muchun Song <songmuchun@bytedance.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |   65 ++++++++++++++++++++++++++++++-------------------
 1 file changed, 40 insertions(+), 25 deletions(-)

--- a/mm/hugetlb.c~hugetlb-create-remove_hugetlb_page-to-separate-functionality
+++ a/mm/hugetlb.c
@@ -1333,6 +1333,41 @@ static inline void destroy_compound_giga
 						unsigned int order) { }
 #endif
 
+/*
+ * Remove hugetlb page from lists, and update dtor so that page appears
+ * as just a compound page.  A reference is held on the page.
+ *
+ * Must be called with hugetlb lock held.
+ */
+static void remove_hugetlb_page(struct hstate *h, struct page *page,
+							bool adjust_surplus)
+{
+	int nid = page_to_nid(page);
+
+	VM_BUG_ON_PAGE(hugetlb_cgroup_from_page(page), page);
+	VM_BUG_ON_PAGE(hugetlb_cgroup_from_page_rsvd(page), page);
+
+	if (hstate_is_gigantic(h) && !gigantic_page_runtime_supported())
+		return;
+
+	list_del(&page->lru);
+
+	if (HPageFreed(page)) {
+		h->free_huge_pages--;
+		h->free_huge_pages_node[nid]--;
+	}
+	if (adjust_surplus) {
+		h->surplus_huge_pages--;
+		h->surplus_huge_pages_node[nid]--;
+	}
+
+	set_page_refcounted(page);
+	set_compound_page_dtor(page, NULL_COMPOUND_DTOR);
+
+	h->nr_huge_pages--;
+	h->nr_huge_pages_node[nid]--;
+}
+
 static void update_and_free_page(struct hstate *h, struct page *page)
 {
 	int i;
@@ -1341,8 +1376,6 @@ static void update_and_free_page(struct
 	if (hstate_is_gigantic(h) && !gigantic_page_runtime_supported())
 		return;
 
-	h->nr_huge_pages--;
-	h->nr_huge_pages_node[page_to_nid(page)]--;
 	for (i = 0; i < pages_per_huge_page(h);
 	     i++, subpage = mem_map_next(subpage, page, i)) {
 		subpage->flags &= ~(1 << PG_locked | 1 << PG_error |
@@ -1350,10 +1383,6 @@ static void update_and_free_page(struct
 				1 << PG_active | 1 << PG_private |
 				1 << PG_writeback);
 	}
-	VM_BUG_ON_PAGE(hugetlb_cgroup_from_page(page), page);
-	VM_BUG_ON_PAGE(hugetlb_cgroup_from_page_rsvd(page), page);
-	set_compound_page_dtor(page, NULL_COMPOUND_DTOR);
-	set_page_refcounted(page);
 	if (hstate_is_gigantic(h)) {
 		destroy_compound_gigantic_page(page, huge_page_order(h));
 		free_gigantic_page(page, huge_page_order(h));
@@ -1421,15 +1450,12 @@ static void __free_huge_page(struct page
 		h->resv_huge_pages++;
 
 	if (HPageTemporary(page)) {
-		list_del(&page->lru);
-		ClearHPageTemporary(page);
+		remove_hugetlb_page(h, page, false);
 		update_and_free_page(h, page);
 	} else if (h->surplus_huge_pages_node[nid]) {
 		/* remove the page from active list */
-		list_del(&page->lru);
+		remove_hugetlb_page(h, page, true);
 		update_and_free_page(h, page);
-		h->surplus_huge_pages--;
-		h->surplus_huge_pages_node[nid]--;
 	} else {
 		arch_clear_hugepage_flags(page);
 		enqueue_huge_page(h, page);
@@ -1714,13 +1740,7 @@ static int free_pool_huge_page(struct hs
 			struct page *page =
 				list_entry(h->hugepage_freelists[node].next,
 					  struct page, lru);
-			list_del(&page->lru);
-			h->free_huge_pages--;
-			h->free_huge_pages_node[node]--;
-			if (acct_surplus) {
-				h->surplus_huge_pages--;
-				h->surplus_huge_pages_node[node]--;
-			}
+			remove_hugetlb_page(h, page, acct_surplus);
 			update_and_free_page(h, page);
 			ret = 1;
 			break;
@@ -1758,7 +1778,6 @@ retry:
 	if (!page_count(page)) {
 		struct page *head = compound_head(page);
 		struct hstate *h = page_hstate(head);
-		int nid = page_to_nid(head);
 		if (h->free_huge_pages - h->resv_huge_pages == 0)
 			goto out;
 
@@ -1789,9 +1808,7 @@ retry:
 			SetPageHWPoison(page);
 			ClearPageHWPoison(head);
 		}
-		list_del(&head->lru);
-		h->free_huge_pages--;
-		h->free_huge_pages_node[nid]--;
+		remove_hugetlb_page(h, page, false);
 		h->max_huge_pages--;
 		update_and_free_page(h, head);
 		rc = 0;
@@ -2558,10 +2575,8 @@ static void try_to_free_low(struct hstat
 				return;
 			if (PageHighMem(page))
 				continue;
-			list_del(&page->lru);
+			remove_hugetlb_page(h, page, false);
 			update_and_free_page(h, page);
-			h->free_huge_pages--;
-			h->free_huge_pages_node[page_to_nid(page)]--;
 		}
 	}
 }
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 043/143] hugetlb: call update_and_free_page without hugetlb_lock
  2021-05-05  1:32 incoming Andrew Morton
                   ` (41 preceding siblings ...)
  2021-05-05  1:34 ` [patch 042/143] hugetlb: create remove_hugetlb_page() to separate functionality Andrew Morton
@ 2021-05-05  1:34 ` Andrew Morton
  2021-05-05  1:35 ` [patch 044/143] hugetlb: change free_pool_huge_page to remove_pool_huge_page Andrew Morton
                   ` (97 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:34 UTC (permalink / raw)
  To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
	iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
	mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
	peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
	will, willy

From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: hugetlb: call update_and_free_page without hugetlb_lock

With the introduction of remove_hugetlb_page(), there is no need for
update_and_free_page to hold the hugetlb lock.  Change all callers to drop
the lock before calling.

With additional code modifications, this will allow loops which decrease
the huge page pool to drop the hugetlb_lock with each page to reduce long
hold times.

The ugly unlock/lock cycle in free_pool_huge_page will be removed in a
subsequent patch which restructures free_pool_huge_page.

Link: https://lkml.kernel.org/r/20210409205254.242291-6-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Muchun Song <songmuchun@bytedance.com>
Reviewed-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |   31 ++++++++++++++++++++++++++-----
 1 file changed, 26 insertions(+), 5 deletions(-)

--- a/mm/hugetlb.c~hugetlb-call-update_and_free_page-without-hugetlb_lock
+++ a/mm/hugetlb.c
@@ -1451,16 +1451,18 @@ static void __free_huge_page(struct page
 
 	if (HPageTemporary(page)) {
 		remove_hugetlb_page(h, page, false);
+		spin_unlock(&hugetlb_lock);
 		update_and_free_page(h, page);
 	} else if (h->surplus_huge_pages_node[nid]) {
 		/* remove the page from active list */
 		remove_hugetlb_page(h, page, true);
+		spin_unlock(&hugetlb_lock);
 		update_and_free_page(h, page);
 	} else {
 		arch_clear_hugepage_flags(page);
 		enqueue_huge_page(h, page);
+		spin_unlock(&hugetlb_lock);
 	}
-	spin_unlock(&hugetlb_lock);
 }
 
 /*
@@ -1741,7 +1743,13 @@ static int free_pool_huge_page(struct hs
 				list_entry(h->hugepage_freelists[node].next,
 					  struct page, lru);
 			remove_hugetlb_page(h, page, acct_surplus);
+			/*
+			 * unlock/lock around update_and_free_page is temporary
+			 * and will be removed with subsequent patch.
+			 */
+			spin_unlock(&hugetlb_lock);
 			update_and_free_page(h, page);
+			spin_lock(&hugetlb_lock);
 			ret = 1;
 			break;
 		}
@@ -1810,8 +1818,9 @@ retry:
 		}
 		remove_hugetlb_page(h, page, false);
 		h->max_huge_pages--;
+		spin_unlock(&hugetlb_lock);
 		update_and_free_page(h, head);
-		rc = 0;
+		return 0;
 	}
 out:
 	spin_unlock(&hugetlb_lock);
@@ -2563,22 +2572,34 @@ static void try_to_free_low(struct hstat
 						nodemask_t *nodes_allowed)
 {
 	int i;
+	struct page *page, *next;
+	LIST_HEAD(page_list);
 
 	if (hstate_is_gigantic(h))
 		return;
 
+	/*
+	 * Collect pages to be freed on a list, and free after dropping lock
+	 */
 	for_each_node_mask(i, *nodes_allowed) {
-		struct page *page, *next;
 		struct list_head *freel = &h->hugepage_freelists[i];
 		list_for_each_entry_safe(page, next, freel, lru) {
 			if (count >= h->nr_huge_pages)
-				return;
+				goto out;
 			if (PageHighMem(page))
 				continue;
 			remove_hugetlb_page(h, page, false);
-			update_and_free_page(h, page);
+			list_add(&page->lru, &page_list);
 		}
 	}
+
+out:
+	spin_unlock(&hugetlb_lock);
+	list_for_each_entry_safe(page, next, &page_list, lru) {
+		update_and_free_page(h, page);
+		cond_resched();
+	}
+	spin_lock(&hugetlb_lock);
 }
 #else
 static inline void try_to_free_low(struct hstate *h, unsigned long count,
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 044/143] hugetlb: change free_pool_huge_page to remove_pool_huge_page
  2021-05-05  1:32 incoming Andrew Morton
                   ` (42 preceding siblings ...)
  2021-05-05  1:34 ` [patch 043/143] hugetlb: call update_and_free_page without hugetlb_lock Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:35 ` [patch 045/143] hugetlb: make free_huge_page irq safe Andrew Morton
                   ` (96 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
	iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
	mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
	peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
	will, willy

From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: hugetlb: change free_pool_huge_page to remove_pool_huge_page

free_pool_huge_page was called with hugetlb_lock held.  It would remove a
hugetlb page, and then free the corresponding pages to the lower level
allocators such as buddy.  free_pool_huge_page was called in a loop to
remove hugetlb pages and these loops could hold the hugetlb_lock for a
considerable time.

Create new routine remove_pool_huge_page to replace free_pool_huge_page. 
remove_pool_huge_page will remove the hugetlb page, and it must be called
with the hugetlb_lock held.  It will return the removed page and it is the
responsibility of the caller to free the page to the lower level
allocators.  The hugetlb_lock is dropped before freeing to these
allocators which results in shorter lock hold times.

Add new helper routine to call update_and_free_page for a list of pages.

Note: Some changes to the routine return_unused_surplus_pages are in need
of explanation.  Commit e5bbc8a6c992 ("mm/hugetlb.c: fix reservation race
when freeing surplus pages") modified this routine to address a race which
could occur when dropping the hugetlb_lock in the loop that removes pool
pages.  Accounting changes introduced in that commit were subtle and took
some thought to understand.  This commit removes the cond_resched_lock()
and the potential race.  Therefore, remove the subtle code and restore the
more straight forward accounting effectively reverting the commit.

Link: https://lkml.kernel.org/r/20210409205254.242291-7-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: Muchun Song <songmuchun@bytedance.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Miaohe Lin <linmiaohe@huawei.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |   93 ++++++++++++++++++++++++++-----------------------
 1 file changed, 51 insertions(+), 42 deletions(-)

--- a/mm/hugetlb.c~hugetlb-change-free_pool_huge_page-to-remove_pool_huge_page
+++ a/mm/hugetlb.c
@@ -1211,7 +1211,7 @@ static int hstate_next_node_to_alloc(str
 }
 
 /*
- * helper for free_pool_huge_page() - return the previously saved
+ * helper for remove_pool_huge_page() - return the previously saved
  * node ["this node"] from which to free a huge page.  Advance the
  * next node id whether or not we find a free huge page to free so
  * that the next attempt to free addresses the next node.
@@ -1391,6 +1391,16 @@ static void update_and_free_page(struct
 	}
 }
 
+static void update_and_free_pages_bulk(struct hstate *h, struct list_head *list)
+{
+	struct page *page, *t_page;
+
+	list_for_each_entry_safe(page, t_page, list, lru) {
+		update_and_free_page(h, page);
+		cond_resched();
+	}
+}
+
 struct hstate *size_to_hstate(unsigned long size)
 {
 	struct hstate *h;
@@ -1721,16 +1731,18 @@ static int alloc_pool_huge_page(struct h
 }
 
 /*
- * Free huge page from pool from next node to free.
- * Attempt to keep persistent huge pages more or less
- * balanced over allowed nodes.
+ * Remove huge page from pool from next node to free.  Attempt to keep
+ * persistent huge pages more or less balanced over allowed nodes.
+ * This routine only 'removes' the hugetlb page.  The caller must make
+ * an additional call to free the page to low level allocators.
  * Called with hugetlb_lock locked.
  */
-static int free_pool_huge_page(struct hstate *h, nodemask_t *nodes_allowed,
-							 bool acct_surplus)
+static struct page *remove_pool_huge_page(struct hstate *h,
+						nodemask_t *nodes_allowed,
+						 bool acct_surplus)
 {
 	int nr_nodes, node;
-	int ret = 0;
+	struct page *page = NULL;
 
 	for_each_node_mask_to_free(h, nr_nodes, node, nodes_allowed) {
 		/*
@@ -1739,23 +1751,14 @@ static int free_pool_huge_page(struct hs
 		 */
 		if ((!acct_surplus || h->surplus_huge_pages_node[node]) &&
 		    !list_empty(&h->hugepage_freelists[node])) {
-			struct page *page =
-				list_entry(h->hugepage_freelists[node].next,
+			page = list_entry(h->hugepage_freelists[node].next,
 					  struct page, lru);
 			remove_hugetlb_page(h, page, acct_surplus);
-			/*
-			 * unlock/lock around update_and_free_page is temporary
-			 * and will be removed with subsequent patch.
-			 */
-			spin_unlock(&hugetlb_lock);
-			update_and_free_page(h, page);
-			spin_lock(&hugetlb_lock);
-			ret = 1;
 			break;
 		}
 	}
 
-	return ret;
+	return page;
 }
 
 /*
@@ -2075,17 +2078,16 @@ free:
  *    to the associated reservation map.
  * 2) Free any unused surplus pages that may have been allocated to satisfy
  *    the reservation.  As many as unused_resv_pages may be freed.
- *
- * Called with hugetlb_lock held.  However, the lock could be dropped (and
- * reacquired) during calls to cond_resched_lock.  Whenever dropping the lock,
- * we must make sure nobody else can claim pages we are in the process of
- * freeing.  Do this by ensuring resv_huge_page always is greater than the
- * number of huge pages we plan to free when dropping the lock.
  */
 static void return_unused_surplus_pages(struct hstate *h,
 					unsigned long unused_resv_pages)
 {
 	unsigned long nr_pages;
+	struct page *page;
+	LIST_HEAD(page_list);
+
+	/* Uncommit the reservation */
+	h->resv_huge_pages -= unused_resv_pages;
 
 	/* Cannot return gigantic pages currently */
 	if (hstate_is_gigantic(h))
@@ -2102,24 +2104,21 @@ static void return_unused_surplus_pages(
 	 * evenly across all nodes with memory. Iterate across these nodes
 	 * until we can no longer free unreserved surplus pages. This occurs
 	 * when the nodes with surplus pages have no free pages.
-	 * free_pool_huge_page() will balance the freed pages across the
+	 * remove_pool_huge_page() will balance the freed pages across the
 	 * on-line nodes with memory and will handle the hstate accounting.
-	 *
-	 * Note that we decrement resv_huge_pages as we free the pages.  If
-	 * we drop the lock, resv_huge_pages will still be sufficiently large
-	 * to cover subsequent pages we may free.
 	 */
 	while (nr_pages--) {
-		h->resv_huge_pages--;
-		unused_resv_pages--;
-		if (!free_pool_huge_page(h, &node_states[N_MEMORY], 1))
+		page = remove_pool_huge_page(h, &node_states[N_MEMORY], 1);
+		if (!page)
 			goto out;
-		cond_resched_lock(&hugetlb_lock);
+
+		list_add(&page->lru, &page_list);
 	}
 
 out:
-	/* Fully uncommit the reservation */
-	h->resv_huge_pages -= unused_resv_pages;
+	spin_unlock(&hugetlb_lock);
+	update_and_free_pages_bulk(h, &page_list);
+	spin_lock(&hugetlb_lock);
 }
 
 
@@ -2572,7 +2571,6 @@ static void try_to_free_low(struct hstat
 						nodemask_t *nodes_allowed)
 {
 	int i;
-	struct page *page, *next;
 	LIST_HEAD(page_list);
 
 	if (hstate_is_gigantic(h))
@@ -2582,6 +2580,7 @@ static void try_to_free_low(struct hstat
 	 * Collect pages to be freed on a list, and free after dropping lock
 	 */
 	for_each_node_mask(i, *nodes_allowed) {
+		struct page *page, *next;
 		struct list_head *freel = &h->hugepage_freelists[i];
 		list_for_each_entry_safe(page, next, freel, lru) {
 			if (count >= h->nr_huge_pages)
@@ -2595,10 +2594,7 @@ static void try_to_free_low(struct hstat
 
 out:
 	spin_unlock(&hugetlb_lock);
-	list_for_each_entry_safe(page, next, &page_list, lru) {
-		update_and_free_page(h, page);
-		cond_resched();
-	}
+	update_and_free_pages_bulk(h, &page_list);
 	spin_lock(&hugetlb_lock);
 }
 #else
@@ -2645,6 +2641,8 @@ static int set_max_huge_pages(struct hst
 			      nodemask_t *nodes_allowed)
 {
 	unsigned long min_count, ret;
+	struct page *page;
+	LIST_HEAD(page_list);
 	NODEMASK_ALLOC(nodemask_t, node_alloc_noretry, GFP_KERNEL);
 
 	/*
@@ -2757,11 +2755,22 @@ static int set_max_huge_pages(struct hst
 	min_count = h->resv_huge_pages + h->nr_huge_pages - h->free_huge_pages;
 	min_count = max(count, min_count);
 	try_to_free_low(h, min_count, nodes_allowed);
+
+	/*
+	 * Collect pages to be removed on list without dropping lock
+	 */
 	while (min_count < persistent_huge_pages(h)) {
-		if (!free_pool_huge_page(h, nodes_allowed, 0))
+		page = remove_pool_huge_page(h, nodes_allowed, 0);
+		if (!page)
 			break;
-		cond_resched_lock(&hugetlb_lock);
+
+		list_add(&page->lru, &page_list);
 	}
+	/* free the pages after dropping lock */
+	spin_unlock(&hugetlb_lock);
+	update_and_free_pages_bulk(h, &page_list);
+	spin_lock(&hugetlb_lock);
+
 	while (count < persistent_huge_pages(h)) {
 		if (!adjust_pool_surplus(h, nodes_allowed, 1))
 			break;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 045/143] hugetlb: make free_huge_page irq safe
  2021-05-05  1:32 incoming Andrew Morton
                   ` (43 preceding siblings ...)
  2021-05-05  1:35 ` [patch 044/143] hugetlb: change free_pool_huge_page to remove_pool_huge_page Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:35 ` [patch 046/143] hugetlb: add lockdep_assert_held() calls for hugetlb_lock Andrew Morton
                   ` (95 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
	iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
	mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
	peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
	will, willy

From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: hugetlb: make free_huge_page irq safe

Commit c77c0a8ac4c5 ("mm/hugetlb: defer freeing of huge pages if in
non-task context") was added to address the issue of free_huge_page being
called from irq context.  That commit hands off free_huge_page processing
to a workqueue if !in_task.  However, this doesn't cover all the cases as
pointed out by 0day bot lockdep report [1].

:  Possible interrupt unsafe locking scenario:
:
:        CPU0                    CPU1
:        ----                    ----
:   lock(hugetlb_lock);
:                                local_irq_disable();
:                                lock(slock-AF_INET);
:                                lock(hugetlb_lock);
:   <Interrupt>
:     lock(slock-AF_INET);

Shakeel has later explained that this is very likely TCP TX zerocopy from
hugetlb pages scenario when the networking code drops a last reference to
hugetlb page while having IRQ disabled.  Hugetlb freeing path doesn't
disable IRQ while holding hugetlb_lock so a lock dependency chain can lead
to a deadlock.

This commit addresses the issue by doing the following:
- Make hugetlb_lock irq safe.  This is mostly a simple process of
  changing spin_*lock calls to spin_*lock_irq* calls.
- Make subpool lock irq safe in a similar manner.
- Revert the !in_task check and workqueue handoff.

[1] https://lore.kernel.org/linux-mm/000000000000f1c03b05bc43aadc@google.com/

Link: https://lkml.kernel.org/r/20210409205254.242291-8-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Muchun Song <songmuchun@bytedance.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Miaohe Lin <linmiaohe@huawei.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c        |  169 +++++++++++++++---------------------------
 mm/hugetlb_cgroup.c |    8 -
 2 files changed, 67 insertions(+), 110 deletions(-)

--- a/mm/hugetlb.c~hugetlb-make-free_huge_page-irq-safe
+++ a/mm/hugetlb.c
@@ -94,9 +94,10 @@ static inline bool subpool_is_free(struc
 	return true;
 }
 
-static inline void unlock_or_release_subpool(struct hugepage_subpool *spool)
+static inline void unlock_or_release_subpool(struct hugepage_subpool *spool,
+						unsigned long irq_flags)
 {
-	spin_unlock(&spool->lock);
+	spin_unlock_irqrestore(&spool->lock, irq_flags);
 
 	/* If no pages are used, and no other handles to the subpool
 	 * remain, give up any reservations based on minimum size and
@@ -135,10 +136,12 @@ struct hugepage_subpool *hugepage_new_su
 
 void hugepage_put_subpool(struct hugepage_subpool *spool)
 {
-	spin_lock(&spool->lock);
+	unsigned long flags;
+
+	spin_lock_irqsave(&spool->lock, flags);
 	BUG_ON(!spool->count);
 	spool->count--;
-	unlock_or_release_subpool(spool);
+	unlock_or_release_subpool(spool, flags);
 }
 
 /*
@@ -157,7 +160,7 @@ static long hugepage_subpool_get_pages(s
 	if (!spool)
 		return ret;
 
-	spin_lock(&spool->lock);
+	spin_lock_irq(&spool->lock);
 
 	if (spool->max_hpages != -1) {		/* maximum size accounting */
 		if ((spool->used_hpages + delta) <= spool->max_hpages)
@@ -184,7 +187,7 @@ static long hugepage_subpool_get_pages(s
 	}
 
 unlock_ret:
-	spin_unlock(&spool->lock);
+	spin_unlock_irq(&spool->lock);
 	return ret;
 }
 
@@ -198,11 +201,12 @@ static long hugepage_subpool_put_pages(s
 				       long delta)
 {
 	long ret = delta;
+	unsigned long flags;
 
 	if (!spool)
 		return delta;
 
-	spin_lock(&spool->lock);
+	spin_lock_irqsave(&spool->lock, flags);
 
 	if (spool->max_hpages != -1)		/* maximum size accounting */
 		spool->used_hpages -= delta;
@@ -223,7 +227,7 @@ static long hugepage_subpool_put_pages(s
 	 * If hugetlbfs_put_super couldn't free spool due to an outstanding
 	 * quota reference, free it now.
 	 */
-	unlock_or_release_subpool(spool);
+	unlock_or_release_subpool(spool, flags);
 
 	return ret;
 }
@@ -1412,7 +1416,7 @@ struct hstate *size_to_hstate(unsigned l
 	return NULL;
 }
 
-static void __free_huge_page(struct page *page)
+void free_huge_page(struct page *page)
 {
 	/*
 	 * Can't pass hstate in here because it is called from the
@@ -1422,6 +1426,7 @@ static void __free_huge_page(struct page
 	int nid = page_to_nid(page);
 	struct hugepage_subpool *spool = hugetlb_page_subpool(page);
 	bool restore_reserve;
+	unsigned long flags;
 
 	VM_BUG_ON_PAGE(page_count(page), page);
 	VM_BUG_ON_PAGE(page_mapcount(page), page);
@@ -1450,7 +1455,7 @@ static void __free_huge_page(struct page
 			restore_reserve = true;
 	}
 
-	spin_lock(&hugetlb_lock);
+	spin_lock_irqsave(&hugetlb_lock, flags);
 	ClearHPageMigratable(page);
 	hugetlb_cgroup_uncharge_page(hstate_index(h),
 				     pages_per_huge_page(h), page);
@@ -1461,66 +1466,18 @@ static void __free_huge_page(struct page
 
 	if (HPageTemporary(page)) {
 		remove_hugetlb_page(h, page, false);
-		spin_unlock(&hugetlb_lock);
+		spin_unlock_irqrestore(&hugetlb_lock, flags);
 		update_and_free_page(h, page);
 	} else if (h->surplus_huge_pages_node[nid]) {
 		/* remove the page from active list */
 		remove_hugetlb_page(h, page, true);
-		spin_unlock(&hugetlb_lock);
+		spin_unlock_irqrestore(&hugetlb_lock, flags);
 		update_and_free_page(h, page);
 	} else {
 		arch_clear_hugepage_flags(page);
 		enqueue_huge_page(h, page);
-		spin_unlock(&hugetlb_lock);
-	}
-}
-
-/*
- * As free_huge_page() can be called from a non-task context, we have
- * to defer the actual freeing in a workqueue to prevent potential
- * hugetlb_lock deadlock.
- *
- * free_hpage_workfn() locklessly retrieves the linked list of pages to
- * be freed and frees them one-by-one. As the page->mapping pointer is
- * going to be cleared in __free_huge_page() anyway, it is reused as the
- * llist_node structure of a lockless linked list of huge pages to be freed.
- */
-static LLIST_HEAD(hpage_freelist);
-
-static void free_hpage_workfn(struct work_struct *work)
-{
-	struct llist_node *node;
-	struct page *page;
-
-	node = llist_del_all(&hpage_freelist);
-
-	while (node) {
-		page = container_of((struct address_space **)node,
-				     struct page, mapping);
-		node = node->next;
-		__free_huge_page(page);
-	}
-}
-static DECLARE_WORK(free_hpage_work, free_hpage_workfn);
-
-void free_huge_page(struct page *page)
-{
-	/*
-	 * Defer freeing if in non-task context to avoid hugetlb_lock deadlock.
-	 */
-	if (!in_task()) {
-		/*
-		 * Only call schedule_work() if hpage_freelist is previously
-		 * empty. Otherwise, schedule_work() had been called but the
-		 * workfn hasn't retrieved the list yet.
-		 */
-		if (llist_add((struct llist_node *)&page->mapping,
-			      &hpage_freelist))
-			schedule_work(&free_hpage_work);
-		return;
+		spin_unlock_irqrestore(&hugetlb_lock, flags);
 	}
-
-	__free_huge_page(page);
 }
 
 static void prep_new_huge_page(struct hstate *h, struct page *page, int nid)
@@ -1530,11 +1487,11 @@ static void prep_new_huge_page(struct hs
 	hugetlb_set_page_subpool(page, NULL);
 	set_hugetlb_cgroup(page, NULL);
 	set_hugetlb_cgroup_rsvd(page, NULL);
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 	h->nr_huge_pages++;
 	h->nr_huge_pages_node[nid]++;
 	ClearHPageFreed(page);
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 }
 
 static void prep_compound_gigantic_page(struct page *page, unsigned int order)
@@ -1780,7 +1737,7 @@ retry:
 	if (!PageHuge(page))
 		return 0;
 
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 	if (!PageHuge(page)) {
 		rc = 0;
 		goto out;
@@ -1797,7 +1754,7 @@ retry:
 		 * when it is dissolved.
 		 */
 		if (unlikely(!HPageFreed(head))) {
-			spin_unlock(&hugetlb_lock);
+			spin_unlock_irq(&hugetlb_lock);
 			cond_resched();
 
 			/*
@@ -1821,12 +1778,12 @@ retry:
 		}
 		remove_hugetlb_page(h, page, false);
 		h->max_huge_pages--;
-		spin_unlock(&hugetlb_lock);
+		spin_unlock_irq(&hugetlb_lock);
 		update_and_free_page(h, head);
 		return 0;
 	}
 out:
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 	return rc;
 }
 
@@ -1868,16 +1825,16 @@ static struct page *alloc_surplus_huge_p
 	if (hstate_is_gigantic(h))
 		return NULL;
 
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 	if (h->surplus_huge_pages >= h->nr_overcommit_huge_pages)
 		goto out_unlock;
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 
 	page = alloc_fresh_huge_page(h, gfp_mask, nid, nmask, NULL);
 	if (!page)
 		return NULL;
 
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 	/*
 	 * We could have raced with the pool size change.
 	 * Double check that and simply deallocate the new page
@@ -1887,7 +1844,7 @@ static struct page *alloc_surplus_huge_p
 	 */
 	if (h->surplus_huge_pages >= h->nr_overcommit_huge_pages) {
 		SetHPageTemporary(page);
-		spin_unlock(&hugetlb_lock);
+		spin_unlock_irq(&hugetlb_lock);
 		put_page(page);
 		return NULL;
 	} else {
@@ -1896,7 +1853,7 @@ static struct page *alloc_surplus_huge_p
 	}
 
 out_unlock:
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 
 	return page;
 }
@@ -1946,17 +1903,17 @@ struct page *alloc_buddy_huge_page_with_
 struct page *alloc_huge_page_nodemask(struct hstate *h, int preferred_nid,
 		nodemask_t *nmask, gfp_t gfp_mask)
 {
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 	if (h->free_huge_pages - h->resv_huge_pages > 0) {
 		struct page *page;
 
 		page = dequeue_huge_page_nodemask(h, gfp_mask, preferred_nid, nmask);
 		if (page) {
-			spin_unlock(&hugetlb_lock);
+			spin_unlock_irq(&hugetlb_lock);
 			return page;
 		}
 	}
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 
 	return alloc_migrate_huge_page(h, gfp_mask, preferred_nid, nmask);
 }
@@ -2004,7 +1961,7 @@ static int gather_surplus_pages(struct h
 
 	ret = -ENOMEM;
 retry:
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 	for (i = 0; i < needed; i++) {
 		page = alloc_surplus_huge_page(h, htlb_alloc_mask(h),
 				NUMA_NO_NODE, NULL);
@@ -2021,7 +1978,7 @@ retry:
 	 * After retaking hugetlb_lock, we need to recalculate 'needed'
 	 * because either resv_huge_pages or free_huge_pages may have changed.
 	 */
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 	needed = (h->resv_huge_pages + delta) -
 			(h->free_huge_pages + allocated);
 	if (needed > 0) {
@@ -2061,12 +2018,12 @@ retry:
 		enqueue_huge_page(h, page);
 	}
 free:
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 
 	/* Free unnecessary surplus pages to the buddy allocator */
 	list_for_each_entry_safe(page, tmp, &surplus_list, lru)
 		put_page(page);
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 
 	return ret;
 }
@@ -2116,9 +2073,9 @@ static void return_unused_surplus_pages(
 	}
 
 out:
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 	update_and_free_pages_bulk(h, &page_list);
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 }
 
 
@@ -2352,7 +2309,7 @@ struct page *alloc_huge_page(struct vm_a
 	if (ret)
 		goto out_uncharge_cgroup_reservation;
 
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 	/*
 	 * glb_chg is passed to indicate whether or not a page must be taken
 	 * from the global free pool (global change).  gbl_chg == 0 indicates
@@ -2360,7 +2317,7 @@ struct page *alloc_huge_page(struct vm_a
 	 */
 	page = dequeue_huge_page_vma(h, vma, addr, avoid_reserve, gbl_chg);
 	if (!page) {
-		spin_unlock(&hugetlb_lock);
+		spin_unlock_irq(&hugetlb_lock);
 		page = alloc_buddy_huge_page_with_mpol(h, vma, addr);
 		if (!page)
 			goto out_uncharge_cgroup;
@@ -2368,7 +2325,7 @@ struct page *alloc_huge_page(struct vm_a
 			SetHPageRestoreReserve(page);
 			h->resv_huge_pages--;
 		}
-		spin_lock(&hugetlb_lock);
+		spin_lock_irq(&hugetlb_lock);
 		list_add(&page->lru, &h->hugepage_activelist);
 		/* Fall through */
 	}
@@ -2381,7 +2338,7 @@ struct page *alloc_huge_page(struct vm_a
 						  h_cg, page);
 	}
 
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 
 	hugetlb_set_page_subpool(page, spool);
 
@@ -2593,9 +2550,9 @@ static void try_to_free_low(struct hstat
 	}
 
 out:
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 	update_and_free_pages_bulk(h, &page_list);
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 }
 #else
 static inline void try_to_free_low(struct hstate *h, unsigned long count,
@@ -2660,7 +2617,7 @@ static int set_max_huge_pages(struct hst
 	 * pages in hstate via the proc/sysfs interfaces.
 	 */
 	mutex_lock(&h->resize_lock);
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 
 	/*
 	 * Check for a node specific request.
@@ -2691,7 +2648,7 @@ static int set_max_huge_pages(struct hst
 	 */
 	if (hstate_is_gigantic(h) && !IS_ENABLED(CONFIG_CONTIG_ALLOC)) {
 		if (count > persistent_huge_pages(h)) {
-			spin_unlock(&hugetlb_lock);
+			spin_unlock_irq(&hugetlb_lock);
 			mutex_unlock(&h->resize_lock);
 			NODEMASK_FREE(node_alloc_noretry);
 			return -EINVAL;
@@ -2721,14 +2678,14 @@ static int set_max_huge_pages(struct hst
 		 * page, free_huge_page will handle it by freeing the page
 		 * and reducing the surplus.
 		 */
-		spin_unlock(&hugetlb_lock);
+		spin_unlock_irq(&hugetlb_lock);
 
 		/* yield cpu to avoid soft lockup */
 		cond_resched();
 
 		ret = alloc_pool_huge_page(h, nodes_allowed,
 						node_alloc_noretry);
-		spin_lock(&hugetlb_lock);
+		spin_lock_irq(&hugetlb_lock);
 		if (!ret)
 			goto out;
 
@@ -2767,9 +2724,9 @@ static int set_max_huge_pages(struct hst
 		list_add(&page->lru, &page_list);
 	}
 	/* free the pages after dropping lock */
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 	update_and_free_pages_bulk(h, &page_list);
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 
 	while (count < persistent_huge_pages(h)) {
 		if (!adjust_pool_surplus(h, nodes_allowed, 1))
@@ -2777,7 +2734,7 @@ static int set_max_huge_pages(struct hst
 	}
 out:
 	h->max_huge_pages = persistent_huge_pages(h);
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 	mutex_unlock(&h->resize_lock);
 
 	NODEMASK_FREE(node_alloc_noretry);
@@ -2933,9 +2890,9 @@ static ssize_t nr_overcommit_hugepages_s
 	if (err)
 		return err;
 
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 	h->nr_overcommit_huge_pages = input;
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 
 	return count;
 }
@@ -3522,9 +3479,9 @@ int hugetlb_overcommit_handler(struct ct
 		goto out;
 
 	if (write) {
-		spin_lock(&hugetlb_lock);
+		spin_lock_irq(&hugetlb_lock);
 		h->nr_overcommit_huge_pages = tmp;
-		spin_unlock(&hugetlb_lock);
+		spin_unlock_irq(&hugetlb_lock);
 	}
 out:
 	return ret;
@@ -3620,7 +3577,7 @@ static int hugetlb_acct_memory(struct hs
 	if (!delta)
 		return 0;
 
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 	/*
 	 * When cpuset is configured, it breaks the strict hugetlb page
 	 * reservation as the accounting is done on a global variable. Such
@@ -3659,7 +3616,7 @@ static int hugetlb_acct_memory(struct hs
 		return_unused_surplus_pages(h, (unsigned long) -delta);
 
 out:
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 	return ret;
 }
 
@@ -5687,7 +5644,7 @@ bool isolate_huge_page(struct page *page
 {
 	bool ret = true;
 
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 	if (!PageHeadHuge(page) ||
 	    !HPageMigratable(page) ||
 	    !get_page_unless_zero(page)) {
@@ -5697,16 +5654,16 @@ bool isolate_huge_page(struct page *page
 	ClearHPageMigratable(page);
 	list_move_tail(&page->lru, list);
 unlock:
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 	return ret;
 }
 
 void putback_active_hugepage(struct page *page)
 {
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 	SetHPageMigratable(page);
 	list_move_tail(&page->lru, &(page_hstate(page))->hugepage_activelist);
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 	put_page(page);
 }
 
@@ -5740,12 +5697,12 @@ void move_hugetlb_state(struct page *old
 		 */
 		if (new_nid == old_nid)
 			return;
-		spin_lock(&hugetlb_lock);
+		spin_lock_irq(&hugetlb_lock);
 		if (h->surplus_huge_pages_node[old_nid]) {
 			h->surplus_huge_pages_node[old_nid]--;
 			h->surplus_huge_pages_node[new_nid]++;
 		}
-		spin_unlock(&hugetlb_lock);
+		spin_unlock_irq(&hugetlb_lock);
 	}
 }
 
--- a/mm/hugetlb_cgroup.c~hugetlb-make-free_huge_page-irq-safe
+++ a/mm/hugetlb_cgroup.c
@@ -204,11 +204,11 @@ static void hugetlb_cgroup_css_offline(s
 	do {
 		idx = 0;
 		for_each_hstate(h) {
-			spin_lock(&hugetlb_lock);
+			spin_lock_irq(&hugetlb_lock);
 			list_for_each_entry(page, &h->hugepage_activelist, lru)
 				hugetlb_cgroup_move_parent(idx, h_cg, page);
 
-			spin_unlock(&hugetlb_lock);
+			spin_unlock_irq(&hugetlb_lock);
 			idx++;
 		}
 		cond_resched();
@@ -784,7 +784,7 @@ void hugetlb_cgroup_migrate(struct page
 	if (hugetlb_cgroup_disabled())
 		return;
 
-	spin_lock(&hugetlb_lock);
+	spin_lock_irq(&hugetlb_lock);
 	h_cg = hugetlb_cgroup_from_page(oldhpage);
 	h_cg_rsvd = hugetlb_cgroup_from_page_rsvd(oldhpage);
 	set_hugetlb_cgroup(oldhpage, NULL);
@@ -794,7 +794,7 @@ void hugetlb_cgroup_migrate(struct page
 	set_hugetlb_cgroup(newhpage, h_cg);
 	set_hugetlb_cgroup_rsvd(newhpage, h_cg_rsvd);
 	list_move(&newhpage->lru, &h->hugepage_activelist);
-	spin_unlock(&hugetlb_lock);
+	spin_unlock_irq(&hugetlb_lock);
 	return;
 }
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 046/143] hugetlb: add lockdep_assert_held() calls for hugetlb_lock
  2021-05-05  1:32 incoming Andrew Morton
                   ` (44 preceding siblings ...)
  2021-05-05  1:35 ` [patch 045/143] hugetlb: make free_huge_page irq safe Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:35 ` [patch 047/143] mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range Andrew Morton
                   ` (94 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
	iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
	mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
	peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
	will, willy

From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: hugetlb: add lockdep_assert_held() calls for hugetlb_lock

After making hugetlb lock irq safe and separating some functionality done
under the lock, add some lockdep_assert_held to help verify locking.

Link: https://lkml.kernel.org/r/20210409205254.242291-9-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Muchun Song <songmuchun@bytedance.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |    9 +++++++++
 1 file changed, 9 insertions(+)

--- a/mm/hugetlb.c~hugetlb-add-lockdep_assert_held-calls-for-hugetlb_lock
+++ a/mm/hugetlb.c
@@ -1069,6 +1069,8 @@ static bool vma_has_reserves(struct vm_a
 static void enqueue_huge_page(struct hstate *h, struct page *page)
 {
 	int nid = page_to_nid(page);
+
+	lockdep_assert_held(&hugetlb_lock);
 	list_move(&page->lru, &h->hugepage_freelists[nid]);
 	h->free_huge_pages++;
 	h->free_huge_pages_node[nid]++;
@@ -1080,6 +1082,7 @@ static struct page *dequeue_huge_page_no
 	struct page *page;
 	bool nocma = !!(current->flags & PF_MEMALLOC_NOCMA);
 
+	lockdep_assert_held(&hugetlb_lock);
 	list_for_each_entry(page, &h->hugepage_freelists[nid], lru) {
 		if (nocma && is_migrate_cma_page(page))
 			continue;
@@ -1351,6 +1354,7 @@ static void remove_hugetlb_page(struct h
 	VM_BUG_ON_PAGE(hugetlb_cgroup_from_page(page), page);
 	VM_BUG_ON_PAGE(hugetlb_cgroup_from_page_rsvd(page), page);
 
+	lockdep_assert_held(&hugetlb_lock);
 	if (hstate_is_gigantic(h) && !gigantic_page_runtime_supported())
 		return;
 
@@ -1701,6 +1705,7 @@ static struct page *remove_pool_huge_pag
 	int nr_nodes, node;
 	struct page *page = NULL;
 
+	lockdep_assert_held(&hugetlb_lock);
 	for_each_node_mask_to_free(h, nr_nodes, node, nodes_allowed) {
 		/*
 		 * If we're returning unused surplus pages, only examine
@@ -1950,6 +1955,7 @@ static int gather_surplus_pages(struct h
 	long needed, allocated;
 	bool alloc_ok = true;
 
+	lockdep_assert_held(&hugetlb_lock);
 	needed = (h->resv_huge_pages + delta) - h->free_huge_pages;
 	if (needed <= 0) {
 		h->resv_huge_pages += delta;
@@ -2043,6 +2049,7 @@ static void return_unused_surplus_pages(
 	struct page *page;
 	LIST_HEAD(page_list);
 
+	lockdep_assert_held(&hugetlb_lock);
 	/* Uncommit the reservation */
 	h->resv_huge_pages -= unused_resv_pages;
 
@@ -2530,6 +2537,7 @@ static void try_to_free_low(struct hstat
 	int i;
 	LIST_HEAD(page_list);
 
+	lockdep_assert_held(&hugetlb_lock);
 	if (hstate_is_gigantic(h))
 		return;
 
@@ -2571,6 +2579,7 @@ static int adjust_pool_surplus(struct hs
 {
 	int nr_nodes, node;
 
+	lockdep_assert_held(&hugetlb_lock);
 	VM_BUG_ON(delta != -1 && delta != 1);
 
 	if (delta < 0) {
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 047/143] mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range
  2021-05-05  1:32 incoming Andrew Morton
                   ` (45 preceding siblings ...)
  2021-05-05  1:35 ` [patch 046/143] hugetlb: add lockdep_assert_held() calls for hugetlb_lock Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:35 ` [patch 048/143] mm,compaction: let isolate_migratepages_{range,block} return error codes Andrew Morton
                   ` (93 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits,
	osalvador, songmuchun, torvalds, vbabka

From: Oscar Salvador <osalvador@suse.de>
Subject: mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range

Patch series "Make alloc_contig_range handle Hugetlb pages", v10.


alloc_contig_range lacks the ability to handle HugeTLB pages.  This can be
problematic for some users, e.g: CMA and virtio-mem, where those users
will fail the call if alloc_contig_range ever sees a HugeTLB page, even
when those pages lay in ZONE_MOVABLE and are free.  That problem can be
easily solved by replacing the page in the free hugepage pool.

In-use HugeTLB are no exception though, as those can be isolated and
migrated as any other LRU or Movable page.

This patchset aims for improving
alloc_contig_range->isolate_migratepages_block, so HugeTLB pages can be
recognized and handled.

Since we also need to start reporting errors down the chain (e.g: -ENOMEM
due to not be able to allocate a new hugetlb page),
isolate_migratepages_{range,block} interfaces need to change to start
reporting error codes instead of the pfn == 0 vs pfn != 0 scheme it is
using right now.  From now on, isolate_migratepages_block will not return
the next pfn to be scanned anymore, but -EINTR, -ENOMEM or 0, so we the
next pfn to be scanned will be recorded in cc->migrate_pfn field (as it is
already done in isolate_migratepages_range()).

Below is an insight from David (thanks), where the problem can clearly be
seen:

 "Start a VM with 4G. Hotplug 1G via virtio-mem and online it to
  ZONE_MOVABLE. Allocate 512 huge pages.

  [root@localhost ~]# cat /proc/meminfo
  MemTotal:        5061512 kB
  MemFree:         3319396 kB
  MemAvailable:    3457144 kB
  ...
  HugePages_Total:     512
  HugePages_Free:      512
  HugePages_Rsvd:        0
  HugePages_Surp:        0
  Hugepagesize:       2048 kB

  The huge pages get partially allocate from ZONE_MOVABLE. Try unplugging
  1G via virtio-mem (remember, all ZONE_MOVABLE). Inside the guest:

  [  180.058992] alloc_contig_range: [1b8000, 1c0000) PFNs busy
  [  180.060531] alloc_contig_range: [1b8000, 1c0000) PFNs busy
  [  180.061972] alloc_contig_range: [1b8000, 1c0000) PFNs busy
  [  180.063413] alloc_contig_range: [1b8000, 1c0000) PFNs busy
  [  180.064838] alloc_contig_range: [1b8000, 1c0000) PFNs busy
  [  180.065848] alloc_contig_range: [1bfc00, 1c0000) PFNs busy
  [  180.066794] alloc_contig_range: [1bfc00, 1c0000) PFNs busy
  [  180.067738] alloc_contig_range: [1bfc00, 1c0000) PFNs busy
  [  180.068669] alloc_contig_range: [1bfc00, 1c0000) PFNs busy
  [  180.069598] alloc_contig_range: [1bfc00, 1c0000) PFNs busy"

And then with this patchset running:

 "Same experiment with ZONE_MOVABLE:

  a) Free huge pages: all memory can get unplugged again.

  b) Allocated/populated but idle huge pages: all memory can get unplugged
     again.

  c) Allocated/populated but all 512 huge pages are read/written in a
     loop: all memory can get unplugged again, but I get a single

     [  121.192345] alloc_contig_range: [180000, 188000) PFNs busy

     Most probably because it happened to try migrating a huge page
     while it was busy.  As virtio-mem retries on ZONE_MOVABLE a couple of
     times, it can deal with this temporary failure.

  Last but not least, I did something extreme:

  # cat /proc/meminfo
  MemTotal:        5061568 kB
  MemFree:          186560 kB
  MemAvailable:     354524 kB
  ...
  HugePages_Total:    2048
  HugePages_Free:     2048
  HugePages_Rsvd:        0
  HugePages_Surp:        0

  Triggering unplug would require to dissolve+alloc - which now fails
  when trying to allocate an additional ~512 huge pages (1G).

  As expected, I can properly see memory unplug not fully succeeding.  +
  I get a fairly continuous stream of

  [  226.611584] alloc_contig_range: [19f400, 19f800) PFNs busy
  ...

  But more importantly, the hugepage count remains stable, as configured
  by the admin (me):

  HugePages_Total:    2048
  HugePages_Free:     2048
  HugePages_Rsvd:        0
  HugePages_Surp:        0"


This patch (of 7):

Currently, __alloc_contig_migrate_range can generate -EINTR, -ENOMEM or
-EBUSY, and report them down the chain.  The problem is that when
migrate_pages() reports -ENOMEM, we keep going till we exhaust all the
try-attempts (5 at the moment) instead of bailing out.

migrate_pages() bails out right away on -ENOMEM because it is considered a
fatal error.  Do the same here instead of keep going and retrying.  Note
that this is not fixing a real issue, just a cosmetic change.  Although we
can save some cycles by backing off ealier

Link: https://lkml.kernel.org/r/20210419075413.1064-1-osalvador@suse.de
Link: https://lkml.kernel.org/r/20210419075413.1064-2-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Acked-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/page_alloc.c |    9 ++++++++-
 1 file changed, 8 insertions(+), 1 deletion(-)

--- a/mm/page_alloc.c~mmpage_alloc-bail-out-earlier-on-enomem-in-alloc_contig_migrate_range
+++ a/mm/page_alloc.c
@@ -8696,7 +8696,7 @@ static int __alloc_contig_migrate_range(
 			}
 			tries = 0;
 		} else if (++tries == 5) {
-			ret = ret < 0 ? ret : -EBUSY;
+			ret = -EBUSY;
 			break;
 		}
 
@@ -8706,6 +8706,13 @@ static int __alloc_contig_migrate_range(
 
 		ret = migrate_pages(&cc->migratepages, alloc_migration_target,
 				NULL, (unsigned long)&mtc, cc->mode, MR_CONTIG_RANGE);
+
+		/*
+		 * On -ENOMEM, migrate_pages() bails out right away. It is pointless
+		 * to retry again over this error, so do the same here.
+		 */
+		if (ret == -ENOMEM)
+			break;
 	}
 	if (ret < 0) {
 		alloc_contig_dump_pages(&cc->migratepages);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 048/143] mm,compaction: let isolate_migratepages_{range,block} return error codes
  2021-05-05  1:32 incoming Andrew Morton
                   ` (46 preceding siblings ...)
  2021-05-05  1:35 ` [patch 047/143] mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:35 ` [patch 049/143] mm,hugetlb: drop clearing of flag from prep_new_huge_page Andrew Morton
                   ` (92 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits,
	osalvador, songmuchun, torvalds, vbabka

From: Oscar Salvador <osalvador@suse.de>
Subject: mm,compaction: let isolate_migratepages_{range,block} return error codes

Currently, isolate_migratepages_{range,block} and their callers use a pfn
== 0 vs pfn != 0 scheme to let the caller know whether there was any error
during isolation.

This does not work as soon as we need to start reporting different error
codes and make sure we pass them down the chain, so they are properly
interpreted by functions like e.g: alloc_contig_range.

Let us rework isolate_migratepages_{range,block} so we can report error
codes.  Since isolate_migratepages_block will stop returning the next pfn
to be scanned, we reuse the cc->migrate_pfn field to keep track of that.

Link: https://lkml.kernel.org/r/20210419075413.1064-3-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/compaction.c |   52 ++++++++++++++++++++++------------------------
 mm/internal.h   |   10 +++++++-
 mm/page_alloc.c |    7 ++----
 3 files changed, 36 insertions(+), 33 deletions(-)

--- a/mm/compaction.c~mmcompaction-let-isolate_migratepages_rangeblock-return-error-codes
+++ a/mm/compaction.c
@@ -787,15 +787,14 @@ static bool too_many_isolated(pg_data_t
  *
  * Isolate all pages that can be migrated from the range specified by
  * [low_pfn, end_pfn). The range is expected to be within same pageblock.
- * Returns zero if there is a fatal signal pending, otherwise PFN of the
- * first page that was not scanned (which may be both less, equal to or more
- * than end_pfn).
+ * Returns errno, like -EAGAIN or -EINTR in case e.g signal pending or congestion,
+ * or 0.
+ * cc->migrate_pfn will contain the next pfn to scan.
  *
  * The pages are isolated on cc->migratepages list (not required to be empty),
- * and cc->nr_migratepages is updated accordingly. The cc->migrate_pfn field
- * is neither read nor updated.
+ * and cc->nr_migratepages is updated accordingly.
  */
-static unsigned long
+static int
 isolate_migratepages_block(struct compact_control *cc, unsigned long low_pfn,
 			unsigned long end_pfn, isolate_mode_t isolate_mode)
 {
@@ -809,6 +808,9 @@ isolate_migratepages_block(struct compac
 	bool skip_on_failure = false;
 	unsigned long next_skip_pfn = 0;
 	bool skip_updated = false;
+	int ret = 0;
+
+	cc->migrate_pfn = low_pfn;
 
 	/*
 	 * Ensure that there are not too many pages isolated from the LRU
@@ -818,16 +820,16 @@ isolate_migratepages_block(struct compac
 	while (unlikely(too_many_isolated(pgdat))) {
 		/* stop isolation if there are still pages not migrated */
 		if (cc->nr_migratepages)
-			return 0;
+			return -EAGAIN;
 
 		/* async migration should just abort */
 		if (cc->mode == MIGRATE_ASYNC)
-			return 0;
+			return -EAGAIN;
 
 		congestion_wait(BLK_RW_ASYNC, HZ/10);
 
 		if (fatal_signal_pending(current))
-			return 0;
+			return -EINTR;
 	}
 
 	cond_resched();
@@ -875,8 +877,8 @@ isolate_migratepages_block(struct compac
 
 			if (fatal_signal_pending(current)) {
 				cc->contended = true;
+				ret = -EINTR;
 
-				low_pfn = 0;
 				goto fatal_pending;
 			}
 
@@ -1130,7 +1132,9 @@ fatal_pending:
 	if (nr_isolated)
 		count_compact_events(COMPACTISOLATED, nr_isolated);
 
-	return low_pfn;
+	cc->migrate_pfn = low_pfn;
+
+	return ret;
 }
 
 /**
@@ -1139,15 +1143,14 @@ fatal_pending:
  * @start_pfn: The first PFN to start isolating.
  * @end_pfn:   The one-past-last PFN.
  *
- * Returns zero if isolation fails fatally due to e.g. pending signal.
- * Otherwise, function returns one-past-the-last PFN of isolated page
- * (which may be greater than end_pfn if end fell in a middle of a THP page).
+ * Returns -EAGAIN when contented, -EINTR in case of a signal pending or 0.
  */
-unsigned long
+int
 isolate_migratepages_range(struct compact_control *cc, unsigned long start_pfn,
 							unsigned long end_pfn)
 {
 	unsigned long pfn, block_start_pfn, block_end_pfn;
+	int ret = 0;
 
 	/* Scan block by block. First and last block may be incomplete */
 	pfn = start_pfn;
@@ -1166,17 +1169,17 @@ isolate_migratepages_range(struct compac
 					block_end_pfn, cc->zone))
 			continue;
 
-		pfn = isolate_migratepages_block(cc, pfn, block_end_pfn,
-							ISOLATE_UNEVICTABLE);
+		ret = isolate_migratepages_block(cc, pfn, block_end_pfn,
+						 ISOLATE_UNEVICTABLE);
 
-		if (!pfn)
+		if (ret)
 			break;
 
 		if (cc->nr_migratepages >= COMPACT_CLUSTER_MAX)
 			break;
 	}
 
-	return pfn;
+	return ret;
 }
 
 #endif /* CONFIG_COMPACTION || CONFIG_CMA */
@@ -1847,7 +1850,7 @@ static isolate_migrate_t isolate_migrate
 	 */
 	for (; block_end_pfn <= cc->free_pfn;
 			fast_find_block = false,
-			low_pfn = block_end_pfn,
+			cc->migrate_pfn = low_pfn = block_end_pfn,
 			block_start_pfn = block_end_pfn,
 			block_end_pfn += pageblock_nr_pages) {
 
@@ -1889,10 +1892,8 @@ static isolate_migrate_t isolate_migrate
 		}
 
 		/* Perform the isolation */
-		low_pfn = isolate_migratepages_block(cc, low_pfn,
-						block_end_pfn, isolate_mode);
-
-		if (!low_pfn)
+		if (isolate_migratepages_block(cc, low_pfn, block_end_pfn,
+						isolate_mode))
 			return ISOLATE_ABORT;
 
 		/*
@@ -1903,9 +1904,6 @@ static isolate_migrate_t isolate_migrate
 		break;
 	}
 
-	/* Record where migration scanner will be restarted. */
-	cc->migrate_pfn = low_pfn;
-
 	return cc->nr_migratepages ? ISOLATE_SUCCESS : ISOLATE_NONE;
 }
 
--- a/mm/internal.h~mmcompaction-let-isolate_migratepages_rangeblock-return-error-codes
+++ a/mm/internal.h
@@ -244,7 +244,13 @@ struct compact_control {
 	unsigned int nr_freepages;	/* Number of isolated free pages */
 	unsigned int nr_migratepages;	/* Number of pages to migrate */
 	unsigned long free_pfn;		/* isolate_freepages search base */
-	unsigned long migrate_pfn;	/* isolate_migratepages search base */
+	/*
+	 * Acts as an in/out parameter to page isolation for migration.
+	 * isolate_migratepages uses it as a search base.
+	 * isolate_migratepages_block will update the value to the next pfn
+	 * after the last isolated one.
+	 */
+	unsigned long migrate_pfn;
 	unsigned long fast_start_pfn;	/* a pfn to start linear scan from */
 	struct zone *zone;
 	unsigned long total_migrate_scanned;
@@ -280,7 +286,7 @@ struct capture_control {
 unsigned long
 isolate_freepages_range(struct compact_control *cc,
 			unsigned long start_pfn, unsigned long end_pfn);
-unsigned long
+int
 isolate_migratepages_range(struct compact_control *cc,
 			   unsigned long low_pfn, unsigned long end_pfn);
 int find_suitable_fallback(struct free_area *area, unsigned int order,
--- a/mm/page_alloc.c~mmcompaction-let-isolate_migratepages_rangeblock-return-error-codes
+++ a/mm/page_alloc.c
@@ -8689,11 +8689,10 @@ static int __alloc_contig_migrate_range(
 
 		if (list_empty(&cc->migratepages)) {
 			cc->nr_migratepages = 0;
-			pfn = isolate_migratepages_range(cc, pfn, end);
-			if (!pfn) {
-				ret = -EINTR;
+			ret = isolate_migratepages_range(cc, pfn, end);
+			if (ret && ret != -EAGAIN)
 				break;
-			}
+			pfn = cc->migrate_pfn;
 			tries = 0;
 		} else if (++tries == 5) {
 			ret = -EBUSY;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 049/143] mm,hugetlb: drop clearing of flag from prep_new_huge_page
  2021-05-05  1:32 incoming Andrew Morton
                   ` (47 preceding siblings ...)
  2021-05-05  1:35 ` [patch 048/143] mm,compaction: let isolate_migratepages_{range,block} return error codes Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:35 ` [patch 050/143] mm,hugetlb: split prep_new_huge_page functionality Andrew Morton
                   ` (91 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits,
	osalvador, songmuchun, torvalds, vbabka

From: Oscar Salvador <osalvador@suse.de>
Subject: mm,hugetlb: drop clearing of flag from prep_new_huge_page

Pages allocated via the page allocator or CMA get its private field
cleared by means of post_alloc_hook().

Pages allocated during boot, that is directly from the memblock allocator,
get cleared by
paging_init()->..->memmap_init_zone->..->__init_single_page() before any
memblock allocation.

Based on this ground, let us remove the clearing of the flag from
prep_new_huge_page() as it is not needed.  This was a leftover from
6c0371490140 ("hugetlb: convert PageHugeFreed to HPageFreed flag"). 
Previously the explicit clearing was necessary because compound
allocations do not get this initialization (see prep_compound_page).

Link: https://lkml.kernel.org/r/20210419075413.1064-4-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |    1 -
 1 file changed, 1 deletion(-)

--- a/mm/hugetlb.c~mmhugetlb-drop-clearing-of-flag-from-prep_new_huge_page
+++ a/mm/hugetlb.c
@@ -1494,7 +1494,6 @@ static void prep_new_huge_page(struct hs
 	spin_lock_irq(&hugetlb_lock);
 	h->nr_huge_pages++;
 	h->nr_huge_pages_node[nid]++;
-	ClearHPageFreed(page);
 	spin_unlock_irq(&hugetlb_lock);
 }
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 050/143] mm,hugetlb: split prep_new_huge_page functionality
  2021-05-05  1:32 incoming Andrew Morton
                   ` (48 preceding siblings ...)
  2021-05-05  1:35 ` [patch 049/143] mm,hugetlb: drop clearing of flag from prep_new_huge_page Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:35 ` [patch 051/143] mm: make alloc_contig_range handle free hugetlb pages Andrew Morton
                   ` (90 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits,
	osalvador, songmuchun, torvalds, vbabka

From: Oscar Salvador <osalvador@suse.de>
Subject: mm,hugetlb: split prep_new_huge_page functionality

Currently, prep_new_huge_page() performs two functions.  It sets the right
state for a new hugetlb, and increases the hstate's counters to account
for the new page.

Let us split its functionality into two separate functions, decoupling the
handling of the counters from initializing a hugepage.  The outcome is
having __prep_new_huge_page(), which only initializes the page , and
__prep_account_new_huge_page(), which adds the new page to the hstate's
counters.

This allows us to be able to set a hugetlb without having to worry about
the counter/locking.  It will prove useful in the next patch. 
prep_new_huge_page() still calls both functions.

Link: https://lkml.kernel.org/r/20210419075413.1064-5-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |   20 +++++++++++++++++---
 1 file changed, 17 insertions(+), 3 deletions(-)

--- a/mm/hugetlb.c~mmhugetlb-split-prep_new_huge_page-functionality
+++ a/mm/hugetlb.c
@@ -1484,16 +1484,30 @@ void free_huge_page(struct page *page)
 	}
 }
 
-static void prep_new_huge_page(struct hstate *h, struct page *page, int nid)
+/*
+ * Must be called with the hugetlb lock held
+ */
+static void __prep_account_new_huge_page(struct hstate *h, int nid)
+{
+	lockdep_assert_held(&hugetlb_lock);
+	h->nr_huge_pages++;
+	h->nr_huge_pages_node[nid]++;
+}
+
+static void __prep_new_huge_page(struct page *page)
 {
 	INIT_LIST_HEAD(&page->lru);
 	set_compound_page_dtor(page, HUGETLB_PAGE_DTOR);
 	hugetlb_set_page_subpool(page, NULL);
 	set_hugetlb_cgroup(page, NULL);
 	set_hugetlb_cgroup_rsvd(page, NULL);
+}
+
+static void prep_new_huge_page(struct hstate *h, struct page *page, int nid)
+{
+	__prep_new_huge_page(page);
 	spin_lock_irq(&hugetlb_lock);
-	h->nr_huge_pages++;
-	h->nr_huge_pages_node[nid]++;
+	__prep_account_new_huge_page(h, nid);
 	spin_unlock_irq(&hugetlb_lock);
 }
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 051/143] mm: make alloc_contig_range handle free hugetlb pages
  2021-05-05  1:32 incoming Andrew Morton
                   ` (49 preceding siblings ...)
  2021-05-05  1:35 ` [patch 050/143] mm,hugetlb: split prep_new_huge_page functionality Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:35 ` [patch 052/143] mm: make alloc_contig_range handle in-use " Andrew Morton
                   ` (89 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits,
	osalvador, songmuchun, torvalds, vbabka

From: Oscar Salvador <osalvador@suse.de>
Subject: mm: make alloc_contig_range handle free hugetlb pages

alloc_contig_range will fail if it ever sees a HugeTLB page within the
range we are trying to allocate, even when that page is free and can be
easily reallocated.

This has proved to be problematic for some users of alloc_contic_range,
e.g: CMA and virtio-mem, where those would fail the call even when those
pages lay in ZONE_MOVABLE and are free.

We can do better by trying to replace such page.

Free hugepages are tricky to handle so as to no userspace application
notices disruption, we need to replace the current free hugepage with a
new one.

In order to do that, a new function called alloc_and_dissolve_huge_page is
introduced.  This function will first try to get a new fresh hugepage, and
if it succeeds, it will replace the old one in the free hugepage pool.

The free page replacement is done under hugetlb_lock, so no external users
of hugetlb will notice the change.  To allocate the new huge page, we use
alloc_buddy_huge_page(), so we do not have to deal with any counters, and
prep_new_huge_page() is not called.  This is valulable because in case we
need to free the new page, we only need to call __free_pages().

Once we know that the page to be replaced is a genuine 0-refcounted huge
page, we remove the old page from the freelist by remove_hugetlb_page(). 
Then, we can call __prep_new_huge_page() and
__prep_account_new_huge_page() for the new huge page to properly
initialize it and increment the hstate->nr_huge_pages counter (previously
decremented by remove_hugetlb_page()).  Once done, the page is enqueued by
enqueue_huge_page() and it is ready to be used.

There is one tricky case when page's refcount is 0 because it is in the
process of being released.  A missing PageHugeFreed bit will tell us that
freeing is in flight so we retry after dropping the hugetlb_lock.  The
race window should be small and the next retry should make a forward
progress.

E.g:

CPU0				CPU1
free_huge_page()		isolate_or_dissolve_huge_page
				  PageHuge() == T
				  alloc_and_dissolve_huge_page
				    alloc_buddy_huge_page()
				    spin_lock_irq(hugetlb_lock)
				    // PageHuge() && !PageHugeFreed &&
				    // !PageCount()
				    spin_unlock_irq(hugetlb_lock)
  spin_lock_irq(hugetlb_lock)
  1) update_and_free_page
       PageHuge() == F
       __free_pages()
  2) enqueue_huge_page
       SetPageHugeFreed()
  spin_unlock_irq(&hugetlb_lock)
				  spin_lock_irq(hugetlb_lock)
                                   1) PageHuge() == F (freed by case#1 from CPU0)
				   2) PageHuge() == T
                                       PageHugeFreed() == T
                                       - proceed with replacing the page

In the case above we retry as the window race is quite small and we have
high chances to succeed next time.

With regard to the allocation, we restrict it to the node the page belongs
to with __GFP_THISNODE, meaning we do not fallback on other node's zones.

Note that gigantic hugetlb pages are fenced off since there is a cyclic
dependency between them and alloc_contig_range.

Link: https://lkml.kernel.org/r/20210419075413.1064-6-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Michal Hocko <mhocko@suse.com>
Acked-by: David Hildenbrand <david@redhat.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/hugetlb.h |    6 +
 mm/compaction.c         |   33 +++++++++-
 mm/hugetlb.c            |  116 ++++++++++++++++++++++++++++++++++++++
 3 files changed, 152 insertions(+), 3 deletions(-)

--- a/include/linux/hugetlb.h~mm-make-alloc_contig_range-handle-free-hugetlb-pages
+++ a/include/linux/hugetlb.h
@@ -588,6 +588,7 @@ struct huge_bootmem_page {
 	struct hstate *hstate;
 };
 
+int isolate_or_dissolve_huge_page(struct page *page);
 struct page *alloc_huge_page(struct vm_area_struct *vma,
 				unsigned long addr, int avoid_reserve);
 struct page *alloc_huge_page_nodemask(struct hstate *h, int preferred_nid,
@@ -870,6 +871,11 @@ static inline void huge_ptep_modify_prot
 #else	/* CONFIG_HUGETLB_PAGE */
 struct hstate {};
 
+static inline int isolate_or_dissolve_huge_page(struct page *page)
+{
+	return -ENOMEM;
+}
+
 static inline struct page *alloc_huge_page(struct vm_area_struct *vma,
 					   unsigned long addr,
 					   int avoid_reserve)
--- a/mm/compaction.c~mm-make-alloc_contig_range-handle-free-hugetlb-pages
+++ a/mm/compaction.c
@@ -788,7 +788,7 @@ static bool too_many_isolated(pg_data_t
  * Isolate all pages that can be migrated from the range specified by
  * [low_pfn, end_pfn). The range is expected to be within same pageblock.
  * Returns errno, like -EAGAIN or -EINTR in case e.g signal pending or congestion,
- * or 0.
+ * -ENOMEM in case we could not allocate a page, or 0.
  * cc->migrate_pfn will contain the next pfn to scan.
  *
  * The pages are isolated on cc->migratepages list (not required to be empty),
@@ -906,6 +906,29 @@ isolate_migratepages_block(struct compac
 			valid_page = page;
 		}
 
+		if (PageHuge(page) && cc->alloc_contig) {
+			ret = isolate_or_dissolve_huge_page(page);
+
+			/*
+			 * Fail isolation in case isolate_or_dissolve_huge_page()
+			 * reports an error. In case of -ENOMEM, abort right away.
+			 */
+			if (ret < 0) {
+				 /* Do not report -EBUSY down the chain */
+				if (ret == -EBUSY)
+					ret = 0;
+				low_pfn += (1UL << compound_order(page)) - 1;
+				goto isolate_fail;
+			}
+
+			/*
+			 * Ok, the hugepage was dissolved. Now these pages are
+			 * Buddy and cannot be re-allocated because they are
+			 * isolated. Fall-through as the check below handles
+			 * Buddy pages.
+			 */
+		}
+
 		/*
 		 * Skip if free. We read page order here without zone lock
 		 * which is generally unsafe, but the race window is small and
@@ -1065,7 +1088,7 @@ isolate_fail_put:
 		put_page(page);
 
 isolate_fail:
-		if (!skip_on_failure)
+		if (!skip_on_failure && ret != -ENOMEM)
 			continue;
 
 		/*
@@ -1091,6 +1114,9 @@ isolate_fail:
 			 */
 			next_skip_pfn += 1UL << cc->order;
 		}
+
+		if (ret == -ENOMEM)
+			break;
 	}
 
 	/*
@@ -1143,7 +1169,8 @@ fatal_pending:
  * @start_pfn: The first PFN to start isolating.
  * @end_pfn:   The one-past-last PFN.
  *
- * Returns -EAGAIN when contented, -EINTR in case of a signal pending or 0.
+ * Returns -EAGAIN when contented, -EINTR in case of a signal pending, -ENOMEM
+ * in case we could not allocate a page, or 0.
  */
 int
 isolate_migratepages_range(struct compact_control *cc, unsigned long start_pfn,
--- a/mm/hugetlb.c~mm-make-alloc_contig_range-handle-free-hugetlb-pages
+++ a/mm/hugetlb.c
@@ -2267,6 +2267,122 @@ static void restore_reserve_on_error(str
 	}
 }
 
+/*
+ * alloc_and_dissolve_huge_page - Allocate a new page and dissolve the old one
+ * @h: struct hstate old page belongs to
+ * @old_page: Old page to dissolve
+ * Returns 0 on success, otherwise negated error.
+ */
+static int alloc_and_dissolve_huge_page(struct hstate *h, struct page *old_page)
+{
+	gfp_t gfp_mask = htlb_alloc_mask(h) | __GFP_THISNODE;
+	int nid = page_to_nid(old_page);
+	struct page *new_page;
+	int ret = 0;
+
+	/*
+	 * Before dissolving the page, we need to allocate a new one for the
+	 * pool to remain stable. Using alloc_buddy_huge_page() allows us to
+	 * not having to deal with prep_new_huge_page() and avoids dealing of any
+	 * counters. This simplifies and let us do the whole thing under the
+	 * lock.
+	 */
+	new_page = alloc_buddy_huge_page(h, gfp_mask, nid, NULL, NULL);
+	if (!new_page)
+		return -ENOMEM;
+
+retry:
+	spin_lock_irq(&hugetlb_lock);
+	if (!PageHuge(old_page)) {
+		/*
+		 * Freed from under us. Drop new_page too.
+		 */
+		goto free_new;
+	} else if (page_count(old_page)) {
+		/*
+		 * Someone has grabbed the page, fail for now.
+		 */
+		ret = -EBUSY;
+		goto free_new;
+	} else if (!HPageFreed(old_page)) {
+		/*
+		 * Page's refcount is 0 but it has not been enqueued in the
+		 * freelist yet. Race window is small, so we can succeed here if
+		 * we retry.
+		 */
+		spin_unlock_irq(&hugetlb_lock);
+		cond_resched();
+		goto retry;
+	} else {
+		/*
+		 * Ok, old_page is still a genuine free hugepage. Remove it from
+		 * the freelist and decrease the counters. These will be
+		 * incremented again when calling __prep_account_new_huge_page()
+		 * and enqueue_huge_page() for new_page. The counters will remain
+		 * stable since this happens under the lock.
+		 */
+		remove_hugetlb_page(h, old_page, false);
+
+		/*
+		 * new_page needs to be initialized with the standard hugetlb
+		 * state. This is normally done by prep_new_huge_page() but
+		 * that takes hugetlb_lock which is already held so we need to
+		 * open code it here.
+		 * Reference count trick is needed because allocator gives us
+		 * referenced page but the pool requires pages with 0 refcount.
+		 */
+		__prep_new_huge_page(new_page);
+		__prep_account_new_huge_page(h, nid);
+		page_ref_dec(new_page);
+		enqueue_huge_page(h, new_page);
+
+		/*
+		 * Pages have been replaced, we can safely free the old one.
+		 */
+		spin_unlock_irq(&hugetlb_lock);
+		update_and_free_page(h, old_page);
+	}
+
+	return ret;
+
+free_new:
+	spin_unlock_irq(&hugetlb_lock);
+	__free_pages(new_page, huge_page_order(h));
+
+	return ret;
+}
+
+int isolate_or_dissolve_huge_page(struct page *page)
+{
+	struct hstate *h;
+	struct page *head;
+
+	/*
+	 * The page might have been dissolved from under our feet, so make sure
+	 * to carefully check the state under the lock.
+	 * Return success when racing as if we dissolved the page ourselves.
+	 */
+	spin_lock_irq(&hugetlb_lock);
+	if (PageHuge(page)) {
+		head = compound_head(page);
+		h = page_hstate(head);
+	} else {
+		spin_unlock_irq(&hugetlb_lock);
+		return 0;
+	}
+	spin_unlock_irq(&hugetlb_lock);
+
+	/*
+	 * Fence off gigantic pages as there is a cyclic dependency between
+	 * alloc_contig_range and them. Return -ENOMEM as this has the effect
+	 * of bailing out right away without further retrying.
+	 */
+	if (hstate_is_gigantic(h))
+		return -ENOMEM;
+
+	return alloc_and_dissolve_huge_page(h, head);
+}
+
 struct page *alloc_huge_page(struct vm_area_struct *vma,
 				    unsigned long addr, int avoid_reserve)
 {
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 052/143] mm: make alloc_contig_range handle in-use hugetlb pages
  2021-05-05  1:32 incoming Andrew Morton
                   ` (50 preceding siblings ...)
  2021-05-05  1:35 ` [patch 051/143] mm: make alloc_contig_range handle free hugetlb pages Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:35 ` [patch 053/143] mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig Andrew Morton
                   ` (88 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits,
	osalvador, songmuchun, torvalds, vbabka

From: Oscar Salvador <osalvador@suse.de>
Subject: mm: make alloc_contig_range handle in-use hugetlb pages

alloc_contig_range() will fail if it finds a HugeTLB page within the
range, without a chance to handle them.  Since HugeTLB pages can be
migrated as any LRU or Movable page, it does not make sense to bail out
without trying.  Enable the interface to recognize in-use HugeTLB pages so
we can migrate them, and have much better chances to succeed the call.

Link: https://lkml.kernel.org/r/20210419075413.1064-7-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Acked-by: David Hildenbrand <david@redhat.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/hugetlb.h |    5 +++--
 mm/compaction.c         |   12 +++++++++++-
 mm/hugetlb.c            |   22 +++++++++++++++++-----
 mm/vmscan.c             |    5 +++--
 4 files changed, 34 insertions(+), 10 deletions(-)

--- a/include/linux/hugetlb.h~mm-make-alloc_contig_range-handle-in-use-hugetlb-pages
+++ a/include/linux/hugetlb.h
@@ -588,7 +588,7 @@ struct huge_bootmem_page {
 	struct hstate *hstate;
 };
 
-int isolate_or_dissolve_huge_page(struct page *page);
+int isolate_or_dissolve_huge_page(struct page *page, struct list_head *list);
 struct page *alloc_huge_page(struct vm_area_struct *vma,
 				unsigned long addr, int avoid_reserve);
 struct page *alloc_huge_page_nodemask(struct hstate *h, int preferred_nid,
@@ -871,7 +871,8 @@ static inline void huge_ptep_modify_prot
 #else	/* CONFIG_HUGETLB_PAGE */
 struct hstate {};
 
-static inline int isolate_or_dissolve_huge_page(struct page *page)
+static inline int isolate_or_dissolve_huge_page(struct page *page,
+						struct list_head *list)
 {
 	return -ENOMEM;
 }
--- a/mm/compaction.c~mm-make-alloc_contig_range-handle-in-use-hugetlb-pages
+++ a/mm/compaction.c
@@ -907,7 +907,7 @@ isolate_migratepages_block(struct compac
 		}
 
 		if (PageHuge(page) && cc->alloc_contig) {
-			ret = isolate_or_dissolve_huge_page(page);
+			ret = isolate_or_dissolve_huge_page(page, &cc->migratepages);
 
 			/*
 			 * Fail isolation in case isolate_or_dissolve_huge_page()
@@ -921,6 +921,15 @@ isolate_migratepages_block(struct compac
 				goto isolate_fail;
 			}
 
+			if (PageHuge(page)) {
+				/*
+				 * Hugepage was successfully isolated and placed
+				 * on the cc->migratepages list.
+				 */
+				low_pfn += compound_nr(page) - 1;
+				goto isolate_success_no_list;
+			}
+
 			/*
 			 * Ok, the hugepage was dissolved. Now these pages are
 			 * Buddy and cannot be re-allocated because they are
@@ -1062,6 +1071,7 @@ isolate_migratepages_block(struct compac
 
 isolate_success:
 		list_add(&page->lru, &cc->migratepages);
+isolate_success_no_list:
 		cc->nr_migratepages += compound_nr(page);
 		nr_isolated += compound_nr(page);
 
--- a/mm/hugetlb.c~mm-make-alloc_contig_range-handle-in-use-hugetlb-pages
+++ a/mm/hugetlb.c
@@ -2271,9 +2271,11 @@ static void restore_reserve_on_error(str
  * alloc_and_dissolve_huge_page - Allocate a new page and dissolve the old one
  * @h: struct hstate old page belongs to
  * @old_page: Old page to dissolve
+ * @list: List to isolate the page in case we need to
  * Returns 0 on success, otherwise negated error.
  */
-static int alloc_and_dissolve_huge_page(struct hstate *h, struct page *old_page)
+static int alloc_and_dissolve_huge_page(struct hstate *h, struct page *old_page,
+					struct list_head *list)
 {
 	gfp_t gfp_mask = htlb_alloc_mask(h) | __GFP_THISNODE;
 	int nid = page_to_nid(old_page);
@@ -2300,9 +2302,13 @@ retry:
 		goto free_new;
 	} else if (page_count(old_page)) {
 		/*
-		 * Someone has grabbed the page, fail for now.
+		 * Someone has grabbed the page, try to isolate it here.
+		 * Fail with -EBUSY if not possible.
 		 */
-		ret = -EBUSY;
+		spin_unlock_irq(&hugetlb_lock);
+		if (!isolate_huge_page(old_page, list))
+			ret = -EBUSY;
+		spin_lock_irq(&hugetlb_lock);
 		goto free_new;
 	} else if (!HPageFreed(old_page)) {
 		/*
@@ -2352,10 +2358,11 @@ free_new:
 	return ret;
 }
 
-int isolate_or_dissolve_huge_page(struct page *page)
+int isolate_or_dissolve_huge_page(struct page *page, struct list_head *list)
 {
 	struct hstate *h;
 	struct page *head;
+	int ret = -EBUSY;
 
 	/*
 	 * The page might have been dissolved from under our feet, so make sure
@@ -2380,7 +2387,12 @@ int isolate_or_dissolve_huge_page(struct
 	if (hstate_is_gigantic(h))
 		return -ENOMEM;
 
-	return alloc_and_dissolve_huge_page(h, head);
+	if (page_count(head) && isolate_huge_page(head, list))
+		ret = 0;
+	else if (!page_count(head))
+		ret = alloc_and_dissolve_huge_page(h, head, list);
+
+	return ret;
 }
 
 struct page *alloc_huge_page(struct vm_area_struct *vma,
--- a/mm/vmscan.c~mm-make-alloc_contig_range-handle-in-use-hugetlb-pages
+++ a/mm/vmscan.c
@@ -1507,8 +1507,9 @@ unsigned int reclaim_clean_pages_from_li
 	LIST_HEAD(clean_pages);
 
 	list_for_each_entry_safe(page, next, page_list, lru) {
-		if (page_is_file_lru(page) && !PageDirty(page) &&
-		    !__PageMovable(page) && !PageUnevictable(page)) {
+		if (!PageHuge(page) && page_is_file_lru(page) &&
+		    !PageDirty(page) && !__PageMovable(page) &&
+		    !PageUnevictable(page)) {
 			ClearPageActive(page);
 			list_move(&page->lru, &clean_pages);
 		}
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 053/143] mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig
  2021-05-05  1:32 incoming Andrew Morton
                   ` (51 preceding siblings ...)
  2021-05-05  1:35 ` [patch 052/143] mm: make alloc_contig_range handle in-use " Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:35 ` [patch 054/143] userfaultfd: add minor fault registration mode Andrew Morton
                   ` (87 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits,
	osalvador, songmuchun, torvalds, vbabka

From: Oscar Salvador <osalvador@suse.de>
Subject: mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig

pfn_range_valid_contig() bails out when it finds an in-use page or a
hugetlb page, among other things.  We can drop the in-use page check since
__alloc_contig_pages can migrate away those pages, and the hugetlb page
check can go too since isolate_migratepages_range is now capable of
dealing with hugetlb pages.  Either way, those checks are racy so let the
end function handle it when the time comes.

Link: https://lkml.kernel.org/r/20210419075413.1064-8-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Suggested-by: David Hildenbrand <david@redhat.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/page_alloc.c |    6 ------
 1 file changed, 6 deletions(-)

--- a/mm/page_alloc.c~mmpage_alloc-drop-unnecessary-checks-from-pfn_range_valid_contig
+++ a/mm/page_alloc.c
@@ -8898,12 +8898,6 @@ static bool pfn_range_valid_contig(struc
 
 		if (PageReserved(page))
 			return false;
-
-		if (page_count(page) > 0)
-			return false;
-
-		if (PageHuge(page))
-			return false;
 	}
 	return true;
 }
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 054/143] userfaultfd: add minor fault registration mode
  2021-05-05  1:32 incoming Andrew Morton
                   ` (52 preceding siblings ...)
  2021-05-05  1:35 ` [patch 053/143] mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:35 ` [patch 055/143] userfaultfd: disable huge PMD sharing for MINOR registered VMAs Andrew Morton
                   ` (86 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
	axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
	dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
	mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
	peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
	steven.price, torvalds, vbabka, viro, walken, willy, ying.huang

From: Axel Rasmussen <axelrasmussen@google.com>
Subject: userfaultfd: add minor fault registration mode

Patch series "userfaultfd: add minor fault handling", v9.

Overview
========

This series adds a new userfaultfd feature, UFFD_FEATURE_MINOR_HUGETLBFS. 
When enabled (via the UFFDIO_API ioctl), this feature means that any
hugetlbfs VMAs registered with UFFDIO_REGISTER_MODE_MISSING will *also*
get events for "minor" faults.  By "minor" fault, I mean the following
situation:

Let there exist two mappings (i.e., VMAs) to the same page(s) (shared
memory).  One of the mappings is registered with userfaultfd (in minor
mode), and the other is not.  Via the non-UFFD mapping, the underlying
pages have already been allocated & filled with some contents.  The UFFD
mapping has not yet been faulted in; when it is touched for the first
time, this results in what I'm calling a "minor" fault.  As a concrete
example, when working with hugetlbfs, we have huge_pte_none(), but
find_lock_page() finds an existing page.

We also add a new ioctl to resolve such faults: UFFDIO_CONTINUE.  The idea
is, userspace resolves the fault by either a) doing nothing if the
contents are already correct, or b) updating the underlying contents using
the second, non-UFFD mapping (via memcpy/memset or similar, or something
fancier like RDMA, or etc...).  In either case, userspace issues
UFFDIO_CONTINUE to tell the kernel "I have ensured the page contents are
correct, carry on setting up the mapping".

Use Case
========

Consider the use case of VM live migration (e.g. under QEMU/KVM):

1. While a VM is still running, we copy the contents of its memory to a
   target machine. The pages are populated on the target by writing to the
   non-UFFD mapping, using the setup described above. The VM is still running
   (and therefore its memory is likely changing), so this may be repeated
   several times, until we decide the target is "up to date enough".

2. We pause the VM on the source, and start executing on the target machine.
   During this gap, the VM's user(s) will *see* a pause, so it is desirable to
   minimize this window.

3. Between the last time any page was copied from the source to the target, and
   when the VM was paused, the contents of that page may have changed - and
   therefore the copy we have on the target machine is out of date. Although we
   can keep track of which pages are out of date, for VMs with large amounts of
   memory, it is "slow" to transfer this information to the target machine. We
   want to resume execution before such a transfer would complete.

4. So, the guest begins executing on the target machine. The first time it
   touches its memory (via the UFFD-registered mapping), userspace wants to
   intercept this fault. Userspace checks whether or not the page is up to date,
   and if not, copies the updated page from the source machine, via the non-UFFD
   mapping. Finally, whether a copy was performed or not, userspace issues a
   UFFDIO_CONTINUE ioctl to tell the kernel "I have ensured the page contents
   are correct, carry on setting up the mapping".

We don't have to do all of the final updates on-demand. The userfaultfd manager
can, in the background, also copy over updated pages once it receives the map of
which pages are up-to-date or not.

Interaction with Existing APIs
==============================

Because this is a feature, a registered VMA could potentially receive both
missing and minor faults.  I spent some time thinking through how the
existing API interacts with the new feature:

UFFDIO_CONTINUE cannot be used to resolve non-minor faults, as it does not
allocate a new page.  If UFFDIO_CONTINUE is used on a non-minor fault:

- For non-shared memory or shmem, -EINVAL is returned.
- For hugetlb, -EFAULT is returned.

UFFDIO_COPY and UFFDIO_ZEROPAGE cannot be used to resolve minor faults. 
Without modifications, the existing codepath assumes a new page needs to
be allocated.  This is okay, since userspace must have a second
non-UFFD-registered mapping anyway, thus there isn't much reason to want
to use these in any case (just memcpy or memset or similar).

- If UFFDIO_COPY is used on a minor fault, -EEXIST is returned.
- If UFFDIO_ZEROPAGE is used on a minor fault, -EEXIST is returned (or -EINVAL
  in the case of hugetlb, as UFFDIO_ZEROPAGE is unsupported in any case).
- UFFDIO_WRITEPROTECT simply doesn't work with shared memory, and returns
  -ENOENT in that case (regardless of the kind of fault).

Future Work
===========

This series only supports hugetlbfs.  I have a second series in flight to
support shmem as well, extending the functionality.  This series is more
mature than the shmem support at this point, and the functionality works
fully on hugetlbfs, so this series can be merged first and then shmem
support will follow.


This patch (of 6):

This feature allows userspace to intercept "minor" faults.  By "minor"
faults, I mean the following situation:

Let there exist two mappings (i.e., VMAs) to the same page(s).  One of the
mappings is registered with userfaultfd (in minor mode), and the other is
not.  Via the non-UFFD mapping, the underlying pages have already been
allocated & filled with some contents.  The UFFD mapping has not yet been
faulted in; when it is touched for the first time, this results in what
I'm calling a "minor" fault.  As a concrete example, when working with
hugetlbfs, we have huge_pte_none(), but find_lock_page() finds an existing
page.

This commit adds the new registration mode, and sets the relevant flag on
the VMAs being registered.  In the hugetlb fault path, if we find that we
have huge_pte_none(), but find_lock_page() does indeed find an existing
page, then we have a "minor" fault, and if the VMA has the userfaultfd
registration flag, we call into userfaultfd to handle it.

This is implemented as a new registration mode, instead of an API feature.
This is because the alternative implementation has significant drawbacks
[1].

However, doing it this was requires we allocate a VM_* flag for the new
registration mode.  On 32-bit systems, there are no unused bits, so this
feature is only supported on architectures with
CONFIG_ARCH_USES_HIGH_VMA_FLAGS.  When attempting to register a VMA in
MINOR mode on 32-bit architectures, we return -EINVAL.

[1] https://lore.kernel.org/patchwork/patch/1380226/

[peterx@redhat.com: fix minor fault page leak]
  Link: https://lkml.kernel.org/r/20210322175132.36659-1-peterx@redhat.com
Link: https://lkml.kernel.org/r/20210301222728.176417-1-axelrasmussen@google.com
Link: https://lkml.kernel.org/r/20210301222728.176417-2-axelrasmussen@google.com
Signed-off-by: Axel Rasmussen <axelrasmussen@google.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Steven Price <steven.price@arm.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Axel Rasmussen <axelrasmussen@google.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/arm64/Kconfig               |    1 
 arch/x86/Kconfig                 |    1 
 fs/proc/task_mmu.c               |    3 +
 fs/userfaultfd.c                 |   78 +++++++++++++++++-----------
 include/linux/mm.h               |    7 ++
 include/linux/userfaultfd_k.h    |   15 +++++
 include/trace/events/mmflags.h   |    7 ++
 include/uapi/linux/userfaultfd.h |   15 ++++-
 init/Kconfig                     |    5 +
 mm/hugetlb.c                     |   80 ++++++++++++++++++-----------
 10 files changed, 150 insertions(+), 62 deletions(-)

--- a/arch/arm64/Kconfig~userfaultfd-add-minor-fault-registration-mode
+++ a/arch/arm64/Kconfig
@@ -213,6 +213,7 @@ config ARM64
 	select SWIOTLB
 	select SYSCTL_EXCEPTION_TRACE
 	select THREAD_INFO_IN_TASK
+	select HAVE_ARCH_USERFAULTFD_MINOR if USERFAULTFD
 	help
 	  ARM 64-bit (AArch64) Linux support.
 
--- a/arch/x86/Kconfig~userfaultfd-add-minor-fault-registration-mode
+++ a/arch/x86/Kconfig
@@ -165,6 +165,7 @@ config X86
 	select HAVE_ARCH_TRANSPARENT_HUGEPAGE
 	select HAVE_ARCH_TRANSPARENT_HUGEPAGE_PUD if X86_64
 	select HAVE_ARCH_USERFAULTFD_WP         if X86_64 && USERFAULTFD
+	select HAVE_ARCH_USERFAULTFD_MINOR	if X86_64 && USERFAULTFD
 	select HAVE_ARCH_VMAP_STACK		if X86_64
 	select HAVE_ARCH_RANDOMIZE_KSTACK_OFFSET
 	select HAVE_ARCH_WITHIN_STACK_FRAMES
--- a/fs/proc/task_mmu.c~userfaultfd-add-minor-fault-registration-mode
+++ a/fs/proc/task_mmu.c
@@ -661,6 +661,9 @@ static void show_smap_vma_flags(struct s
 		[ilog2(VM_PKEY_BIT4)]	= "",
 #endif
 #endif /* CONFIG_ARCH_HAS_PKEYS */
+#ifdef CONFIG_HAVE_ARCH_USERFAULTFD_MINOR
+		[ilog2(VM_UFFD_MINOR)]	= "ui",
+#endif /* CONFIG_HAVE_ARCH_USERFAULTFD_MINOR */
 	};
 	size_t i;
 
--- a/fs/userfaultfd.c~userfaultfd-add-minor-fault-registration-mode
+++ a/fs/userfaultfd.c
@@ -197,24 +197,21 @@ static inline struct uffd_msg userfault_
 	msg_init(&msg);
 	msg.event = UFFD_EVENT_PAGEFAULT;
 	msg.arg.pagefault.address = address;
+	/*
+	 * These flags indicate why the userfault occurred:
+	 * - UFFD_PAGEFAULT_FLAG_WP indicates a write protect fault.
+	 * - UFFD_PAGEFAULT_FLAG_MINOR indicates a minor fault.
+	 * - Neither of these flags being set indicates a MISSING fault.
+	 *
+	 * Separately, UFFD_PAGEFAULT_FLAG_WRITE indicates it was a write
+	 * fault. Otherwise, it was a read fault.
+	 */
 	if (flags & FAULT_FLAG_WRITE)
-		/*
-		 * If UFFD_FEATURE_PAGEFAULT_FLAG_WP was set in the
-		 * uffdio_api.features and UFFD_PAGEFAULT_FLAG_WRITE
-		 * was not set in a UFFD_EVENT_PAGEFAULT, it means it
-		 * was a read fault, otherwise if set it means it's
-		 * a write fault.
-		 */
 		msg.arg.pagefault.flags |= UFFD_PAGEFAULT_FLAG_WRITE;
 	if (reason & VM_UFFD_WP)
-		/*
-		 * If UFFD_FEATURE_PAGEFAULT_FLAG_WP was set in the
-		 * uffdio_api.features and UFFD_PAGEFAULT_FLAG_WP was
-		 * not set in a UFFD_EVENT_PAGEFAULT, it means it was
-		 * a missing fault, otherwise if set it means it's a
-		 * write protect fault.
-		 */
 		msg.arg.pagefault.flags |= UFFD_PAGEFAULT_FLAG_WP;
+	if (reason & VM_UFFD_MINOR)
+		msg.arg.pagefault.flags |= UFFD_PAGEFAULT_FLAG_MINOR;
 	if (features & UFFD_FEATURE_THREAD_ID)
 		msg.arg.pagefault.feat.ptid = task_pid_vnr(current);
 	return msg;
@@ -401,8 +398,10 @@ vm_fault_t handle_userfault(struct vm_fa
 
 	BUG_ON(ctx->mm != mm);
 
-	VM_BUG_ON(reason & ~(VM_UFFD_MISSING|VM_UFFD_WP));
-	VM_BUG_ON(!(reason & VM_UFFD_MISSING) ^ !!(reason & VM_UFFD_WP));
+	/* Any unrecognized flag is a bug. */
+	VM_BUG_ON(reason & ~__VM_UFFD_FLAGS);
+	/* 0 or > 1 flags set is a bug; we expect exactly 1. */
+	VM_BUG_ON(!reason || (reason & (reason - 1)));
 
 	if (ctx->features & UFFD_FEATURE_SIGBUS)
 		goto out;
@@ -612,7 +611,7 @@ static void userfaultfd_event_wait_compl
 		for (vma = mm->mmap; vma; vma = vma->vm_next)
 			if (vma->vm_userfaultfd_ctx.ctx == release_new_ctx) {
 				vma->vm_userfaultfd_ctx = NULL_VM_UFFD_CTX;
-				vma->vm_flags &= ~(VM_UFFD_WP | VM_UFFD_MISSING);
+				vma->vm_flags &= ~__VM_UFFD_FLAGS;
 			}
 		mmap_write_unlock(mm);
 
@@ -644,7 +643,7 @@ int dup_userfaultfd(struct vm_area_struc
 	octx = vma->vm_userfaultfd_ctx.ctx;
 	if (!octx || !(octx->features & UFFD_FEATURE_EVENT_FORK)) {
 		vma->vm_userfaultfd_ctx = NULL_VM_UFFD_CTX;
-		vma->vm_flags &= ~(VM_UFFD_WP | VM_UFFD_MISSING);
+		vma->vm_flags &= ~__VM_UFFD_FLAGS;
 		return 0;
 	}
 
@@ -726,7 +725,7 @@ void mremap_userfaultfd_prep(struct vm_a
 	} else {
 		/* Drop uffd context if remap feature not enabled */
 		vma->vm_userfaultfd_ctx = NULL_VM_UFFD_CTX;
-		vma->vm_flags &= ~(VM_UFFD_WP | VM_UFFD_MISSING);
+		vma->vm_flags &= ~__VM_UFFD_FLAGS;
 	}
 }
 
@@ -867,12 +866,12 @@ static int userfaultfd_release(struct in
 	for (vma = mm->mmap; vma; vma = vma->vm_next) {
 		cond_resched();
 		BUG_ON(!!vma->vm_userfaultfd_ctx.ctx ^
-		       !!(vma->vm_flags & (VM_UFFD_MISSING | VM_UFFD_WP)));
+		       !!(vma->vm_flags & __VM_UFFD_FLAGS));
 		if (vma->vm_userfaultfd_ctx.ctx != ctx) {
 			prev = vma;
 			continue;
 		}
-		new_flags = vma->vm_flags & ~(VM_UFFD_MISSING | VM_UFFD_WP);
+		new_flags = vma->vm_flags & ~__VM_UFFD_FLAGS;
 		prev = vma_merge(mm, prev, vma->vm_start, vma->vm_end,
 				 new_flags, vma->anon_vma,
 				 vma->vm_file, vma->vm_pgoff,
@@ -1262,9 +1261,19 @@ static inline bool vma_can_userfault(str
 				     unsigned long vm_flags)
 {
 	/* FIXME: add WP support to hugetlbfs and shmem */
-	return vma_is_anonymous(vma) ||
-		((is_vm_hugetlb_page(vma) || vma_is_shmem(vma)) &&
-		 !(vm_flags & VM_UFFD_WP));
+	if (vm_flags & VM_UFFD_WP) {
+		if (is_vm_hugetlb_page(vma) || vma_is_shmem(vma))
+			return false;
+	}
+
+	if (vm_flags & VM_UFFD_MINOR) {
+		/* FIXME: Add minor fault interception for shmem. */
+		if (!is_vm_hugetlb_page(vma))
+			return false;
+	}
+
+	return vma_is_anonymous(vma) || is_vm_hugetlb_page(vma) ||
+	       vma_is_shmem(vma);
 }
 
 static int userfaultfd_register(struct userfaultfd_ctx *ctx,
@@ -1290,14 +1299,19 @@ static int userfaultfd_register(struct u
 	ret = -EINVAL;
 	if (!uffdio_register.mode)
 		goto out;
-	if (uffdio_register.mode & ~(UFFDIO_REGISTER_MODE_MISSING|
-				     UFFDIO_REGISTER_MODE_WP))
+	if (uffdio_register.mode & ~UFFD_API_REGISTER_MODES)
 		goto out;
 	vm_flags = 0;
 	if (uffdio_register.mode & UFFDIO_REGISTER_MODE_MISSING)
 		vm_flags |= VM_UFFD_MISSING;
 	if (uffdio_register.mode & UFFDIO_REGISTER_MODE_WP)
 		vm_flags |= VM_UFFD_WP;
+	if (uffdio_register.mode & UFFDIO_REGISTER_MODE_MINOR) {
+#ifndef CONFIG_HAVE_ARCH_USERFAULTFD_MINOR
+		goto out;
+#endif
+		vm_flags |= VM_UFFD_MINOR;
+	}
 
 	ret = validate_range(mm, &uffdio_register.range.start,
 			     uffdio_register.range.len);
@@ -1341,7 +1355,7 @@ static int userfaultfd_register(struct u
 		cond_resched();
 
 		BUG_ON(!!cur->vm_userfaultfd_ctx.ctx ^
-		       !!(cur->vm_flags & (VM_UFFD_MISSING | VM_UFFD_WP)));
+		       !!(cur->vm_flags & __VM_UFFD_FLAGS));
 
 		/* check not compatible vmas */
 		ret = -EINVAL;
@@ -1421,8 +1435,7 @@ static int userfaultfd_register(struct u
 			start = vma->vm_start;
 		vma_end = min(end, vma->vm_end);
 
-		new_flags = (vma->vm_flags &
-			     ~(VM_UFFD_MISSING|VM_UFFD_WP)) | vm_flags;
+		new_flags = (vma->vm_flags & ~__VM_UFFD_FLAGS) | vm_flags;
 		prev = vma_merge(mm, prev, start, vma_end, new_flags,
 				 vma->anon_vma, vma->vm_file, vma->vm_pgoff,
 				 vma_policy(vma),
@@ -1544,7 +1557,7 @@ static int userfaultfd_unregister(struct
 		cond_resched();
 
 		BUG_ON(!!cur->vm_userfaultfd_ctx.ctx ^
-		       !!(cur->vm_flags & (VM_UFFD_MISSING | VM_UFFD_WP)));
+		       !!(cur->vm_flags & __VM_UFFD_FLAGS));
 
 		/*
 		 * Check not compatible vmas, not strictly required
@@ -1595,7 +1608,7 @@ static int userfaultfd_unregister(struct
 			wake_userfault(vma->vm_userfaultfd_ctx.ctx, &range);
 		}
 
-		new_flags = vma->vm_flags & ~(VM_UFFD_MISSING | VM_UFFD_WP);
+		new_flags = vma->vm_flags & ~__VM_UFFD_FLAGS;
 		prev = vma_merge(mm, prev, start, vma_end, new_flags,
 				 vma->anon_vma, vma->vm_file, vma->vm_pgoff,
 				 vma_policy(vma),
@@ -1863,6 +1876,9 @@ static int userfaultfd_api(struct userfa
 		goto err_out;
 	/* report all available features and ioctls to userland */
 	uffdio_api.features = UFFD_API_FEATURES;
+#ifndef CONFIG_HAVE_ARCH_USERFAULTFD_MINOR
+	uffdio_api.features &= ~UFFD_FEATURE_MINOR_HUGETLBFS;
+#endif
 	uffdio_api.ioctls = UFFD_API_IOCTLS;
 	ret = -EFAULT;
 	if (copy_to_user(buf, &uffdio_api, sizeof(uffdio_api)))
--- a/include/linux/mm.h~userfaultfd-add-minor-fault-registration-mode
+++ a/include/linux/mm.h
@@ -372,6 +372,13 @@ extern unsigned int kobjsize(const void
 # define VM_GROWSUP	VM_NONE
 #endif
 
+#ifdef CONFIG_HAVE_ARCH_USERFAULTFD_MINOR
+# define VM_UFFD_MINOR_BIT	37
+# define VM_UFFD_MINOR		BIT(VM_UFFD_MINOR_BIT)	/* UFFD minor faults */
+#else /* !CONFIG_HAVE_ARCH_USERFAULTFD_MINOR */
+# define VM_UFFD_MINOR		VM_NONE
+#endif /* CONFIG_HAVE_ARCH_USERFAULTFD_MINOR */
+
 /* Bits set in the VMA until the stack is in its final location */
 #define VM_STACK_INCOMPLETE_SETUP	(VM_RAND_READ | VM_SEQ_READ)
 
--- a/include/linux/userfaultfd_k.h~userfaultfd-add-minor-fault-registration-mode
+++ a/include/linux/userfaultfd_k.h
@@ -17,6 +17,9 @@
 #include <linux/mm.h>
 #include <asm-generic/pgtable_uffd.h>
 
+/* The set of all possible UFFD-related VM flags. */
+#define __VM_UFFD_FLAGS (VM_UFFD_MISSING | VM_UFFD_WP | VM_UFFD_MINOR)
+
 /*
  * CAREFUL: Check include/uapi/asm-generic/fcntl.h when defining
  * new flags, since they might collide with O_* ones. We want
@@ -71,6 +74,11 @@ static inline bool userfaultfd_wp(struct
 	return vma->vm_flags & VM_UFFD_WP;
 }
 
+static inline bool userfaultfd_minor(struct vm_area_struct *vma)
+{
+	return vma->vm_flags & VM_UFFD_MINOR;
+}
+
 static inline bool userfaultfd_pte_wp(struct vm_area_struct *vma,
 				      pte_t pte)
 {
@@ -85,7 +93,7 @@ static inline bool userfaultfd_huge_pmd_
 
 static inline bool userfaultfd_armed(struct vm_area_struct *vma)
 {
-	return vma->vm_flags & (VM_UFFD_MISSING | VM_UFFD_WP);
+	return vma->vm_flags & __VM_UFFD_FLAGS;
 }
 
 extern int dup_userfaultfd(struct vm_area_struct *, struct list_head *);
@@ -131,6 +139,11 @@ static inline bool userfaultfd_wp(struct
 {
 	return false;
 }
+
+static inline bool userfaultfd_minor(struct vm_area_struct *vma)
+{
+	return false;
+}
 
 static inline bool userfaultfd_pte_wp(struct vm_area_struct *vma,
 				      pte_t pte)
--- a/include/trace/events/mmflags.h~userfaultfd-add-minor-fault-registration-mode
+++ a/include/trace/events/mmflags.h
@@ -137,6 +137,12 @@ IF_HAVE_PG_ARCH_2(PG_arch_2,		"arch_2"	)
 #define IF_HAVE_VM_SOFTDIRTY(flag,name)
 #endif
 
+#ifdef CONFIG_HAVE_ARCH_USERFAULTFD_MINOR
+# define IF_HAVE_UFFD_MINOR(flag, name) {flag, name},
+#else
+# define IF_HAVE_UFFD_MINOR(flag, name)
+#endif
+
 #define __def_vmaflag_names						\
 	{VM_READ,			"read"		},		\
 	{VM_WRITE,			"write"		},		\
@@ -148,6 +154,7 @@ IF_HAVE_PG_ARCH_2(PG_arch_2,		"arch_2"	)
 	{VM_MAYSHARE,			"mayshare"	},		\
 	{VM_GROWSDOWN,			"growsdown"	},		\
 	{VM_UFFD_MISSING,		"uffd_missing"	},		\
+IF_HAVE_UFFD_MINOR(VM_UFFD_MINOR,	"uffd_minor"	)		\
 	{VM_PFNMAP,			"pfnmap"	},		\
 	{VM_DENYWRITE,			"denywrite"	},		\
 	{VM_UFFD_WP,			"uffd_wp"	},		\
--- a/include/uapi/linux/userfaultfd.h~userfaultfd-add-minor-fault-registration-mode
+++ a/include/uapi/linux/userfaultfd.h
@@ -19,15 +19,19 @@
  * means the userland is reading).
  */
 #define UFFD_API ((__u64)0xAA)
+#define UFFD_API_REGISTER_MODES (UFFDIO_REGISTER_MODE_MISSING |	\
+				 UFFDIO_REGISTER_MODE_WP |	\
+				 UFFDIO_REGISTER_MODE_MINOR)
 #define UFFD_API_FEATURES (UFFD_FEATURE_PAGEFAULT_FLAG_WP |	\
 			   UFFD_FEATURE_EVENT_FORK |		\
 			   UFFD_FEATURE_EVENT_REMAP |		\
-			   UFFD_FEATURE_EVENT_REMOVE |	\
+			   UFFD_FEATURE_EVENT_REMOVE |		\
 			   UFFD_FEATURE_EVENT_UNMAP |		\
 			   UFFD_FEATURE_MISSING_HUGETLBFS |	\
 			   UFFD_FEATURE_MISSING_SHMEM |		\
 			   UFFD_FEATURE_SIGBUS |		\
-			   UFFD_FEATURE_THREAD_ID)
+			   UFFD_FEATURE_THREAD_ID |		\
+			   UFFD_FEATURE_MINOR_HUGETLBFS)
 #define UFFD_API_IOCTLS				\
 	((__u64)1 << _UFFDIO_REGISTER |		\
 	 (__u64)1 << _UFFDIO_UNREGISTER |	\
@@ -127,6 +131,7 @@ struct uffd_msg {
 /* flags for UFFD_EVENT_PAGEFAULT */
 #define UFFD_PAGEFAULT_FLAG_WRITE	(1<<0)	/* If this was a write fault */
 #define UFFD_PAGEFAULT_FLAG_WP		(1<<1)	/* If reason is VM_UFFD_WP */
+#define UFFD_PAGEFAULT_FLAG_MINOR	(1<<2)	/* If reason is VM_UFFD_MINOR */
 
 struct uffdio_api {
 	/* userland asks for an API number and the features to enable */
@@ -171,6 +176,10 @@ struct uffdio_api {
 	 *
 	 * UFFD_FEATURE_THREAD_ID pid of the page faulted task_struct will
 	 * be returned, if feature is not requested 0 will be returned.
+	 *
+	 * UFFD_FEATURE_MINOR_HUGETLBFS indicates that minor faults
+	 * can be intercepted (via REGISTER_MODE_MINOR) for
+	 * hugetlbfs-backed pages.
 	 */
 #define UFFD_FEATURE_PAGEFAULT_FLAG_WP		(1<<0)
 #define UFFD_FEATURE_EVENT_FORK			(1<<1)
@@ -181,6 +190,7 @@ struct uffdio_api {
 #define UFFD_FEATURE_EVENT_UNMAP		(1<<6)
 #define UFFD_FEATURE_SIGBUS			(1<<7)
 #define UFFD_FEATURE_THREAD_ID			(1<<8)
+#define UFFD_FEATURE_MINOR_HUGETLBFS		(1<<9)
 	__u64 features;
 
 	__u64 ioctls;
@@ -195,6 +205,7 @@ struct uffdio_register {
 	struct uffdio_range range;
 #define UFFDIO_REGISTER_MODE_MISSING	((__u64)1<<0)
 #define UFFDIO_REGISTER_MODE_WP		((__u64)1<<1)
+#define UFFDIO_REGISTER_MODE_MINOR	((__u64)1<<2)
 	__u64 mode;
 
 	/*
--- a/init/Kconfig~userfaultfd-add-minor-fault-registration-mode
+++ a/init/Kconfig
@@ -1644,6 +1644,11 @@ config HAVE_ARCH_USERFAULTFD_WP
 	help
 	  Arch has userfaultfd write protection support
 
+config HAVE_ARCH_USERFAULTFD_MINOR
+	bool
+	help
+	  Arch has userfaultfd minor fault support
+
 config MEMBARRIER
 	bool "Enable membarrier() system call" if EXPERT
 	default y
--- a/mm/hugetlb.c~userfaultfd-add-minor-fault-registration-mode
+++ a/mm/hugetlb.c
@@ -4469,6 +4469,44 @@ int huge_add_to_page_cache(struct page *
 	return 0;
 }
 
+static inline vm_fault_t hugetlb_handle_userfault(struct vm_area_struct *vma,
+						  struct address_space *mapping,
+						  pgoff_t idx,
+						  unsigned int flags,
+						  unsigned long haddr,
+						  unsigned long reason)
+{
+	vm_fault_t ret;
+	u32 hash;
+	struct vm_fault vmf = {
+		.vma = vma,
+		.address = haddr,
+		.flags = flags,
+
+		/*
+		 * Hard to debug if it ends up being
+		 * used by a callee that assumes
+		 * something about the other
+		 * uninitialized fields... same as in
+		 * memory.c
+		 */
+	};
+
+	/*
+	 * hugetlb_fault_mutex and i_mmap_rwsem must be
+	 * dropped before handling userfault.  Reacquire
+	 * after handling fault to make calling code simpler.
+	 */
+	hash = hugetlb_fault_mutex_hash(mapping, idx);
+	mutex_unlock(&hugetlb_fault_mutex_table[hash]);
+	i_mmap_unlock_read(mapping);
+	ret = handle_userfault(&vmf, reason);
+	i_mmap_lock_read(mapping);
+	mutex_lock(&hugetlb_fault_mutex_table[hash]);
+
+	return ret;
+}
+
 static vm_fault_t hugetlb_no_page(struct mm_struct *mm,
 			struct vm_area_struct *vma,
 			struct address_space *mapping, pgoff_t idx,
@@ -4507,35 +4545,11 @@ static vm_fault_t hugetlb_no_page(struct
 retry:
 	page = find_lock_page(mapping, idx);
 	if (!page) {
-		/*
-		 * Check for page in userfault range
-		 */
+		/* Check for page in userfault range */
 		if (userfaultfd_missing(vma)) {
-			u32 hash;
-			struct vm_fault vmf = {
-				.vma = vma,
-				.address = haddr,
-				.flags = flags,
-				/*
-				 * Hard to debug if it ends up being
-				 * used by a callee that assumes
-				 * something about the other
-				 * uninitialized fields... same as in
-				 * memory.c
-				 */
-			};
-
-			/*
-			 * hugetlb_fault_mutex and i_mmap_rwsem must be
-			 * dropped before handling userfault.  Reacquire
-			 * after handling fault to make calling code simpler.
-			 */
-			hash = hugetlb_fault_mutex_hash(mapping, idx);
-			mutex_unlock(&hugetlb_fault_mutex_table[hash]);
-			i_mmap_unlock_read(mapping);
-			ret = handle_userfault(&vmf, VM_UFFD_MISSING);
-			i_mmap_lock_read(mapping);
-			mutex_lock(&hugetlb_fault_mutex_table[hash]);
+			ret = hugetlb_handle_userfault(vma, mapping, idx,
+						       flags, haddr,
+						       VM_UFFD_MISSING);
 			goto out;
 		}
 
@@ -4591,6 +4605,16 @@ retry:
 				VM_FAULT_SET_HINDEX(hstate_index(h));
 			goto backout_unlocked;
 		}
+
+		/* Check for page in userfault range. */
+		if (userfaultfd_minor(vma)) {
+			unlock_page(page);
+			put_page(page);
+			ret = hugetlb_handle_userfault(vma, mapping, idx,
+						       flags, haddr,
+						       VM_UFFD_MINOR);
+			goto out;
+		}
 	}
 
 	/*
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 055/143] userfaultfd: disable huge PMD sharing for MINOR registered VMAs
  2021-05-05  1:32 incoming Andrew Morton
                   ` (53 preceding siblings ...)
  2021-05-05  1:35 ` [patch 054/143] userfaultfd: add minor fault registration mode Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:35 ` [patch 056/143] userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled Andrew Morton
                   ` (85 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
	axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
	dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
	mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
	peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
	steven.price, torvalds, vbabka, viro, walken, willy, ying.huang

From: Axel Rasmussen <axelrasmussen@google.com>
Subject: userfaultfd: disable huge PMD sharing for MINOR registered VMAs

As the comment says: for the MINOR fault use case, although the page might
be present and populated in the other (non-UFFD-registered) half of the
mapping, it may be out of date, and we explicitly want userspace to get a
minor fault so it can check and potentially update the page's contents.

Huge PMD sharing would prevent these faults from occurring for suitably
aligned areas, so disable it upon UFFD registration.

Link: https://lkml.kernel.org/r/20210301222728.176417-3-axelrasmussen@google.com
Signed-off-by: Axel Rasmussen <axelrasmussen@google.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/userfaultfd_k.h |   13 ++++++++++---
 1 file changed, 10 insertions(+), 3 deletions(-)

--- a/include/linux/userfaultfd_k.h~userfaultfd-disable-huge-pmd-sharing-for-minor-registered-vmas
+++ a/include/linux/userfaultfd_k.h
@@ -56,12 +56,19 @@ static inline bool is_mergeable_vm_userf
 }
 
 /*
- * Never enable huge pmd sharing on uffd-wp registered vmas, because uffd-wp
- * protect information is per pgtable entry.
+ * Never enable huge pmd sharing on some uffd registered vmas:
+ *
+ * - VM_UFFD_WP VMAs, because write protect information is per pgtable entry.
+ *
+ * - VM_UFFD_MINOR VMAs, because otherwise we would never get minor faults for
+ *   VMAs which share huge pmds. (If you have two mappings to the same
+ *   underlying pages, and fault in the non-UFFD-registered one with a write,
+ *   with huge pmd sharing this would *also* setup the second UFFD-registered
+ *   mapping, and we'd not get minor faults.)
  */
 static inline bool uffd_disable_huge_pmd_share(struct vm_area_struct *vma)
 {
-	return vma->vm_flags & VM_UFFD_WP;
+	return vma->vm_flags & (VM_UFFD_WP | VM_UFFD_MINOR);
 }
 
 static inline bool userfaultfd_missing(struct vm_area_struct *vma)
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 056/143] userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled
  2021-05-05  1:32 incoming Andrew Morton
                   ` (54 preceding siblings ...)
  2021-05-05  1:35 ` [patch 055/143] userfaultfd: disable huge PMD sharing for MINOR registered VMAs Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:35 ` [patch 057/143] userfaultfd: add UFFDIO_CONTINUE ioctl Andrew Morton
                   ` (84 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
	axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
	dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
	mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
	peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
	steven.price, torvalds, vbabka, viro, walken, willy, ying.huang

From: Axel Rasmussen <axelrasmussen@google.com>
Subject: userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled

For background, mm/userfaultfd.c provides a general mcopy_atomic
implementation.  But some types of memory (i.e., hugetlb and shmem) need a
slightly different implementation, so they provide their own helpers for
this.  In other words, userfaultfd is the only caller of these functions.

This patch achieves two things:

1. Don't spend time compiling code which will end up never being
   referenced anyway (a small build time optimization).

2. In patches later in this series, we extend the signature of these
   helpers with UFFD-specific state (a mode enumeration).  Once this
   happens, we *have to* either not compile the helpers, or
   unconditionally define the UFFD-only state (which seems messier to me).
   This includes the declarations in the headers, as otherwise they'd
   yield warnings about implicitly defining the type of those arguments.

Link: https://lkml.kernel.org/r/20210301222728.176417-4-axelrasmussen@google.com
Signed-off-by: Axel Rasmussen <axelrasmussen@google.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/hugetlb.h |    4 ++++
 mm/hugetlb.c            |    2 ++
 2 files changed, 6 insertions(+)

--- a/include/linux/hugetlb.h~userfaultfd-hugetlbfs-only-compile-uffd-helpers-if-config-enabled
+++ a/include/linux/hugetlb.h
@@ -134,11 +134,13 @@ void hugetlb_show_meminfo(void);
 unsigned long hugetlb_total_pages(void);
 vm_fault_t hugetlb_fault(struct mm_struct *mm, struct vm_area_struct *vma,
 			unsigned long address, unsigned int flags);
+#ifdef CONFIG_USERFAULTFD
 int hugetlb_mcopy_atomic_pte(struct mm_struct *dst_mm, pte_t *dst_pte,
 				struct vm_area_struct *dst_vma,
 				unsigned long dst_addr,
 				unsigned long src_addr,
 				struct page **pagep);
+#endif /* CONFIG_USERFAULTFD */
 bool hugetlb_reserve_pages(struct inode *inode, long from, long to,
 						struct vm_area_struct *vma,
 						vm_flags_t vm_flags);
@@ -310,6 +312,7 @@ static inline void hugetlb_free_pgd_rang
 	BUG();
 }
 
+#ifdef CONFIG_USERFAULTFD
 static inline int hugetlb_mcopy_atomic_pte(struct mm_struct *dst_mm,
 						pte_t *dst_pte,
 						struct vm_area_struct *dst_vma,
@@ -320,6 +323,7 @@ static inline int hugetlb_mcopy_atomic_p
 	BUG();
 	return 0;
 }
+#endif /* CONFIG_USERFAULTFD */
 
 static inline pte_t *huge_pte_offset(struct mm_struct *mm, unsigned long addr,
 					unsigned long sz)
--- a/mm/hugetlb.c~userfaultfd-hugetlbfs-only-compile-uffd-helpers-if-config-enabled
+++ a/mm/hugetlb.c
@@ -4855,6 +4855,7 @@ out_mutex:
 	return ret;
 }
 
+#ifdef CONFIG_USERFAULTFD
 /*
  * Used by userfaultfd UFFDIO_COPY.  Based on mcopy_atomic_pte with
  * modifications for huge pages.
@@ -4985,6 +4986,7 @@ out_release_nounlock:
 	put_page(page);
 	goto out;
 }
+#endif /* CONFIG_USERFAULTFD */
 
 static void record_subpages_vmas(struct page *page, struct vm_area_struct *vma,
 				 int refs, struct page **pages,
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 057/143] userfaultfd: add UFFDIO_CONTINUE ioctl
  2021-05-05  1:32 incoming Andrew Morton
                   ` (55 preceding siblings ...)
  2021-05-05  1:35 ` [patch 056/143] userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:35 ` [patch 058/143] userfaultfd: update documentation to describe minor fault handling Andrew Morton
                   ` (83 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
	axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
	dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
	mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
	peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
	steven.price, torvalds, vbabka, viro, walken, willy, ying.huang

From: Axel Rasmussen <axelrasmussen@google.com>
Subject: userfaultfd: add UFFDIO_CONTINUE ioctl

This ioctl is how userspace ought to resolve "minor" userfaults. The
idea is, userspace is notified that a minor fault has occurred. It might
change the contents of the page using its second non-UFFD mapping, or
not. Then, it calls UFFDIO_CONTINUE to tell the kernel "I have ensured
the page contents are correct, carry on setting up the mapping".

Note that it doesn't make much sense to use UFFDIO_{COPY,ZEROPAGE} for
MINOR registered VMAs. ZEROPAGE maps the VMA to the zero page; but in
the minor fault case, we already have some pre-existing underlying page.
Likewise, UFFDIO_COPY isn't useful if we have a second non-UFFD mapping.
We'd just use memcpy() or similar instead.

It turns out hugetlb_mcopy_atomic_pte() already does very close to what
we want, if an existing page is provided via `struct page **pagep`. We
already special-case the behavior a bit for the UFFDIO_ZEROPAGE case, so
just extend that design: add an enum for the three modes of operation,
and make the small adjustments needed for the MCOPY_ATOMIC_CONTINUE
case. (Basically, look up the existing page, and avoid adding the
existing page to the page cache or calling set_page_huge_active() on
it.)

Link: https://lkml.kernel.org/r/20210301222728.176417-5-axelrasmussen@google.com
Signed-off-by: Axel Rasmussen <axelrasmussen@google.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 fs/userfaultfd.c                 |   67 +++++++++++++++++++++++++++++
 include/linux/hugetlb.h          |    3 +
 include/linux/userfaultfd_k.h    |   18 +++++++
 include/uapi/linux/userfaultfd.h |   21 ++++++++-
 mm/hugetlb.c                     |   40 +++++++++++------
 mm/userfaultfd.c                 |   37 +++++++++-------
 6 files changed, 156 insertions(+), 30 deletions(-)

--- a/fs/userfaultfd.c~userfaultfd-add-uffdio_continue-ioctl
+++ a/fs/userfaultfd.c
@@ -1487,6 +1487,10 @@ out_unlock:
 		if (!(uffdio_register.mode & UFFDIO_REGISTER_MODE_WP))
 			ioctls_out &= ~((__u64)1 << _UFFDIO_WRITEPROTECT);
 
+		/* CONTINUE ioctl is only supported for MINOR ranges. */
+		if (!(uffdio_register.mode & UFFDIO_REGISTER_MODE_MINOR))
+			ioctls_out &= ~((__u64)1 << _UFFDIO_CONTINUE);
+
 		/*
 		 * Now that we scanned all vmas we can already tell
 		 * userland which ioctls methods are guaranteed to
@@ -1840,6 +1844,66 @@ static int userfaultfd_writeprotect(stru
 	return ret;
 }
 
+static int userfaultfd_continue(struct userfaultfd_ctx *ctx, unsigned long arg)
+{
+	__s64 ret;
+	struct uffdio_continue uffdio_continue;
+	struct uffdio_continue __user *user_uffdio_continue;
+	struct userfaultfd_wake_range range;
+
+	user_uffdio_continue = (struct uffdio_continue __user *)arg;
+
+	ret = -EAGAIN;
+	if (READ_ONCE(ctx->mmap_changing))
+		goto out;
+
+	ret = -EFAULT;
+	if (copy_from_user(&uffdio_continue, user_uffdio_continue,
+			   /* don't copy the output fields */
+			   sizeof(uffdio_continue) - (sizeof(__s64))))
+		goto out;
+
+	ret = validate_range(ctx->mm, &uffdio_continue.range.start,
+			     uffdio_continue.range.len);
+	if (ret)
+		goto out;
+
+	ret = -EINVAL;
+	/* double check for wraparound just in case. */
+	if (uffdio_continue.range.start + uffdio_continue.range.len <=
+	    uffdio_continue.range.start) {
+		goto out;
+	}
+	if (uffdio_continue.mode & ~UFFDIO_CONTINUE_MODE_DONTWAKE)
+		goto out;
+
+	if (mmget_not_zero(ctx->mm)) {
+		ret = mcopy_continue(ctx->mm, uffdio_continue.range.start,
+				     uffdio_continue.range.len,
+				     &ctx->mmap_changing);
+		mmput(ctx->mm);
+	} else {
+		return -ESRCH;
+	}
+
+	if (unlikely(put_user(ret, &user_uffdio_continue->mapped)))
+		return -EFAULT;
+	if (ret < 0)
+		goto out;
+
+	/* len == 0 would wake all */
+	BUG_ON(!ret);
+	range.len = ret;
+	if (!(uffdio_continue.mode & UFFDIO_CONTINUE_MODE_DONTWAKE)) {
+		range.start = uffdio_continue.range.start;
+		wake_userfault(ctx, &range);
+	}
+	ret = range.len == uffdio_continue.range.len ? 0 : -EAGAIN;
+
+out:
+	return ret;
+}
+
 static inline unsigned int uffd_ctx_features(__u64 user_features)
 {
 	/*
@@ -1927,6 +1991,9 @@ static long userfaultfd_ioctl(struct fil
 	case UFFDIO_WRITEPROTECT:
 		ret = userfaultfd_writeprotect(ctx, arg);
 		break;
+	case UFFDIO_CONTINUE:
+		ret = userfaultfd_continue(ctx, arg);
+		break;
 	}
 	return ret;
 }
--- a/include/linux/hugetlb.h~userfaultfd-add-uffdio_continue-ioctl
+++ a/include/linux/hugetlb.h
@@ -11,6 +11,7 @@
 #include <linux/kref.h>
 #include <linux/pgtable.h>
 #include <linux/gfp.h>
+#include <linux/userfaultfd_k.h>
 
 struct ctl_table;
 struct user_struct;
@@ -139,6 +140,7 @@ int hugetlb_mcopy_atomic_pte(struct mm_s
 				struct vm_area_struct *dst_vma,
 				unsigned long dst_addr,
 				unsigned long src_addr,
+				enum mcopy_atomic_mode mode,
 				struct page **pagep);
 #endif /* CONFIG_USERFAULTFD */
 bool hugetlb_reserve_pages(struct inode *inode, long from, long to,
@@ -318,6 +320,7 @@ static inline int hugetlb_mcopy_atomic_p
 						struct vm_area_struct *dst_vma,
 						unsigned long dst_addr,
 						unsigned long src_addr,
+						enum mcopy_atomic_mode mode,
 						struct page **pagep)
 {
 	BUG();
--- a/include/linux/userfaultfd_k.h~userfaultfd-add-uffdio_continue-ioctl
+++ a/include/linux/userfaultfd_k.h
@@ -37,6 +37,22 @@ extern int sysctl_unprivileged_userfault
 
 extern vm_fault_t handle_userfault(struct vm_fault *vmf, unsigned long reason);
 
+/*
+ * The mode of operation for __mcopy_atomic and its helpers.
+ *
+ * This is almost an implementation detail (mcopy_atomic below doesn't take this
+ * as a parameter), but it's exposed here because memory-kind-specific
+ * implementations (e.g. hugetlbfs) need to know the mode of operation.
+ */
+enum mcopy_atomic_mode {
+	/* A normal copy_from_user into the destination range. */
+	MCOPY_ATOMIC_NORMAL,
+	/* Don't copy; map the destination range to the zero page. */
+	MCOPY_ATOMIC_ZEROPAGE,
+	/* Just install pte(s) with the existing page(s) in the page cache. */
+	MCOPY_ATOMIC_CONTINUE,
+};
+
 extern ssize_t mcopy_atomic(struct mm_struct *dst_mm, unsigned long dst_start,
 			    unsigned long src_start, unsigned long len,
 			    bool *mmap_changing, __u64 mode);
@@ -44,6 +60,8 @@ extern ssize_t mfill_zeropage(struct mm_
 			      unsigned long dst_start,
 			      unsigned long len,
 			      bool *mmap_changing);
+extern ssize_t mcopy_continue(struct mm_struct *dst_mm, unsigned long dst_start,
+			      unsigned long len, bool *mmap_changing);
 extern int mwriteprotect_range(struct mm_struct *dst_mm,
 			       unsigned long start, unsigned long len,
 			       bool enable_wp, bool *mmap_changing);
--- a/include/uapi/linux/userfaultfd.h~userfaultfd-add-uffdio_continue-ioctl
+++ a/include/uapi/linux/userfaultfd.h
@@ -40,10 +40,12 @@
 	((__u64)1 << _UFFDIO_WAKE |		\
 	 (__u64)1 << _UFFDIO_COPY |		\
 	 (__u64)1 << _UFFDIO_ZEROPAGE |		\
-	 (__u64)1 << _UFFDIO_WRITEPROTECT)
+	 (__u64)1 << _UFFDIO_WRITEPROTECT |	\
+	 (__u64)1 << _UFFDIO_CONTINUE)
 #define UFFD_API_RANGE_IOCTLS_BASIC		\
 	((__u64)1 << _UFFDIO_WAKE |		\
-	 (__u64)1 << _UFFDIO_COPY)
+	 (__u64)1 << _UFFDIO_COPY |		\
+	 (__u64)1 << _UFFDIO_CONTINUE)
 
 /*
  * Valid ioctl command number range with this API is from 0x00 to
@@ -59,6 +61,7 @@
 #define _UFFDIO_COPY			(0x03)
 #define _UFFDIO_ZEROPAGE		(0x04)
 #define _UFFDIO_WRITEPROTECT		(0x06)
+#define _UFFDIO_CONTINUE		(0x07)
 #define _UFFDIO_API			(0x3F)
 
 /* userfaultfd ioctl ids */
@@ -77,6 +80,8 @@
 				      struct uffdio_zeropage)
 #define UFFDIO_WRITEPROTECT	_IOWR(UFFDIO, _UFFDIO_WRITEPROTECT, \
 				      struct uffdio_writeprotect)
+#define UFFDIO_CONTINUE		_IOR(UFFDIO, _UFFDIO_CONTINUE,	\
+				     struct uffdio_continue)
 
 /* read() structure */
 struct uffd_msg {
@@ -268,6 +273,18 @@ struct uffdio_writeprotect {
 	__u64 mode;
 };
 
+struct uffdio_continue {
+	struct uffdio_range range;
+#define UFFDIO_CONTINUE_MODE_DONTWAKE		((__u64)1<<0)
+	__u64 mode;
+
+	/*
+	 * Fields below here are written by the ioctl and must be at the end:
+	 * the copy_from_user will not read past here.
+	 */
+	__s64 mapped;
+};
+
 /*
  * Flags for the userfaultfd(2) system call itself.
  */
--- a/mm/hugetlb.c~userfaultfd-add-uffdio_continue-ioctl
+++ a/mm/hugetlb.c
@@ -39,7 +39,6 @@
 #include <linux/hugetlb.h>
 #include <linux/hugetlb_cgroup.h>
 #include <linux/node.h>
-#include <linux/userfaultfd_k.h>
 #include <linux/page_owner.h>
 #include "internal.h"
 
@@ -4865,8 +4864,10 @@ int hugetlb_mcopy_atomic_pte(struct mm_s
 			    struct vm_area_struct *dst_vma,
 			    unsigned long dst_addr,
 			    unsigned long src_addr,
+			    enum mcopy_atomic_mode mode,
 			    struct page **pagep)
 {
+	bool is_continue = (mode == MCOPY_ATOMIC_CONTINUE);
 	struct address_space *mapping;
 	pgoff_t idx;
 	unsigned long size;
@@ -4876,8 +4877,17 @@ int hugetlb_mcopy_atomic_pte(struct mm_s
 	spinlock_t *ptl;
 	int ret;
 	struct page *page;
+	int writable;
 
-	if (!*pagep) {
+	mapping = dst_vma->vm_file->f_mapping;
+	idx = vma_hugecache_offset(h, dst_vma, dst_addr);
+
+	if (is_continue) {
+		ret = -EFAULT;
+		page = find_lock_page(mapping, idx);
+		if (!page)
+			goto out;
+	} else if (!*pagep) {
 		ret = -ENOMEM;
 		page = alloc_huge_page(dst_vma, dst_addr, 0);
 		if (IS_ERR(page))
@@ -4906,13 +4916,8 @@ int hugetlb_mcopy_atomic_pte(struct mm_s
 	 */
 	__SetPageUptodate(page);
 
-	mapping = dst_vma->vm_file->f_mapping;
-	idx = vma_hugecache_offset(h, dst_vma, dst_addr);
-
-	/*
-	 * If shared, add to page cache
-	 */
-	if (vm_shared) {
+	/* Add shared, newly allocated pages to the page cache. */
+	if (vm_shared && !is_continue) {
 		size = i_size_read(mapping->host) >> huge_page_shift(h);
 		ret = -EFAULT;
 		if (idx >= size)
@@ -4957,8 +4962,14 @@ int hugetlb_mcopy_atomic_pte(struct mm_s
 		hugepage_add_new_anon_rmap(page, dst_vma, dst_addr);
 	}
 
-	_dst_pte = make_huge_pte(dst_vma, page, dst_vma->vm_flags & VM_WRITE);
-	if (dst_vma->vm_flags & VM_WRITE)
+	/* For CONTINUE on a non-shared VMA, don't set VM_WRITE for CoW. */
+	if (is_continue && !vm_shared)
+		writable = 0;
+	else
+		writable = dst_vma->vm_flags & VM_WRITE;
+
+	_dst_pte = make_huge_pte(dst_vma, page, writable);
+	if (writable)
 		_dst_pte = huge_pte_mkdirty(_dst_pte);
 	_dst_pte = pte_mkyoung(_dst_pte);
 
@@ -4972,15 +4983,16 @@ int hugetlb_mcopy_atomic_pte(struct mm_s
 	update_mmu_cache(dst_vma, dst_addr, dst_pte);
 
 	spin_unlock(ptl);
-	SetHPageMigratable(page);
-	if (vm_shared)
+	if (!is_continue)
+		SetHPageMigratable(page);
+	if (vm_shared || is_continue)
 		unlock_page(page);
 	ret = 0;
 out:
 	return ret;
 out_release_unlock:
 	spin_unlock(ptl);
-	if (vm_shared)
+	if (vm_shared || is_continue)
 		unlock_page(page);
 out_release_nounlock:
 	put_page(page);
--- a/mm/userfaultfd.c~userfaultfd-add-uffdio_continue-ioctl
+++ a/mm/userfaultfd.c
@@ -207,7 +207,7 @@ static __always_inline ssize_t __mcopy_a
 					      unsigned long dst_start,
 					      unsigned long src_start,
 					      unsigned long len,
-					      bool zeropage)
+					      enum mcopy_atomic_mode mode)
 {
 	int vm_alloc_shared = dst_vma->vm_flags & VM_SHARED;
 	int vm_shared = dst_vma->vm_flags & VM_SHARED;
@@ -227,7 +227,7 @@ static __always_inline ssize_t __mcopy_a
 	 * by THP.  Since we can not reliably insert a zero page, this
 	 * feature is not supported.
 	 */
-	if (zeropage) {
+	if (mode == MCOPY_ATOMIC_ZEROPAGE) {
 		mmap_read_unlock(dst_mm);
 		return -EINVAL;
 	}
@@ -273,8 +273,6 @@ retry:
 	}
 
 	while (src_addr < src_start + len) {
-		pte_t dst_pteval;
-
 		BUG_ON(dst_addr >= dst_start + len);
 
 		/*
@@ -297,16 +295,16 @@ retry:
 			goto out_unlock;
 		}
 
-		err = -EEXIST;
-		dst_pteval = huge_ptep_get(dst_pte);
-		if (!huge_pte_none(dst_pteval)) {
+		if (mode != MCOPY_ATOMIC_CONTINUE &&
+		    !huge_pte_none(huge_ptep_get(dst_pte))) {
+			err = -EEXIST;
 			mutex_unlock(&hugetlb_fault_mutex_table[hash]);
 			i_mmap_unlock_read(mapping);
 			goto out_unlock;
 		}
 
 		err = hugetlb_mcopy_atomic_pte(dst_mm, dst_pte, dst_vma,
-						dst_addr, src_addr, &page);
+					       dst_addr, src_addr, mode, &page);
 
 		mutex_unlock(&hugetlb_fault_mutex_table[hash]);
 		i_mmap_unlock_read(mapping);
@@ -408,7 +406,7 @@ extern ssize_t __mcopy_atomic_hugetlb(st
 				      unsigned long dst_start,
 				      unsigned long src_start,
 				      unsigned long len,
-				      bool zeropage);
+				      enum mcopy_atomic_mode mode);
 #endif /* CONFIG_HUGETLB_PAGE */
 
 static __always_inline ssize_t mfill_atomic_pte(struct mm_struct *dst_mm,
@@ -458,7 +456,7 @@ static __always_inline ssize_t __mcopy_a
 					      unsigned long dst_start,
 					      unsigned long src_start,
 					      unsigned long len,
-					      bool zeropage,
+					      enum mcopy_atomic_mode mcopy_mode,
 					      bool *mmap_changing,
 					      __u64 mode)
 {
@@ -469,6 +467,7 @@ static __always_inline ssize_t __mcopy_a
 	long copied;
 	struct page *page;
 	bool wp_copy;
+	bool zeropage = (mcopy_mode == MCOPY_ATOMIC_ZEROPAGE);
 
 	/*
 	 * Sanitize the command parameters:
@@ -527,10 +526,12 @@ retry:
 	 */
 	if (is_vm_hugetlb_page(dst_vma))
 		return  __mcopy_atomic_hugetlb(dst_mm, dst_vma, dst_start,
-						src_start, len, zeropage);
+						src_start, len, mcopy_mode);
 
 	if (!vma_is_anonymous(dst_vma) && !vma_is_shmem(dst_vma))
 		goto out_unlock;
+	if (mcopy_mode == MCOPY_ATOMIC_CONTINUE)
+		goto out_unlock;
 
 	/*
 	 * Ensure the dst_vma has a anon_vma or this page
@@ -626,14 +627,22 @@ ssize_t mcopy_atomic(struct mm_struct *d
 		     unsigned long src_start, unsigned long len,
 		     bool *mmap_changing, __u64 mode)
 {
-	return __mcopy_atomic(dst_mm, dst_start, src_start, len, false,
-			      mmap_changing, mode);
+	return __mcopy_atomic(dst_mm, dst_start, src_start, len,
+			      MCOPY_ATOMIC_NORMAL, mmap_changing, mode);
 }
 
 ssize_t mfill_zeropage(struct mm_struct *dst_mm, unsigned long start,
 		       unsigned long len, bool *mmap_changing)
 {
-	return __mcopy_atomic(dst_mm, start, 0, len, true, mmap_changing, 0);
+	return __mcopy_atomic(dst_mm, start, 0, len, MCOPY_ATOMIC_ZEROPAGE,
+			      mmap_changing, 0);
+}
+
+ssize_t mcopy_continue(struct mm_struct *dst_mm, unsigned long start,
+		       unsigned long len, bool *mmap_changing)
+{
+	return __mcopy_atomic(dst_mm, start, 0, len, MCOPY_ATOMIC_CONTINUE,
+			      mmap_changing, 0);
 }
 
 int mwriteprotect_range(struct mm_struct *dst_mm, unsigned long start,
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 058/143] userfaultfd: update documentation to describe minor fault handling
  2021-05-05  1:32 incoming Andrew Morton
                   ` (56 preceding siblings ...)
  2021-05-05  1:35 ` [patch 057/143] userfaultfd: add UFFDIO_CONTINUE ioctl Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:35 ` [patch 059/143] userfaultfd/selftests: add test exercising " Andrew Morton
                   ` (82 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
	axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
	dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
	mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
	peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
	steven.price, torvalds, vbabka, viro, walken, willy, ying.huang

From: Axel Rasmussen <axelrasmussen@google.com>
Subject: userfaultfd: update documentation to describe minor fault handling

Reword / reorganize things a little bit into "lists", so new features /
modes / ioctls can sort of just be appended.

Describe how UFFDIO_REGISTER_MODE_MINOR and UFFDIO_CONTINUE can be used to
intercept and resolve minor faults.  Make it clear that COPY and ZEROPAGE
are used for MISSING faults, whereas CONTINUE is used for MINOR faults.

Link: https://lkml.kernel.org/r/20210301222728.176417-6-axelrasmussen@google.com
Signed-off-by: Axel Rasmussen <axelrasmussen@google.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 Documentation/admin-guide/mm/userfaultfd.rst |  105 ++++++++++-------
 1 file changed, 65 insertions(+), 40 deletions(-)

--- a/Documentation/admin-guide/mm/userfaultfd.rst~userfaultfd-update-documentation-to-describe-minor-fault-handling
+++ a/Documentation/admin-guide/mm/userfaultfd.rst
@@ -63,36 +63,36 @@ the generic ioctl available.
 
 The ``uffdio_api.features`` bitmask returned by the ``UFFDIO_API`` ioctl
 defines what memory types are supported by the ``userfaultfd`` and what
-events, except page fault notifications, may be generated.
+events, except page fault notifications, may be generated:
 
-If the kernel supports registering ``userfaultfd`` ranges on hugetlbfs
-virtual memory areas, ``UFFD_FEATURE_MISSING_HUGETLBFS`` will be set in
-``uffdio_api.features``. Similarly, ``UFFD_FEATURE_MISSING_SHMEM`` will be
-set if the kernel supports registering ``userfaultfd`` ranges on shared
-memory (covering all shmem APIs, i.e. tmpfs, ``IPCSHM``, ``/dev/zero``,
-``MAP_SHARED``, ``memfd_create``, etc).
-
-The userland application that wants to use ``userfaultfd`` with hugetlbfs
-or shared memory need to set the corresponding flag in
-``uffdio_api.features`` to enable those features.
-
-If the userland desires to receive notifications for events other than
-page faults, it has to verify that ``uffdio_api.features`` has appropriate
-``UFFD_FEATURE_EVENT_*`` bits set. These events are described in more
-detail below in `Non-cooperative userfaultfd`_ section.
-
-Once the ``userfaultfd`` has been enabled the ``UFFDIO_REGISTER`` ioctl should
-be invoked (if present in the returned ``uffdio_api.ioctls`` bitmask) to
-register a memory range in the ``userfaultfd`` by setting the
+- The ``UFFD_FEATURE_EVENT_*`` flags indicate that various other events
+  other than page faults are supported. These events are described in more
+  detail below in the `Non-cooperative userfaultfd`_ section.
+
+- ``UFFD_FEATURE_MISSING_HUGETLBFS`` and ``UFFD_FEATURE_MISSING_SHMEM``
+  indicate that the kernel supports ``UFFDIO_REGISTER_MODE_MISSING``
+  registrations for hugetlbfs and shared memory (covering all shmem APIs,
+  i.e. tmpfs, ``IPCSHM``, ``/dev/zero``, ``MAP_SHARED``, ``memfd_create``,
+  etc) virtual memory areas, respectively.
+
+- ``UFFD_FEATURE_MINOR_HUGETLBFS`` indicates that the kernel supports
+  ``UFFDIO_REGISTER_MODE_MINOR`` registration for hugetlbfs virtual memory
+  areas.
+
+The userland application should set the feature flags it intends to use
+when invoking the ``UFFDIO_API`` ioctl, to request that those features be
+enabled if supported.
+
+Once the ``userfaultfd`` API has been enabled the ``UFFDIO_REGISTER``
+ioctl should be invoked (if present in the returned ``uffdio_api.ioctls``
+bitmask) to register a memory range in the ``userfaultfd`` by setting the
 uffdio_register structure accordingly. The ``uffdio_register.mode``
 bitmask will specify to the kernel which kind of faults to track for
-the range (``UFFDIO_REGISTER_MODE_MISSING`` would track missing
-pages). The ``UFFDIO_REGISTER`` ioctl will return the
+the range. The ``UFFDIO_REGISTER`` ioctl will return the
 ``uffdio_register.ioctls`` bitmask of ioctls that are suitable to resolve
 userfaults on the range registered. Not all ioctls will necessarily be
-supported for all memory types depending on the underlying virtual
-memory backend (anonymous memory vs tmpfs vs real filebacked
-mappings).
+supported for all memory types (e.g. anonymous memory vs. shmem vs.
+hugetlbfs), or all types of intercepted faults.
 
 Userland can use the ``uffdio_register.ioctls`` to manage the virtual
 address space in the background (to add or potentially also remove
@@ -100,21 +100,46 @@ memory from the ``userfaultfd`` register
 could be triggering just before userland maps in the background the
 user-faulted page.
 
-The primary ioctl to resolve userfaults is ``UFFDIO_COPY``. That
-atomically copies a page into the userfault registered range and wakes
-up the blocked userfaults
-(unless ``uffdio_copy.mode & UFFDIO_COPY_MODE_DONTWAKE`` is set).
-Other ioctl works similarly to ``UFFDIO_COPY``. They're atomic as in
-guaranteeing that nothing can see an half copied page since it'll
-keep userfaulting until the copy has finished.
+Resolving Userfaults
+--------------------
+
+There are three basic ways to resolve userfaults:
+
+- ``UFFDIO_COPY`` atomically copies some existing page contents from
+  userspace.
+
+- ``UFFDIO_ZEROPAGE`` atomically zeros the new page.
+
+- ``UFFDIO_CONTINUE`` maps an existing, previously-populated page.
+
+These operations are atomic in the sense that they guarantee nothing can
+see a half-populated page, since readers will keep userfaulting until the
+operation has finished.
+
+By default, these wake up userfaults blocked on the range in question.
+They support a ``UFFDIO_*_MODE_DONTWAKE`` ``mode`` flag, which indicates
+that waking will be done separately at some later time.
+
+Which ioctl to choose depends on the kind of page fault, and what we'd
+like to do to resolve it:
+
+- For ``UFFDIO_REGISTER_MODE_MISSING`` faults, the fault needs to be
+  resolved by either providing a new page (``UFFDIO_COPY``), or mapping
+  the zero page (``UFFDIO_ZEROPAGE``). By default, the kernel would map
+  the zero page for a missing fault. With userfaultfd, userspace can
+  decide what content to provide before the faulting thread continues.
+
+- For ``UFFDIO_REGISTER_MODE_MINOR`` faults, there is an existing page (in
+  the page cache). Userspace has the option of modifying the page's
+  contents before resolving the fault. Once the contents are correct
+  (modified or not), userspace asks the kernel to map the page and let the
+  faulting thread continue with ``UFFDIO_CONTINUE``.
 
 Notes:
 
-- If you requested ``UFFDIO_REGISTER_MODE_MISSING`` when registering then
-  you must provide some kind of page in your thread after reading from
-  the uffd.  You must provide either ``UFFDIO_COPY`` or ``UFFDIO_ZEROPAGE``.
-  The normal behavior of the OS automatically providing a zero page on
-  an anonymous mmaping is not in place.
+- You can tell which kind of fault occurred by examining
+  ``pagefault.flags`` within the ``uffd_msg``, checking for the
+  ``UFFD_PAGEFAULT_FLAG_*`` flags.
 
 - None of the page-delivering ioctls default to the range that you
   registered with.  You must fill in all fields for the appropriate
@@ -122,9 +147,9 @@ Notes:
 
 - You get the address of the access that triggered the missing page
   event out of a struct uffd_msg that you read in the thread from the
-  uffd.  You can supply as many pages as you want with ``UFFDIO_COPY`` or
-  ``UFFDIO_ZEROPAGE``.  Keep in mind that unless you used DONTWAKE then
-  the first of any of those IOCTLs wakes up the faulting thread.
+  uffd.  You can supply as many pages as you want with these IOCTLs.
+  Keep in mind that unless you used DONTWAKE then the first of any of
+  those IOCTLs wakes up the faulting thread.
 
 - Be sure to test for all errors including
   (``pollfd[0].revents & POLLERR``).  This can happen, e.g. when ranges
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 059/143] userfaultfd/selftests: add test exercising minor fault handling
  2021-05-05  1:32 incoming Andrew Morton
                   ` (57 preceding siblings ...)
  2021-05-05  1:35 ` [patch 058/143] userfaultfd: update documentation to describe minor fault handling Andrew Morton
@ 2021-05-05  1:35 ` Andrew Morton
  2021-05-05  1:36 ` [patch 060/143] mm/vmscan: move RECLAIM* bits to uapi header Andrew Morton
                   ` (81 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:35 UTC (permalink / raw)
  To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
	axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
	dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
	mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
	peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
	steven.price, torvalds, vbabka, viro, walken, willy, ying.huang

From: Axel Rasmussen <axelrasmussen@google.com>
Subject: userfaultfd/selftests: add test exercising minor fault handling

Fix a dormant bug in userfaultfd_events_test(), where we did `return
faulting_process(0)` instead of `exit(faulting_process(0))`.  This caused
the forked process to keep running, trying to execute any further test
cases after the events test in parallel with the "real" process.

Add a simple test case which exercises minor faults. In short, it does
the following:

1. "Sets up" an area (area_dst) and a second shared mapping to the same
   underlying pages (area_dst_alias).

2. Register one of these areas with userfaultfd, in minor fault mode.

3. Start a second thread to handle any minor faults.

4. Populate the underlying pages with the non-UFFD-registered side of
   the mapping. Basically, memset() each page with some arbitrary
   contents.

5. Then, using the UFFD-registered mapping, read all of the page
   contents, asserting that the contents match expectations (we expect
   the minor fault handling thread can modify the page contents before
   resolving the fault).

The minor fault handling thread, upon receiving an event, flips all the
bits (~) in that page, just to prove that it can modify it in some
arbitrary way.  Then it issues a UFFDIO_CONTINUE ioctl, to setup the
mapping and resolve the fault.  The reading thread should wake up and see
this modification.

Currently the minor fault test is only enabled in hugetlb_shared mode, as
this is the only configuration the kernel feature supports.

Link: https://lkml.kernel.org/r/20210301222728.176417-7-axelrasmussen@google.com
Signed-off-by: Axel Rasmussen <axelrasmussen@google.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 tools/testing/selftests/vm/userfaultfd.c |  164 ++++++++++++++++++++-
 1 file changed, 158 insertions(+), 6 deletions(-)

--- a/tools/testing/selftests/vm/userfaultfd.c~userfaultfd-selftests-add-test-exercising-minor-fault-handling
+++ a/tools/testing/selftests/vm/userfaultfd.c
@@ -81,6 +81,8 @@ static volatile bool test_uffdio_copy_ee
 static volatile bool test_uffdio_zeropage_eexist = true;
 /* Whether to test uffd write-protection */
 static bool test_uffdio_wp = false;
+/* Whether to test uffd minor faults */
+static bool test_uffdio_minor = false;
 
 static bool map_shared;
 static int huge_fd;
@@ -96,6 +98,7 @@ struct uffd_stats {
 	int cpu;
 	unsigned long missing_faults;
 	unsigned long wp_faults;
+	unsigned long minor_faults;
 };
 
 /* pthread_mutex_t starts at page offset 0 */
@@ -153,17 +156,19 @@ static void uffd_stats_reset(struct uffd
 		uffd_stats[i].cpu = i;
 		uffd_stats[i].missing_faults = 0;
 		uffd_stats[i].wp_faults = 0;
+		uffd_stats[i].minor_faults = 0;
 	}
 }
 
 static void uffd_stats_report(struct uffd_stats *stats, int n_cpus)
 {
 	int i;
-	unsigned long long miss_total = 0, wp_total = 0;
+	unsigned long long miss_total = 0, wp_total = 0, minor_total = 0;
 
 	for (i = 0; i < n_cpus; i++) {
 		miss_total += stats[i].missing_faults;
 		wp_total += stats[i].wp_faults;
+		minor_total += stats[i].minor_faults;
 	}
 
 	printf("userfaults: %llu missing (", miss_total);
@@ -172,6 +177,9 @@ static void uffd_stats_report(struct uff
 	printf("\b), %llu wp (", wp_total);
 	for (i = 0; i < n_cpus; i++)
 		printf("%lu+", stats[i].wp_faults);
+	printf("\b), %llu minor (", minor_total);
+	for (i = 0; i < n_cpus; i++)
+		printf("%lu+", stats[i].minor_faults);
 	printf("\b)\n");
 }
 
@@ -328,7 +336,7 @@ static struct uffd_test_ops shmem_uffd_t
 };
 
 static struct uffd_test_ops hugetlb_uffd_test_ops = {
-	.expected_ioctls = UFFD_API_RANGE_IOCTLS_BASIC,
+	.expected_ioctls = UFFD_API_RANGE_IOCTLS_BASIC & ~(1 << _UFFDIO_CONTINUE),
 	.allocate_area	= hugetlb_allocate_area,
 	.release_pages	= hugetlb_release_pages,
 	.alias_mapping = hugetlb_alias_mapping,
@@ -362,6 +370,22 @@ static void wp_range(int ufd, __u64 star
 	}
 }
 
+static void continue_range(int ufd, __u64 start, __u64 len)
+{
+	struct uffdio_continue req;
+
+	req.range.start = start;
+	req.range.len = len;
+	req.mode = 0;
+
+	if (ioctl(ufd, UFFDIO_CONTINUE, &req)) {
+		fprintf(stderr,
+			"UFFDIO_CONTINUE failed for address 0x%" PRIx64 "\n",
+			(uint64_t)start);
+		exit(1);
+	}
+}
+
 static void *locking_thread(void *arg)
 {
 	unsigned long cpu = (unsigned long) arg;
@@ -569,8 +593,32 @@ static void uffd_handle_page_fault(struc
 	}
 
 	if (msg->arg.pagefault.flags & UFFD_PAGEFAULT_FLAG_WP) {
+		/* Write protect page faults */
 		wp_range(uffd, msg->arg.pagefault.address, page_size, false);
 		stats->wp_faults++;
+	} else if (msg->arg.pagefault.flags & UFFD_PAGEFAULT_FLAG_MINOR) {
+		uint8_t *area;
+		int b;
+
+		/*
+		 * Minor page faults
+		 *
+		 * To prove we can modify the original range for testing
+		 * purposes, we're going to bit flip this range before
+		 * continuing.
+		 *
+		 * Note that this requires all minor page fault tests operate on
+		 * area_dst (non-UFFD-registered) and area_dst_alias
+		 * (UFFD-registered).
+		 */
+
+		area = (uint8_t *)(area_dst +
+				   ((char *)msg->arg.pagefault.address -
+				    area_dst_alias));
+		for (b = 0; b < page_size; ++b)
+			area[b] = ~area[b];
+		continue_range(uffd, msg->arg.pagefault.address, page_size);
+		stats->minor_faults++;
 	} else {
 		/* Missing page faults */
 		if (bounces & BOUNCE_VERIFY &&
@@ -779,7 +827,7 @@ static int stress(struct uffd_stats *uff
 	return 0;
 }
 
-static int userfaultfd_open(int features)
+static int userfaultfd_open_ext(uint64_t *features)
 {
 	struct uffdio_api uffdio_api;
 
@@ -792,7 +840,7 @@ static int userfaultfd_open(int features
 	uffd_flags = fcntl(uffd, F_GETFD, NULL);
 
 	uffdio_api.api = UFFD_API;
-	uffdio_api.features = features;
+	uffdio_api.features = *features;
 	if (ioctl(uffd, UFFDIO_API, &uffdio_api)) {
 		fprintf(stderr, "UFFDIO_API failed.\nPlease make sure to "
 			"run with either root or ptrace capability.\n");
@@ -804,9 +852,15 @@ static int userfaultfd_open(int features
 		return 1;
 	}
 
+	*features = uffdio_api.features;
 	return 0;
 }
 
+static int userfaultfd_open(uint64_t features)
+{
+	return userfaultfd_open_ext(&features);
+}
+
 sigjmp_buf jbuf, *sigbuf;
 
 static void sighndl(int sig, siginfo_t *siginfo, void *ptr)
@@ -1112,7 +1166,7 @@ static int userfaultfd_events_test(void)
 	}
 
 	if (!pid)
-		return faulting_process(0);
+		exit(faulting_process(0));
 
 	waitpid(pid, &err, 0);
 	if (err) {
@@ -1215,6 +1269,102 @@ static int userfaultfd_sig_test(void)
 	return userfaults != 0;
 }
 
+static int userfaultfd_minor_test(void)
+{
+	struct uffdio_register uffdio_register;
+	unsigned long expected_ioctls;
+	unsigned long p;
+	pthread_t uffd_mon;
+	uint8_t expected_byte;
+	void *expected_page;
+	char c;
+	struct uffd_stats stats = { 0 };
+	uint64_t features = UFFD_FEATURE_MINOR_HUGETLBFS;
+
+	if (!test_uffdio_minor)
+		return 0;
+
+	printf("testing minor faults: ");
+	fflush(stdout);
+
+	if (uffd_test_ops->release_pages(area_dst))
+		return 1;
+
+	if (userfaultfd_open_ext(&features))
+		return 1;
+	/* If kernel reports the feature isn't supported, skip the test. */
+	if (!(features & UFFD_FEATURE_MINOR_HUGETLBFS)) {
+		printf("skipping test due to lack of feature support\n");
+		fflush(stdout);
+		return 0;
+	}
+
+	uffdio_register.range.start = (unsigned long)area_dst_alias;
+	uffdio_register.range.len = nr_pages * page_size;
+	uffdio_register.mode = UFFDIO_REGISTER_MODE_MINOR;
+	if (ioctl(uffd, UFFDIO_REGISTER, &uffdio_register)) {
+		fprintf(stderr, "register failure\n");
+		exit(1);
+	}
+
+	expected_ioctls = uffd_test_ops->expected_ioctls;
+	expected_ioctls |= 1 << _UFFDIO_CONTINUE;
+	if ((uffdio_register.ioctls & expected_ioctls) != expected_ioctls) {
+		fprintf(stderr, "unexpected missing ioctl(s)\n");
+		exit(1);
+	}
+
+	/*
+	 * After registering with UFFD, populate the non-UFFD-registered side of
+	 * the shared mapping. This should *not* trigger any UFFD minor faults.
+	 */
+	for (p = 0; p < nr_pages; ++p) {
+		memset(area_dst + (p * page_size), p % ((uint8_t)-1),
+		       page_size);
+	}
+
+	if (pthread_create(&uffd_mon, &attr, uffd_poll_thread, &stats)) {
+		perror("uffd_poll_thread create");
+		exit(1);
+	}
+
+	/*
+	 * Read each of the pages back using the UFFD-registered mapping. We
+	 * expect that the first time we touch a page, it will result in a minor
+	 * fault. uffd_poll_thread will resolve the fault by bit-flipping the
+	 * page's contents, and then issuing a CONTINUE ioctl.
+	 */
+
+	if (posix_memalign(&expected_page, page_size, page_size)) {
+		fprintf(stderr, "out of memory\n");
+		return 1;
+	}
+
+	for (p = 0; p < nr_pages; ++p) {
+		expected_byte = ~((uint8_t)(p % ((uint8_t)-1)));
+		memset(expected_page, expected_byte, page_size);
+		if (my_bcmp(expected_page, area_dst_alias + (p * page_size),
+			    page_size)) {
+			fprintf(stderr,
+				"unexpected page contents after minor fault\n");
+			exit(1);
+		}
+	}
+
+	if (write(pipefd[1], &c, sizeof(c)) != sizeof(c)) {
+		perror("pipe write");
+		exit(1);
+	}
+	if (pthread_join(uffd_mon, NULL))
+		return 1;
+
+	close(uffd);
+
+	uffd_stats_report(&stats, 1);
+
+	return stats.missing_faults != 0 || stats.minor_faults != nr_pages;
+}
+
 static int userfaultfd_stress(void)
 {
 	void *area;
@@ -1413,7 +1563,7 @@ static int userfaultfd_stress(void)
 
 	close(uffd);
 	return userfaultfd_zeropage_test() || userfaultfd_sig_test()
-		|| userfaultfd_events_test();
+		|| userfaultfd_events_test() || userfaultfd_minor_test();
 }
 
 /*
@@ -1454,6 +1604,8 @@ static void set_test_type(const char *ty
 		map_shared = true;
 		test_type = TEST_HUGETLB;
 		uffd_test_ops = &hugetlb_uffd_test_ops;
+		/* Minor faults require shared hugetlb; only enable here. */
+		test_uffdio_minor = true;
 	} else if (!strcmp(type, "shmem")) {
 		map_shared = true;
 		test_type = TEST_SHMEM;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 060/143] mm/vmscan: move RECLAIM* bits to uapi header
  2021-05-05  1:32 incoming Andrew Morton
                   ` (58 preceding siblings ...)
  2021-05-05  1:35 ` [patch 059/143] userfaultfd/selftests: add test exercising " Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 061/143] mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks Andrew Morton
                   ` (80 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, alex.shi, ben.widawsky, cai, cl, dan.j.williams,
	dave.hansen, dwagner, linux-mm, mm-commits, osalvador, rientjes,
	tobin, torvalds, ying.huang

From: Dave Hansen <dave.hansen@linux.intel.com>
Subject: mm/vmscan: move RECLAIM* bits to uapi header

It is currently not obvious that the RECLAIM_* bits are part of the uapi
since they are defined in vmscan.c.  Move them to a uapi header to make it
obvious.

This should have no functional impact.

Link: https://lkml.kernel.org/r/20210219172557.08074910@viggo.jf.intel.com
Signed-off-by: Dave Hansen <dave.hansen@linux.intel.com>
Reviewed-by: Ben Widawsky <ben.widawsky@intel.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Acked-by: David Rientjes <rientjes@google.com>
Acked-by: Christoph Lameter <cl@linux.com>
Cc: Alex Shi <alex.shi@linux.alibaba.com>
Cc: Daniel Wagner <dwagner@suse.de>
Cc: "Tobin C. Harding" <tobin@kernel.org>
Cc: Christoph Lameter <cl@linux.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: Qian Cai <cai@lca.pw>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/uapi/linux/mempolicy.h |    7 +++++++
 mm/vmscan.c                    |    8 --------
 2 files changed, 7 insertions(+), 8 deletions(-)

--- a/include/uapi/linux/mempolicy.h~mm-vmscan-move-reclaim-bits-to-uapi-header
+++ a/include/uapi/linux/mempolicy.h
@@ -64,5 +64,12 @@ enum {
 #define MPOL_F_MOF	(1 << 3) /* this policy wants migrate on fault */
 #define MPOL_F_MORON	(1 << 4) /* Migrate On protnone Reference On Node */
 
+/*
+ * These bit locations are exposed in the vm.zone_reclaim_mode sysctl
+ * ABI.  New bits are OK, but existing bits can never change.
+ */
+#define RECLAIM_ZONE	(1<<0)	/* Run shrink_inactive_list on the zone */
+#define RECLAIM_WRITE	(1<<1)	/* Writeout pages during reclaim */
+#define RECLAIM_UNMAP	(1<<2)	/* Unmap pages during reclaim */
 
 #endif /* _UAPI_LINUX_MEMPOLICY_H */
--- a/mm/vmscan.c~mm-vmscan-move-reclaim-bits-to-uapi-header
+++ a/mm/vmscan.c
@@ -4087,14 +4087,6 @@ module_init(kswapd_init)
 int node_reclaim_mode __read_mostly;
 
 /*
- * These bit locations are exposed in the vm.zone_reclaim_mode sysctl
- * ABI.  New bits are OK, but existing bits can never change.
- */
-#define RECLAIM_ZONE  (1<<0)   /* Run shrink_inactive_list on the zone */
-#define RECLAIM_WRITE (1<<1)   /* Writeout pages during reclaim */
-#define RECLAIM_UNMAP (1<<2)   /* Unmap pages during reclaim */
-
-/*
  * Priority for NODE_RECLAIM. This determines the fraction of pages
  * of a node considered for each zone_reclaim. 4 scans 1/16th of
  * a zone.
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 061/143] mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks
  2021-05-05  1:32 incoming Andrew Morton
                   ` (59 preceding siblings ...)
  2021-05-05  1:36 ` [patch 060/143] mm/vmscan: move RECLAIM* bits to uapi header Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 062/143] mm: vmscan: use nid from shrink_control for tracepoint Andrew Morton
                   ` (79 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, alex.shi, ben.widawsky, cai, cl, dan.j.williams,
	dave.hansen, dwagner, linux-mm, mm-commits, osalvador, rientjes,
	tobin, torvalds, ying.huang

From: Dave Hansen <dave.hansen@linux.intel.com>
Subject: mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks

RECLAIM_ZONE was assumed to be unused because it was never explicitly used
in the kernel.  However, there were a number of places where it was
checked implicitly by checking 'node_reclaim_mode' for a zero value.

These zero checks are not great because it is not obvious what a zero mode
*means* in the code.  Replace them with a helper which makes it more
obvious: node_reclaim_enabled().

This helper also provides a handy place to explicitly check the
RECLAIM_ZONE bit itself.  Check it explicitly there to make it more
obvious where the bit can affect behavior.

This should have no functional impact.

Link: https://lkml.kernel.org/r/20210219172559.BF589C44@viggo.jf.intel.com
Signed-off-by: Dave Hansen <dave.hansen@linux.intel.com>
Reviewed-by: Ben Widawsky <ben.widawsky@intel.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Christoph Lameter <cl@linux.com>
Acked-by: David Rientjes <rientjes@google.com>
Cc: Alex Shi <alex.shi@linux.alibaba.com>
Cc: "Tobin C. Harding" <tobin@kernel.org>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: Qian Cai <cai@lca.pw>
Cc: Daniel Wagner <dwagner@suse.de>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/swap.h |    7 +++++++
 mm/khugepaged.c      |    2 +-
 mm/page_alloc.c      |    2 +-
 3 files changed, 9 insertions(+), 2 deletions(-)

--- a/include/linux/swap.h~mm-vmscan-replace-implicit-reclaim_zone-checks-with-explicit-checks
+++ a/include/linux/swap.h
@@ -12,6 +12,7 @@
 #include <linux/fs.h>
 #include <linux/atomic.h>
 #include <linux/page-flags.h>
+#include <uapi/linux/mempolicy.h>
 #include <asm/page.h>
 
 struct notifier_block;
@@ -378,6 +379,12 @@ extern int sysctl_min_slab_ratio;
 #define node_reclaim_mode 0
 #endif
 
+static inline bool node_reclaim_enabled(void)
+{
+	/* Is any node_reclaim_mode bit set? */
+	return node_reclaim_mode & (RECLAIM_ZONE|RECLAIM_WRITE|RECLAIM_UNMAP);
+}
+
 extern void check_move_unevictable_pages(struct pagevec *pvec);
 
 extern int kswapd_run(int nid);
--- a/mm/khugepaged.c~mm-vmscan-replace-implicit-reclaim_zone-checks-with-explicit-checks
+++ a/mm/khugepaged.c
@@ -809,7 +809,7 @@ static bool khugepaged_scan_abort(int ni
 	 * If node_reclaim_mode is disabled, then no extra effort is made to
 	 * allocate memory locally.
 	 */
-	if (!node_reclaim_mode)
+	if (!node_reclaim_enabled())
 		return false;
 
 	/* If there is a count for this node already, it must be acceptable */
--- a/mm/page_alloc.c~mm-vmscan-replace-implicit-reclaim_zone-checks-with-explicit-checks
+++ a/mm/page_alloc.c
@@ -3968,7 +3968,7 @@ retry:
 			if (alloc_flags & ALLOC_NO_WATERMARKS)
 				goto try_this_zone;
 
-			if (node_reclaim_mode == 0 ||
+			if (!node_reclaim_enabled() ||
 			    !zone_allows_reclaim(ac->preferred_zoneref->zone, zone))
 				continue;
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 062/143] mm: vmscan: use nid from shrink_control for tracepoint
  2021-05-05  1:32 incoming Andrew Morton
                   ` (60 preceding siblings ...)
  2021-05-05  1:36 ` [patch 061/143] mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 063/143] mm: vmscan: consolidate shrinker_maps handling code Andrew Morton
                   ` (78 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
	shakeelb, shy828301, torvalds, vbabka

From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: use nid from shrink_control for tracepoint

Patch series "Make shrinker's nr_deferred memcg aware", v10.

Recently huge amount one-off slab drop was seen on some vfs metadata heavy
workloads, it turned out there were huge amount accumulated nr_deferred
objects seen by the shrinker.

On our production machine, I saw absurd number of nr_deferred shown as the
below tracing result: 

<...>-48776 [032] .... 27970562.458916: mm_shrink_slab_start:
super_cache_scan+0x0/0x1a0 ffff9a83046f3458: nid: 0 objects to shrink
2531805877005 gfp_flags GFP_HIGHUSER_MOVABLE pgs_scanned 32 lru_pgs
9300 cache items 1667 delta 11 total_scan 833

There are 2.5 trillion deferred objects on one node, assuming all of them
are dentry (192 bytes per object), so the total size of deferred on one
node is ~480TB.  It is definitely ridiculous.

I managed to reproduce this problem with kernel build workload plus
negative dentry generator.

First step, run the below kernel build test script:

NR_CPUS=`cat /proc/cpuinfo | grep -e processor | wc -l`

cd /root/Buildarea/linux-stable

for i in `seq 1500`; do
        cgcreate -g memory:kern_build
        echo 4G > /sys/fs/cgroup/memory/kern_build/memory.limit_in_bytes

        echo 3 > /proc/sys/vm/drop_caches
        cgexec -g memory:kern_build make clean > /dev/null 2>&1
        cgexec -g memory:kern_build make -j$NR_CPUS > /dev/null 2>&1

        cgdelete -g memory:kern_build
done

Then run the below negative dentry generator script:

NR_CPUS=`cat /proc/cpuinfo | grep -e processor | wc -l`

mkdir /sys/fs/cgroup/memory/test
echo $$ > /sys/fs/cgroup/memory/test/tasks

for i in `seq $NR_CPUS`; do
        while true; do
                FILE=`head /dev/urandom | tr -dc A-Za-z0-9 | head -c 64`
                cat $FILE 2>/dev/null
        done &
done

Then kswapd will shrink half of dentry cache in just one loop as the below
tracing result showed:

	kswapd0-475   [028] .... 305968.252561: mm_shrink_slab_start: super_cache_scan+0x0/0x190 0000000024acf00c: nid: 0
objects to shrink 4994376020 gfp_flags GFP_KERNEL cache items 93689873 delta 45746 total_scan 46844936 priority 12
	kswapd0-475   [021] .... 306013.099399: mm_shrink_slab_end: super_cache_scan+0x0/0x190 0000000024acf00c: nid: 0 unused
scan count 4994376020 new scan count 4947576838 total_scan 8 last shrinker return val 46844928

There were huge number of deferred objects before the shrinker was called,
the behavior does match the code but it might be not desirable from the
user's stand of point.

The excessive amount of nr_deferred might be accumulated due to various
reasons, for example:

* GFP_NOFS allocation

* Significant times of small amount scan (< scan_batch, 1024 for vfs
  metadata)

However the LRUs of slabs are per memcg (memcg-aware shrinkers) but the
deferred objects is per shrinker, this may have some bad effects:

* Poor isolation among memcgs.  Some memcgs which happen to have
  frequent limit reclaim may get nr_deferred accumulated to a huge number,
  then other innocent memcgs may take the fall.  In our case the main
  workload was hit.

* Unbounded deferred objects.  There is no cap for deferred objects, it
  can outgrow ridiculously as the tracing result showed.

* Easy to get out of control.  Although shrinkers take into account
  deferred objects, but it can go out of control easily.  One
  misconfigured memcg could incur absurd amount of deferred objects in a
  period of time.

* Sort of reclaim problems, i.e.  over reclaim, long reclaim latency,
  etc.  There may be hundred GB slab caches for vfe metadata heavy
  workload, shrink half of them may take minutes.  We observed latency
  spike due to the prolonged reclaim.

These issues also have been discussed in
https://lore.kernel.org/linux-mm/20200916185823.5347-1-shy828301@gmail.com/.
The patchset is the outcome of that discussion.

So this patchset makes nr_deferred per-memcg to tackle the problem.  It
does:

* Have memcg_shrinker_deferred per memcg per node, just like what
  shrinker_map does.  Instead it is an atomic_long_t array, each element
  represent one shrinker even though the shrinker is not memcg aware, this
  simplifies the implementation.  For memcg aware shrinkers, the deferred
  objects are just accumulated to its own memcg.  The shrinkers just see
  nr_deferred from its own memcg.  Non memcg aware shrinkers still use
  global nr_deferred from struct shrinker.

* Once the memcg is offlined, its nr_deferred will be reparented to its
  parent along with LRUs.

* The root memcg has memcg_shrinker_deferred array too.  It simplifies
  the handling of reparenting to root memcg.

* Cap nr_deferred to 2x of the length of lru.  The idea is borrowed from
  Dave Chinner's series
  (https://lore.kernel.org/linux-xfs/20191031234618.15403-1-david@fromorbit.com/)

The downside is each memcg has to allocate extra memory to store the
nr_deferred array.  On our production environment, there are typically
around 40 shrinkers, so each memcg needs ~320 bytes.  10K memcgs would
need ~3.2MB memory.  It seems fine.

We have been running the patched kernel on some hosts of our fleet (test
and production) for months, it works very well.  The monitor data shows
the working set is sustained as expected.


This patch (of 13):

The tracepoint's nid should show what node the shrink happens on, the
start tracepoint uses nid from shrinkctl, but the nid might be set to 0
before end tracepoint if the shrinker is not NUMA aware, so the tracing
log may show the shrink happens on one node but end up on the other node. 
It seems confusing.  And the following patch will remove using nid
directly in do_shrink_slab(), this patch also helps cleanup the code.

Link: https://lkml.kernel.org/r/20210311190845.9708-1-shy828301@gmail.com
Link: https://lkml.kernel.org/r/20210311190845.9708-2-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Acked-by: Roman Gushchin <guro@fb.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/vmscan.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/mm/vmscan.c~mm-vmscan-use-nid-from-shrink_control-for-tracepoint
+++ a/mm/vmscan.c
@@ -536,7 +536,7 @@ static unsigned long do_shrink_slab(stru
 	else
 		new_nr = atomic_long_read(&shrinker->nr_deferred[nid]);
 
-	trace_mm_shrink_slab_end(shrinker, nid, freed, nr, new_nr, total_scan);
+	trace_mm_shrink_slab_end(shrinker, shrinkctl->nid, freed, nr, new_nr, total_scan);
 	return freed;
 }
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 063/143] mm: vmscan: consolidate shrinker_maps handling code
  2021-05-05  1:32 incoming Andrew Morton
                   ` (61 preceding siblings ...)
  2021-05-05  1:36 ` [patch 062/143] mm: vmscan: use nid from shrink_control for tracepoint Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 064/143] mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation Andrew Morton
                   ` (77 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
	shakeelb, shy828301, torvalds, vbabka

From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: consolidate shrinker_maps handling code

The shrinker map management is not purely memcg specific, it is at the
intersection between memory cgroup and shrinkers.  It's allocation and
assignment of a structure, and the only memcg bit is the map is being
stored in a memcg structure.  So move the shrinker_maps handling code into
vmscan.c for tighter integration with shrinker code, and remove the
"memcg_" prefix.  There is no functional change.

Link: https://lkml.kernel.org/r/20210311190845.9708-3-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/memcontrol.h |   11 +-
 mm/huge_memory.c           |    4 -
 mm/list_lru.c              |    6 -
 mm/memcontrol.c            |  130 ----------------------------------
 mm/vmscan.c                |  132 ++++++++++++++++++++++++++++++++++-
 5 files changed, 142 insertions(+), 141 deletions(-)

--- a/include/linux/memcontrol.h~mm-vmscan-consolidate-shrinker_maps-handling-code
+++ a/include/linux/memcontrol.h
@@ -1610,10 +1610,9 @@ static inline bool mem_cgroup_under_sock
 	return false;
 }
 
-extern int memcg_expand_shrinker_maps(int new_id);
-
-extern void memcg_set_shrinker_bit(struct mem_cgroup *memcg,
-				   int nid, int shrinker_id);
+int alloc_shrinker_maps(struct mem_cgroup *memcg);
+void free_shrinker_maps(struct mem_cgroup *memcg);
+void set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id);
 #else
 #define mem_cgroup_sockets_enabled 0
 static inline void mem_cgroup_sk_alloc(struct sock *sk) { };
@@ -1623,8 +1622,8 @@ static inline bool mem_cgroup_under_sock
 	return false;
 }
 
-static inline void memcg_set_shrinker_bit(struct mem_cgroup *memcg,
-					  int nid, int shrinker_id)
+static inline void set_shrinker_bit(struct mem_cgroup *memcg,
+				    int nid, int shrinker_id)
 {
 }
 #endif
--- a/mm/huge_memory.c~mm-vmscan-consolidate-shrinker_maps-handling-code
+++ a/mm/huge_memory.c
@@ -2830,8 +2830,8 @@ void deferred_split_huge_page(struct pag
 		ds_queue->split_queue_len++;
 #ifdef CONFIG_MEMCG
 		if (memcg)
-			memcg_set_shrinker_bit(memcg, page_to_nid(page),
-					       deferred_split_shrinker.id);
+			set_shrinker_bit(memcg, page_to_nid(page),
+					 deferred_split_shrinker.id);
 #endif
 	}
 	spin_unlock_irqrestore(&ds_queue->split_queue_lock, flags);
--- a/mm/list_lru.c~mm-vmscan-consolidate-shrinker_maps-handling-code
+++ a/mm/list_lru.c
@@ -125,8 +125,8 @@ bool list_lru_add(struct list_lru *lru,
 		list_add_tail(item, &l->list);
 		/* Set shrinker bit if the first element was added */
 		if (!l->nr_items++)
-			memcg_set_shrinker_bit(memcg, nid,
-					       lru_shrinker_id(lru));
+			set_shrinker_bit(memcg, nid,
+					 lru_shrinker_id(lru));
 		nlru->nr_items++;
 		spin_unlock(&nlru->lock);
 		return true;
@@ -540,7 +540,7 @@ static void memcg_drain_list_lru_node(st
 
 	if (src->nr_items) {
 		dst->nr_items += src->nr_items;
-		memcg_set_shrinker_bit(dst_memcg, nid, lru_shrinker_id(lru));
+		set_shrinker_bit(dst_memcg, nid, lru_shrinker_id(lru));
 		src->nr_items = 0;
 	}
 
--- a/mm/memcontrol.c~mm-vmscan-consolidate-shrinker_maps-handling-code
+++ a/mm/memcontrol.c
@@ -400,130 +400,6 @@ DEFINE_STATIC_KEY_FALSE(memcg_kmem_enabl
 EXPORT_SYMBOL(memcg_kmem_enabled_key);
 #endif
 
-static int memcg_shrinker_map_size;
-static DEFINE_MUTEX(memcg_shrinker_map_mutex);
-
-static void memcg_free_shrinker_map_rcu(struct rcu_head *head)
-{
-	kvfree(container_of(head, struct memcg_shrinker_map, rcu));
-}
-
-static int memcg_expand_one_shrinker_map(struct mem_cgroup *memcg,
-					 int size, int old_size)
-{
-	struct memcg_shrinker_map *new, *old;
-	struct mem_cgroup_per_node *pn;
-	int nid;
-
-	lockdep_assert_held(&memcg_shrinker_map_mutex);
-
-	for_each_node(nid) {
-		pn = memcg->nodeinfo[nid];
-		old = rcu_dereference_protected(pn->shrinker_map, true);
-		/* Not yet online memcg */
-		if (!old)
-			return 0;
-
-		new = kvmalloc_node(sizeof(*new) + size, GFP_KERNEL, nid);
-		if (!new)
-			return -ENOMEM;
-
-		/* Set all old bits, clear all new bits */
-		memset(new->map, (int)0xff, old_size);
-		memset((void *)new->map + old_size, 0, size - old_size);
-
-		rcu_assign_pointer(pn->shrinker_map, new);
-		call_rcu(&old->rcu, memcg_free_shrinker_map_rcu);
-	}
-
-	return 0;
-}
-
-static void memcg_free_shrinker_maps(struct mem_cgroup *memcg)
-{
-	struct mem_cgroup_per_node *pn;
-	struct memcg_shrinker_map *map;
-	int nid;
-
-	if (mem_cgroup_is_root(memcg))
-		return;
-
-	for_each_node(nid) {
-		pn = memcg->nodeinfo[nid];
-		map = rcu_dereference_protected(pn->shrinker_map, true);
-		kvfree(map);
-		rcu_assign_pointer(pn->shrinker_map, NULL);
-	}
-}
-
-static int memcg_alloc_shrinker_maps(struct mem_cgroup *memcg)
-{
-	struct memcg_shrinker_map *map;
-	int nid, size, ret = 0;
-
-	if (mem_cgroup_is_root(memcg))
-		return 0;
-
-	mutex_lock(&memcg_shrinker_map_mutex);
-	size = memcg_shrinker_map_size;
-	for_each_node(nid) {
-		map = kvzalloc_node(sizeof(*map) + size, GFP_KERNEL, nid);
-		if (!map) {
-			memcg_free_shrinker_maps(memcg);
-			ret = -ENOMEM;
-			break;
-		}
-		rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_map, map);
-	}
-	mutex_unlock(&memcg_shrinker_map_mutex);
-
-	return ret;
-}
-
-int memcg_expand_shrinker_maps(int new_id)
-{
-	int size, old_size, ret = 0;
-	struct mem_cgroup *memcg;
-
-	size = DIV_ROUND_UP(new_id + 1, BITS_PER_LONG) * sizeof(unsigned long);
-	old_size = memcg_shrinker_map_size;
-	if (size <= old_size)
-		return 0;
-
-	mutex_lock(&memcg_shrinker_map_mutex);
-	if (!root_mem_cgroup)
-		goto unlock;
-
-	for_each_mem_cgroup(memcg) {
-		if (mem_cgroup_is_root(memcg))
-			continue;
-		ret = memcg_expand_one_shrinker_map(memcg, size, old_size);
-		if (ret) {
-			mem_cgroup_iter_break(NULL, memcg);
-			goto unlock;
-		}
-	}
-unlock:
-	if (!ret)
-		memcg_shrinker_map_size = size;
-	mutex_unlock(&memcg_shrinker_map_mutex);
-	return ret;
-}
-
-void memcg_set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id)
-{
-	if (shrinker_id >= 0 && memcg && !mem_cgroup_is_root(memcg)) {
-		struct memcg_shrinker_map *map;
-
-		rcu_read_lock();
-		map = rcu_dereference(memcg->nodeinfo[nid]->shrinker_map);
-		/* Pairs with smp mb in shrink_slab() */
-		smp_mb__before_atomic();
-		set_bit(shrinker_id, map->map);
-		rcu_read_unlock();
-	}
-}
-
 /**
  * mem_cgroup_css_from_page - css of the memcg associated with a page
  * @page: page of interest
@@ -5242,11 +5118,11 @@ static int mem_cgroup_css_online(struct
 	struct mem_cgroup *memcg = mem_cgroup_from_css(css);
 
 	/*
-	 * A memcg must be visible for memcg_expand_shrinker_maps()
+	 * A memcg must be visible for expand_shrinker_maps()
 	 * by the time the maps are allocated. So, we allocate maps
 	 * here, when for_each_mem_cgroup() can't skip it.
 	 */
-	if (memcg_alloc_shrinker_maps(memcg)) {
+	if (alloc_shrinker_maps(memcg)) {
 		mem_cgroup_id_remove(memcg);
 		return -ENOMEM;
 	}
@@ -5310,7 +5186,7 @@ static void mem_cgroup_css_free(struct c
 	vmpressure_cleanup(&memcg->vmpressure);
 	cancel_work_sync(&memcg->high_work);
 	mem_cgroup_remove_from_trees(memcg);
-	memcg_free_shrinker_maps(memcg);
+	free_shrinker_maps(memcg);
 	memcg_free_kmem(memcg);
 	mem_cgroup_free(memcg);
 }
--- a/mm/vmscan.c~mm-vmscan-consolidate-shrinker_maps-handling-code
+++ a/mm/vmscan.c
@@ -185,6 +185,132 @@ static LIST_HEAD(shrinker_list);
 static DECLARE_RWSEM(shrinker_rwsem);
 
 #ifdef CONFIG_MEMCG
+
+static int memcg_shrinker_map_size;
+static DEFINE_MUTEX(memcg_shrinker_map_mutex);
+
+static void free_shrinker_map_rcu(struct rcu_head *head)
+{
+	kvfree(container_of(head, struct memcg_shrinker_map, rcu));
+}
+
+static int expand_one_shrinker_map(struct mem_cgroup *memcg,
+				   int size, int old_size)
+{
+	struct memcg_shrinker_map *new, *old;
+	struct mem_cgroup_per_node *pn;
+	int nid;
+
+	lockdep_assert_held(&memcg_shrinker_map_mutex);
+
+	for_each_node(nid) {
+		pn = memcg->nodeinfo[nid];
+		old = rcu_dereference_protected(pn->shrinker_map, true);
+		/* Not yet online memcg */
+		if (!old)
+			return 0;
+
+		new = kvmalloc_node(sizeof(*new) + size, GFP_KERNEL, nid);
+		if (!new)
+			return -ENOMEM;
+
+		/* Set all old bits, clear all new bits */
+		memset(new->map, (int)0xff, old_size);
+		memset((void *)new->map + old_size, 0, size - old_size);
+
+		rcu_assign_pointer(pn->shrinker_map, new);
+		call_rcu(&old->rcu, free_shrinker_map_rcu);
+	}
+
+	return 0;
+}
+
+void free_shrinker_maps(struct mem_cgroup *memcg)
+{
+	struct mem_cgroup_per_node *pn;
+	struct memcg_shrinker_map *map;
+	int nid;
+
+	if (mem_cgroup_is_root(memcg))
+		return;
+
+	for_each_node(nid) {
+		pn = memcg->nodeinfo[nid];
+		map = rcu_dereference_protected(pn->shrinker_map, true);
+		kvfree(map);
+		rcu_assign_pointer(pn->shrinker_map, NULL);
+	}
+}
+
+int alloc_shrinker_maps(struct mem_cgroup *memcg)
+{
+	struct memcg_shrinker_map *map;
+	int nid, size, ret = 0;
+
+	if (mem_cgroup_is_root(memcg))
+		return 0;
+
+	mutex_lock(&memcg_shrinker_map_mutex);
+	size = memcg_shrinker_map_size;
+	for_each_node(nid) {
+		map = kvzalloc_node(sizeof(*map) + size, GFP_KERNEL, nid);
+		if (!map) {
+			free_shrinker_maps(memcg);
+			ret = -ENOMEM;
+			break;
+		}
+		rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_map, map);
+	}
+	mutex_unlock(&memcg_shrinker_map_mutex);
+
+	return ret;
+}
+
+static int expand_shrinker_maps(int new_id)
+{
+	int size, old_size, ret = 0;
+	struct mem_cgroup *memcg;
+
+	size = DIV_ROUND_UP(new_id + 1, BITS_PER_LONG) * sizeof(unsigned long);
+	old_size = memcg_shrinker_map_size;
+	if (size <= old_size)
+		return 0;
+
+	mutex_lock(&memcg_shrinker_map_mutex);
+	if (!root_mem_cgroup)
+		goto unlock;
+
+	memcg = mem_cgroup_iter(NULL, NULL, NULL);
+	do {
+		if (mem_cgroup_is_root(memcg))
+			continue;
+		ret = expand_one_shrinker_map(memcg, size, old_size);
+		if (ret) {
+			mem_cgroup_iter_break(NULL, memcg);
+			goto unlock;
+		}
+	} while ((memcg = mem_cgroup_iter(NULL, memcg, NULL)) != NULL);
+unlock:
+	if (!ret)
+		memcg_shrinker_map_size = size;
+	mutex_unlock(&memcg_shrinker_map_mutex);
+	return ret;
+}
+
+void set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id)
+{
+	if (shrinker_id >= 0 && memcg && !mem_cgroup_is_root(memcg)) {
+		struct memcg_shrinker_map *map;
+
+		rcu_read_lock();
+		map = rcu_dereference(memcg->nodeinfo[nid]->shrinker_map);
+		/* Pairs with smp mb in shrink_slab() */
+		smp_mb__before_atomic();
+		set_bit(shrinker_id, map->map);
+		rcu_read_unlock();
+	}
+}
+
 /*
  * We allow subsystems to populate their shrinker-related
  * LRU lists before register_shrinker_prepared() is called
@@ -212,7 +338,7 @@ static int prealloc_memcg_shrinker(struc
 		goto unlock;
 
 	if (id >= shrinker_nr_max) {
-		if (memcg_expand_shrinker_maps(id)) {
+		if (expand_shrinker_maps(id)) {
 			idr_remove(&shrinker_idr, id);
 			goto unlock;
 		}
@@ -590,7 +716,7 @@ static unsigned long shrink_slab_memcg(g
 			 * case, we invoke the shrinker one more time and reset
 			 * the bit if it reports that it is not empty anymore.
 			 * The memory barrier here pairs with the barrier in
-			 * memcg_set_shrinker_bit():
+			 * set_shrinker_bit():
 			 *
 			 * list_lru_add()     shrink_slab_memcg()
 			 *   list_add_tail()    clear_bit()
@@ -602,7 +728,7 @@ static unsigned long shrink_slab_memcg(g
 			if (ret == SHRINK_EMPTY)
 				ret = 0;
 			else
-				memcg_set_shrinker_bit(memcg, nid, i);
+				set_shrinker_bit(memcg, nid, i);
 		}
 		freed += ret;
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 064/143] mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation
  2021-05-05  1:32 incoming Andrew Morton
                   ` (62 preceding siblings ...)
  2021-05-05  1:36 ` [patch 063/143] mm: vmscan: consolidate shrinker_maps handling code Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 065/143] mm: vmscan: remove memcg_shrinker_map_size Andrew Morton
                   ` (76 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
	shakeelb, shy828301, torvalds, vbabka

From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation

Since memcg_shrinker_map_size just can be changed under holding
shrinker_rwsem exclusively, the read side can be protected by holding read
lock, so it sounds superfluous to have a dedicated mutex.

Kirill Tkhai suggested use write lock since:

  * We want the assignment to shrinker_maps is visible for shrink_slab_memcg().
  * The rcu_dereference_protected() dereferrencing in shrink_slab_memcg(), but
    in case of we use READ lock in alloc_shrinker_maps(), the dereferrencing
    is not actually protected.
  * READ lock makes alloc_shrinker_info() racy against memory allocation fail.
    alloc_shrinker_info()->free_shrinker_info() may free memory right after
    shrink_slab_memcg() dereferenced it. You may say
    shrink_slab_memcg()->mem_cgroup_online() protects us from it? Yes, sure,
    but this is not the thing we want to remember in the future, since this
    spreads modularity.

And a test with heavy paging workload didn't show write lock makes things worse.

Link: https://lkml.kernel.org/r/20210311190845.9708-4-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/vmscan.c |   18 ++++++++----------
 1 file changed, 8 insertions(+), 10 deletions(-)

--- a/mm/vmscan.c~mm-vmscan-use-shrinker_rwsem-to-protect-shrinker_maps-allocation
+++ a/mm/vmscan.c
@@ -187,7 +187,6 @@ static DECLARE_RWSEM(shrinker_rwsem);
 #ifdef CONFIG_MEMCG
 
 static int memcg_shrinker_map_size;
-static DEFINE_MUTEX(memcg_shrinker_map_mutex);
 
 static void free_shrinker_map_rcu(struct rcu_head *head)
 {
@@ -201,8 +200,6 @@ static int expand_one_shrinker_map(struc
 	struct mem_cgroup_per_node *pn;
 	int nid;
 
-	lockdep_assert_held(&memcg_shrinker_map_mutex);
-
 	for_each_node(nid) {
 		pn = memcg->nodeinfo[nid];
 		old = rcu_dereference_protected(pn->shrinker_map, true);
@@ -250,7 +247,7 @@ int alloc_shrinker_maps(struct mem_cgrou
 	if (mem_cgroup_is_root(memcg))
 		return 0;
 
-	mutex_lock(&memcg_shrinker_map_mutex);
+	down_write(&shrinker_rwsem);
 	size = memcg_shrinker_map_size;
 	for_each_node(nid) {
 		map = kvzalloc_node(sizeof(*map) + size, GFP_KERNEL, nid);
@@ -261,7 +258,7 @@ int alloc_shrinker_maps(struct mem_cgrou
 		}
 		rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_map, map);
 	}
-	mutex_unlock(&memcg_shrinker_map_mutex);
+	up_write(&shrinker_rwsem);
 
 	return ret;
 }
@@ -276,9 +273,10 @@ static int expand_shrinker_maps(int new_
 	if (size <= old_size)
 		return 0;
 
-	mutex_lock(&memcg_shrinker_map_mutex);
 	if (!root_mem_cgroup)
-		goto unlock;
+		goto out;
+
+	lockdep_assert_held(&shrinker_rwsem);
 
 	memcg = mem_cgroup_iter(NULL, NULL, NULL);
 	do {
@@ -287,13 +285,13 @@ static int expand_shrinker_maps(int new_
 		ret = expand_one_shrinker_map(memcg, size, old_size);
 		if (ret) {
 			mem_cgroup_iter_break(NULL, memcg);
-			goto unlock;
+			goto out;
 		}
 	} while ((memcg = mem_cgroup_iter(NULL, memcg, NULL)) != NULL);
-unlock:
+out:
 	if (!ret)
 		memcg_shrinker_map_size = size;
-	mutex_unlock(&memcg_shrinker_map_mutex);
+
 	return ret;
 }
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 065/143] mm: vmscan: remove memcg_shrinker_map_size
  2021-05-05  1:32 incoming Andrew Morton
                   ` (63 preceding siblings ...)
  2021-05-05  1:36 ` [patch 064/143] mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 066/143] mm: vmscan: use kvfree_rcu instead of call_rcu Andrew Morton
                   ` (75 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
	shakeelb, shy828301, torvalds, vbabka

From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: remove memcg_shrinker_map_size

Both memcg_shrinker_map_size and shrinker_nr_max is maintained, but
actually the map size can be calculated via shrinker_nr_max, so it seems
unnecessary to keep both.  Remove memcg_shrinker_map_size since
shrinker_nr_max is also used by iterating the bit map.

Link: https://lkml.kernel.org/r/20210311190845.9708-5-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Roman Gushchin <guro@fb.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/vmscan.c |   20 +++++++++++---------
 1 file changed, 11 insertions(+), 9 deletions(-)

--- a/mm/vmscan.c~mm-vmscan-remove-memcg_shrinker_map_size
+++ a/mm/vmscan.c
@@ -185,8 +185,12 @@ static LIST_HEAD(shrinker_list);
 static DECLARE_RWSEM(shrinker_rwsem);
 
 #ifdef CONFIG_MEMCG
+static int shrinker_nr_max;
 
-static int memcg_shrinker_map_size;
+static inline int shrinker_map_size(int nr_items)
+{
+	return (DIV_ROUND_UP(nr_items, BITS_PER_LONG) * sizeof(unsigned long));
+}
 
 static void free_shrinker_map_rcu(struct rcu_head *head)
 {
@@ -248,7 +252,7 @@ int alloc_shrinker_maps(struct mem_cgrou
 		return 0;
 
 	down_write(&shrinker_rwsem);
-	size = memcg_shrinker_map_size;
+	size = shrinker_map_size(shrinker_nr_max);
 	for_each_node(nid) {
 		map = kvzalloc_node(sizeof(*map) + size, GFP_KERNEL, nid);
 		if (!map) {
@@ -266,12 +270,13 @@ int alloc_shrinker_maps(struct mem_cgrou
 static int expand_shrinker_maps(int new_id)
 {
 	int size, old_size, ret = 0;
+	int new_nr_max = new_id + 1;
 	struct mem_cgroup *memcg;
 
-	size = DIV_ROUND_UP(new_id + 1, BITS_PER_LONG) * sizeof(unsigned long);
-	old_size = memcg_shrinker_map_size;
+	size = shrinker_map_size(new_nr_max);
+	old_size = shrinker_map_size(shrinker_nr_max);
 	if (size <= old_size)
-		return 0;
+		goto out;
 
 	if (!root_mem_cgroup)
 		goto out;
@@ -290,7 +295,7 @@ static int expand_shrinker_maps(int new_
 	} while ((memcg = mem_cgroup_iter(NULL, memcg, NULL)) != NULL);
 out:
 	if (!ret)
-		memcg_shrinker_map_size = size;
+		shrinker_nr_max = new_nr_max;
 
 	return ret;
 }
@@ -323,7 +328,6 @@ void set_shrinker_bit(struct mem_cgroup
 #define SHRINKER_REGISTERING ((struct shrinker *)~0UL)
 
 static DEFINE_IDR(shrinker_idr);
-static int shrinker_nr_max;
 
 static int prealloc_memcg_shrinker(struct shrinker *shrinker)
 {
@@ -340,8 +344,6 @@ static int prealloc_memcg_shrinker(struc
 			idr_remove(&shrinker_idr, id);
 			goto unlock;
 		}
-
-		shrinker_nr_max = id + 1;
 	}
 	shrinker->id = id;
 	ret = 0;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 066/143] mm: vmscan: use kvfree_rcu instead of call_rcu
  2021-05-05  1:32 incoming Andrew Morton
                   ` (64 preceding siblings ...)
  2021-05-05  1:36 ` [patch 065/143] mm: vmscan: remove memcg_shrinker_map_size Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 067/143] mm: memcontrol: rename shrinker_map to shrinker_info Andrew Morton
                   ` (74 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
	shakeelb, shy828301, torvalds, vbabka

From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: use kvfree_rcu instead of call_rcu

Using kvfree_rcu() to free the old shrinker_maps instead of call_rcu(). 
We don't have to define a dedicated callback for call_rcu() anymore.

Link: https://lkml.kernel.org/r/20210311190845.9708-6-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Roman Gushchin <guro@fb.com>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/vmscan.c |    7 +------
 1 file changed, 1 insertion(+), 6 deletions(-)

--- a/mm/vmscan.c~mm-vmscan-use-kvfree_rcu-instead-of-call_rcu
+++ a/mm/vmscan.c
@@ -192,11 +192,6 @@ static inline int shrinker_map_size(int
 	return (DIV_ROUND_UP(nr_items, BITS_PER_LONG) * sizeof(unsigned long));
 }
 
-static void free_shrinker_map_rcu(struct rcu_head *head)
-{
-	kvfree(container_of(head, struct memcg_shrinker_map, rcu));
-}
-
 static int expand_one_shrinker_map(struct mem_cgroup *memcg,
 				   int size, int old_size)
 {
@@ -220,7 +215,7 @@ static int expand_one_shrinker_map(struc
 		memset((void *)new->map + old_size, 0, size - old_size);
 
 		rcu_assign_pointer(pn->shrinker_map, new);
-		call_rcu(&old->rcu, free_shrinker_map_rcu);
+		kvfree_rcu(old, rcu);
 	}
 
 	return 0;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 067/143] mm: memcontrol: rename shrinker_map to shrinker_info
  2021-05-05  1:32 incoming Andrew Morton
                   ` (65 preceding siblings ...)
  2021-05-05  1:36 ` [patch 066/143] mm: vmscan: use kvfree_rcu instead of call_rcu Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 068/143] mm: vmscan: add shrinker_info_protected() helper Andrew Morton
                   ` (73 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
	shakeelb, shy828301, torvalds, vbabka

From: Yang Shi <shy828301@gmail.com>
Subject: mm: memcontrol: rename shrinker_map to shrinker_info

The following patch is going to add nr_deferred into shrinker_map, the
change will make shrinker_map not only include map anymore, so rename it
to "memcg_shrinker_info".  And this should make the patch adding
nr_deferred cleaner and readable and make review easier.  Also remove the
"memcg_" prefix.

Link: https://lkml.kernel.org/r/20210311190845.9708-7-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/memcontrol.h |    8 ++--
 mm/memcontrol.c            |    6 +--
 mm/vmscan.c                |   58 +++++++++++++++++------------------
 3 files changed, 36 insertions(+), 36 deletions(-)

--- a/include/linux/memcontrol.h~mm-memcontrol-rename-shrinker_map-to-shrinker_info
+++ a/include/linux/memcontrol.h
@@ -117,7 +117,7 @@ struct batched_lruvec_stat {
  * Bitmap of shrinker::id corresponding to memcg-aware shrinkers,
  * which have elements charged to this memcg.
  */
-struct memcg_shrinker_map {
+struct shrinker_info {
 	struct rcu_head rcu;
 	unsigned long map[];
 };
@@ -145,7 +145,7 @@ struct mem_cgroup_per_node {
 
 	struct mem_cgroup_reclaim_iter	iter;
 
-	struct memcg_shrinker_map __rcu	*shrinker_map;
+	struct shrinker_info __rcu	*shrinker_info;
 
 	struct rb_node		tree_node;	/* RB tree node */
 	unsigned long		usage_in_excess;/* Set to the value by which */
@@ -1610,8 +1610,8 @@ static inline bool mem_cgroup_under_sock
 	return false;
 }
 
-int alloc_shrinker_maps(struct mem_cgroup *memcg);
-void free_shrinker_maps(struct mem_cgroup *memcg);
+int alloc_shrinker_info(struct mem_cgroup *memcg);
+void free_shrinker_info(struct mem_cgroup *memcg);
 void set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id);
 #else
 #define mem_cgroup_sockets_enabled 0
--- a/mm/memcontrol.c~mm-memcontrol-rename-shrinker_map-to-shrinker_info
+++ a/mm/memcontrol.c
@@ -5118,11 +5118,11 @@ static int mem_cgroup_css_online(struct
 	struct mem_cgroup *memcg = mem_cgroup_from_css(css);
 
 	/*
-	 * A memcg must be visible for expand_shrinker_maps()
+	 * A memcg must be visible for expand_shrinker_info()
 	 * by the time the maps are allocated. So, we allocate maps
 	 * here, when for_each_mem_cgroup() can't skip it.
 	 */
-	if (alloc_shrinker_maps(memcg)) {
+	if (alloc_shrinker_info(memcg)) {
 		mem_cgroup_id_remove(memcg);
 		return -ENOMEM;
 	}
@@ -5186,7 +5186,7 @@ static void mem_cgroup_css_free(struct c
 	vmpressure_cleanup(&memcg->vmpressure);
 	cancel_work_sync(&memcg->high_work);
 	mem_cgroup_remove_from_trees(memcg);
-	free_shrinker_maps(memcg);
+	free_shrinker_info(memcg);
 	memcg_free_kmem(memcg);
 	mem_cgroup_free(memcg);
 }
--- a/mm/vmscan.c~mm-memcontrol-rename-shrinker_map-to-shrinker_info
+++ a/mm/vmscan.c
@@ -192,16 +192,16 @@ static inline int shrinker_map_size(int
 	return (DIV_ROUND_UP(nr_items, BITS_PER_LONG) * sizeof(unsigned long));
 }
 
-static int expand_one_shrinker_map(struct mem_cgroup *memcg,
-				   int size, int old_size)
+static int expand_one_shrinker_info(struct mem_cgroup *memcg,
+				    int size, int old_size)
 {
-	struct memcg_shrinker_map *new, *old;
+	struct shrinker_info *new, *old;
 	struct mem_cgroup_per_node *pn;
 	int nid;
 
 	for_each_node(nid) {
 		pn = memcg->nodeinfo[nid];
-		old = rcu_dereference_protected(pn->shrinker_map, true);
+		old = rcu_dereference_protected(pn->shrinker_info, true);
 		/* Not yet online memcg */
 		if (!old)
 			return 0;
@@ -214,17 +214,17 @@ static int expand_one_shrinker_map(struc
 		memset(new->map, (int)0xff, old_size);
 		memset((void *)new->map + old_size, 0, size - old_size);
 
-		rcu_assign_pointer(pn->shrinker_map, new);
+		rcu_assign_pointer(pn->shrinker_info, new);
 		kvfree_rcu(old, rcu);
 	}
 
 	return 0;
 }
 
-void free_shrinker_maps(struct mem_cgroup *memcg)
+void free_shrinker_info(struct mem_cgroup *memcg)
 {
 	struct mem_cgroup_per_node *pn;
-	struct memcg_shrinker_map *map;
+	struct shrinker_info *info;
 	int nid;
 
 	if (mem_cgroup_is_root(memcg))
@@ -232,15 +232,15 @@ void free_shrinker_maps(struct mem_cgrou
 
 	for_each_node(nid) {
 		pn = memcg->nodeinfo[nid];
-		map = rcu_dereference_protected(pn->shrinker_map, true);
-		kvfree(map);
-		rcu_assign_pointer(pn->shrinker_map, NULL);
+		info = rcu_dereference_protected(pn->shrinker_info, true);
+		kvfree(info);
+		rcu_assign_pointer(pn->shrinker_info, NULL);
 	}
 }
 
-int alloc_shrinker_maps(struct mem_cgroup *memcg)
+int alloc_shrinker_info(struct mem_cgroup *memcg)
 {
-	struct memcg_shrinker_map *map;
+	struct shrinker_info *info;
 	int nid, size, ret = 0;
 
 	if (mem_cgroup_is_root(memcg))
@@ -249,20 +249,20 @@ int alloc_shrinker_maps(struct mem_cgrou
 	down_write(&shrinker_rwsem);
 	size = shrinker_map_size(shrinker_nr_max);
 	for_each_node(nid) {
-		map = kvzalloc_node(sizeof(*map) + size, GFP_KERNEL, nid);
-		if (!map) {
-			free_shrinker_maps(memcg);
+		info = kvzalloc_node(sizeof(*info) + size, GFP_KERNEL, nid);
+		if (!info) {
+			free_shrinker_info(memcg);
 			ret = -ENOMEM;
 			break;
 		}
-		rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_map, map);
+		rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_info, info);
 	}
 	up_write(&shrinker_rwsem);
 
 	return ret;
 }
 
-static int expand_shrinker_maps(int new_id)
+static int expand_shrinker_info(int new_id)
 {
 	int size, old_size, ret = 0;
 	int new_nr_max = new_id + 1;
@@ -282,7 +282,7 @@ static int expand_shrinker_maps(int new_
 	do {
 		if (mem_cgroup_is_root(memcg))
 			continue;
-		ret = expand_one_shrinker_map(memcg, size, old_size);
+		ret = expand_one_shrinker_info(memcg, size, old_size);
 		if (ret) {
 			mem_cgroup_iter_break(NULL, memcg);
 			goto out;
@@ -298,13 +298,13 @@ out:
 void set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id)
 {
 	if (shrinker_id >= 0 && memcg && !mem_cgroup_is_root(memcg)) {
-		struct memcg_shrinker_map *map;
+		struct shrinker_info *info;
 
 		rcu_read_lock();
-		map = rcu_dereference(memcg->nodeinfo[nid]->shrinker_map);
+		info = rcu_dereference(memcg->nodeinfo[nid]->shrinker_info);
 		/* Pairs with smp mb in shrink_slab() */
 		smp_mb__before_atomic();
-		set_bit(shrinker_id, map->map);
+		set_bit(shrinker_id, info->map);
 		rcu_read_unlock();
 	}
 }
@@ -335,7 +335,7 @@ static int prealloc_memcg_shrinker(struc
 		goto unlock;
 
 	if (id >= shrinker_nr_max) {
-		if (expand_shrinker_maps(id)) {
+		if (expand_shrinker_info(id)) {
 			idr_remove(&shrinker_idr, id);
 			goto unlock;
 		}
@@ -665,7 +665,7 @@ static unsigned long do_shrink_slab(stru
 static unsigned long shrink_slab_memcg(gfp_t gfp_mask, int nid,
 			struct mem_cgroup *memcg, int priority)
 {
-	struct memcg_shrinker_map *map;
+	struct shrinker_info *info;
 	unsigned long ret, freed = 0;
 	int i;
 
@@ -675,12 +675,12 @@ static unsigned long shrink_slab_memcg(g
 	if (!down_read_trylock(&shrinker_rwsem))
 		return 0;
 
-	map = rcu_dereference_protected(memcg->nodeinfo[nid]->shrinker_map,
-					true);
-	if (unlikely(!map))
+	info = rcu_dereference_protected(memcg->nodeinfo[nid]->shrinker_info,
+					 true);
+	if (unlikely(!info))
 		goto unlock;
 
-	for_each_set_bit(i, map->map, shrinker_nr_max) {
+	for_each_set_bit(i, info->map, shrinker_nr_max) {
 		struct shrink_control sc = {
 			.gfp_mask = gfp_mask,
 			.nid = nid,
@@ -691,7 +691,7 @@ static unsigned long shrink_slab_memcg(g
 		shrinker = idr_find(&shrinker_idr, i);
 		if (unlikely(!shrinker || shrinker == SHRINKER_REGISTERING)) {
 			if (!shrinker)
-				clear_bit(i, map->map);
+				clear_bit(i, info->map);
 			continue;
 		}
 
@@ -702,7 +702,7 @@ static unsigned long shrink_slab_memcg(g
 
 		ret = do_shrink_slab(&sc, shrinker, priority);
 		if (ret == SHRINK_EMPTY) {
-			clear_bit(i, map->map);
+			clear_bit(i, info->map);
 			/*
 			 * After the shrinker reported that it had no objects to
 			 * free, but before we cleared the corresponding bit in
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 068/143] mm: vmscan: add shrinker_info_protected() helper
  2021-05-05  1:32 incoming Andrew Morton
                   ` (66 preceding siblings ...)
  2021-05-05  1:36 ` [patch 067/143] mm: memcontrol: rename shrinker_map to shrinker_info Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 069/143] mm: vmscan: use a new flag to indicate shrinker is registered Andrew Morton
                   ` (72 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
	shakeelb, shy828301, torvalds, vbabka

From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: add shrinker_info_protected() helper

The shrinker_info is dereferenced in a couple of places via
rcu_dereference_protected with different calling conventions, for example,
using mem_cgroup_nodeinfo helper or dereferencing
memcg->nodeinfo[nid]->shrinker_info.  And the later patch will add more
dereference places.

So extract the dereference into a helper to make the code more readable. 
No functional change.

[akpm@linux-foundation.org: retain rcu_dereference_protected() in free_shrinker_info(), per Hugh]
Link: https://lkml.kernel.org/r/20210311190845.9708-8-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Roman Gushchin <guro@fb.com>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/vmscan.c |   12 +++++++++---
 1 file changed, 9 insertions(+), 3 deletions(-)

--- a/mm/vmscan.c~mm-vmscan-add-shrinker_info_protected-helper
+++ a/mm/vmscan.c
@@ -192,6 +192,13 @@ static inline int shrinker_map_size(int
 	return (DIV_ROUND_UP(nr_items, BITS_PER_LONG) * sizeof(unsigned long));
 }
 
+static struct shrinker_info *shrinker_info_protected(struct mem_cgroup *memcg,
+						     int nid)
+{
+	return rcu_dereference_protected(memcg->nodeinfo[nid]->shrinker_info,
+					 lockdep_is_held(&shrinker_rwsem));
+}
+
 static int expand_one_shrinker_info(struct mem_cgroup *memcg,
 				    int size, int old_size)
 {
@@ -201,7 +208,7 @@ static int expand_one_shrinker_info(stru
 
 	for_each_node(nid) {
 		pn = memcg->nodeinfo[nid];
-		old = rcu_dereference_protected(pn->shrinker_info, true);
+		old = shrinker_info_protected(memcg, nid);
 		/* Not yet online memcg */
 		if (!old)
 			return 0;
@@ -675,8 +682,7 @@ static unsigned long shrink_slab_memcg(g
 	if (!down_read_trylock(&shrinker_rwsem))
 		return 0;
 
-	info = rcu_dereference_protected(memcg->nodeinfo[nid]->shrinker_info,
-					 true);
+	info = shrinker_info_protected(memcg, nid);
 	if (unlikely(!info))
 		goto unlock;
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 069/143] mm: vmscan: use a new flag to indicate shrinker is registered
  2021-05-05  1:32 incoming Andrew Morton
                   ` (67 preceding siblings ...)
  2021-05-05  1:36 ` [patch 068/143] mm: vmscan: add shrinker_info_protected() helper Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 070/143] mm: vmscan: add per memcg shrinker nr_deferred Andrew Morton
                   ` (71 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
	shakeelb, shy828301, torvalds, vbabka

From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: use a new flag to indicate shrinker is registered

Currently registered shrinker is indicated by non-NULL
shrinker->nr_deferred.  This approach is fine with nr_deferred at the
shrinker level, but the following patches will move MEMCG_AWARE shrinkers'
nr_deferred to memcg level, so their shrinker->nr_deferred would always be
NULL.  This would prevent the shrinkers from unregistering correctly.

Remove SHRINKER_REGISTERING since we could check if shrinker is registered
successfully by the new flag.

Link: https://lkml.kernel.org/r/20210311190845.9708-9-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/shrinker.h |    7 +++---
 mm/vmscan.c              |   40 +++++++++++++------------------------
 2 files changed, 19 insertions(+), 28 deletions(-)

--- a/include/linux/shrinker.h~mm-vmscan-use-a-new-flag-to-indicate-shrinker-is-registered
+++ a/include/linux/shrinker.h
@@ -79,13 +79,14 @@ struct shrinker {
 #define DEFAULT_SEEKS 2 /* A good number if you don't know better. */
 
 /* Flags */
-#define SHRINKER_NUMA_AWARE	(1 << 0)
-#define SHRINKER_MEMCG_AWARE	(1 << 1)
+#define SHRINKER_REGISTERED	(1 << 0)
+#define SHRINKER_NUMA_AWARE	(1 << 1)
+#define SHRINKER_MEMCG_AWARE	(1 << 2)
 /*
  * It just makes sense when the shrinker is also MEMCG_AWARE for now,
  * non-MEMCG_AWARE shrinker should not have this flag set.
  */
-#define SHRINKER_NONSLAB	(1 << 2)
+#define SHRINKER_NONSLAB	(1 << 3)
 
 extern int prealloc_shrinker(struct shrinker *shrinker);
 extern void register_shrinker_prepared(struct shrinker *shrinker);
--- a/mm/vmscan.c~mm-vmscan-use-a-new-flag-to-indicate-shrinker-is-registered
+++ a/mm/vmscan.c
@@ -316,19 +316,6 @@ void set_shrinker_bit(struct mem_cgroup
 	}
 }
 
-/*
- * We allow subsystems to populate their shrinker-related
- * LRU lists before register_shrinker_prepared() is called
- * for the shrinker, since we don't want to impose
- * restrictions on their internal registration order.
- * In this case shrink_slab_memcg() may find corresponding
- * bit is set in the shrinkers map.
- *
- * This value is used by the function to detect registering
- * shrinkers and to skip do_shrink_slab() calls for them.
- */
-#define SHRINKER_REGISTERING ((struct shrinker *)~0UL)
-
 static DEFINE_IDR(shrinker_idr);
 
 static int prealloc_memcg_shrinker(struct shrinker *shrinker)
@@ -337,7 +324,7 @@ static int prealloc_memcg_shrinker(struc
 
 	down_write(&shrinker_rwsem);
 	/* This may call shrinker, so it must use down_read_trylock() */
-	id = idr_alloc(&shrinker_idr, SHRINKER_REGISTERING, 0, 0, GFP_KERNEL);
+	id = idr_alloc(&shrinker_idr, shrinker, 0, 0, GFP_KERNEL);
 	if (id < 0)
 		goto unlock;
 
@@ -360,9 +347,9 @@ static void unregister_memcg_shrinker(st
 
 	BUG_ON(id < 0);
 
-	down_write(&shrinker_rwsem);
+	lockdep_assert_held(&shrinker_rwsem);
+
 	idr_remove(&shrinker_idr, id);
-	up_write(&shrinker_rwsem);
 }
 
 static bool cgroup_reclaim(struct scan_control *sc)
@@ -490,8 +477,11 @@ void free_prealloced_shrinker(struct shr
 	if (!shrinker->nr_deferred)
 		return;
 
-	if (shrinker->flags & SHRINKER_MEMCG_AWARE)
+	if (shrinker->flags & SHRINKER_MEMCG_AWARE) {
+		down_write(&shrinker_rwsem);
 		unregister_memcg_shrinker(shrinker);
+		up_write(&shrinker_rwsem);
+	}
 
 	kfree(shrinker->nr_deferred);
 	shrinker->nr_deferred = NULL;
@@ -501,10 +491,7 @@ void register_shrinker_prepared(struct s
 {
 	down_write(&shrinker_rwsem);
 	list_add_tail(&shrinker->list, &shrinker_list);
-#ifdef CONFIG_MEMCG
-	if (shrinker->flags & SHRINKER_MEMCG_AWARE)
-		idr_replace(&shrinker_idr, shrinker, shrinker->id);
-#endif
+	shrinker->flags |= SHRINKER_REGISTERED;
 	up_write(&shrinker_rwsem);
 }
 
@@ -524,13 +511,16 @@ EXPORT_SYMBOL(register_shrinker);
  */
 void unregister_shrinker(struct shrinker *shrinker)
 {
-	if (!shrinker->nr_deferred)
+	if (!(shrinker->flags & SHRINKER_REGISTERED))
 		return;
-	if (shrinker->flags & SHRINKER_MEMCG_AWARE)
-		unregister_memcg_shrinker(shrinker);
+
 	down_write(&shrinker_rwsem);
 	list_del(&shrinker->list);
+	shrinker->flags &= ~SHRINKER_REGISTERED;
+	if (shrinker->flags & SHRINKER_MEMCG_AWARE)
+		unregister_memcg_shrinker(shrinker);
 	up_write(&shrinker_rwsem);
+
 	kfree(shrinker->nr_deferred);
 	shrinker->nr_deferred = NULL;
 }
@@ -695,7 +685,7 @@ static unsigned long shrink_slab_memcg(g
 		struct shrinker *shrinker;
 
 		shrinker = idr_find(&shrinker_idr, i);
-		if (unlikely(!shrinker || shrinker == SHRINKER_REGISTERING)) {
+		if (unlikely(!shrinker || !(shrinker->flags & SHRINKER_REGISTERED))) {
 			if (!shrinker)
 				clear_bit(i, info->map);
 			continue;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 070/143] mm: vmscan: add per memcg shrinker nr_deferred
  2021-05-05  1:32 incoming Andrew Morton
                   ` (68 preceding siblings ...)
  2021-05-05  1:36 ` [patch 069/143] mm: vmscan: use a new flag to indicate shrinker is registered Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 071/143] mm: vmscan: use per memcg nr_deferred of shrinker Andrew Morton
                   ` (70 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
	shakeelb, shy828301, torvalds, vbabka

From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: add per memcg shrinker nr_deferred

Currently the number of deferred objects are per shrinker, but some slabs,
for example, vfs inode/dentry cache are per memcg, this would result in
poor isolation among memcgs.

The deferred objects typically are generated by __GFP_NOFS allocations,
one memcg with excessive __GFP_NOFS allocations may blow up deferred
objects, then other innocent memcgs may suffer from over shrink, excessive
reclaim latency, etc.

For example, two workloads run in memcgA and memcgB respectively, workload
in B is vfs heavy workload.  Workload in A generates excessive deferred
objects, then B's vfs cache might be hit heavily (drop half of caches) by
B's limit reclaim or global reclaim.

We observed this hit in our production environment which was running vfs
heavy workload shown as the below tracing log:

<...>-409454 [016] .... 28286961.747146: mm_shrink_slab_start: super_cache_scan+0x0/0x1a0 ffff9a83046f3458:
nid: 1 objects to shrink 3641681686040 gfp_flags GFP_HIGHUSER_MOVABLE|__GFP_ZERO pgs_scanned 1 lru_pgs 15721
cache items 246404277 delta 31345 total_scan 123202138
<...>-409454 [022] .... 28287105.928018: mm_shrink_slab_end: super_cache_scan+0x0/0x1a0 ffff9a83046f3458:
nid: 1 unused scan count 3641681686040 new scan count 3641798379189 total_scan 602
last shrinker return val 123186855

The vfs cache and page cache ratio was 10:1 on this machine, and half of
caches were dropped.  This also resulted in significant amount of page
caches were dropped due to inodes eviction.

Make nr_deferred per memcg for memcg aware shrinkers would solve the
unfairness and bring better isolation.

The following patch will add nr_deferred to parent memcg when memcg
offline.  To preserve nr_deferred when reparenting memcgs to root, root
memcg needs shrinker_info allocated too.

When memcg is not enabled (!CONFIG_MEMCG or memcg disabled), the
shrinker's nr_deferred would be used.  And non memcg aware shrinkers use
shrinker's nr_deferred all the time.

Link: https://lkml.kernel.org/r/20210311190845.9708-10-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Roman Gushchin <guro@fb.com>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/memcontrol.h |    7 ++--
 mm/vmscan.c                |   60 ++++++++++++++++++++++++-----------
 2 files changed, 46 insertions(+), 21 deletions(-)

--- a/include/linux/memcontrol.h~mm-vmscan-add-per-memcg-shrinker-nr_deferred
+++ a/include/linux/memcontrol.h
@@ -114,12 +114,13 @@ struct batched_lruvec_stat {
 };
 
 /*
- * Bitmap of shrinker::id corresponding to memcg-aware shrinkers,
- * which have elements charged to this memcg.
+ * Bitmap and deferred work of shrinker::id corresponding to memcg-aware
+ * shrinkers, which have elements charged to this memcg.
  */
 struct shrinker_info {
 	struct rcu_head rcu;
-	unsigned long map[];
+	atomic_long_t *nr_deferred;
+	unsigned long *map;
 };
 
 /*
--- a/mm/vmscan.c~mm-vmscan-add-per-memcg-shrinker-nr_deferred
+++ a/mm/vmscan.c
@@ -187,11 +187,17 @@ static DECLARE_RWSEM(shrinker_rwsem);
 #ifdef CONFIG_MEMCG
 static int shrinker_nr_max;
 
+/* The shrinker_info is expanded in a batch of BITS_PER_LONG */
 static inline int shrinker_map_size(int nr_items)
 {
 	return (DIV_ROUND_UP(nr_items, BITS_PER_LONG) * sizeof(unsigned long));
 }
 
+static inline int shrinker_defer_size(int nr_items)
+{
+	return (round_up(nr_items, BITS_PER_LONG) * sizeof(atomic_long_t));
+}
+
 static struct shrinker_info *shrinker_info_protected(struct mem_cgroup *memcg,
 						     int nid)
 {
@@ -200,11 +206,13 @@ static struct shrinker_info *shrinker_in
 }
 
 static int expand_one_shrinker_info(struct mem_cgroup *memcg,
-				    int size, int old_size)
+				    int map_size, int defer_size,
+				    int old_map_size, int old_defer_size)
 {
 	struct shrinker_info *new, *old;
 	struct mem_cgroup_per_node *pn;
 	int nid;
+	int size = map_size + defer_size;
 
 	for_each_node(nid) {
 		pn = memcg->nodeinfo[nid];
@@ -217,9 +225,16 @@ static int expand_one_shrinker_info(stru
 		if (!new)
 			return -ENOMEM;
 
-		/* Set all old bits, clear all new bits */
-		memset(new->map, (int)0xff, old_size);
-		memset((void *)new->map + old_size, 0, size - old_size);
+		new->nr_deferred = (atomic_long_t *)(new + 1);
+		new->map = (void *)new->nr_deferred + defer_size;
+
+		/* map: set all old bits, clear all new bits */
+		memset(new->map, (int)0xff, old_map_size);
+		memset((void *)new->map + old_map_size, 0, map_size - old_map_size);
+		/* nr_deferred: copy old values, clear all new values */
+		memcpy(new->nr_deferred, old->nr_deferred, old_defer_size);
+		memset((void *)new->nr_deferred + old_defer_size, 0,
+		       defer_size - old_defer_size);
 
 		rcu_assign_pointer(pn->shrinker_info, new);
 		kvfree_rcu(old, rcu);
@@ -234,9 +249,6 @@ void free_shrinker_info(struct mem_cgrou
 	struct shrinker_info *info;
 	int nid;
 
-	if (mem_cgroup_is_root(memcg))
-		return;
-
 	for_each_node(nid) {
 		pn = memcg->nodeinfo[nid];
 		info = rcu_dereference_protected(pn->shrinker_info, true);
@@ -249,12 +261,12 @@ int alloc_shrinker_info(struct mem_cgrou
 {
 	struct shrinker_info *info;
 	int nid, size, ret = 0;
-
-	if (mem_cgroup_is_root(memcg))
-		return 0;
+	int map_size, defer_size = 0;
 
 	down_write(&shrinker_rwsem);
-	size = shrinker_map_size(shrinker_nr_max);
+	map_size = shrinker_map_size(shrinker_nr_max);
+	defer_size = shrinker_defer_size(shrinker_nr_max);
+	size = map_size + defer_size;
 	for_each_node(nid) {
 		info = kvzalloc_node(sizeof(*info) + size, GFP_KERNEL, nid);
 		if (!info) {
@@ -262,6 +274,8 @@ int alloc_shrinker_info(struct mem_cgrou
 			ret = -ENOMEM;
 			break;
 		}
+		info->nr_deferred = (atomic_long_t *)(info + 1);
+		info->map = (void *)info->nr_deferred + defer_size;
 		rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_info, info);
 	}
 	up_write(&shrinker_rwsem);
@@ -269,15 +283,21 @@ int alloc_shrinker_info(struct mem_cgrou
 	return ret;
 }
 
+static inline bool need_expand(int nr_max)
+{
+	return round_up(nr_max, BITS_PER_LONG) >
+	       round_up(shrinker_nr_max, BITS_PER_LONG);
+}
+
 static int expand_shrinker_info(int new_id)
 {
-	int size, old_size, ret = 0;
+	int ret = 0;
 	int new_nr_max = new_id + 1;
+	int map_size, defer_size = 0;
+	int old_map_size, old_defer_size = 0;
 	struct mem_cgroup *memcg;
 
-	size = shrinker_map_size(new_nr_max);
-	old_size = shrinker_map_size(shrinker_nr_max);
-	if (size <= old_size)
+	if (!need_expand(new_nr_max))
 		goto out;
 
 	if (!root_mem_cgroup)
@@ -285,11 +305,15 @@ static int expand_shrinker_info(int new_
 
 	lockdep_assert_held(&shrinker_rwsem);
 
+	map_size = shrinker_map_size(new_nr_max);
+	defer_size = shrinker_defer_size(new_nr_max);
+	old_map_size = shrinker_map_size(shrinker_nr_max);
+	old_defer_size = shrinker_defer_size(shrinker_nr_max);
+
 	memcg = mem_cgroup_iter(NULL, NULL, NULL);
 	do {
-		if (mem_cgroup_is_root(memcg))
-			continue;
-		ret = expand_one_shrinker_info(memcg, size, old_size);
+		ret = expand_one_shrinker_info(memcg, map_size, defer_size,
+					       old_map_size, old_defer_size);
 		if (ret) {
 			mem_cgroup_iter_break(NULL, memcg);
 			goto out;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 071/143] mm: vmscan: use per memcg nr_deferred of shrinker
  2021-05-05  1:32 incoming Andrew Morton
                   ` (69 preceding siblings ...)
  2021-05-05  1:36 ` [patch 070/143] mm: vmscan: add per memcg shrinker nr_deferred Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 072/143] mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers Andrew Morton
                   ` (69 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
	shakeelb, shy828301, torvalds, vbabka

From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: use per memcg nr_deferred of shrinker

Use per memcg's nr_deferred for memcg aware shrinkers.  The shrinker's
nr_deferred will be used in the following cases:

    1. Non memcg aware shrinkers
    2. !CONFIG_MEMCG
    3. memcg is disabled by boot parameter

Link: https://lkml.kernel.org/r/20210311190845.9708-11-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Roman Gushchin <guro@fb.com>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/vmscan.c |   78 ++++++++++++++++++++++++++++++++++++++++++--------
 1 file changed, 66 insertions(+), 12 deletions(-)

--- a/mm/vmscan.c~mm-vmscan-use-per-memcg-nr_deferred-of-shrinker
+++ a/mm/vmscan.c
@@ -376,6 +376,24 @@ static void unregister_memcg_shrinker(st
 	idr_remove(&shrinker_idr, id);
 }
 
+static long xchg_nr_deferred_memcg(int nid, struct shrinker *shrinker,
+				   struct mem_cgroup *memcg)
+{
+	struct shrinker_info *info;
+
+	info = shrinker_info_protected(memcg, nid);
+	return atomic_long_xchg(&info->nr_deferred[shrinker->id], 0);
+}
+
+static long add_nr_deferred_memcg(long nr, int nid, struct shrinker *shrinker,
+				  struct mem_cgroup *memcg)
+{
+	struct shrinker_info *info;
+
+	info = shrinker_info_protected(memcg, nid);
+	return atomic_long_add_return(nr, &info->nr_deferred[shrinker->id]);
+}
+
 static bool cgroup_reclaim(struct scan_control *sc)
 {
 	return sc->target_mem_cgroup;
@@ -414,6 +432,18 @@ static void unregister_memcg_shrinker(st
 {
 }
 
+static long xchg_nr_deferred_memcg(int nid, struct shrinker *shrinker,
+				   struct mem_cgroup *memcg)
+{
+	return 0;
+}
+
+static long add_nr_deferred_memcg(long nr, int nid, struct shrinker *shrinker,
+				  struct mem_cgroup *memcg)
+{
+	return 0;
+}
+
 static bool cgroup_reclaim(struct scan_control *sc)
 {
 	return false;
@@ -425,6 +455,39 @@ static bool writeback_throttling_sane(st
 }
 #endif
 
+static long xchg_nr_deferred(struct shrinker *shrinker,
+			     struct shrink_control *sc)
+{
+	int nid = sc->nid;
+
+	if (!(shrinker->flags & SHRINKER_NUMA_AWARE))
+		nid = 0;
+
+	if (sc->memcg &&
+	    (shrinker->flags & SHRINKER_MEMCG_AWARE))
+		return xchg_nr_deferred_memcg(nid, shrinker,
+					      sc->memcg);
+
+	return atomic_long_xchg(&shrinker->nr_deferred[nid], 0);
+}
+
+
+static long add_nr_deferred(long nr, struct shrinker *shrinker,
+			    struct shrink_control *sc)
+{
+	int nid = sc->nid;
+
+	if (!(shrinker->flags & SHRINKER_NUMA_AWARE))
+		nid = 0;
+
+	if (sc->memcg &&
+	    (shrinker->flags & SHRINKER_MEMCG_AWARE))
+		return add_nr_deferred_memcg(nr, nid, shrinker,
+					     sc->memcg);
+
+	return atomic_long_add_return(nr, &shrinker->nr_deferred[nid]);
+}
+
 /*
  * This misses isolated pages which are not accounted for to save counters.
  * As the data only determines if reclaim or compaction continues, it is
@@ -561,14 +624,10 @@ static unsigned long do_shrink_slab(stru
 	long freeable;
 	long nr;
 	long new_nr;
-	int nid = shrinkctl->nid;
 	long batch_size = shrinker->batch ? shrinker->batch
 					  : SHRINK_BATCH;
 	long scanned = 0, next_deferred;
 
-	if (!(shrinker->flags & SHRINKER_NUMA_AWARE))
-		nid = 0;
-
 	freeable = shrinker->count_objects(shrinker, shrinkctl);
 	if (freeable == 0 || freeable == SHRINK_EMPTY)
 		return freeable;
@@ -578,7 +637,7 @@ static unsigned long do_shrink_slab(stru
 	 * and zero it so that other concurrent shrinker invocations
 	 * don't also do this scanning work.
 	 */
-	nr = atomic_long_xchg(&shrinker->nr_deferred[nid], 0);
+	nr = xchg_nr_deferred(shrinker, shrinkctl);
 
 	total_scan = nr;
 	if (shrinker->seeks) {
@@ -669,14 +728,9 @@ static unsigned long do_shrink_slab(stru
 		next_deferred = 0;
 	/*
 	 * move the unused scan count back into the shrinker in a
-	 * manner that handles concurrent updates. If we exhausted the
-	 * scan, there is no need to do an update.
+	 * manner that handles concurrent updates.
 	 */
-	if (next_deferred > 0)
-		new_nr = atomic_long_add_return(next_deferred,
-						&shrinker->nr_deferred[nid]);
-	else
-		new_nr = atomic_long_read(&shrinker->nr_deferred[nid]);
+	new_nr = add_nr_deferred(next_deferred, shrinker, shrinkctl);
 
 	trace_mm_shrink_slab_end(shrinker, shrinkctl->nid, freed, nr, new_nr, total_scan);
 	return freed;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 072/143] mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers
  2021-05-05  1:32 incoming Andrew Morton
                   ` (70 preceding siblings ...)
  2021-05-05  1:36 ` [patch 071/143] mm: vmscan: use per memcg nr_deferred of shrinker Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 073/143] mm: memcontrol: reparent nr_deferred when memcg offline Andrew Morton
                   ` (68 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
	shakeelb, shy828301, torvalds, vbabka

From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers

Now nr_deferred is available on per memcg level for memcg aware shrinkers,
so don't need allocate shrinker->nr_deferred for such shrinkers anymore.

The prealloc_memcg_shrinker() would return -ENOSYS if !CONFIG_MEMCG or
memcg is disabled by kernel command line, then shrinker's
SHRINKER_MEMCG_AWARE flag would be cleared.  This makes the implementation
of this patch simpler.

Link: https://lkml.kernel.org/r/20210311190845.9708-12-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/vmscan.c |   31 ++++++++++++++++---------------
 1 file changed, 16 insertions(+), 15 deletions(-)

--- a/mm/vmscan.c~mm-vmscan-dont-need-allocate-shrinker-nr_deferred-for-memcg-aware-shrinkers
+++ a/mm/vmscan.c
@@ -346,6 +346,9 @@ static int prealloc_memcg_shrinker(struc
 {
 	int id, ret = -ENOMEM;
 
+	if (mem_cgroup_disabled())
+		return -ENOSYS;
+
 	down_write(&shrinker_rwsem);
 	/* This may call shrinker, so it must use down_read_trylock() */
 	id = idr_alloc(&shrinker_idr, shrinker, 0, 0, GFP_KERNEL);
@@ -425,7 +428,7 @@ static bool writeback_throttling_sane(st
 #else
 static int prealloc_memcg_shrinker(struct shrinker *shrinker)
 {
-	return 0;
+	return -ENOSYS;
 }
 
 static void unregister_memcg_shrinker(struct shrinker *shrinker)
@@ -537,8 +540,18 @@ static unsigned long lruvec_lru_size(str
  */
 int prealloc_shrinker(struct shrinker *shrinker)
 {
-	unsigned int size = sizeof(*shrinker->nr_deferred);
+	unsigned int size;
+	int err;
+
+	if (shrinker->flags & SHRINKER_MEMCG_AWARE) {
+		err = prealloc_memcg_shrinker(shrinker);
+		if (err != -ENOSYS)
+			return err;
 
+		shrinker->flags &= ~SHRINKER_MEMCG_AWARE;
+	}
+
+	size = sizeof(*shrinker->nr_deferred);
 	if (shrinker->flags & SHRINKER_NUMA_AWARE)
 		size *= nr_node_ids;
 
@@ -546,28 +559,16 @@ int prealloc_shrinker(struct shrinker *s
 	if (!shrinker->nr_deferred)
 		return -ENOMEM;
 
-	if (shrinker->flags & SHRINKER_MEMCG_AWARE) {
-		if (prealloc_memcg_shrinker(shrinker))
-			goto free_deferred;
-	}
-
 	return 0;
-
-free_deferred:
-	kfree(shrinker->nr_deferred);
-	shrinker->nr_deferred = NULL;
-	return -ENOMEM;
 }
 
 void free_prealloced_shrinker(struct shrinker *shrinker)
 {
-	if (!shrinker->nr_deferred)
-		return;
-
 	if (shrinker->flags & SHRINKER_MEMCG_AWARE) {
 		down_write(&shrinker_rwsem);
 		unregister_memcg_shrinker(shrinker);
 		up_write(&shrinker_rwsem);
+		return;
 	}
 
 	kfree(shrinker->nr_deferred);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 073/143] mm: memcontrol: reparent nr_deferred when memcg offline
  2021-05-05  1:32 incoming Andrew Morton
                   ` (71 preceding siblings ...)
  2021-05-05  1:36 ` [patch 072/143] mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 074/143] mm: vmscan: shrink deferred objects proportional to priority Andrew Morton
                   ` (67 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
	shakeelb, shy828301, torvalds, vbabka

From: Yang Shi <shy828301@gmail.com>
Subject: mm: memcontrol: reparent nr_deferred when memcg offline

Now shrinker's nr_deferred is per memcg for memcg aware shrinkers, add to
parent's corresponding nr_deferred when memcg offline.

Link: https://lkml.kernel.org/r/20210311190845.9708-13-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/memcontrol.h |    1 +
 mm/memcontrol.c            |    1 +
 mm/vmscan.c                |   24 ++++++++++++++++++++++++
 3 files changed, 26 insertions(+)

--- a/include/linux/memcontrol.h~mm-memcontrol-reparent-nr_deferred-when-memcg-offline
+++ a/include/linux/memcontrol.h
@@ -1614,6 +1614,7 @@ static inline bool mem_cgroup_under_sock
 int alloc_shrinker_info(struct mem_cgroup *memcg);
 void free_shrinker_info(struct mem_cgroup *memcg);
 void set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id);
+void reparent_shrinker_deferred(struct mem_cgroup *memcg);
 #else
 #define mem_cgroup_sockets_enabled 0
 static inline void mem_cgroup_sk_alloc(struct sock *sk) { };
--- a/mm/memcontrol.c~mm-memcontrol-reparent-nr_deferred-when-memcg-offline
+++ a/mm/memcontrol.c
@@ -5154,6 +5154,7 @@ static void mem_cgroup_css_offline(struc
 	page_counter_set_low(&memcg->memory, 0);
 
 	memcg_offline_kmem(memcg);
+	reparent_shrinker_deferred(memcg);
 	wb_memcg_offline(memcg);
 
 	drain_all_stock(memcg);
--- a/mm/vmscan.c~mm-memcontrol-reparent-nr_deferred-when-memcg-offline
+++ a/mm/vmscan.c
@@ -397,6 +397,30 @@ static long add_nr_deferred_memcg(long n
 	return atomic_long_add_return(nr, &info->nr_deferred[shrinker->id]);
 }
 
+void reparent_shrinker_deferred(struct mem_cgroup *memcg)
+{
+	int i, nid;
+	long nr;
+	struct mem_cgroup *parent;
+	struct shrinker_info *child_info, *parent_info;
+
+	parent = parent_mem_cgroup(memcg);
+	if (!parent)
+		parent = root_mem_cgroup;
+
+	/* Prevent from concurrent shrinker_info expand */
+	down_read(&shrinker_rwsem);
+	for_each_node(nid) {
+		child_info = shrinker_info_protected(memcg, nid);
+		parent_info = shrinker_info_protected(parent, nid);
+		for (i = 0; i < shrinker_nr_max; i++) {
+			nr = atomic_long_read(&child_info->nr_deferred[i]);
+			atomic_long_add(nr, &parent_info->nr_deferred[i]);
+		}
+	}
+	up_read(&shrinker_rwsem);
+}
+
 static bool cgroup_reclaim(struct scan_control *sc)
 {
 	return sc->target_mem_cgroup;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 074/143] mm: vmscan: shrink deferred objects proportional to priority
  2021-05-05  1:32 incoming Andrew Morton
                   ` (72 preceding siblings ...)
  2021-05-05  1:36 ` [patch 073/143] mm: memcontrol: reparent nr_deferred when memcg offline Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 075/143] mm/compaction: remove unused variable sysctl_compact_memory Andrew Morton
                   ` (66 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
	shakeelb, shy828301, torvalds, vbabka

From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: shrink deferred objects proportional to priority

The number of deferred objects might get windup to an absurd number, and
it results in clamp of slab objects.  It is undesirable for sustaining
workingset.

So shrink deferred objects proportional to priority and cap nr_deferred to
twice of cache items.

The idea is borrowed from Dave Chinner's patch:
https://lore.kernel.org/linux-xfs/20191031234618.15403-13-david@fromorbit.com/

Tested with kernel build and vfs metadata heavy workload in our production
environment, no regression is spotted so far.

Link: https://lkml.kernel.org/r/20210311190845.9708-14-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Kirill Tkhai <ktkhai@virtuozzo.com>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/vmscan.c |   46 +++++++++++-----------------------------------
 1 file changed, 11 insertions(+), 35 deletions(-)

--- a/mm/vmscan.c~mm-vmscan-shrink-deferred-objects-proportional-to-priority
+++ a/mm/vmscan.c
@@ -664,7 +664,6 @@ static unsigned long do_shrink_slab(stru
 	 */
 	nr = xchg_nr_deferred(shrinker, shrinkctl);
 
-	total_scan = nr;
 	if (shrinker->seeks) {
 		delta = freeable >> priority;
 		delta *= 4;
@@ -678,37 +677,9 @@ static unsigned long do_shrink_slab(stru
 		delta = freeable / 2;
 	}
 
+	total_scan = nr >> priority;
 	total_scan += delta;
-	if (total_scan < 0) {
-		pr_err("shrink_slab: %pS negative objects to delete nr=%ld\n",
-		       shrinker->scan_objects, total_scan);
-		total_scan = freeable;
-		next_deferred = nr;
-	} else
-		next_deferred = total_scan;
-
-	/*
-	 * We need to avoid excessive windup on filesystem shrinkers
-	 * due to large numbers of GFP_NOFS allocations causing the
-	 * shrinkers to return -1 all the time. This results in a large
-	 * nr being built up so when a shrink that can do some work
-	 * comes along it empties the entire cache due to nr >>>
-	 * freeable. This is bad for sustaining a working set in
-	 * memory.
-	 *
-	 * Hence only allow the shrinker to scan the entire cache when
-	 * a large delta change is calculated directly.
-	 */
-	if (delta < freeable / 4)
-		total_scan = min(total_scan, freeable / 2);
-
-	/*
-	 * Avoid risking looping forever due to too large nr value:
-	 * never try to free more than twice the estimate number of
-	 * freeable entries.
-	 */
-	if (total_scan > freeable * 2)
-		total_scan = freeable * 2;
+	total_scan = min(total_scan, (2 * freeable));
 
 	trace_mm_shrink_slab_start(shrinker, shrinkctl, nr,
 				   freeable, delta, total_scan, priority);
@@ -747,10 +718,15 @@ static unsigned long do_shrink_slab(stru
 		cond_resched();
 	}
 
-	if (next_deferred >= scanned)
-		next_deferred -= scanned;
-	else
-		next_deferred = 0;
+	/*
+	 * The deferred work is increased by any new work (delta) that wasn't
+	 * done, decreased by old deferred work that was done now.
+	 *
+	 * And it is capped to two times of the freeable items.
+	 */
+	next_deferred = max_t(long, (nr + delta - scanned), 0);
+	next_deferred = min(next_deferred, (2 * freeable));
+
 	/*
 	 * move the unused scan count back into the shrinker in a
 	 * manner that handles concurrent updates.
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 075/143] mm/compaction: remove unused variable sysctl_compact_memory
  2021-05-05  1:32 incoming Andrew Morton
                   ` (73 preceding siblings ...)
  2021-05-05  1:36 ` [patch 074/143] mm: vmscan: shrink deferred objects proportional to priority Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 076/143] mm: compaction: update the COMPACT[STALL|FAIL] events properly Andrew Morton
                   ` (65 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, linux-mm, mm-commits, pintu.ping, pintu, torvalds, vbabka

From: Pintu Kumar <pintu@codeaurora.org>
Subject: mm/compaction: remove unused variable sysctl_compact_memory

The sysctl_compact_memory is mostly unused in mm/compaction.c
It just acts as a place holder for sysctl to store .data.

But the .data itself is not needed here.
So we can get ride of this variable completely and make .data as NULL.
This will also eliminate the extern declaration from header file.
No functionality is broken or changed this way.

Link: https://lkml.kernel.org/r/1614852224-14671-1-git-send-email-pintu@codeaurora.org
Signed-off-by: Pintu Kumar <pintu@codeaurora.org>
Signed-off-by: Pintu Agarwal <pintu.ping@gmail.com>
Reviewed-by: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/compaction.h |    1 -
 kernel/sysctl.c            |    2 +-
 mm/compaction.c            |    3 ---
 3 files changed, 1 insertion(+), 5 deletions(-)

--- a/include/linux/compaction.h~mm-compaction-remove-unused-variable-sysctl_compact_memory
+++ a/include/linux/compaction.h
@@ -81,7 +81,6 @@ static inline unsigned long compact_gap(
 }
 
 #ifdef CONFIG_COMPACTION
-extern int sysctl_compact_memory;
 extern unsigned int sysctl_compaction_proactiveness;
 extern int sysctl_compaction_handler(struct ctl_table *table, int write,
 			void *buffer, size_t *length, loff_t *ppos);
--- a/kernel/sysctl.c~mm-compaction-remove-unused-variable-sysctl_compact_memory
+++ a/kernel/sysctl.c
@@ -2830,7 +2830,7 @@ static struct ctl_table vm_table[] = {
 #ifdef CONFIG_COMPACTION
 	{
 		.procname	= "compact_memory",
-		.data		= &sysctl_compact_memory,
+		.data		= NULL,
 		.maxlen		= sizeof(int),
 		.mode		= 0200,
 		.proc_handler	= sysctl_compaction_handler,
--- a/mm/compaction.c~mm-compaction-remove-unused-variable-sysctl_compact_memory
+++ a/mm/compaction.c
@@ -2692,9 +2692,6 @@ static void compact_nodes(void)
 		compact_node(nid);
 }
 
-/* The written value is actually unused, all memory is compacted */
-int sysctl_compact_memory;
-
 /*
  * Tunable for proactive compaction. It determines how
  * aggressively the kernel should compact memory in the
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 076/143] mm: compaction: update the COMPACT[STALL|FAIL] events properly
  2021-05-05  1:32 incoming Andrew Morton
                   ` (74 preceding siblings ...)
  2021-05-05  1:36 ` [patch 075/143] mm/compaction: remove unused variable sysctl_compact_memory Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 077/143] mm: disable LRU pagevec during the migration temporarily Andrew Morton
                   ` (64 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, charante, linux-mm, mm-commits, rientjes, torvalds, vbabka

From: Charan Teja Reddy <charante@codeaurora.org>
Subject: mm: compaction: update the COMPACT[STALL|FAIL] events properly

By definition, COMPACT[STALL|FAIL] events needs to be counted when there
is 'At least in one zone compaction wasn't deferred or skipped from the
direct compaction'.  And when compaction is skipped or deferred,
COMPACT_SKIPPED will be returned but it will still go and update these
compaction events which is wrong in the sense that COMPACT[STALL|FAIL] is
counted without even trying the compaction.

Correct this by skipping the counting of these events when COMPACT_SKIPPED
is returned for compaction.  This indirectly also avoid the unnecessary
try into the get_page_from_freelist() when compaction is not even tried.

There is a corner case where compaction is skipped but still count
COMPACTSTALL event, which is that IRQ came and freed the page and the same
is captured in capture_control.

Link: https://lkml.kernel.org/r/1613151184-21213-1-git-send-email-charante@codeaurora.org
Signed-off-by: Charan Teja Reddy <charante@codeaurora.org>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: David Rientjes <rientjes@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/compaction.c |    8 ++++++++
 mm/page_alloc.c |    2 ++
 2 files changed, 10 insertions(+)

--- a/mm/compaction.c~mm-compaction-update-the-compact-events-properly
+++ a/mm/compaction.c
@@ -2529,6 +2529,14 @@ static enum compact_result compact_zone_
 	 */
 	WRITE_ONCE(current->capture_control, NULL);
 	*capture = READ_ONCE(capc.page);
+	/*
+	 * Technically, it is also possible that compaction is skipped but
+	 * the page is still captured out of luck(IRQ came and freed the page).
+	 * Returning COMPACT_SUCCESS in such cases helps in properly accounting
+	 * the COMPACT[STALL|FAIL] when compaction is skipped.
+	 */
+	if (*capture)
+		ret = COMPACT_SUCCESS;
 
 	return ret;
 }
--- a/mm/page_alloc.c~mm-compaction-update-the-compact-events-properly
+++ a/mm/page_alloc.c
@@ -4204,6 +4204,8 @@ __alloc_pages_direct_compact(gfp_t gfp_m
 	memalloc_noreclaim_restore(noreclaim_flag);
 	psi_memstall_leave(&pflags);
 
+	if (*compact_result == COMPACT_SKIPPED)
+		return NULL;
 	/*
 	 * At least in one zone compaction wasn't deferred or skipped, so let's
 	 * count a compaction stall
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 077/143] mm: disable LRU pagevec during the migration temporarily
  2021-05-05  1:32 incoming Andrew Morton
                   ` (75 preceding siblings ...)
  2021-05-05  1:36 ` [patch 076/143] mm: compaction: update the COMPACT[STALL|FAIL] events properly Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:36 ` [patch 078/143] mm: replace migrate_[prep|finish] with lru_cache_[disable|enable] Andrew Morton
                   ` (63 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, cgoldswo, david, joaodias, linux-mm, mhocko, minchan,
	mm-commits, oliver.sang, surenb, torvalds, vbabka, willy

From: Minchan Kim <minchan@kernel.org>
Subject: mm: disable LRU pagevec during the migration temporarily

LRU pagevec holds refcount of pages until the pagevec are drained.  It
could prevent migration since the refcount of the page is greater than the
expection in migration logic.  To mitigate the issue, callers of
migrate_pages drains LRU pagevec via migrate_prep or lru_add_drain_all
before migrate_pages call.

However, it's not enough because pages coming into pagevec after the
draining call still could stay at the pagevec so it could keep preventing
page migration.  Since some callers of migrate_pages have retrial logic
with LRU draining, the page would migrate at next trail but it is still
fragile in that it doesn't close the fundamental race between upcoming LRU
pages into pagvec and migration so the migration failure could cause
contiguous memory allocation failure in the end.

To close the race, this patch disables lru caches(i.e, pagevec) during
ongoing migration until migrate is done.

Since it's really hard to reproduce, I measured how many times
migrate_pages retried with force mode(it is about a fallback to a sync
migration) with below debug code.

int migrate_pages(struct list_head *from, new_page_t get_new_page,
			..
			..

if (rc && reason == MR_CONTIG_RANGE && pass > 2) {
       printk(KERN_ERR, "pfn 0x%lx reason %d
", page_to_pfn(page), rc);
       dump_page(page, "fail to migrate");
}

The test was repeating android apps launching with cma allocation in
background every five seconds.  Total cma allocation count was about 500
during the testing.  With this patch, the dump_page count was reduced from
400 to 30.

The new interface is also useful for memory hotplug which currently drains
lru pcp caches after each migration failure.  This is rather suboptimal as
it has to disrupt others running during the operation.  With the new
interface the operation happens only once.  This is also in line with pcp
allocator cache which are disabled for the offlining as well.

Link: https://lkml.kernel.org/r/20210319175127.886124-1-minchan@kernel.org
Signed-off-by: Minchan Kim <minchan@kernel.org>
Reviewed-by: Chris Goldsworthy <cgoldswo@codeaurora.org>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: John Dias <joaodias@google.com>
Cc: Suren Baghdasaryan <surenb@google.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: David Hildenbrand <david@redhat.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Oliver Sang <oliver.sang@intel.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/migrate.h |    2 +
 include/linux/swap.h    |   14 ++++++++
 mm/memory_hotplug.c     |    3 +
 mm/mempolicy.c          |    4 ++
 mm/migrate.c            |   11 ++++--
 mm/page_alloc.c         |    2 +
 mm/swap.c               |   64 ++++++++++++++++++++++++++++++++------
 7 files changed, 86 insertions(+), 14 deletions(-)

--- a/include/linux/migrate.h~mm-disable-lru-pagevec-during-the-migration-temporarily
+++ a/include/linux/migrate.h
@@ -46,6 +46,7 @@ extern int isolate_movable_page(struct p
 extern void putback_movable_page(struct page *page);
 
 extern void migrate_prep(void);
+extern void migrate_finish(void);
 extern void migrate_prep_local(void);
 extern void migrate_page_states(struct page *newpage, struct page *page);
 extern void migrate_page_copy(struct page *newpage, struct page *page);
@@ -67,6 +68,7 @@ static inline int isolate_movable_page(s
 	{ return -EBUSY; }
 
 static inline int migrate_prep(void) { return -ENOSYS; }
+static inline int migrate_finish(void) { return -ENOSYS; }
 static inline int migrate_prep_local(void) { return -ENOSYS; }
 
 static inline void migrate_page_states(struct page *newpage, struct page *page)
--- a/include/linux/swap.h~mm-disable-lru-pagevec-during-the-migration-temporarily
+++ a/include/linux/swap.h
@@ -340,6 +340,20 @@ extern void lru_note_cost(struct lruvec
 extern void lru_note_cost_page(struct page *);
 extern void lru_cache_add(struct page *);
 extern void mark_page_accessed(struct page *);
+
+extern atomic_t lru_disable_count;
+
+static inline bool lru_cache_disabled(void)
+{
+	return atomic_read(&lru_disable_count);
+}
+
+static inline void lru_cache_enable(void)
+{
+	atomic_dec(&lru_disable_count);
+}
+
+extern void lru_cache_disable(void);
 extern void lru_add_drain(void);
 extern void lru_add_drain_cpu(int cpu);
 extern void lru_add_drain_cpu_zone(struct zone *zone);
--- a/mm/memory_hotplug.c~mm-disable-lru-pagevec-during-the-migration-temporarily
+++ a/mm/memory_hotplug.c
@@ -1611,6 +1611,7 @@ int __ref offline_pages(unsigned long st
 	 * in a way that pages from isolated pageblock are left on pcplists.
 	 */
 	zone_pcp_disable(zone);
+	lru_cache_disable();
 
 	/* set above range as isolated */
 	ret = start_isolate_page_range(start_pfn, end_pfn,
@@ -1642,7 +1643,6 @@ int __ref offline_pages(unsigned long st
 			}
 
 			cond_resched();
-			lru_add_drain_all();
 
 			ret = scan_movable_pages(pfn, end_pfn, &pfn);
 			if (!ret) {
@@ -1687,6 +1687,7 @@ int __ref offline_pages(unsigned long st
 	zone->nr_isolate_pageblock -= nr_pages / pageblock_nr_pages;
 	spin_unlock_irqrestore(&zone->lock, flags);
 
+	lru_cache_enable();
 	zone_pcp_enable(zone);
 
 	/* removal success */
--- a/mm/mempolicy.c~mm-disable-lru-pagevec-during-the-migration-temporarily
+++ a/mm/mempolicy.c
@@ -1208,6 +1208,8 @@ int do_migrate_pages(struct mm_struct *m
 			break;
 	}
 	mmap_read_unlock(mm);
+
+	migrate_finish();
 	if (err < 0)
 		return err;
 	return busy;
@@ -1371,6 +1373,8 @@ up_out:
 	mmap_write_unlock(mm);
 mpol_out:
 	mpol_put(new);
+	if (flags & (MPOL_MF_MOVE | MPOL_MF_MOVE_ALL))
+		migrate_finish();
 	return err;
 }
 
--- a/mm/migrate.c~mm-disable-lru-pagevec-during-the-migration-temporarily
+++ a/mm/migrate.c
@@ -66,11 +66,13 @@ void migrate_prep(void)
 {
 	/*
 	 * Clear the LRU lists so pages can be isolated.
-	 * Note that pages may be moved off the LRU after we have
-	 * drained them. Those pages will fail to migrate like other
-	 * pages that may be busy.
 	 */
-	lru_add_drain_all();
+	lru_cache_disable();
+}
+
+void migrate_finish(void)
+{
+	lru_cache_enable();
 }
 
 /* Do the necessary work of migrate_prep but not if it involves other CPUs */
@@ -1838,6 +1840,7 @@ out_flush:
 	if (err >= 0)
 		err = err1;
 out:
+	migrate_finish();
 	return err;
 }
 
--- a/mm/page_alloc.c~mm-disable-lru-pagevec-during-the-migration-temporarily
+++ a/mm/page_alloc.c
@@ -8715,6 +8715,8 @@ static int __alloc_contig_migrate_range(
 		if (ret == -ENOMEM)
 			break;
 	}
+
+	migrate_finish();
 	if (ret < 0) {
 		alloc_contig_dump_pages(&cc->migratepages);
 		putback_movable_pages(&cc->migratepages);
--- a/mm/swap.c~mm-disable-lru-pagevec-during-the-migration-temporarily
+++ a/mm/swap.c
@@ -235,6 +235,18 @@ static void pagevec_move_tail_fn(struct
 	}
 }
 
+/* return true if pagevec needs to drain */
+static bool pagevec_add_and_need_flush(struct pagevec *pvec, struct page *page)
+{
+	bool ret = false;
+
+	if (!pagevec_add(pvec, page) || PageCompound(page) ||
+			lru_cache_disabled())
+		ret = true;
+
+	return ret;
+}
+
 /*
  * Writeback is about to end against a page which has been marked for immediate
  * reclaim.  If it still appears to be reclaimable, move it to the tail of the
@@ -252,7 +264,7 @@ void rotate_reclaimable_page(struct page
 		get_page(page);
 		local_lock_irqsave(&lru_rotate.lock, flags);
 		pvec = this_cpu_ptr(&lru_rotate.pvec);
-		if (!pagevec_add(pvec, page) || PageCompound(page))
+		if (pagevec_add_and_need_flush(pvec, page))
 			pagevec_lru_move_fn(pvec, pagevec_move_tail_fn);
 		local_unlock_irqrestore(&lru_rotate.lock, flags);
 	}
@@ -343,7 +355,7 @@ static void activate_page(struct page *p
 		local_lock(&lru_pvecs.lock);
 		pvec = this_cpu_ptr(&lru_pvecs.activate_page);
 		get_page(page);
-		if (!pagevec_add(pvec, page) || PageCompound(page))
+		if (pagevec_add_and_need_flush(pvec, page))
 			pagevec_lru_move_fn(pvec, __activate_page);
 		local_unlock(&lru_pvecs.lock);
 	}
@@ -458,7 +470,7 @@ void lru_cache_add(struct page *page)
 	get_page(page);
 	local_lock(&lru_pvecs.lock);
 	pvec = this_cpu_ptr(&lru_pvecs.lru_add);
-	if (!pagevec_add(pvec, page) || PageCompound(page))
+	if (pagevec_add_and_need_flush(pvec, page))
 		__pagevec_lru_add(pvec);
 	local_unlock(&lru_pvecs.lock);
 }
@@ -654,7 +666,7 @@ void deactivate_file_page(struct page *p
 		local_lock(&lru_pvecs.lock);
 		pvec = this_cpu_ptr(&lru_pvecs.lru_deactivate_file);
 
-		if (!pagevec_add(pvec, page) || PageCompound(page))
+		if (pagevec_add_and_need_flush(pvec, page))
 			pagevec_lru_move_fn(pvec, lru_deactivate_file_fn);
 		local_unlock(&lru_pvecs.lock);
 	}
@@ -676,7 +688,7 @@ void deactivate_page(struct page *page)
 		local_lock(&lru_pvecs.lock);
 		pvec = this_cpu_ptr(&lru_pvecs.lru_deactivate);
 		get_page(page);
-		if (!pagevec_add(pvec, page) || PageCompound(page))
+		if (pagevec_add_and_need_flush(pvec, page))
 			pagevec_lru_move_fn(pvec, lru_deactivate_fn);
 		local_unlock(&lru_pvecs.lock);
 	}
@@ -698,7 +710,7 @@ void mark_page_lazyfree(struct page *pag
 		local_lock(&lru_pvecs.lock);
 		pvec = this_cpu_ptr(&lru_pvecs.lru_lazyfree);
 		get_page(page);
-		if (!pagevec_add(pvec, page) || PageCompound(page))
+		if (pagevec_add_and_need_flush(pvec, page))
 			pagevec_lru_move_fn(pvec, lru_lazyfree_fn);
 		local_unlock(&lru_pvecs.lock);
 	}
@@ -735,7 +747,7 @@ static void lru_add_drain_per_cpu(struct
  * Calling this function with cpu hotplug locks held can actually lead
  * to obscure indirect dependencies via WQ context.
  */
-void lru_add_drain_all(void)
+inline void __lru_add_drain_all(bool force_all_cpus)
 {
 	/*
 	 * lru_drain_gen - Global pages generation number
@@ -780,7 +792,7 @@ void lru_add_drain_all(void)
 	 * (C) Exit the draining operation if a newer generation, from another
 	 * lru_add_drain_all(), was already scheduled for draining. Check (A).
 	 */
-	if (unlikely(this_gen != lru_drain_gen))
+	if (unlikely(this_gen != lru_drain_gen && !force_all_cpus))
 		goto done;
 
 	/*
@@ -810,7 +822,8 @@ void lru_add_drain_all(void)
 	for_each_online_cpu(cpu) {
 		struct work_struct *work = &per_cpu(lru_add_drain_work, cpu);
 
-		if (pagevec_count(&per_cpu(lru_pvecs.lru_add, cpu)) ||
+		if (force_all_cpus ||
+		    pagevec_count(&per_cpu(lru_pvecs.lru_add, cpu)) ||
 		    data_race(pagevec_count(&per_cpu(lru_rotate.pvec, cpu))) ||
 		    pagevec_count(&per_cpu(lru_pvecs.lru_deactivate_file, cpu)) ||
 		    pagevec_count(&per_cpu(lru_pvecs.lru_deactivate, cpu)) ||
@@ -828,6 +841,11 @@ void lru_add_drain_all(void)
 done:
 	mutex_unlock(&lock);
 }
+
+void lru_add_drain_all(void)
+{
+	__lru_add_drain_all(false);
+}
 #else
 void lru_add_drain_all(void)
 {
@@ -835,6 +853,34 @@ void lru_add_drain_all(void)
 }
 #endif /* CONFIG_SMP */
 
+atomic_t lru_disable_count = ATOMIC_INIT(0);
+
+/*
+ * lru_cache_disable() needs to be called before we start compiling
+ * a list of pages to be migrated using isolate_lru_page().
+ * It drains pages on LRU cache and then disable on all cpus until
+ * lru_cache_enable is called.
+ *
+ * Must be paired with a call to lru_cache_enable().
+ */
+void lru_cache_disable(void)
+{
+	atomic_inc(&lru_disable_count);
+#ifdef CONFIG_SMP
+	/*
+	 * lru_add_drain_all in the force mode will schedule draining on
+	 * all online CPUs so any calls of lru_cache_disabled wrapped by
+	 * local_lock or preemption disabled would be ordered by that.
+	 * The atomic operation doesn't need to have stronger ordering
+	 * requirements because that is enforeced by the scheduling
+	 * guarantees.
+	 */
+	__lru_add_drain_all(true);
+#else
+	lru_add_drain();
+#endif
+}
+
 /**
  * release_pages - batched put_page()
  * @pages: array of pages to release
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 078/143] mm: replace migrate_[prep|finish] with lru_cache_[disable|enable]
  2021-05-05  1:32 incoming Andrew Morton
                   ` (76 preceding siblings ...)
  2021-05-05  1:36 ` [patch 077/143] mm: disable LRU pagevec during the migration temporarily Andrew Morton
@ 2021-05-05  1:36 ` Andrew Morton
  2021-05-05  1:37 ` [patch 079/143] mm: fs: invalidate BH LRU during page migration Andrew Morton
                   ` (62 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:36 UTC (permalink / raw)
  To: akpm, cgoldswo, david, joaodias, linux-mm, mhocko, minchan,
	mm-commits, oliver.sang, surenb, torvalds, vbabka, willy

From: Minchan Kim <minchan@kernel.org>
Subject: mm: replace migrate_[prep|finish] with lru_cache_[disable|enable]

Currently, migrate_[prep|finish] is merely a wrapper of
lru_cache_[disable|enable].  There is not much to gain from having
additional abstraction.

Use lru_cache_[disable|enable] instead of migrate_[prep|finish], which
would be more descriptive.

note: migrate_prep_local in compaction.c changed into lru_add_drain to
avoid CPU schedule cost with involving many other CPUs to keep old
behavior.

Link: https://lkml.kernel.org/r/20210319175127.886124-2-minchan@kernel.org
Signed-off-by: Minchan Kim <minchan@kernel.org>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Chris Goldsworthy <cgoldswo@codeaurora.org>
Cc: John Dias <joaodias@google.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Oliver Sang <oliver.sang@intel.com>
Cc: Suren Baghdasaryan <surenb@google.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/migrate.h |    7 -------
 mm/compaction.c         |    3 ++-
 mm/mempolicy.c          |    8 ++++----
 mm/migrate.c            |   28 ++--------------------------
 mm/page_alloc.c         |    4 ++--
 5 files changed, 10 insertions(+), 40 deletions(-)

--- a/include/linux/migrate.h~mm-replace-migrate_-with-lru_cache_
+++ a/include/linux/migrate.h
@@ -45,9 +45,6 @@ extern struct page *alloc_migration_targ
 extern int isolate_movable_page(struct page *page, isolate_mode_t mode);
 extern void putback_movable_page(struct page *page);
 
-extern void migrate_prep(void);
-extern void migrate_finish(void);
-extern void migrate_prep_local(void);
 extern void migrate_page_states(struct page *newpage, struct page *page);
 extern void migrate_page_copy(struct page *newpage, struct page *page);
 extern int migrate_huge_page_move_mapping(struct address_space *mapping,
@@ -67,10 +64,6 @@ static inline struct page *alloc_migrati
 static inline int isolate_movable_page(struct page *page, isolate_mode_t mode)
 	{ return -EBUSY; }
 
-static inline int migrate_prep(void) { return -ENOSYS; }
-static inline int migrate_finish(void) { return -ENOSYS; }
-static inline int migrate_prep_local(void) { return -ENOSYS; }
-
 static inline void migrate_page_states(struct page *newpage, struct page *page)
 {
 }
--- a/mm/compaction.c~mm-replace-migrate_-with-lru_cache_
+++ a/mm/compaction.c
@@ -2354,7 +2354,8 @@ compact_zone(struct compact_control *cc,
 	trace_mm_compaction_begin(start_pfn, cc->migrate_pfn,
 				cc->free_pfn, end_pfn, sync);
 
-	migrate_prep_local();
+	/* lru_add_drain_all could be expensive with involving other CPUs */
+	lru_add_drain();
 
 	while ((ret = compact_finished(cc)) == COMPACT_CONTINUE) {
 		int err;
--- a/mm/mempolicy.c~mm-replace-migrate_-with-lru_cache_
+++ a/mm/mempolicy.c
@@ -1124,7 +1124,7 @@ int do_migrate_pages(struct mm_struct *m
 	int err = 0;
 	nodemask_t tmp;
 
-	migrate_prep();
+	lru_cache_disable();
 
 	mmap_read_lock(mm);
 
@@ -1209,7 +1209,7 @@ int do_migrate_pages(struct mm_struct *m
 	}
 	mmap_read_unlock(mm);
 
-	migrate_finish();
+	lru_cache_enable();
 	if (err < 0)
 		return err;
 	return busy;
@@ -1325,7 +1325,7 @@ static long do_mbind(unsigned long start
 
 	if (flags & (MPOL_MF_MOVE | MPOL_MF_MOVE_ALL)) {
 
-		migrate_prep();
+		lru_cache_disable();
 	}
 	{
 		NODEMASK_SCRATCH(scratch);
@@ -1374,7 +1374,7 @@ up_out:
 mpol_out:
 	mpol_put(new);
 	if (flags & (MPOL_MF_MOVE | MPOL_MF_MOVE_ALL))
-		migrate_finish();
+		lru_cache_enable();
 	return err;
 }
 
--- a/mm/migrate.c~mm-replace-migrate_-with-lru_cache_
+++ a/mm/migrate.c
@@ -57,30 +57,6 @@
 
 #include "internal.h"
 
-/*
- * migrate_prep() needs to be called before we start compiling a list of pages
- * to be migrated using isolate_lru_page(). If scheduling work on other CPUs is
- * undesirable, use migrate_prep_local()
- */
-void migrate_prep(void)
-{
-	/*
-	 * Clear the LRU lists so pages can be isolated.
-	 */
-	lru_cache_disable();
-}
-
-void migrate_finish(void)
-{
-	lru_cache_enable();
-}
-
-/* Do the necessary work of migrate_prep but not if it involves other CPUs */
-void migrate_prep_local(void)
-{
-	lru_add_drain();
-}
-
 int isolate_movable_page(struct page *page, isolate_mode_t mode)
 {
 	struct address_space *mapping;
@@ -1771,7 +1747,7 @@ static int do_pages_move(struct mm_struc
 	int start, i;
 	int err = 0, err1;
 
-	migrate_prep();
+	lru_cache_disable();
 
 	for (i = start = 0; i < nr_pages; i++) {
 		const void __user *p;
@@ -1840,7 +1816,7 @@ out_flush:
 	if (err >= 0)
 		err = err1;
 out:
-	migrate_finish();
+	lru_cache_enable();
 	return err;
 }
 
--- a/mm/page_alloc.c~mm-replace-migrate_-with-lru_cache_
+++ a/mm/page_alloc.c
@@ -8681,7 +8681,7 @@ static int __alloc_contig_migrate_range(
 		.gfp_mask = GFP_USER | __GFP_MOVABLE | __GFP_RETRY_MAYFAIL,
 	};
 
-	migrate_prep();
+	lru_cache_disable();
 
 	while (pfn < end || !list_empty(&cc->migratepages)) {
 		if (fatal_signal_pending(current)) {
@@ -8716,7 +8716,7 @@ static int __alloc_contig_migrate_range(
 			break;
 	}
 
-	migrate_finish();
+	lru_cache_enable();
 	if (ret < 0) {
 		alloc_contig_dump_pages(&cc->migratepages);
 		putback_movable_pages(&cc->migratepages);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 079/143] mm: fs: invalidate BH LRU during page migration
  2021-05-05  1:32 incoming Andrew Morton
                   ` (77 preceding siblings ...)
  2021-05-05  1:36 ` [patch 078/143] mm: replace migrate_[prep|finish] with lru_cache_[disable|enable] Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 080/143] mm/migrate.c: make putback_movable_page() static Andrew Morton
                   ` (61 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, cgoldswo, david, joaodias, labbott, linux-mm, mhocko,
	minchan, mm-commits, oliver.sang, surenb, torvalds, vbabka, willy

From: Minchan Kim <minchan@kernel.org>
Subject: mm: fs: invalidate BH LRU during page migration

Pages containing buffer_heads that are in one of the per-CPU buffer_head
LRU caches will be pinned and thus cannot be migrated.  This can prevent
CMA allocations from succeeding, which are often used on platforms with
co-processors (such as a DSP) that can only use physically contiguous
memory.  It can also prevent memory hot-unplugging from succeeding, which
involves migrating at least MIN_MEMORY_BLOCK_SIZE bytes of memory, which
ranges from 8 MiB to 1 GiB based on the architecture in use.

Correspondingly, invalidate the BH LRU caches before a migration starts
and stop any buffer_head from being cached in the LRU caches, until
migration has finished.

Link: https://lkml.kernel.org/r/20210319175127.886124-3-minchan@kernel.org
Signed-off-by: Minchan Kim <minchan@kernel.org>
Reported-by: Chris Goldsworthy <cgoldswo@codeaurora.org>
Reported-by: Laura Abbott <labbott@kernel.org>
Tested-by: Oliver Sang <oliver.sang@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: John Dias <joaodias@google.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Suren Baghdasaryan <surenb@google.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 fs/buffer.c                 |   36 ++++++++++++++++++++++++++++------
 include/linux/buffer_head.h |    4 +++
 mm/swap.c                   |    5 +++-
 3 files changed, 38 insertions(+), 7 deletions(-)

--- a/fs/buffer.c~mm-fs-invalidate-bh-lru-during-page-migration
+++ a/fs/buffer.c
@@ -1264,6 +1264,15 @@ static void bh_lru_install(struct buffer
 	int i;
 
 	check_irqs_on();
+	/*
+	 * the refcount of buffer_head in bh_lru prevents dropping the
+	 * attached page(i.e., try_to_free_buffers) so it could cause
+	 * failing page migration.
+	 * Skip putting upcoming bh into bh_lru until migration is done.
+	 */
+	if (lru_cache_disabled())
+		return;
+
 	bh_lru_lock();
 
 	b = this_cpu_ptr(&bh_lrus);
@@ -1404,6 +1413,15 @@ __bread_gfp(struct block_device *bdev, s
 }
 EXPORT_SYMBOL(__bread_gfp);
 
+static void __invalidate_bh_lrus(struct bh_lru *b)
+{
+	int i;
+
+	for (i = 0; i < BH_LRU_SIZE; i++) {
+		brelse(b->bhs[i]);
+		b->bhs[i] = NULL;
+	}
+}
 /*
  * invalidate_bh_lrus() is called rarely - but not only at unmount.
  * This doesn't race because it runs in each cpu either in irq
@@ -1412,16 +1430,12 @@ EXPORT_SYMBOL(__bread_gfp);
 static void invalidate_bh_lru(void *arg)
 {
 	struct bh_lru *b = &get_cpu_var(bh_lrus);
-	int i;
 
-	for (i = 0; i < BH_LRU_SIZE; i++) {
-		brelse(b->bhs[i]);
-		b->bhs[i] = NULL;
-	}
+	__invalidate_bh_lrus(b);
 	put_cpu_var(bh_lrus);
 }
 
-static bool has_bh_in_lru(int cpu, void *dummy)
+bool has_bh_in_lru(int cpu, void *dummy)
 {
 	struct bh_lru *b = per_cpu_ptr(&bh_lrus, cpu);
 	int i;
@@ -1440,6 +1454,16 @@ void invalidate_bh_lrus(void)
 }
 EXPORT_SYMBOL_GPL(invalidate_bh_lrus);
 
+void invalidate_bh_lrus_cpu(int cpu)
+{
+	struct bh_lru *b;
+
+	bh_lru_lock();
+	b = per_cpu_ptr(&bh_lrus, cpu);
+	__invalidate_bh_lrus(b);
+	bh_lru_unlock();
+}
+
 void set_bh_page(struct buffer_head *bh,
 		struct page *page, unsigned long offset)
 {
--- a/include/linux/buffer_head.h~mm-fs-invalidate-bh-lru-during-page-migration
+++ a/include/linux/buffer_head.h
@@ -194,6 +194,8 @@ void __breadahead_gfp(struct block_devic
 struct buffer_head *__bread_gfp(struct block_device *,
 				sector_t block, unsigned size, gfp_t gfp);
 void invalidate_bh_lrus(void);
+void invalidate_bh_lrus_cpu(int cpu);
+bool has_bh_in_lru(int cpu, void *dummy);
 struct buffer_head *alloc_buffer_head(gfp_t gfp_flags);
 void free_buffer_head(struct buffer_head * bh);
 void unlock_buffer(struct buffer_head *bh);
@@ -406,6 +408,8 @@ static inline int inode_has_buffers(stru
 static inline void invalidate_inode_buffers(struct inode *inode) {}
 static inline int remove_inode_buffers(struct inode *inode) { return 1; }
 static inline int sync_mapping_buffers(struct address_space *mapping) { return 0; }
+static inline void invalidate_bh_lrus_cpu(int cpu) {}
+static inline bool has_bh_in_lru(int cpu, void *dummy) { return 0; }
 #define buffer_heads_over_limit 0
 
 #endif /* CONFIG_BLOCK */
--- a/mm/swap.c~mm-fs-invalidate-bh-lru-during-page-migration
+++ a/mm/swap.c
@@ -36,6 +36,7 @@
 #include <linux/hugetlb.h>
 #include <linux/page_idle.h>
 #include <linux/local_lock.h>
+#include <linux/buffer_head.h>
 
 #include "internal.h"
 
@@ -641,6 +642,7 @@ void lru_add_drain_cpu(int cpu)
 		pagevec_lru_move_fn(pvec, lru_lazyfree_fn);
 
 	activate_page_drain(cpu);
+	invalidate_bh_lrus_cpu(cpu);
 }
 
 /**
@@ -828,7 +830,8 @@ inline void __lru_add_drain_all(bool for
 		    pagevec_count(&per_cpu(lru_pvecs.lru_deactivate_file, cpu)) ||
 		    pagevec_count(&per_cpu(lru_pvecs.lru_deactivate, cpu)) ||
 		    pagevec_count(&per_cpu(lru_pvecs.lru_lazyfree, cpu)) ||
-		    need_activate_page_drain(cpu)) {
+		    need_activate_page_drain(cpu) ||
+		    has_bh_in_lru(cpu, NULL)) {
 			INIT_WORK(work, lru_add_drain_per_cpu);
 			queue_work_on(cpu, mm_percpu_wq, work);
 			__cpumask_set_cpu(cpu, &has_work);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 080/143] mm/migrate.c: make putback_movable_page() static
  2021-05-05  1:32 incoming Andrew Morton
                   ` (78 preceding siblings ...)
  2021-05-05  1:37 ` [patch 079/143] mm: fs: invalidate BH LRU during page migration Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 081/143] mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case Andrew Morton
                   ` (60 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, apopple, aquini, david, jglisse, linmiaohe, linux-mm,
	mm-commits, shy828301, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/migrate.c: make putback_movable_page() static

Patch series "Cleanup and fixup for mm/migrate.c", v3.

This series contains cleanups to remove unnecessary VM_BUG_ON_PAGE and rc
!= MIGRATEPAGE_SUCCESS check.  Also use helper function to remove some
duplicated codes.  What's more, this fixes potential deadlock in NUMA
balancing shared exec THP case and so on.  More details can be found in
the respective changelogs.


This patch (of 5):

The putback_movable_page() is just called by putback_movable_pages() and
we know the page is locked and both PageMovable() and PageIsolated() is
checked right before calling putback_movable_page().  So we make it static
and remove all the 3 VM_BUG_ON_PAGE().

Link: https://lkml.kernel.org/r/20210325131524.48181-1-linmiaohe@huawei.com
Link: https://lkml.kernel.org/r/20210325131524.48181-2-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Reviewed-by: Yang Shi <shy828301@gmail.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Rafael Aquini <aquini@redhat.com>
Cc: Alistair Popple <apopple@nvidia.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/migrate.h |    1 -
 mm/migrate.c            |    7 +------
 2 files changed, 1 insertion(+), 7 deletions(-)

--- a/include/linux/migrate.h~mm-migratec-make-putback_movable_page-static
+++ a/include/linux/migrate.h
@@ -43,7 +43,6 @@ extern int migrate_pages(struct list_hea
 		unsigned long private, enum migrate_mode mode, int reason);
 extern struct page *alloc_migration_target(struct page *page, unsigned long private);
 extern int isolate_movable_page(struct page *page, isolate_mode_t mode);
-extern void putback_movable_page(struct page *page);
 
 extern void migrate_page_states(struct page *newpage, struct page *page);
 extern void migrate_page_copy(struct page *newpage, struct page *page);
--- a/mm/migrate.c~mm-migratec-make-putback_movable_page-static
+++ a/mm/migrate.c
@@ -118,15 +118,10 @@ out:
 	return -EBUSY;
 }
 
-/* It should be called on page which is PG_movable */
-void putback_movable_page(struct page *page)
+static void putback_movable_page(struct page *page)
 {
 	struct address_space *mapping;
 
-	VM_BUG_ON_PAGE(!PageLocked(page), page);
-	VM_BUG_ON_PAGE(!PageMovable(page), page);
-	VM_BUG_ON_PAGE(!PageIsolated(page), page);
-
 	mapping = page_mapping(page);
 	mapping->a_ops->putback_page(page);
 	__ClearPageIsolated(page);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 081/143] mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case
  2021-05-05  1:32 incoming Andrew Morton
                   ` (79 preceding siblings ...)
  2021-05-05  1:37 ` [patch 080/143] mm/migrate.c: make putback_movable_page() static Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 082/143] mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page() Andrew Morton
                   ` (59 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, apopple, aquini, david, jglisse, linmiaohe, linux-mm,
	mm-commits, shy828301, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case

It's guaranteed that in the 'else' case of the rc == MIGRATEPAGE_SUCCESS
check, rc does not equal to MIGRATEPAGE_SUCCESS.  Remove this unnecessary
check.

Link: https://lkml.kernel.org/r/20210325131524.48181-3-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Reviewed-by: Yang Shi <shy828301@gmail.com>
Cc: Alistair Popple <apopple@nvidia.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Rafael Aquini <aquini@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/migrate.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/mm/migrate.c~mm-migratec-remove-unnecessary-rc-=-migratepage_success-check-in-else-case
+++ a/mm/migrate.c
@@ -1348,7 +1348,7 @@ out_unlock:
 out:
 	if (rc == MIGRATEPAGE_SUCCESS)
 		putback_active_hugepage(hpage);
-	else if (rc != -EAGAIN && rc != MIGRATEPAGE_SUCCESS)
+	else if (rc != -EAGAIN)
 		list_move_tail(&hpage->lru, ret);
 
 	/*
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 082/143] mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (80 preceding siblings ...)
  2021-05-05  1:37 ` [patch 081/143] mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 083/143] mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole() Andrew Morton
                   ` (58 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, apopple, aquini, david, jglisse, linmiaohe, linux-mm,
	mm-commits, shy828301, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page()

If the zone device page does not belong to un-addressable device memory,
the variable entry will be uninitialized and lead to indeterminate pte
entry ultimately.  Fix this unexpected case and warn about it.

Link: https://lkml.kernel.org/r/20210325131524.48181-4-linmiaohe@huawei.com
Fixes: df6ad69838fc ("mm/device-public-memory: device memory cache coherent with CPU")
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Alistair Popple <apopple@nvidia.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Rafael Aquini <aquini@redhat.com>
Cc: Yang Shi <shy828301@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/migrate.c |    7 +++++++
 1 file changed, 7 insertions(+)

--- a/mm/migrate.c~mm-migratec-fix-potential-indeterminate-pte-entry-in-migrate_vma_insert_page
+++ a/mm/migrate.c
@@ -2947,6 +2947,13 @@ static void migrate_vma_insert_page(stru
 
 			swp_entry = make_device_private_entry(page, vma->vm_flags & VM_WRITE);
 			entry = swp_entry_to_pte(swp_entry);
+		} else {
+			/*
+			 * For now we only support migrating to un-addressable
+			 * device memory.
+			 */
+			pr_warn_once("Unsupported ZONE_DEVICE page type.\n");
+			goto abort;
 		}
 	} else {
 		entry = mk_pte(page, vma->vm_page_prot);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 083/143] mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (81 preceding siblings ...)
  2021-05-05  1:37 ` [patch 082/143] mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page() Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 084/143] Revert "mm: migrate: skip shared exec THP for NUMA balancing" Andrew Morton
                   ` (57 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, apopple, aquini, david, jglisse, linmiaohe, linux-mm,
	mm-commits, shy828301, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole()

It's more recommended to use helper function migrate_vma_collect_skip() to
skip the unexpected case and it also helps remove some duplicated codes. 
Move migrate_vma_collect_skip() above migrate_vma_collect_hole() to avoid
compiler warning.

Link: https://lkml.kernel.org/r/20210325131524.48181-5-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Alistair Popple <apopple@nvidia.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Rafael Aquini <aquini@redhat.com>
Cc: Yang Shi <shy828301@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/migrate.c |   28 +++++++++++-----------------
 1 file changed, 11 insertions(+), 17 deletions(-)

--- a/mm/migrate.c~mm-migratec-use-helper-migrate_vma_collect_skip-in-migrate_vma_collect_hole
+++ a/mm/migrate.c
@@ -2290,44 +2290,38 @@ out:
 #endif /* CONFIG_NUMA */
 
 #ifdef CONFIG_DEVICE_PRIVATE
-static int migrate_vma_collect_hole(unsigned long start,
+static int migrate_vma_collect_skip(unsigned long start,
 				    unsigned long end,
-				    __always_unused int depth,
 				    struct mm_walk *walk)
 {
 	struct migrate_vma *migrate = walk->private;
 	unsigned long addr;
 
-	/* Only allow populating anonymous memory. */
-	if (!vma_is_anonymous(walk->vma)) {
-		for (addr = start; addr < end; addr += PAGE_SIZE) {
-			migrate->src[migrate->npages] = 0;
-			migrate->dst[migrate->npages] = 0;
-			migrate->npages++;
-		}
-		return 0;
-	}
-
 	for (addr = start; addr < end; addr += PAGE_SIZE) {
-		migrate->src[migrate->npages] = MIGRATE_PFN_MIGRATE;
 		migrate->dst[migrate->npages] = 0;
-		migrate->npages++;
-		migrate->cpages++;
+		migrate->src[migrate->npages++] = 0;
 	}
 
 	return 0;
 }
 
-static int migrate_vma_collect_skip(unsigned long start,
+static int migrate_vma_collect_hole(unsigned long start,
 				    unsigned long end,
+				    __always_unused int depth,
 				    struct mm_walk *walk)
 {
 	struct migrate_vma *migrate = walk->private;
 	unsigned long addr;
 
+	/* Only allow populating anonymous memory. */
+	if (!vma_is_anonymous(walk->vma))
+		return migrate_vma_collect_skip(start, end, walk);
+
 	for (addr = start; addr < end; addr += PAGE_SIZE) {
+		migrate->src[migrate->npages] = MIGRATE_PFN_MIGRATE;
 		migrate->dst[migrate->npages] = 0;
-		migrate->src[migrate->npages++] = 0;
+		migrate->npages++;
+		migrate->cpages++;
 	}
 
 	return 0;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 084/143] Revert "mm: migrate: skip shared exec THP for NUMA balancing"
  2021-05-05  1:32 incoming Andrew Morton
                   ` (82 preceding siblings ...)
  2021-05-05  1:37 ` [patch 083/143] mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole() Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 085/143] mm: vmstat: add cma statistics Andrew Morton
                   ` (56 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, apopple, aquini, david, jglisse, linmiaohe, linux-mm,
	mm-commits, shy828301, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: Revert "mm: migrate: skip shared exec THP for NUMA balancing"

This reverts commit c77c5cbafe549eb330e8909861a3e16cbda2c848.

Since commit c77c5cbafe54 ("mm: migrate: skip shared exec THP for NUMA
balancing"), the NUMA balancing would skip shared exec transhuge page. 
But this enhancement is not suitable for transhuge page.  Because it's
required that page_mapcount() must be 1 due to no migration pte dance is
done here.  On the other hand, the shared exec transhuge page will leave
the migrate_misplaced_page() with pte entry untouched and page locked. 
Thus pagefault for NUMA will be triggered again and deadlock occurs when
we start waiting for the page lock held by ourselves.

Yang Shi said:

 "Thanks for catching this. By relooking the code I think the other
  important reason for removing this is
  migrate_misplaced_transhuge_page() actually can't see shared exec
  file THP at all since page_lock_anon_vma_read() is called before
  and if page is not anonymous page it will just restore the PMD
  without migrating anything.
  The pages for private mapped file vma may be anonymous pages due to
  COW but they can't be THP so it won't trigger THP numa fault at all. I
  think this is why no bug was reported. I overlooked this in the first
  place."

Link: https://lkml.kernel.org/r/20210325131524.48181-6-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Yang Shi <shy828301@gmail.com>
Cc: Alistair Popple <apopple@nvidia.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Rafael Aquini <aquini@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/migrate.c |   18 ++----------------
 1 file changed, 2 insertions(+), 16 deletions(-)

--- a/mm/migrate.c~revert-mm-migrate-skip-shared-exec-thp-for-numa-balancing
+++ a/mm/migrate.c
@@ -2084,17 +2084,6 @@ bool pmd_trans_migrating(pmd_t pmd)
 	return PageLocked(page);
 }
 
-static inline bool is_shared_exec_page(struct vm_area_struct *vma,
-				       struct page *page)
-{
-	if (page_mapcount(page) != 1 &&
-	    (page_is_file_lru(page) || vma_is_shmem(vma)) &&
-	    (vma->vm_flags & VM_EXEC))
-		return true;
-
-	return false;
-}
-
 /*
  * Attempt to migrate a misplaced page to the specified destination
  * node. Caller is expected to have an elevated reference count on
@@ -2112,7 +2101,8 @@ int migrate_misplaced_page(struct page *
 	 * Don't migrate file pages that are mapped in multiple processes
 	 * with execute permissions as they are probably shared libraries.
 	 */
-	if (is_shared_exec_page(vma, page))
+	if (page_mapcount(page) != 1 && page_is_file_lru(page) &&
+	    (vma->vm_flags & VM_EXEC))
 		goto out;
 
 	/*
@@ -2167,9 +2157,6 @@ int migrate_misplaced_transhuge_page(str
 	int page_lru = page_is_file_lru(page);
 	unsigned long start = address & HPAGE_PMD_MASK;
 
-	if (is_shared_exec_page(vma, page))
-		goto out;
-
 	new_page = alloc_pages_node(node,
 		(GFP_TRANSHUGE_LIGHT | __GFP_THISNODE),
 		HPAGE_PMD_ORDER);
@@ -2281,7 +2268,6 @@ out_fail:
 
 out_unlock:
 	unlock_page(page);
-out:
 	put_page(page);
 	return 0;
 }
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 085/143] mm: vmstat: add cma statistics
  2021-05-05  1:32 incoming Andrew Morton
                   ` (83 preceding siblings ...)
  2021-05-05  1:37 ` [patch 084/143] Revert "mm: migrate: skip shared exec THP for NUMA balancing" Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 086/143] mm: cma: use pr_err_ratelimited for CMA warning Andrew Morton
                   ` (55 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, jhubbard, joaodias, linux-mm, minchan, mm-commits, surenb,
	torvalds

From: Minchan Kim <minchan@kernel.org>
Subject: mm: vmstat: add cma statistics

Since CMA is used more widely, it's worth to have CMA allocation
statistics into vmstat.  With it, we could know how agressively system
uses cma allocation and how often it fails.

Link: https://lkml.kernel.org/r/20210302183346.3707237-1-minchan@kernel.org
Signed-off-by: Minchan Kim <minchan@kernel.org>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Cc: John Dias <joaodias@google.com>
Cc: Suren Baghdasaryan <surenb@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/vm_event_item.h |    4 ++++
 mm/cma.c                      |   12 +++++++++---
 mm/vmstat.c                   |    4 ++++
 3 files changed, 17 insertions(+), 3 deletions(-)

--- a/include/linux/vm_event_item.h~mm-vmstat-add-cma-statistics
+++ a/include/linux/vm_event_item.h
@@ -71,6 +71,10 @@ enum vm_event_item { PGPGIN, PGPGOUT, PS
 #ifdef CONFIG_HUGETLB_PAGE
 		HTLB_BUDDY_PGALLOC, HTLB_BUDDY_PGALLOC_FAIL,
 #endif
+#ifdef CONFIG_CMA
+		CMA_ALLOC_SUCCESS,
+		CMA_ALLOC_FAIL,
+#endif
 		UNEVICTABLE_PGCULLED,	/* culled to noreclaim list */
 		UNEVICTABLE_PGSCANNED,	/* scanned for reclaimability */
 		UNEVICTABLE_PGRESCUED,	/* rescued from noreclaim list */
--- a/mm/cma.c~mm-vmstat-add-cma-statistics
+++ a/mm/cma.c
@@ -435,13 +435,13 @@ struct page *cma_alloc(struct cma *cma,
 	int ret = -ENOMEM;
 
 	if (!cma || !cma->count || !cma->bitmap)
-		return NULL;
+		goto out;
 
 	pr_debug("%s(cma %p, count %zu, align %d)\n", __func__, (void *)cma,
 		 count, align);
 
 	if (!count)
-		return NULL;
+		goto out;
 
 	mask = cma_bitmap_aligned_mask(cma, align);
 	offset = cma_bitmap_aligned_offset(cma, align);
@@ -449,7 +449,7 @@ struct page *cma_alloc(struct cma *cma,
 	bitmap_count = cma_bitmap_pages_to_bits(cma, count);
 
 	if (bitmap_count > bitmap_maxno)
-		return NULL;
+		goto out;
 
 	for (;;) {
 		spin_lock_irq(&cma->lock);
@@ -506,6 +506,12 @@ struct page *cma_alloc(struct cma *cma,
 	}
 
 	pr_debug("%s(): returned %p\n", __func__, page);
+out:
+	if (page)
+		count_vm_event(CMA_ALLOC_SUCCESS);
+	else
+		count_vm_event(CMA_ALLOC_FAIL);
+
 	return page;
 }
 
--- a/mm/vmstat.c~mm-vmstat-add-cma-statistics
+++ a/mm/vmstat.c
@@ -1313,6 +1313,10 @@ const char * const vmstat_text[] = {
 	"htlb_buddy_alloc_success",
 	"htlb_buddy_alloc_fail",
 #endif
+#ifdef CONFIG_CMA
+	"cma_alloc_success",
+	"cma_alloc_fail",
+#endif
 	"unevictable_pgs_culled",
 	"unevictable_pgs_scanned",
 	"unevictable_pgs_rescued",
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 086/143] mm: cma: use pr_err_ratelimited for CMA warning
  2021-05-05  1:32 incoming Andrew Morton
                   ` (84 preceding siblings ...)
  2021-05-05  1:37 ` [patch 085/143] mm: vmstat: add cma statistics Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 087/143] mm: cma: add trace events for CMA alloc perf testing Andrew Morton
                   ` (54 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, baolin.wang, david, linux-mm, minchan, mm-commits, torvalds

From: Baolin Wang <baolin.wang@linux.alibaba.com>
Subject: mm: cma: use pr_err_ratelimited for CMA warning

If we did not reserve extra CMA memory, the log buffer can be easily
filled up by CMA failure warning when the devices calling
dmam_alloc_coherent() to alloc DMA memory.  Thus we can use
pr_err_ratelimited() instead to reduce the duplicate CMA warning.

Link: https://lkml.kernel.org/r/ce2251ef49e1727a9a40531d1996660b05462bd2.1615279825.git.baolin.wang@linux.alibaba.com
Signed-off-by: Baolin Wang <baolin.wang@linux.alibaba.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Minchan Kim <minchan@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/cma.c |    4 ++--
 1 file changed, 2 insertions(+), 2 deletions(-)

--- a/mm/cma.c~mm-cma-use-pr_err_ratelimited-for-cma-warning
+++ a/mm/cma.c
@@ -500,8 +500,8 @@ struct page *cma_alloc(struct cma *cma,
 	}
 
 	if (ret && !no_warn) {
-		pr_err("%s: %s: alloc failed, req-size: %zu pages, ret: %d\n",
-		       __func__, cma->name, count, ret);
+		pr_err_ratelimited("%s: %s: alloc failed, req-size: %zu pages, ret: %d\n",
+				   __func__, cma->name, count, ret);
 		cma_debug_show_areas(cma);
 	}
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 087/143] mm: cma: add trace events for CMA alloc perf testing
  2021-05-05  1:32 incoming Andrew Morton
                   ` (85 preceding siblings ...)
  2021-05-05  1:37 ` [patch 086/143] mm: cma: use pr_err_ratelimited for CMA warning Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 088/143] mm: cma: support sysfs Andrew Morton
                   ` (53 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, georgi.djakov, linux-mm, lmark, minchan, mm-commits,
	torvalds

From: Liam Mark <lmark@codeaurora.org>
Subject: mm: cma: add trace events for CMA alloc perf testing

Add cma and migrate trace events to enable CMA allocation performance to
be measured via ftrace.

[georgi.djakov@linaro.org: add the CMA instance name to the cma_alloc_start trace event]
  Link: https://lkml.kernel.org/r/20210326155414.25006-1-georgi.djakov@linaro.org
Link: https://lkml.kernel.org/r/20210324160740.15901-1-georgi.djakov@linaro.org
Signed-off-by: Liam Mark <lmark@codeaurora.org>
Signed-off-by: Georgi Djakov <georgi.djakov@linaro.org>
Acked-by: Minchan Kim <minchan@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/trace/events/cma.h     |   42 ++++++++++++++++++++++++++++++-
 include/trace/events/migrate.h |   22 ++++++++++++++++
 mm/cma.c                       |    4 ++
 mm/migrate.c                   |    2 +
 4 files changed, 69 insertions(+), 1 deletion(-)

--- a/include/trace/events/cma.h~mm-cma-add-trace-events-for-cma-alloc-perf-testing
+++ a/include/trace/events/cma.h
@@ -8,7 +8,7 @@
 #include <linux/types.h>
 #include <linux/tracepoint.h>
 
-TRACE_EVENT(cma_alloc,
+DECLARE_EVENT_CLASS(cma_alloc_class,
 
 	TP_PROTO(unsigned long pfn, const struct page *page,
 		 unsigned int count, unsigned int align),
@@ -61,6 +61,46 @@ TRACE_EVENT(cma_release,
 		  __entry->count)
 );
 
+TRACE_EVENT(cma_alloc_start,
+
+	TP_PROTO(const char *name, unsigned int count, unsigned int align),
+
+	TP_ARGS(name, count, align),
+
+	TP_STRUCT__entry(
+		__string(name, name)
+		__field(unsigned int, count)
+		__field(unsigned int, align)
+	),
+
+	TP_fast_assign(
+		__assign_str(name, name);
+		__entry->count = count;
+		__entry->align = align;
+	),
+
+	TP_printk("name=%s count=%u align=%u",
+		  __get_str(name),
+		  __entry->count,
+		  __entry->align)
+);
+
+DEFINE_EVENT(cma_alloc_class, cma_alloc,
+
+	TP_PROTO(unsigned long pfn, const struct page *page,
+		 unsigned int count, unsigned int align),
+
+	TP_ARGS(pfn, page, count, align)
+);
+
+DEFINE_EVENT(cma_alloc_class, cma_alloc_busy_retry,
+
+	TP_PROTO(unsigned long pfn, const struct page *page,
+		 unsigned int count, unsigned int align),
+
+	TP_ARGS(pfn, page, count, align)
+);
+
 #endif /* _TRACE_CMA_H */
 
 /* This part must be outside protection */
--- a/include/trace/events/migrate.h~mm-cma-add-trace-events-for-cma-alloc-perf-testing
+++ a/include/trace/events/migrate.h
@@ -81,6 +81,28 @@ TRACE_EVENT(mm_migrate_pages,
 		__print_symbolic(__entry->mode, MIGRATE_MODE),
 		__print_symbolic(__entry->reason, MIGRATE_REASON))
 );
+
+TRACE_EVENT(mm_migrate_pages_start,
+
+	TP_PROTO(enum migrate_mode mode, int reason),
+
+	TP_ARGS(mode, reason),
+
+	TP_STRUCT__entry(
+		__field(enum migrate_mode, mode)
+		__field(int, reason)
+	),
+
+	TP_fast_assign(
+		__entry->mode	= mode;
+		__entry->reason	= reason;
+	),
+
+	TP_printk("mode=%s reason=%s",
+		  __print_symbolic(__entry->mode, MIGRATE_MODE),
+		  __print_symbolic(__entry->reason, MIGRATE_REASON))
+);
+
 #endif /* _TRACE_MIGRATE_H */
 
 /* This part must be outside protection */
--- a/mm/cma.c~mm-cma-add-trace-events-for-cma-alloc-perf-testing
+++ a/mm/cma.c
@@ -443,6 +443,8 @@ struct page *cma_alloc(struct cma *cma,
 	if (!count)
 		goto out;
 
+	trace_cma_alloc_start(cma->name, count, align);
+
 	mask = cma_bitmap_aligned_mask(cma, align);
 	offset = cma_bitmap_aligned_offset(cma, align);
 	bitmap_maxno = cma_bitmap_maxno(cma);
@@ -483,6 +485,8 @@ struct page *cma_alloc(struct cma *cma,
 
 		pr_debug("%s(): memory range at %p is busy, retrying\n",
 			 __func__, pfn_to_page(pfn));
+
+		trace_cma_alloc_busy_retry(pfn, pfn_to_page(pfn), count, align);
 		/* try again with a bit different memory target */
 		start = bitmap_no + mask + 1;
 	}
--- a/mm/migrate.c~mm-cma-add-trace-events-for-cma-alloc-perf-testing
+++ a/mm/migrate.c
@@ -1418,6 +1418,8 @@ int migrate_pages(struct list_head *from
 	int rc, nr_subpages;
 	LIST_HEAD(ret_pages);
 
+	trace_mm_migrate_pages_start(mode, reason);
+
 	if (!swapwrite)
 		current->flags |= PF_SWAPWRITE;
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 088/143] mm: cma: support sysfs
  2021-05-05  1:32 incoming Andrew Morton
                   ` (86 preceding siblings ...)
  2021-05-05  1:37 ` [patch 087/143] mm: cma: add trace events for CMA alloc perf testing Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 089/143] mm: cma: add the CMA instance name to cma trace events Andrew Morton
                   ` (52 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, anders.roxell, colin.king, digetx, gregkh, jhubbard,
	joaodias, linux-mm, minchan, mm-commits, surenb, torvalds, willy

From: Minchan Kim <minchan@kernel.org>
Subject: mm: cma: support sysfs

Since CMA is getting used more widely, it's more important to keep
monitoring CMA statistics for system health since it's directly related to
user experience.

This patch introduces sysfs statistics for CMA, in order to provide some
basic monitoring of the CMA allocator.

 * the number of CMA page successful allocations
 * the number of CMA page allocation failures

These two values allow the user to calcuate the allocation
failure rate for each CMA area.

e.g.)
  /sys/kernel/mm/cma/WIFI/alloc_pages_[success|fail]
  /sys/kernel/mm/cma/SENSOR/alloc_pages_[success|fail]
  /sys/kernel/mm/cma/BLUETOOTH/alloc_pages_[success|fail]

The cma_stat was intentionally allocated by dynamic allocation
to harmonize with kobject lifetime management.
https://lore.kernel.org/linux-mm/YCOAmXqt6dZkCQYs@kroah.com/

Link: https://lkml.kernel.org/r/20210324230759.2213957-1-minchan@kernel.org
Link: https://lore.kernel.org/linux-mm/20210316100433.17665-1-colin.king@canonical.com/
Signed-off-by: Minchan Kim <minchan@kernel.org>
Signed-off-by: Colin Ian King <colin.king@canonical.com>

Tested-by: Dmitry Osipenko <digetx@gmail.com>
Reviewed-by: Dmitry Osipenko <digetx@gmail.com>
Reviewed-by: Greg Kroah-Hartman <gregkh@linuxfoundation.org>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Tested-by: Anders Roxell <anders.roxell@linaro.org>
Cc: Suren Baghdasaryan <surenb@google.com>
Cc: John Dias <joaodias@google.com>
Cc: Matthew Wilcox (Oracle) <willy@infradead.org>
Cc: Colin Ian King <colin.king@canonical.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 Documentation/ABI/testing/sysfs-kernel-mm-cma |   25 +++
 mm/Kconfig                                    |    7 +
 mm/Makefile                                   |    1 
 mm/cma.c                                      |    8 -
 mm/cma.h                                      |   23 +++
 mm/cma_sysfs.c                                |  112 ++++++++++++++++
 6 files changed, 174 insertions(+), 2 deletions(-)

--- /dev/null
+++ a/Documentation/ABI/testing/sysfs-kernel-mm-cma
@@ -0,0 +1,25 @@
+What:		/sys/kernel/mm/cma/
+Date:		Feb 2021
+Contact:	Minchan Kim <minchan@kernel.org>
+Description:
+		/sys/kernel/mm/cma/ contains a subdirectory for each CMA
+		heap name (also sometimes called CMA areas).
+
+		Each CMA heap subdirectory (that is, each
+		/sys/kernel/mm/cma/<cma-heap-name> directory) contains the
+		following items:
+
+			alloc_pages_success
+			alloc_pages_fail
+
+What:		/sys/kernel/mm/cma/<cma-heap-name>/alloc_pages_success
+Date:		Feb 2021
+Contact:	Minchan Kim <minchan@kernel.org>
+Description:
+		the number of pages CMA API succeeded to allocate
+
+What:		/sys/kernel/mm/cma/<cma-heap-name>/alloc_pages_fail
+Date:		Feb 2021
+Contact:	Minchan Kim <minchan@kernel.org>
+Description:
+		the number of pages CMA API failed to allocate
--- a/mm/cma.c~mm-cma-support-sysfs
+++ a/mm/cma.c
@@ -511,10 +511,14 @@ struct page *cma_alloc(struct cma *cma,
 
 	pr_debug("%s(): returned %p\n", __func__, page);
 out:
-	if (page)
+	if (page) {
 		count_vm_event(CMA_ALLOC_SUCCESS);
-	else
+		cma_sysfs_account_success_pages(cma, count);
+	} else {
 		count_vm_event(CMA_ALLOC_FAIL);
+		if (cma)
+			cma_sysfs_account_fail_pages(cma, count);
+	}
 
 	return page;
 }
--- a/mm/cma.h~mm-cma-support-sysfs
+++ a/mm/cma.h
@@ -3,6 +3,12 @@
 #define __MM_CMA_H__
 
 #include <linux/debugfs.h>
+#include <linux/kobject.h>
+
+struct cma_kobject {
+	struct kobject kobj;
+	struct cma *cma;
+};
 
 struct cma {
 	unsigned long   base_pfn;
@@ -16,6 +22,14 @@ struct cma {
 	struct debugfs_u32_array dfs_bitmap;
 #endif
 	char name[CMA_MAX_NAME];
+#ifdef CONFIG_CMA_SYSFS
+	/* the number of CMA page successful allocations */
+	atomic64_t nr_pages_succeeded;
+	/* the number of CMA page allocation failures */
+	atomic64_t nr_pages_failed;
+	/* kobject requires dynamic object */
+	struct cma_kobject *cma_kobj;
+#endif
 };
 
 extern struct cma cma_areas[MAX_CMA_AREAS];
@@ -26,4 +40,13 @@ static inline unsigned long cma_bitmap_m
 	return cma->count >> cma->order_per_bit;
 }
 
+#ifdef CONFIG_CMA_SYSFS
+void cma_sysfs_account_success_pages(struct cma *cma, unsigned long nr_pages);
+void cma_sysfs_account_fail_pages(struct cma *cma, unsigned long nr_pages);
+#else
+static inline void cma_sysfs_account_success_pages(struct cma *cma,
+						   unsigned long nr_pages) {};
+static inline void cma_sysfs_account_fail_pages(struct cma *cma,
+						unsigned long nr_pages) {};
+#endif
 #endif
--- /dev/null
+++ a/mm/cma_sysfs.c
@@ -0,0 +1,112 @@
+// SPDX-License-Identifier: GPL-2.0
+/*
+ * CMA SysFS Interface
+ *
+ * Copyright (c) 2021 Minchan Kim <minchan@kernel.org>
+ */
+
+#include <linux/cma.h>
+#include <linux/kernel.h>
+#include <linux/slab.h>
+
+#include "cma.h"
+
+#define CMA_ATTR_RO(_name) \
+	static struct kobj_attribute _name##_attr = __ATTR_RO(_name)
+
+void cma_sysfs_account_success_pages(struct cma *cma, unsigned long nr_pages)
+{
+	atomic64_add(nr_pages, &cma->nr_pages_succeeded);
+}
+
+void cma_sysfs_account_fail_pages(struct cma *cma, unsigned long nr_pages)
+{
+	atomic64_add(nr_pages, &cma->nr_pages_failed);
+}
+
+static inline struct cma *cma_from_kobj(struct kobject *kobj)
+{
+	return container_of(kobj, struct cma_kobject, kobj)->cma;
+}
+
+static ssize_t alloc_pages_success_show(struct kobject *kobj,
+					struct kobj_attribute *attr, char *buf)
+{
+	struct cma *cma = cma_from_kobj(kobj);
+
+	return sysfs_emit(buf, "%llu\n",
+			  atomic64_read(&cma->nr_pages_succeeded));
+}
+CMA_ATTR_RO(alloc_pages_success);
+
+static ssize_t alloc_pages_fail_show(struct kobject *kobj,
+				     struct kobj_attribute *attr, char *buf)
+{
+	struct cma *cma = cma_from_kobj(kobj);
+
+	return sysfs_emit(buf, "%llu\n", atomic64_read(&cma->nr_pages_failed));
+}
+CMA_ATTR_RO(alloc_pages_fail);
+
+static void cma_kobj_release(struct kobject *kobj)
+{
+	struct cma *cma = cma_from_kobj(kobj);
+	struct cma_kobject *cma_kobj = cma->cma_kobj;
+
+	kfree(cma_kobj);
+	cma->cma_kobj = NULL;
+}
+
+static struct attribute *cma_attrs[] = {
+	&alloc_pages_success_attr.attr,
+	&alloc_pages_fail_attr.attr,
+	NULL,
+};
+ATTRIBUTE_GROUPS(cma);
+
+static struct kobj_type cma_ktype = {
+	.release = cma_kobj_release,
+	.sysfs_ops = &kobj_sysfs_ops,
+	.default_groups = cma_groups,
+};
+
+static int __init cma_sysfs_init(void)
+{
+	struct kobject *cma_kobj_root;
+	struct cma_kobject *cma_kobj;
+	struct cma *cma;
+	int i, err;
+
+	cma_kobj_root = kobject_create_and_add("cma", mm_kobj);
+	if (!cma_kobj_root)
+		return -ENOMEM;
+
+	for (i = 0; i < cma_area_count; i++) {
+		cma_kobj = kzalloc(sizeof(*cma_kobj), GFP_KERNEL);
+		if (!cma_kobj) {
+			err = -ENOMEM;
+			goto out;
+		}
+
+		cma = &cma_areas[i];
+		cma->cma_kobj = cma_kobj;
+		cma_kobj->cma = cma;
+		err = kobject_init_and_add(&cma_kobj->kobj, &cma_ktype,
+					   cma_kobj_root, "%s", cma->name);
+		if (err) {
+			kobject_put(&cma_kobj->kobj);
+			goto out;
+		}
+	}
+
+	return 0;
+out:
+	while (--i >= 0) {
+		cma = &cma_areas[i];
+		kobject_put(&cma->cma_kobj->kobj);
+	}
+	kobject_put(cma_kobj_root);
+
+	return err;
+}
+subsys_initcall(cma_sysfs_init);
--- a/mm/Kconfig~mm-cma-support-sysfs
+++ a/mm/Kconfig
@@ -518,6 +518,13 @@ config CMA_DEBUGFS
 	help
 	  Turns on the DebugFS interface for CMA.
 
+config CMA_SYSFS
+	bool "CMA information through sysfs interface"
+	depends on CMA && SYSFS
+	help
+	  This option exposes some sysfs attributes to get information
+	  from CMA.
+
 config CMA_AREAS
 	int "Maximum count of the CMA areas"
 	depends on CMA
--- a/mm/Makefile~mm-cma-support-sysfs
+++ a/mm/Makefile
@@ -109,6 +109,7 @@ obj-$(CONFIG_CMA)	+= cma.o
 obj-$(CONFIG_MEMORY_BALLOON) += balloon_compaction.o
 obj-$(CONFIG_PAGE_EXTENSION) += page_ext.o
 obj-$(CONFIG_CMA_DEBUGFS) += cma_debug.o
+obj-$(CONFIG_CMA_SYSFS) += cma_sysfs.o
 obj-$(CONFIG_USERFAULTFD) += userfaultfd.o
 obj-$(CONFIG_IDLE_PAGE_TRACKING) += page_idle.o
 obj-$(CONFIG_DEBUG_PAGE_REF) += debug_page_ref.o
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 089/143] mm: cma: add the CMA instance name to cma trace events
  2021-05-05  1:32 incoming Andrew Morton
                   ` (87 preceding siblings ...)
  2021-05-05  1:37 ` [patch 088/143] mm: cma: support sysfs Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 090/143] mm: use proper type for cma_[alloc|release] Andrew Morton
                   ` (51 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, georgi.djakov, linux-mm, lmark, minchan, mm-commits,
	torvalds

From: Minchan Kim <minchan@kernel.org>
Subject: mm: cma: add the CMA instance name to cma trace events

There were missing places to add cma instance name.  To identify each CMA
instance, let's add the name for every cma trace.  This patch also changes
the existing cma_trace_alloc to cma_trace_finish since we have
cma_alloc_start[1].

[1] https://lore.kernel.org/linux-mm/20210324160740.15901-1-georgi.djakov@linaro.org

Link: https://lkml.kernel.org/r/20210330220237.748899-1-minchan@kernel.org
Signed-off-by: Minchan Kim <minchan@kernel.org>
Cc: Liam Mark <lmark@codeaurora.org>
Cc: Georgi Djakov <georgi.djakov@linaro.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/trace/events/cma.h |   28 +++++++++++++++++-----------
 mm/cma.c                   |    7 ++++---
 2 files changed, 21 insertions(+), 14 deletions(-)

--- a/include/trace/events/cma.h~mm-cma-add-the-cma-instance-name-to-cma-trace-events
+++ a/include/trace/events/cma.h
@@ -10,12 +10,13 @@
 
 DECLARE_EVENT_CLASS(cma_alloc_class,
 
-	TP_PROTO(unsigned long pfn, const struct page *page,
+	TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
 		 unsigned int count, unsigned int align),
 
-	TP_ARGS(pfn, page, count, align),
+	TP_ARGS(name, pfn, page, count, align),
 
 	TP_STRUCT__entry(
+		__string(name, name)
 		__field(unsigned long, pfn)
 		__field(const struct page *, page)
 		__field(unsigned int, count)
@@ -23,13 +24,15 @@ DECLARE_EVENT_CLASS(cma_alloc_class,
 	),
 
 	TP_fast_assign(
+		__assign_str(name, name);
 		__entry->pfn = pfn;
 		__entry->page = page;
 		__entry->count = count;
 		__entry->align = align;
 	),
 
-	TP_printk("pfn=%lx page=%p count=%u align=%u",
+	TP_printk("name=%s pfn=%lx page=%p count=%u align=%u",
+		  __get_str(name),
 		  __entry->pfn,
 		  __entry->page,
 		  __entry->count,
@@ -38,24 +41,27 @@ DECLARE_EVENT_CLASS(cma_alloc_class,
 
 TRACE_EVENT(cma_release,
 
-	TP_PROTO(unsigned long pfn, const struct page *page,
+	TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
 		 unsigned int count),
 
-	TP_ARGS(pfn, page, count),
+	TP_ARGS(name, pfn, page, count),
 
 	TP_STRUCT__entry(
+		__string(name, name)
 		__field(unsigned long, pfn)
 		__field(const struct page *, page)
 		__field(unsigned int, count)
 	),
 
 	TP_fast_assign(
+		__assign_str(name, name);
 		__entry->pfn = pfn;
 		__entry->page = page;
 		__entry->count = count;
 	),
 
-	TP_printk("pfn=%lx page=%p count=%u",
+	TP_printk("name=%s pfn=%lx page=%p count=%u",
+		  __get_str(name),
 		  __entry->pfn,
 		  __entry->page,
 		  __entry->count)
@@ -85,20 +91,20 @@ TRACE_EVENT(cma_alloc_start,
 		  __entry->align)
 );
 
-DEFINE_EVENT(cma_alloc_class, cma_alloc,
+DEFINE_EVENT(cma_alloc_class, cma_alloc_finish,
 
-	TP_PROTO(unsigned long pfn, const struct page *page,
+	TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
 		 unsigned int count, unsigned int align),
 
-	TP_ARGS(pfn, page, count, align)
+	TP_ARGS(name, pfn, page, count, align)
 );
 
 DEFINE_EVENT(cma_alloc_class, cma_alloc_busy_retry,
 
-	TP_PROTO(unsigned long pfn, const struct page *page,
+	TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
 		 unsigned int count, unsigned int align),
 
-	TP_ARGS(pfn, page, count, align)
+	TP_ARGS(name, pfn, page, count, align)
 );
 
 #endif /* _TRACE_CMA_H */
--- a/mm/cma.c~mm-cma-add-the-cma-instance-name-to-cma-trace-events
+++ a/mm/cma.c
@@ -486,12 +486,13 @@ struct page *cma_alloc(struct cma *cma,
 		pr_debug("%s(): memory range at %p is busy, retrying\n",
 			 __func__, pfn_to_page(pfn));
 
-		trace_cma_alloc_busy_retry(pfn, pfn_to_page(pfn), count, align);
+		trace_cma_alloc_busy_retry(cma->name, pfn, pfn_to_page(pfn),
+					   count, align);
 		/* try again with a bit different memory target */
 		start = bitmap_no + mask + 1;
 	}
 
-	trace_cma_alloc(pfn, page, count, align);
+	trace_cma_alloc_finish(cma->name, pfn, page, count, align);
 
 	/*
 	 * CMA can allocate multiple page blocks, which results in different
@@ -551,7 +552,7 @@ bool cma_release(struct cma *cma, const
 
 	free_contig_range(pfn, count);
 	cma_clear_bitmap(cma, pfn, count);
-	trace_cma_release(pfn, pages, count);
+	trace_cma_release(cma->name, pfn, pages, count);
 
 	return true;
 }
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 090/143] mm: use proper type for cma_[alloc|release]
  2021-05-05  1:32 incoming Andrew Morton
                   ` (88 preceding siblings ...)
  2021-05-05  1:37 ` [patch 089/143] mm: cma: add the CMA instance name to cma trace events Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 091/143] ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search() Andrew Morton
                   ` (50 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, david, linux-mm, minchan, mm-commits, torvalds, willy

From: Minchan Kim <minchan@kernel.org>
Subject: mm: use proper type for cma_[alloc|release]

size_t in cma_alloc is confusing since it makes people think it's byte
count, not pages.  Change it to unsigned long[1].

The unsigned int in cma_release is also not right so change it.  Since we
have unsigned long in cma_release, free_contig_range should also respect
it.

[1] 67a2e213e7e9, mm: cma: fix incorrect type conversion for size during dma allocation

Link: https://lore.kernel.org/linux-mm/20210324043434.GP1719932@casper.infradead.org/
Link: https://lkml.kernel.org/r/20210331164018.710560-1-minchan@kernel.org
Signed-off-by: Minchan Kim <minchan@kernel.org>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: David Hildenbrand <david@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/cma.h        |    4 ++--
 include/linux/gfp.h        |    2 +-
 include/trace/events/cma.h |   22 +++++++++++-----------
 mm/cma.c                   |   17 +++++++++--------
 mm/page_alloc.c            |    6 +++---
 5 files changed, 26 insertions(+), 25 deletions(-)

--- a/include/linux/cma.h~mm-use-proper-type-for-cma_
+++ a/include/linux/cma.h
@@ -44,9 +44,9 @@ extern int cma_init_reserved_mem(phys_ad
 					unsigned int order_per_bit,
 					const char *name,
 					struct cma **res_cma);
-extern struct page *cma_alloc(struct cma *cma, size_t count, unsigned int align,
+extern struct page *cma_alloc(struct cma *cma, unsigned long count, unsigned int align,
 			      bool no_warn);
-extern bool cma_release(struct cma *cma, const struct page *pages, unsigned int count);
+extern bool cma_release(struct cma *cma, const struct page *pages, unsigned long count);
 
 extern int cma_for_each_area(int (*it)(struct cma *cma, void *data), void *data);
 #endif
--- a/include/linux/gfp.h~mm-use-proper-type-for-cma_
+++ a/include/linux/gfp.h
@@ -657,7 +657,7 @@ extern int alloc_contig_range(unsigned l
 extern struct page *alloc_contig_pages(unsigned long nr_pages, gfp_t gfp_mask,
 				       int nid, nodemask_t *nodemask);
 #endif
-void free_contig_range(unsigned long pfn, unsigned int nr_pages);
+void free_contig_range(unsigned long pfn, unsigned long nr_pages);
 
 #ifdef CONFIG_CMA
 /* CMA stuff */
--- a/include/trace/events/cma.h~mm-use-proper-type-for-cma_
+++ a/include/trace/events/cma.h
@@ -11,7 +11,7 @@
 DECLARE_EVENT_CLASS(cma_alloc_class,
 
 	TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
-		 unsigned int count, unsigned int align),
+		 unsigned long count, unsigned int align),
 
 	TP_ARGS(name, pfn, page, count, align),
 
@@ -19,7 +19,7 @@ DECLARE_EVENT_CLASS(cma_alloc_class,
 		__string(name, name)
 		__field(unsigned long, pfn)
 		__field(const struct page *, page)
-		__field(unsigned int, count)
+		__field(unsigned long, count)
 		__field(unsigned int, align)
 	),
 
@@ -31,7 +31,7 @@ DECLARE_EVENT_CLASS(cma_alloc_class,
 		__entry->align = align;
 	),
 
-	TP_printk("name=%s pfn=%lx page=%p count=%u align=%u",
+	TP_printk("name=%s pfn=%lx page=%p count=%lu align=%u",
 		  __get_str(name),
 		  __entry->pfn,
 		  __entry->page,
@@ -42,7 +42,7 @@ DECLARE_EVENT_CLASS(cma_alloc_class,
 TRACE_EVENT(cma_release,
 
 	TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
-		 unsigned int count),
+		 unsigned long count),
 
 	TP_ARGS(name, pfn, page, count),
 
@@ -50,7 +50,7 @@ TRACE_EVENT(cma_release,
 		__string(name, name)
 		__field(unsigned long, pfn)
 		__field(const struct page *, page)
-		__field(unsigned int, count)
+		__field(unsigned long, count)
 	),
 
 	TP_fast_assign(
@@ -60,7 +60,7 @@ TRACE_EVENT(cma_release,
 		__entry->count = count;
 	),
 
-	TP_printk("name=%s pfn=%lx page=%p count=%u",
+	TP_printk("name=%s pfn=%lx page=%p count=%lu",
 		  __get_str(name),
 		  __entry->pfn,
 		  __entry->page,
@@ -69,13 +69,13 @@ TRACE_EVENT(cma_release,
 
 TRACE_EVENT(cma_alloc_start,
 
-	TP_PROTO(const char *name, unsigned int count, unsigned int align),
+	TP_PROTO(const char *name, unsigned long count, unsigned int align),
 
 	TP_ARGS(name, count, align),
 
 	TP_STRUCT__entry(
 		__string(name, name)
-		__field(unsigned int, count)
+		__field(unsigned long, count)
 		__field(unsigned int, align)
 	),
 
@@ -85,7 +85,7 @@ TRACE_EVENT(cma_alloc_start,
 		__entry->align = align;
 	),
 
-	TP_printk("name=%s count=%u align=%u",
+	TP_printk("name=%s count=%lu align=%u",
 		  __get_str(name),
 		  __entry->count,
 		  __entry->align)
@@ -94,7 +94,7 @@ TRACE_EVENT(cma_alloc_start,
 DEFINE_EVENT(cma_alloc_class, cma_alloc_finish,
 
 	TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
-		 unsigned int count, unsigned int align),
+		 unsigned long count, unsigned int align),
 
 	TP_ARGS(name, pfn, page, count, align)
 );
@@ -102,7 +102,7 @@ DEFINE_EVENT(cma_alloc_class, cma_alloc_
 DEFINE_EVENT(cma_alloc_class, cma_alloc_busy_retry,
 
 	TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
-		 unsigned int count, unsigned int align),
+		 unsigned long count, unsigned int align),
 
 	TP_ARGS(name, pfn, page, count, align)
 );
--- a/mm/cma.c~mm-use-proper-type-for-cma_
+++ a/mm/cma.c
@@ -79,7 +79,7 @@ static unsigned long cma_bitmap_pages_to
 }
 
 static void cma_clear_bitmap(struct cma *cma, unsigned long pfn,
-			     unsigned int count)
+			     unsigned long count)
 {
 	unsigned long bitmap_no, bitmap_count;
 	unsigned long flags;
@@ -423,21 +423,21 @@ static inline void cma_debug_show_areas(
  * This function allocates part of contiguous memory on specific
  * contiguous memory area.
  */
-struct page *cma_alloc(struct cma *cma, size_t count, unsigned int align,
-		       bool no_warn)
+struct page *cma_alloc(struct cma *cma, unsigned long count,
+		       unsigned int align, bool no_warn)
 {
 	unsigned long mask, offset;
 	unsigned long pfn = -1;
 	unsigned long start = 0;
 	unsigned long bitmap_maxno, bitmap_no, bitmap_count;
-	size_t i;
+	unsigned long i;
 	struct page *page = NULL;
 	int ret = -ENOMEM;
 
 	if (!cma || !cma->count || !cma->bitmap)
 		goto out;
 
-	pr_debug("%s(cma %p, count %zu, align %d)\n", __func__, (void *)cma,
+	pr_debug("%s(cma %p, count %lu, align %d)\n", __func__, (void *)cma,
 		 count, align);
 
 	if (!count)
@@ -505,7 +505,7 @@ struct page *cma_alloc(struct cma *cma,
 	}
 
 	if (ret && !no_warn) {
-		pr_err_ratelimited("%s: %s: alloc failed, req-size: %zu pages, ret: %d\n",
+		pr_err_ratelimited("%s: %s: alloc failed, req-size: %lu pages, ret: %d\n",
 				   __func__, cma->name, count, ret);
 		cma_debug_show_areas(cma);
 	}
@@ -534,14 +534,15 @@ out:
  * It returns false when provided pages do not belong to contiguous area and
  * true otherwise.
  */
-bool cma_release(struct cma *cma, const struct page *pages, unsigned int count)
+bool cma_release(struct cma *cma, const struct page *pages,
+		 unsigned long count)
 {
 	unsigned long pfn;
 
 	if (!cma || !pages)
 		return false;
 
-	pr_debug("%s(page %p, count %u)\n", __func__, (void *)pages, count);
+	pr_debug("%s(page %p, count %lu)\n", __func__, (void *)pages, count);
 
 	pfn = page_to_pfn(pages);
 
--- a/mm/page_alloc.c~mm-use-proper-type-for-cma_
+++ a/mm/page_alloc.c
@@ -8973,9 +8973,9 @@ struct page *alloc_contig_pages(unsigned
 }
 #endif /* CONFIG_CONTIG_ALLOC */
 
-void free_contig_range(unsigned long pfn, unsigned int nr_pages)
+void free_contig_range(unsigned long pfn, unsigned long nr_pages)
 {
-	unsigned int count = 0;
+	unsigned long count = 0;
 
 	for (; nr_pages--; pfn++) {
 		struct page *page = pfn_to_page(pfn);
@@ -8983,7 +8983,7 @@ void free_contig_range(unsigned long pfn
 		count += page_count(page) != 1;
 		__free_page(page);
 	}
-	WARN(count != 0, "%d pages are still in use!\n", count);
+	WARN(count != 0, "%lu pages are still in use!\n", count);
 }
 EXPORT_SYMBOL(free_contig_range);
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 091/143] ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (89 preceding siblings ...)
  2021-05-05  1:37 ` [patch 090/143] mm: use proper type for cma_[alloc|release] Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 092/143] ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree() Andrew Morton
                   ` (49 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, hughd, linmiaohe, linux-mm, mm-commits, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search()

Patch series "Cleanup and fixup for ksm".

This series contains cleanups to remove unnecessary VM_BUG_ON_PAGE and
dedicated macro KSM_FLAG_MASK.  Also this fixes potential missing
rmap_item for stable_node which would result in failed rmap_walk_ksm(). 
More details can be found in the respective changelogs.


This patch (of 4):

The same VM_BUG_ON_PAGE() check is already done in the callee.  Remove
these extra caller one to simplify code slightly.

Link: https://lkml.kernel.org/r/20210330140228.45635-1-linmiaohe@huawei.com
Link: https://lkml.kernel.org/r/20210330140228.45635-2-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Hugh Dickins <hughd@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/ksm.c |    2 --
 1 file changed, 2 deletions(-)

--- a/mm/ksm.c~ksm-remove-redundant-vm_bug_on_page-on-stable_tree_search
+++ a/mm/ksm.c
@@ -1771,7 +1771,6 @@ chain_append:
 	 * stable_node_dup is the dup to replace.
 	 */
 	if (stable_node_dup == stable_node) {
-		VM_BUG_ON(is_stable_node_chain(stable_node_dup));
 		VM_BUG_ON(is_stable_node_dup(stable_node_dup));
 		/* chain is missing so create it */
 		stable_node = alloc_stable_node_chain(stable_node_dup,
@@ -1785,7 +1784,6 @@ chain_append:
 	 * of the current nid for this page
 	 * content.
 	 */
-	VM_BUG_ON(!is_stable_node_chain(stable_node));
 	VM_BUG_ON(!is_stable_node_dup(stable_node_dup));
 	VM_BUG_ON(page_node->head != &migrate_nodes);
 	list_del(&page_node->list);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 092/143] ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (90 preceding siblings ...)
  2021-05-05  1:37 ` [patch 091/143] ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search() Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 093/143] ksm: remove dedicated macro KSM_FLAG_MASK Andrew Morton
                   ` (48 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, hughd, linmiaohe, linux-mm, mm-commits, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()

It's unnecessary to lock the page when get ksm page if we're going to
remove the rmap item as page migration is irrelevant in this case.  Use
GET_KSM_PAGE_NOLOCK instead to save some page lock cycles.

Link: https://lkml.kernel.org/r/20210330140228.45635-3-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Hugh Dickins <hughd@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/ksm.c |    3 +--
 1 file changed, 1 insertion(+), 2 deletions(-)

--- a/mm/ksm.c~ksm-use-get_ksm_page_nolock-to-get-ksm-page-in-remove_rmap_item_from_tree
+++ a/mm/ksm.c
@@ -778,12 +778,11 @@ static void remove_rmap_item_from_tree(s
 		struct page *page;
 
 		stable_node = rmap_item->head;
-		page = get_ksm_page(stable_node, GET_KSM_PAGE_LOCK);
+		page = get_ksm_page(stable_node, GET_KSM_PAGE_NOLOCK);
 		if (!page)
 			goto out;
 
 		hlist_del(&rmap_item->hlist);
-		unlock_page(page);
 		put_page(page);
 
 		if (!hlist_empty(&stable_node->hlist))
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 093/143] ksm: remove dedicated macro KSM_FLAG_MASK
  2021-05-05  1:32 incoming Andrew Morton
                   ` (91 preceding siblings ...)
  2021-05-05  1:37 ` [patch 092/143] ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree() Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 094/143] ksm: fix potential missing rmap_item for stable_node Andrew Morton
                   ` (47 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, hughd, linmiaohe, linux-mm, mm-commits, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: ksm: remove dedicated macro KSM_FLAG_MASK

The macro KSM_FLAG_MASK is used in rmap_walk_ksm() only.  So we can
replace ~KSM_FLAG_MASK with PAGE_MASK to remove this dedicated macro and
make code more consistent because PAGE_MASK is used elsewhere in this
file.

Link: https://lkml.kernel.org/r/20210330140228.45635-4-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Hugh Dickins <hughd@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/ksm.c |    4 +---
 1 file changed, 1 insertion(+), 3 deletions(-)

--- a/mm/ksm.c~ksm-remove-dedicated-macro-ksm_flag_mask
+++ a/mm/ksm.c
@@ -215,8 +215,6 @@ struct rmap_item {
 #define SEQNR_MASK	0x0ff	/* low bits of unstable tree seqnr */
 #define UNSTABLE_FLAG	0x100	/* is a node of the unstable tree */
 #define STABLE_FLAG	0x200	/* is listed from the stable tree */
-#define KSM_FLAG_MASK	(SEQNR_MASK|UNSTABLE_FLAG|STABLE_FLAG)
-				/* to mask all the flags */
 
 /* The stable and unstable tree heads */
 static struct rb_root one_stable_tree[1] = { RB_ROOT };
@@ -2631,7 +2629,7 @@ again:
 			vma = vmac->vma;
 
 			/* Ignore the stable/unstable/sqnr flags */
-			addr = rmap_item->address & ~KSM_FLAG_MASK;
+			addr = rmap_item->address & PAGE_MASK;
 
 			if (addr < vma->vm_start || addr >= vma->vm_end)
 				continue;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 094/143] ksm: fix potential missing rmap_item for stable_node
  2021-05-05  1:32 incoming Andrew Morton
                   ` (92 preceding siblings ...)
  2021-05-05  1:37 ` [patch 093/143] ksm: remove dedicated macro KSM_FLAG_MASK Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 095/143] mm/ksm: remove unused parameter from remove_trailing_rmap_items() Andrew Morton
                   ` (46 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, hughd, linmiaohe, linux-mm, mm-commits, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: ksm: fix potential missing rmap_item for stable_node

When removing rmap_item from stable tree, STABLE_FLAG of rmap_item is
cleared with head reserved.  So the following scenario might happen: For
ksm page with rmap_item1:

cmp_and_merge_page
  stable_node->head = &migrate_nodes;
  remove_rmap_item_from_tree, but head still equal to stable_node;
  try_to_merge_with_ksm_page failed;
  return;

For the same ksm page with rmap_item2, stable node migration succeed this
time.  The stable_node->head does not equal to migrate_nodes now.  For ksm
page with rmap_item1 again:

cmp_and_merge_page
 stable_node->head != &migrate_nodes && rmap_item->head == stable_node
 return;

We would miss the rmap_item for stable_node and might result in failed
rmap_walk_ksm().  Fix this by set rmap_item->head to NULL when rmap_item
is removed from stable tree.

Link: https://lkml.kernel.org/r/20210330140228.45635-5-linmiaohe@huawei.com
Fixes: 4146d2d673e8 ("ksm: make !merge_across_nodes migration safe")
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Hugh Dickins <hughd@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/ksm.c |    1 +
 1 file changed, 1 insertion(+)

--- a/mm/ksm.c~ksm-fix-potential-missing-rmap_item-for-stable_node
+++ a/mm/ksm.c
@@ -791,6 +791,7 @@ static void remove_rmap_item_from_tree(s
 		stable_node->rmap_hlist_len--;
 
 		put_anon_vma(rmap_item->anon_vma);
+		rmap_item->head = NULL;
 		rmap_item->address &= PAGE_MASK;
 
 	} else if (rmap_item->address & UNSTABLE_FLAG) {
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 095/143] mm/ksm: remove unused parameter from remove_trailing_rmap_items()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (93 preceding siblings ...)
  2021-05-05  1:37 ` [patch 094/143] ksm: fix potential missing rmap_item for stable_node Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 096/143] mm: restore node stat checking in /proc/sys/vm/stat_refresh Andrew Morton
                   ` (45 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, cy.fan, david, hughd, linux-mm, mm-commits, torvalds

From: Chengyang Fan <cy.fan@huawei.com>
Subject: mm/ksm: remove unused parameter from remove_trailing_rmap_items()

Since commit 6514d511dbe5 ("ksm: singly-linked rmap_list") was merged,
remove_trailing_rmap_items() doesn't use the 'mm_slot' parameter.  So
remove it, and update caller accordingly.

Link: https://lkml.kernel.org/r/20210330121320.1693474-1-cy.fan@huawei.com
Signed-off-by: Chengyang Fan <cy.fan@huawei.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Hugh Dickins <hughd@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/ksm.c |    7 +++----
 1 file changed, 3 insertions(+), 4 deletions(-)

--- a/mm/ksm.c~mm-ksm-remove-unused-parameter-from-remove_trailing_rmap_items
+++ a/mm/ksm.c
@@ -815,8 +815,7 @@ out:
 	cond_resched();		/* we're called from many long loops */
 }
 
-static void remove_trailing_rmap_items(struct mm_slot *mm_slot,
-				       struct rmap_item **rmap_list)
+static void remove_trailing_rmap_items(struct rmap_item **rmap_list)
 {
 	while (*rmap_list) {
 		struct rmap_item *rmap_item = *rmap_list;
@@ -987,7 +986,7 @@ static int unmerge_and_remove_all_rmap_i
 				goto error;
 		}
 
-		remove_trailing_rmap_items(mm_slot, &mm_slot->rmap_list);
+		remove_trailing_rmap_items(&mm_slot->rmap_list);
 		mmap_read_unlock(mm);
 
 		spin_lock(&ksm_mmlist_lock);
@@ -2333,7 +2332,7 @@ next_mm:
 	 * Nuke all the rmap_items that are above this current rmap:
 	 * because there were no VM_MERGEABLE vmas with such addresses.
 	 */
-	remove_trailing_rmap_items(slot, ksm_scan.rmap_list);
+	remove_trailing_rmap_items(ksm_scan.rmap_list);
 
 	spin_lock(&ksm_mmlist_lock);
 	ksm_scan.mm_slot = list_entry(slot->mm_list.next,
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 096/143] mm: restore node stat checking in /proc/sys/vm/stat_refresh
  2021-05-05  1:32 incoming Andrew Morton
                   ` (94 preceding siblings ...)
  2021-05-05  1:37 ` [patch 095/143] mm/ksm: remove unused parameter from remove_trailing_rmap_items() Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 097/143] mm: no more EINVAL from /proc/sys/vm/stat_refresh Andrew Morton
                   ` (44 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, guro, hannes, hughd, linux-mm, mhocko, mm-commits, torvalds,
	vbabka

From: Hugh Dickins <hughd@google.com>
Subject: mm: restore node stat checking in /proc/sys/vm/stat_refresh

v4.7 52b6f46bc163 ("mm: /proc/sys/vm/stat_refresh to force vmstat update")
introduced vmstat_refresh(), with its vmstat underflow checking; then v4.8
75ef71840539 ("mm, vmstat: add infrastructure for per-node vmstats") split
NR_VM_NODE_STAT_ITEMS out of NR_VM_ZONE_STAT_ITEMS without updating
vmstat_refresh(): so it has been missing out much of the vmstat underflow
checking ever since.  Reinstate it.  Thanks to Roman Gushchin
<guro@fb.com> for tangentially pointing this out.

Link: https://lkml.kernel.org/r/alpine.LSU.2.11.2102251502240.13363@eggly.anvils
Signed-off-by: Hugh Dickins <hughd@google.com>
Cc: Roman Gushchin <guro@fb.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/vmstat.c |    8 ++++++++
 1 file changed, 8 insertions(+)

--- a/mm/vmstat.c~mm-restore-node-stat-checking-in-proc-sys-vm-stat_refresh
+++ a/mm/vmstat.c
@@ -1875,6 +1875,14 @@ int vmstat_refresh(struct ctl_table *tab
 		}
 	}
 #endif
+	for (i = 0; i < NR_VM_NODE_STAT_ITEMS; i++) {
+		val = atomic_long_read(&vm_node_stat[i]);
+		if (val < 0) {
+			pr_warn("%s: %s %ld\n",
+				__func__, node_stat_name(i), val);
+			err = -EINVAL;
+		}
+	}
 	if (err)
 		return err;
 	if (write)
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 097/143] mm: no more EINVAL from /proc/sys/vm/stat_refresh
  2021-05-05  1:32 incoming Andrew Morton
                   ` (95 preceding siblings ...)
  2021-05-05  1:37 ` [patch 096/143] mm: restore node stat checking in /proc/sys/vm/stat_refresh Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:37 ` [patch 098/143] mm: /proc/sys/vm/stat_refresh skip checking known negative stats Andrew Morton
                   ` (43 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, guro, hannes, hughd, linux-mm, mhocko, mm-commits, torvalds,
	vbabka

From: Hugh Dickins <hughd@google.com>
Subject: mm: no more EINVAL from /proc/sys/vm/stat_refresh

EINVAL was good for drawing the refresher's attention to a warning in
dmesg, but became very tiresome when running test suites scripted with
"set -e": an underflow from a bug in one feature would cause unrelated
tests much later to fail, just because their /proc/sys/vm/stat_refresh
touch failed with that error.  Stop doing that.

Link: https://lkml.kernel.org/r/alpine.LSU.2.11.2102251510410.13363@eggly.anvils
Signed-off-by: Hugh Dickins <hughd@google.com>
Acked-by: Roman Gushchin <guro@fb.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/vmstat.c |    5 -----
 1 file changed, 5 deletions(-)

--- a/mm/vmstat.c~mm-no-more-einval-from-proc-sys-vm-stat_refresh
+++ a/mm/vmstat.c
@@ -1862,7 +1862,6 @@ int vmstat_refresh(struct ctl_table *tab
 		if (val < 0) {
 			pr_warn("%s: %s %ld\n",
 				__func__, zone_stat_name(i), val);
-			err = -EINVAL;
 		}
 	}
 #ifdef CONFIG_NUMA
@@ -1871,7 +1870,6 @@ int vmstat_refresh(struct ctl_table *tab
 		if (val < 0) {
 			pr_warn("%s: %s %ld\n",
 				__func__, numa_stat_name(i), val);
-			err = -EINVAL;
 		}
 	}
 #endif
@@ -1880,11 +1878,8 @@ int vmstat_refresh(struct ctl_table *tab
 		if (val < 0) {
 			pr_warn("%s: %s %ld\n",
 				__func__, node_stat_name(i), val);
-			err = -EINVAL;
 		}
 	}
-	if (err)
-		return err;
 	if (write)
 		*ppos += *lenp;
 	else
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 098/143] mm: /proc/sys/vm/stat_refresh skip checking known negative stats
  2021-05-05  1:32 incoming Andrew Morton
                   ` (96 preceding siblings ...)
  2021-05-05  1:37 ` [patch 097/143] mm: no more EINVAL from /proc/sys/vm/stat_refresh Andrew Morton
@ 2021-05-05  1:37 ` Andrew Morton
  2021-05-05  1:38 ` [patch 099/143] mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats Andrew Morton
                   ` (42 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:37 UTC (permalink / raw)
  To: akpm, guro, hannes, hughd, linux-mm, mhocko, mm-commits, torvalds,
	vbabka

From: Hugh Dickins <hughd@google.com>
Subject: mm: /proc/sys/vm/stat_refresh skip checking known negative stats

vmstat_refresh() can occasionally catch nr_zone_write_pending and
nr_writeback when they are transiently negative.  The reason is partly
that the interrupt which decrements them in test_clear_page_writeback()
can come in before __test_set_page_writeback() got to increment them; but
transient negatives are still seen even when that is prevented, and I am
not yet certain why (but see Roman's note below).  Those stats are not
buggy, they have never been seen to drift away from 0 permanently: so just
avoid the annoyance of showing a warning on them.

Similarly avoid showing a warning on nr_free_cma: CMA users have seen that
one reported negative from /proc/sys/vm/stat_refresh too, but it does
drift away permanently: I believe that's because its incrementation and
decrementation are decided by page migratetype, but the migratetype of a
pageblock is not guaranteed to be constant.

Roman Gushchin points out:
For performance reasons, vmstat counters are incremented and decremented
using per-cpu batches.  vmstat_refresh() flushes the per-cpu batches on
all CPUs, to get values as accurate as possible; but this method is not
atomic, so the resulting value is not always precise.  As a consequence,
for those counters whose actual value is close to 0, a small negative
value may occasionally be reported.  If the value is small and the state
is transient, it is not an indication of an error.

Link: https://lore.kernel.org/linux-mm/20200714173747.3315771-1-guro@fb.com/
Link: https://lkml.kernel.org/r/alpine.LSU.2.11.2103012158540.7549@eggly.anvils
Signed-off-by: Hugh Dickins <hughd@google.com>
Reported-by: Roman Gushchin <guro@fb.com>
Acked-by: Roman Gushchin <guro@fb.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/vmstat.c |   15 +++++++++++++++
 1 file changed, 15 insertions(+)

--- a/mm/vmstat.c~mm-proc-sys-vm-stat_refresh-skip-checking-known-negative-stats
+++ a/mm/vmstat.c
@@ -1858,6 +1858,14 @@ int vmstat_refresh(struct ctl_table *tab
 	if (err)
 		return err;
 	for (i = 0; i < NR_VM_ZONE_STAT_ITEMS; i++) {
+		/*
+		 * Skip checking stats known to go negative occasionally.
+		 */
+		switch (i) {
+		case NR_ZONE_WRITE_PENDING:
+		case NR_FREE_CMA_PAGES:
+			continue;
+		}
 		val = atomic_long_read(&vm_zone_stat[i]);
 		if (val < 0) {
 			pr_warn("%s: %s %ld\n",
@@ -1874,6 +1882,13 @@ int vmstat_refresh(struct ctl_table *tab
 	}
 #endif
 	for (i = 0; i < NR_VM_NODE_STAT_ITEMS; i++) {
+		/*
+		 * Skip checking stats known to go negative occasionally.
+		 */
+		switch (i) {
+		case NR_WRITEBACK:
+			continue;
+		}
 		val = atomic_long_read(&vm_node_stat[i]);
 		if (val < 0) {
 			pr_warn("%s: %s %ld\n",
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 099/143] mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats
  2021-05-05  1:32 incoming Andrew Morton
                   ` (97 preceding siblings ...)
  2021-05-05  1:37 ` [patch 098/143] mm: /proc/sys/vm/stat_refresh skip checking known negative stats Andrew Morton
@ 2021-05-05  1:38 ` Andrew Morton
  2021-05-05  1:38 ` [patch 100/143] x86/mm: track linear mapping split events Andrew Morton
                   ` (41 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:38 UTC (permalink / raw)
  To: akpm, guro, hannes, hughd, linux-mm, mhocko, mm-commits, torvalds,
	vbabka

From: Hugh Dickins <hughd@google.com>
Subject: mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats

All of the VM NUMA stats are event counts, incremented never decremented:
it is not very useful for vmstat_refresh() to check them throughout their
first aeon, then warn on them throughout their next.

Link: https://lkml.kernel.org/r/alpine.LSU.2.11.2102251514110.13363@eggly.anvils
Signed-off-by: Hugh Dickins <hughd@google.com>
Acked-by: Roman Gushchin <guro@fb.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/vmstat.c |    9 ---------
 1 file changed, 9 deletions(-)

--- a/mm/vmstat.c~mm-proc-sys-vm-stat_refresh-stop-checking-monotonic-numa-stats
+++ a/mm/vmstat.c
@@ -1872,15 +1872,6 @@ int vmstat_refresh(struct ctl_table *tab
 				__func__, zone_stat_name(i), val);
 		}
 	}
-#ifdef CONFIG_NUMA
-	for (i = 0; i < NR_VM_NUMA_STAT_ITEMS; i++) {
-		val = atomic_long_read(&vm_numa_stat[i]);
-		if (val < 0) {
-			pr_warn("%s: %s %ld\n",
-				__func__, numa_stat_name(i), val);
-		}
-	}
-#endif
 	for (i = 0; i < NR_VM_NODE_STAT_ITEMS; i++) {
 		/*
 		 * Skip checking stats known to go negative occasionally.
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 100/143] x86/mm: track linear mapping split events
  2021-05-05  1:32 incoming Andrew Morton
                   ` (98 preceding siblings ...)
  2021-05-05  1:38 ` [patch 099/143] mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats Andrew Morton
@ 2021-05-05  1:38 ` Andrew Morton
  2021-05-05  1:38 ` [patch 101/143] mm/mmap.c: don't unlock VMAs in remap_file_pages() Andrew Morton
                   ` (40 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:38 UTC (permalink / raw)
  To: akpm, dave.hansen, hannes, linux-mm, mingo, mm-commits,
	saravanand, tj, torvalds

From: Saravanan D <saravanand@fb.com>
Subject: x86/mm: track linear mapping split events

To help with debugging the sluggishness caused by TLB miss/reload, we
introduce monotonic hugepage [direct mapped] split event counts since
system state: SYSTEM_RUNNING to be displayed as part of /proc/vmstat in
x86 servers

The lifetime split event information will be displayed at the bottom of
/proc/vmstat
....
swap_ra 0
swap_ra_hit 0
direct_map_level2_splits 94
direct_map_level3_splits 4
nr_unstable 0
....

One of the many lasting sources of direct hugepage splits is kernel
tracing (kprobes, tracepoints).

Note that the kernel's code segment [512 MB] points to the same physical
addresses that have been already mapped in the kernel's direct mapping
range.

Source : Documentation/x86/x86_64/mm.rst

When we enable kernel tracing, the kernel has to modify
attributes/permissions of the text segment hugepages that are direct
mapped causing them to split.

Kernel's direct mapped hugepages do not coalesce back after split and
remain in place for the remainder of the lifetime.

An instance of direct page splits when we turn on dynamic kernel tracing
....
cat /proc/vmstat | grep -i direct_map_level
direct_map_level2_splits 784
direct_map_level3_splits 12
bpftrace -e 'tracepoint:raw_syscalls:sys_enter { @ [pid, comm] =
count(); }'
cat /proc/vmstat | grep -i
direct_map_level
direct_map_level2_splits 789
direct_map_level3_splits 12
....

Link: https://lkml.kernel.org/r/20210218235744.1040634-1-saravanand@fb.com
Signed-off-by: Saravanan D <saravanand@fb.com>
Acked-by: Tejun Heo <tj@kernel.org>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Acked-by: Dave Hansen <dave.hansen@linux.intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/x86/mm/pat/set_memory.c  |    8 ++++++++
 include/linux/vm_event_item.h |    4 ++++
 mm/vmstat.c                   |    4 ++++
 3 files changed, 16 insertions(+)

--- a/arch/x86/mm/pat/set_memory.c~x86-mm-tracking-linear-mapping-split-events
+++ a/arch/x86/mm/pat/set_memory.c
@@ -16,6 +16,8 @@
 #include <linux/pci.h>
 #include <linux/vmalloc.h>
 #include <linux/libnvdimm.h>
+#include <linux/vmstat.h>
+#include <linux/kernel.h>
 
 #include <asm/e820/api.h>
 #include <asm/processor.h>
@@ -91,6 +93,12 @@ static void split_page_count(int level)
 		return;
 
 	direct_pages_count[level]--;
+	if (system_state == SYSTEM_RUNNING) {
+		if (level == PG_LEVEL_2M)
+			count_vm_event(DIRECT_MAP_LEVEL2_SPLIT);
+		else if (level == PG_LEVEL_1G)
+			count_vm_event(DIRECT_MAP_LEVEL3_SPLIT);
+	}
 	direct_pages_count[level - 1] += PTRS_PER_PTE;
 }
 
--- a/include/linux/vm_event_item.h~x86-mm-tracking-linear-mapping-split-events
+++ a/include/linux/vm_event_item.h
@@ -125,6 +125,10 @@ enum vm_event_item { PGPGIN, PGPGOUT, PS
 		SWAP_RA,
 		SWAP_RA_HIT,
 #endif
+#ifdef CONFIG_X86
+		DIRECT_MAP_LEVEL2_SPLIT,
+		DIRECT_MAP_LEVEL3_SPLIT,
+#endif
 		NR_VM_EVENT_ITEMS
 };
 
--- a/mm/vmstat.c~x86-mm-tracking-linear-mapping-split-events
+++ a/mm/vmstat.c
@@ -1369,6 +1369,10 @@ const char * const vmstat_text[] = {
 	"swap_ra",
 	"swap_ra_hit",
 #endif
+#ifdef CONFIG_X86
+	"direct_map_level2_splits",
+	"direct_map_level3_splits",
+#endif
 #endif /* CONFIG_VM_EVENT_COUNTERS || CONFIG_MEMCG */
 };
 #endif /* CONFIG_PROC_FS || CONFIG_SYSFS || CONFIG_NUMA || CONFIG_MEMCG */
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 101/143] mm/mmap.c: don't unlock VMAs in remap_file_pages()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (99 preceding siblings ...)
  2021-05-05  1:38 ` [patch 100/143] x86/mm: track linear mapping split events Andrew Morton
@ 2021-05-05  1:38 ` Andrew Morton
  2021-05-05  1:38 ` [patch 102/143] mm: generalize ARCH_HAS_CACHE_LINE_SIZE Andrew Morton
                   ` (39 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:38 UTC (permalink / raw)
  To: akpm, david, hughd, Liam.Howlett, linux-mm, mm-commits, torvalds,
	willy

From: Liam Howlett <liam.howlett@oracle.com>
Subject: mm/mmap.c: don't unlock VMAs in remap_file_pages()

Since this call uses MAP_FIXED, do_mmap() will munlock the necessary
range.  There is also an error in the loop test expression which will
evaluate as false and the loop body has never execute.

Link: https://lkml.kernel.org/r/20210223235010.2296915-1-Liam.Howlett@Oracle.com
Signed-off-by: Liam R. Howlett <Liam.Howlett@Oracle.com>
Acked-by: Hugh Dickins <hughd@google.com>
Reviewed-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Reviewed-by: David Hildenbrand <david@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/mmap.c |   18 +-----------------
 1 file changed, 1 insertion(+), 17 deletions(-)

--- a/mm/mmap.c~mm-mmap-dont-unlock-vmas-in-remap_file_pages
+++ a/mm/mmap.c
@@ -3029,25 +3029,9 @@ SYSCALL_DEFINE5(remap_file_pages, unsign
 
 	flags &= MAP_NONBLOCK;
 	flags |= MAP_SHARED | MAP_FIXED | MAP_POPULATE;
-	if (vma->vm_flags & VM_LOCKED) {
-		struct vm_area_struct *tmp;
+	if (vma->vm_flags & VM_LOCKED)
 		flags |= MAP_LOCKED;
 
-		/* drop PG_Mlocked flag for over-mapped range */
-		for (tmp = vma; tmp->vm_start >= start + size;
-				tmp = tmp->vm_next) {
-			/*
-			 * Split pmd and munlock page on the border
-			 * of the range.
-			 */
-			vma_adjust_trans_huge(tmp, start, start + size, 0);
-
-			munlock_vma_pages_range(tmp,
-					max(tmp->vm_start, start),
-					min(tmp->vm_end, start + size));
-		}
-	}
-
 	file = get_file(vma->vm_file);
 	ret = do_mmap(vma->vm_file, start, size,
 			prot, flags, pgoff, &populate, NULL);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 102/143] mm: generalize ARCH_HAS_CACHE_LINE_SIZE
  2021-05-05  1:32 incoming Andrew Morton
                   ` (100 preceding siblings ...)
  2021-05-05  1:38 ` [patch 101/143] mm/mmap.c: don't unlock VMAs in remap_file_pages() Andrew Morton
@ 2021-05-05  1:38 ` Andrew Morton
  2021-05-05  1:38 ` [patch 104/143] mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] Andrew Morton
                   ` (38 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:38 UTC (permalink / raw)
  To: akpm, anshuman.khandual, aou, arnd, benh, borntraeger, bp,
	catalin.marinas, dalias, deller, gor, hca, hpa, James.Bottomley,
	linux-mm, linux, mingo, mm-commits, mpe, palmerdabbelt,
	paul.walmsley, paulus, tglx, torvalds, tsbogend, vgupta, viro,
	will, ysato

From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: generalize ARCH_HAS_CACHE_LINE_SIZE

Patch series "mm: some config cleanups", v2.

This series contains config cleanup patches which reduces code duplication
across platforms and also improves maintainability. There is no functional
change intended with this series.


This patch (of 6):

ARCH_HAS_CACHE_LINE_SIZE config has duplicate definitions on platforms
that subscribe it.  Instead, just make it a generic option which can be
selected on applicable platforms.  This change reduces code duplication
and makes it cleaner.

Link: https://lkml.kernel.org/r/1617259448-22529-1-git-send-email-anshuman.khandual@arm.com
Link: https://lkml.kernel.org/r/1617259448-22529-2-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com>	[arm64]
Acked-by: Vineet Gupta <vgupta@synopsys.com>		[arc]
Cc: Will Deacon <will@kernel.org>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Borislav Petkov <bp@alien8.de>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: Helge Deller <deller@gmx.de>
Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: Palmer Dabbelt <palmerdabbelt@google.com>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Rich Felker <dalias@libc.org>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/arc/Kconfig   |    4 +---
 arch/arm64/Kconfig |    4 +---
 arch/x86/Kconfig   |    4 +---
 mm/Kconfig         |    3 +++
 4 files changed, 6 insertions(+), 9 deletions(-)

--- a/arch/arc/Kconfig~mm-generalize-arch_has_cache_line_size
+++ a/arch/arc/Kconfig
@@ -6,6 +6,7 @@
 config ARC
 	def_bool y
 	select ARC_TIMERS
+	select ARCH_HAS_CACHE_LINE_SIZE
 	select ARCH_HAS_DEBUG_VM_PGTABLE
 	select ARCH_HAS_DMA_PREP_COHERENT
 	select ARCH_HAS_PTE_SPECIAL
@@ -48,9 +49,6 @@ config ARC
 	select HAVE_ARCH_JUMP_LABEL if ISA_ARCV2 && !CPU_ENDIAN_BE32
 	select SET_FS
 
-config ARCH_HAS_CACHE_LINE_SIZE
-	def_bool y
-
 config TRACE_IRQFLAGS_SUPPORT
 	def_bool y
 
--- a/arch/arm64/Kconfig~mm-generalize-arch_has_cache_line_size
+++ a/arch/arm64/Kconfig
@@ -11,6 +11,7 @@ config ARM64
 	select ACPI_PPTT if ACPI
 	select ARCH_HAS_DEBUG_WX
 	select ARCH_BINFMT_ELF_STATE
+	select ARCH_HAS_CACHE_LINE_SIZE
 	select ARCH_HAS_DEBUG_VIRTUAL
 	select ARCH_HAS_DEBUG_VM_PGTABLE
 	select ARCH_HAS_DMA_PREP_COHERENT
@@ -1074,9 +1075,6 @@ config HW_PERF_EVENTS
 config SYS_SUPPORTS_HUGETLBFS
 	def_bool y
 
-config ARCH_HAS_CACHE_LINE_SIZE
-	def_bool y
-
 config ARCH_HAS_FILTER_PGPROT
 	def_bool y
 
--- a/arch/x86/Kconfig~mm-generalize-arch_has_cache_line_size
+++ a/arch/x86/Kconfig
@@ -61,6 +61,7 @@ config X86
 	select ARCH_32BIT_OFF_T			if X86_32
 	select ARCH_CLOCKSOURCE_INIT
 	select ARCH_HAS_ACPI_TABLE_UPGRADE	if ACPI
+	select ARCH_HAS_CACHE_LINE_SIZE
 	select ARCH_HAS_DEBUG_VIRTUAL
 	select ARCH_HAS_DEBUG_VM_PGTABLE	if !X86_PAE
 	select ARCH_HAS_DEVMEM_IS_ALLOWED
@@ -316,9 +317,6 @@ config GENERIC_CALIBRATE_DELAY
 config ARCH_HAS_CPU_RELAX
 	def_bool y
 
-config ARCH_HAS_CACHE_LINE_SIZE
-	def_bool y
-
 config ARCH_HAS_FILTER_PGPROT
 	def_bool y
 
--- a/mm/Kconfig~mm-generalize-arch_has_cache_line_size
+++ a/mm/Kconfig
@@ -772,6 +772,9 @@ config IDLE_PAGE_TRACKING
 	  See Documentation/admin-guide/mm/idle_page_tracking.rst for
 	  more details.
 
+config ARCH_HAS_CACHE_LINE_SIZE
+	bool
+
 config ARCH_HAS_PTE_DEVMAP
 	bool
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 104/143] mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE]
  2021-05-05  1:32 incoming Andrew Morton
                   ` (101 preceding siblings ...)
  2021-05-05  1:38 ` [patch 102/143] mm: generalize ARCH_HAS_CACHE_LINE_SIZE Andrew Morton
@ 2021-05-05  1:38 ` Andrew Morton
  2021-05-05  1:38 ` [patch 105/143] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION Andrew Morton
                   ` (37 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:38 UTC (permalink / raw)
  To: akpm, anshuman.khandual, aou, arnd, benh, borntraeger, bp,
	catalin.marinas, dalias, deller, gor, hca, hpa, James.Bottomley,
	linux-mm, linux, mingo, mm-commits, mpe, palmerdabbelt,
	paul.walmsley, paulus, tglx, torvalds, tsbogend, vgupta, viro,
	will, ysato

From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE]

ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] configs have duplicate definitions
on platforms that subscribe them.  Instead, just make them generic options
which can be selected on applicable platforms.

Link: https://lkml.kernel.org/r/1617259448-22529-4-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com>	[arm64]
Acked-by: Heiko Carstens <hca@linux.ibm.com>		[s390]
Cc: Will Deacon <will@kernel.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Cc: Rich Felker <dalias@libc.org>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Helge Deller <deller@gmx.de>
Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com>
Cc: Palmer Dabbelt <palmerdabbelt@google.com>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: Vineet Gupta <vgupta@synopsys.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/arm64/Kconfig   |    8 ++------
 arch/ia64/Kconfig    |    8 ++------
 arch/powerpc/Kconfig |    8 ++------
 arch/s390/Kconfig    |    8 ++------
 arch/sh/Kconfig      |    2 ++
 arch/sh/mm/Kconfig   |    8 --------
 arch/x86/Kconfig     |   10 ++--------
 mm/Kconfig           |    6 ++++++
 8 files changed, 18 insertions(+), 40 deletions(-)

--- a/arch/arm64/Kconfig~mm-generalize-arch_enable_memory_
+++ a/arch/arm64/Kconfig
@@ -11,6 +11,8 @@ config ARM64
 	select ACPI_PPTT if ACPI
 	select ARCH_HAS_DEBUG_WX
 	select ARCH_BINFMT_ELF_STATE
+	select ARCH_ENABLE_MEMORY_HOTPLUG
+	select ARCH_ENABLE_MEMORY_HOTREMOVE
 	select ARCH_HAS_CACHE_LINE_SIZE
 	select ARCH_HAS_DEBUG_VIRTUAL
 	select ARCH_HAS_DEBUG_VM_PGTABLE
@@ -311,12 +313,6 @@ config ZONE_DMA32
 	bool "Support DMA32 zone" if EXPERT
 	default y
 
-config ARCH_ENABLE_MEMORY_HOTPLUG
-	def_bool y
-
-config ARCH_ENABLE_MEMORY_HOTREMOVE
-	def_bool y
-
 config SMP
 	def_bool y
 
--- a/arch/ia64/Kconfig~mm-generalize-arch_enable_memory_
+++ a/arch/ia64/Kconfig
@@ -13,6 +13,8 @@ config IA64
 	select ARCH_MIGHT_HAVE_PC_SERIO
 	select ACPI
 	select ACPI_NUMA if NUMA
+	select ARCH_ENABLE_MEMORY_HOTPLUG
+	select ARCH_ENABLE_MEMORY_HOTREMOVE
 	select ARCH_SUPPORTS_ACPI
 	select ACPI_SYSTEM_POWER_STATES_SUPPORT if ACPI
 	select ARCH_MIGHT_HAVE_ACPI_PDC if ACPI
@@ -246,12 +248,6 @@ config HOTPLUG_CPU
 	  can be controlled through /sys/devices/system/cpu/cpu#.
 	  Say N if you want to disable CPU hotplug.
 
-config ARCH_ENABLE_MEMORY_HOTPLUG
-	def_bool y
-
-config ARCH_ENABLE_MEMORY_HOTREMOVE
-	def_bool y
-
 config SCHED_SMT
 	bool "SMT scheduler support"
 	depends on SMP
--- a/arch/powerpc/Kconfig~mm-generalize-arch_enable_memory_
+++ a/arch/powerpc/Kconfig
@@ -118,6 +118,8 @@ config PPC
 	# Please keep this list sorted alphabetically.
 	#
 	select ARCH_32BIT_OFF_T if PPC32
+	select ARCH_ENABLE_MEMORY_HOTPLUG
+	select ARCH_ENABLE_MEMORY_HOTREMOVE
 	select ARCH_HAS_DEBUG_VIRTUAL
 	select ARCH_HAS_DEVMEM_IS_ALLOWED
 	select ARCH_HAS_ELF_RANDOMIZE
@@ -512,12 +514,6 @@ config ARCH_CPU_PROBE_RELEASE
 	def_bool y
 	depends on HOTPLUG_CPU
 
-config ARCH_ENABLE_MEMORY_HOTPLUG
-	def_bool y
-
-config ARCH_ENABLE_MEMORY_HOTREMOVE
-	def_bool y
-
 config PPC64_SUPPORTS_MEMORY_FAILURE
 	bool "Add support for memory hwpoison"
 	depends on PPC_BOOK3S_64
--- a/arch/s390/Kconfig~mm-generalize-arch_enable_memory_
+++ a/arch/s390/Kconfig
@@ -60,6 +60,8 @@ config S390
 	imply IMA_SECURE_AND_OR_TRUSTED_BOOT
 	select ARCH_32BIT_USTAT_F_TINODE
 	select ARCH_BINFMT_ELF_STATE
+	select ARCH_ENABLE_MEMORY_HOTPLUG if SPARSEMEM
+	select ARCH_ENABLE_MEMORY_HOTREMOVE
 	select ARCH_HAS_DEBUG_VM_PGTABLE
 	select ARCH_HAS_DEBUG_WX
 	select ARCH_HAS_DEVMEM_IS_ALLOWED
@@ -626,12 +628,6 @@ config ARCH_SPARSEMEM_ENABLE
 config ARCH_SPARSEMEM_DEFAULT
 	def_bool y
 
-config ARCH_ENABLE_MEMORY_HOTPLUG
-	def_bool y if SPARSEMEM
-
-config ARCH_ENABLE_MEMORY_HOTREMOVE
-	def_bool y
-
 config ARCH_ENABLE_SPLIT_PMD_PTLOCK
 	def_bool y
 
--- a/arch/sh/Kconfig~mm-generalize-arch_enable_memory_
+++ a/arch/sh/Kconfig
@@ -2,6 +2,8 @@
 config SUPERH
 	def_bool y
 	select ARCH_32BIT_OFF_T
+	select ARCH_ENABLE_MEMORY_HOTPLUG if SPARSEMEM && MMU
+	select ARCH_ENABLE_MEMORY_HOTREMOVE if SPARSEMEM && MMU
 	select ARCH_HAVE_CUSTOM_GPIO_H
 	select ARCH_HAVE_NMI_SAFE_CMPXCHG if (GUSA_RB || CPU_SH4A)
 	select ARCH_HAS_BINFMT_FLAT if !MMU
--- a/arch/sh/mm/Kconfig~mm-generalize-arch_enable_memory_
+++ a/arch/sh/mm/Kconfig
@@ -136,14 +136,6 @@ config ARCH_SPARSEMEM_DEFAULT
 config ARCH_SELECT_MEMORY_MODEL
 	def_bool y
 
-config ARCH_ENABLE_MEMORY_HOTPLUG
-	def_bool y
-	depends on SPARSEMEM && MMU
-
-config ARCH_ENABLE_MEMORY_HOTREMOVE
-	def_bool y
-	depends on SPARSEMEM && MMU
-
 config ARCH_MEMORY_PROBE
 	def_bool y
 	depends on MEMORY_HOTPLUG
--- a/arch/x86/Kconfig~mm-generalize-arch_enable_memory_
+++ a/arch/x86/Kconfig
@@ -60,6 +60,8 @@ config X86
 	select ACPI_SYSTEM_POWER_STATES_SUPPORT	if ACPI
 	select ARCH_32BIT_OFF_T			if X86_32
 	select ARCH_CLOCKSOURCE_INIT
+	select ARCH_ENABLE_MEMORY_HOTPLUG if X86_64 || (X86_32 && HIGHMEM)
+	select ARCH_ENABLE_MEMORY_HOTREMOVE if MEMORY_HOTPLUG
 	select ARCH_HAS_ACPI_TABLE_UPGRADE	if ACPI
 	select ARCH_HAS_CACHE_LINE_SIZE
 	select ARCH_HAS_DEBUG_VIRTUAL
@@ -2427,14 +2429,6 @@ config ARCH_HAS_ADD_PAGES
 	def_bool y
 	depends on X86_64 && ARCH_ENABLE_MEMORY_HOTPLUG
 
-config ARCH_ENABLE_MEMORY_HOTPLUG
-	def_bool y
-	depends on X86_64 || (X86_32 && HIGHMEM)
-
-config ARCH_ENABLE_MEMORY_HOTREMOVE
-	def_bool y
-	depends on MEMORY_HOTPLUG
-
 config USE_PERCPU_NUMA_NODE_ID
 	def_bool y
 	depends on NUMA
--- a/mm/Kconfig~mm-generalize-arch_enable_memory_
+++ a/mm/Kconfig
@@ -148,6 +148,9 @@ config MEMORY_ISOLATION
 config HAVE_BOOTMEM_INFO_NODE
 	def_bool n
 
+config ARCH_ENABLE_MEMORY_HOTPLUG
+	bool
+
 # eventually, we can have this option just 'select SPARSEMEM'
 config MEMORY_HOTPLUG
 	bool "Allow for memory hot-add"
@@ -176,6 +179,9 @@ config MEMORY_HOTPLUG_DEFAULT_ONLINE
 	  Say N here if you want the default policy to keep all hot-plugged
 	  memory blocks in 'offline' state.
 
+config ARCH_ENABLE_MEMORY_HOTREMOVE
+	bool
+
 config MEMORY_HOTREMOVE
 	bool "Allow for memory hot remove"
 	select HAVE_BOOTMEM_INFO_NODE if (X86_64 || PPC64)
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 105/143] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION
  2021-05-05  1:32 incoming Andrew Morton
                   ` (102 preceding siblings ...)
  2021-05-05  1:38 ` [patch 104/143] mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] Andrew Morton
@ 2021-05-05  1:38 ` Andrew Morton
  2021-05-05  1:38 ` [patch 108/143] mm/util.c: reduce mem_dump_obj() object size Andrew Morton
                   ` (36 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:38 UTC (permalink / raw)
  To: akpm, anshuman.khandual, aou, arnd, benh, borntraeger, bp,
	catalin.marinas, dalias, deller, gor, hca, hpa, James.Bottomley,
	linux-mm, linux, mingo, mm-commits, mpe, palmerdabbelt,
	paul.walmsley, paulus, tglx, torvalds, tsbogend, vgupta, viro,
	will, ysato

From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION

ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION configs have duplicate definitions on
platforms that subscribe them.  Drop these reduntant definitions and
instead just select them appropriately.

[akpm@linux-foundation.org: s/x86_64/X86_64/, per Oscar]
Link: https://lkml.kernel.org/r/1617259448-22529-5-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com>	[arm64]
Cc: Will Deacon <will@kernel.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: Helge Deller <deller@gmx.de>
Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com>
Cc: Palmer Dabbelt <palmerdabbelt@google.com>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Rich Felker <dalias@libc.org>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/arm64/Kconfig                     |   10 ++--------
 arch/powerpc/platforms/Kconfig.cputype |    5 +----
 arch/x86/Kconfig                       |   10 ++--------
 3 files changed, 5 insertions(+), 20 deletions(-)

--- a/arch/arm64/Kconfig~mm-drop-redundant-arch_enable__migration
+++ a/arch/arm64/Kconfig
@@ -11,8 +11,10 @@ config ARM64
 	select ACPI_PPTT if ACPI
 	select ARCH_HAS_DEBUG_WX
 	select ARCH_BINFMT_ELF_STATE
+	select ARCH_ENABLE_HUGEPAGE_MIGRATION if HUGETLB_PAGE && MIGRATION
 	select ARCH_ENABLE_MEMORY_HOTPLUG
 	select ARCH_ENABLE_MEMORY_HOTREMOVE
+	select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE
 	select ARCH_HAS_CACHE_LINE_SIZE
 	select ARCH_HAS_DEBUG_VIRTUAL
 	select ARCH_HAS_DEBUG_VM_PGTABLE
@@ -1916,14 +1918,6 @@ config SYSVIPC_COMPAT
 	def_bool y
 	depends on COMPAT && SYSVIPC
 
-config ARCH_ENABLE_HUGEPAGE_MIGRATION
-	def_bool y
-	depends on HUGETLB_PAGE && MIGRATION
-
-config ARCH_ENABLE_THP_MIGRATION
-	def_bool y
-	depends on TRANSPARENT_HUGEPAGE
-
 menu "Power management options"
 
 source "kernel/power/Kconfig"
--- a/arch/powerpc/platforms/Kconfig.cputype~mm-drop-redundant-arch_enable__migration
+++ a/arch/powerpc/platforms/Kconfig.cputype
@@ -96,6 +96,7 @@ config PPC_BOOK3S_64
 	select PPC_FPU
 	select PPC_HAVE_PMU_SUPPORT
 	select HAVE_ARCH_TRANSPARENT_HUGEPAGE
+	select ARCH_ENABLE_HUGEPAGE_MIGRATION if HUGETLB_PAGE && MIGRATION
 	select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE
 	select ARCH_SUPPORTS_HUGETLBFS
 	select ARCH_SUPPORTS_NUMA_BALANCING
@@ -420,10 +421,6 @@ config PPC_PKEY
 	depends on PPC_BOOK3S_64
 	depends on PPC_MEM_KEYS || PPC_KUAP || PPC_KUEP
 
-config ARCH_ENABLE_HUGEPAGE_MIGRATION
-	def_bool y
-	depends on PPC_BOOK3S_64 && HUGETLB_PAGE && MIGRATION
-
 
 config PPC_MMU_NOHASH
 	def_bool y
--- a/arch/x86/Kconfig~mm-drop-redundant-arch_enable__migration
+++ a/arch/x86/Kconfig
@@ -60,8 +60,10 @@ config X86
 	select ACPI_SYSTEM_POWER_STATES_SUPPORT	if ACPI
 	select ARCH_32BIT_OFF_T			if X86_32
 	select ARCH_CLOCKSOURCE_INIT
+	select ARCH_ENABLE_HUGEPAGE_MIGRATION if X86_64 && HUGETLB_PAGE && MIGRATION
 	select ARCH_ENABLE_MEMORY_HOTPLUG if X86_64 || (X86_32 && HIGHMEM)
 	select ARCH_ENABLE_MEMORY_HOTREMOVE if MEMORY_HOTPLUG
+	select ARCH_ENABLE_THP_MIGRATION if X86_64 && TRANSPARENT_HUGEPAGE
 	select ARCH_HAS_ACPI_TABLE_UPGRADE	if ACPI
 	select ARCH_HAS_CACHE_LINE_SIZE
 	select ARCH_HAS_DEBUG_VIRTUAL
@@ -2437,14 +2439,6 @@ config ARCH_ENABLE_SPLIT_PMD_PTLOCK
 	def_bool y
 	depends on X86_64 || X86_PAE
 
-config ARCH_ENABLE_HUGEPAGE_MIGRATION
-	def_bool y
-	depends on X86_64 && HUGETLB_PAGE && MIGRATION
-
-config ARCH_ENABLE_THP_MIGRATION
-	def_bool y
-	depends on X86_64 && TRANSPARENT_HUGEPAGE
-
 menu "Power management and ACPI options"
 
 config ARCH_HIBERNATION_HEADER
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 108/143] mm/util.c: reduce mem_dump_obj() object size
  2021-05-05  1:32 incoming Andrew Morton
                   ` (103 preceding siblings ...)
  2021-05-05  1:38 ` [patch 105/143] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION Andrew Morton
@ 2021-05-05  1:38 ` Andrew Morton
  2021-05-05  1:38 ` [patch 109/143] mm/util.c: fix typo Andrew Morton
                   ` (35 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:38 UTC (permalink / raw)
  To: akpm, joe, linux-mm, mm-commits, torvalds

From: Joe Perches <joe@perches.com>
Subject: mm/util.c: reduce mem_dump_obj() object size

Simplify the code by using a temporary and reduce the object size by using
a single call to pr_cont().  Reverse a test and unindent a block too.

$ size mm/util.o* (defconfig x86-64)
   text	   data	    bss	    dec	    hex	filename
   7419	    372	     40	   7831	   1e97	mm/util.o.new
   7477	    372	     40	   7889	   1ed1	mm/util.o.old

Link: https://lkml.kernel.org/r/a6e105886338f68afd35f7a13d73bcf06b0cc732.camel@perches.com
Signed-off-by: Joe Perches <joe@perches.com>
Reviewed-by: Andrew Morton <akpm@linux-foundation.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/util.c |   24 ++++++++++++++----------
 1 file changed, 14 insertions(+), 10 deletions(-)

--- a/mm/util.c~mm-reduce-mem_dump_obj-object-size
+++ a/mm/util.c
@@ -987,22 +987,26 @@ int __weak memcmp_pages(struct page *pag
  */
 void mem_dump_obj(void *object)
 {
+	const char *type;
+
 	if (kmem_valid_obj(object)) {
 		kmem_dump_obj(object);
 		return;
 	}
+
 	if (vmalloc_dump_obj(object))
 		return;
-	if (!virt_addr_valid(object)) {
-		if (object == NULL)
-			pr_cont(" NULL pointer.\n");
-		else if (object == ZERO_SIZE_PTR)
-			pr_cont(" zero-size pointer.\n");
-		else
-			pr_cont(" non-paged memory.\n");
-		return;
-	}
-	pr_cont(" non-slab/vmalloc memory.\n");
+
+	if (virt_addr_valid(object))
+		type = "non-slab/vmalloc memory";
+	else if (object == NULL)
+		type = "NULL pointer";
+	else if (object == ZERO_SIZE_PTR)
+		type = "zero-size pointer";
+	else
+		type = "non-paged memory";
+
+	pr_cont(" %s\n", type);
 }
 EXPORT_SYMBOL_GPL(mem_dump_obj);
 #endif
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 109/143] mm/util.c: fix typo
  2021-05-05  1:32 incoming Andrew Morton
                   ` (104 preceding siblings ...)
  2021-05-05  1:38 ` [patch 108/143] mm/util.c: reduce mem_dump_obj() object size Andrew Morton
@ 2021-05-05  1:38 ` Andrew Morton
  2021-05-05  1:38 ` [patch 110/143] mm/gup: don't pin migrated cma pages in movable zone Andrew Morton
                   ` (34 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:38 UTC (permalink / raw)
  To: akpm, linux-mm, mm-commits, rdunlap, torvalds, unixbhaskar, willy

From: Bhaskar Chowdhury <unixbhaskar@gmail.com>
Subject: mm/util.c: fix typo

s/condtion/condition/

Link: https://lkml.kernel.org/r/20210317033439.3429411-1-unixbhaskar@gmail.com
Signed-off-by: Bhaskar Chowdhury <unixbhaskar@gmail.com>
Acked-by: Randy Dunlap <rdunlap@infradead.org>
Cc: Matthew Wilcox <willy@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/util.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/mm/util.c~mm-typo-fix-in-the-file-utilc
+++ a/mm/util.c
@@ -765,7 +765,7 @@ int overcommit_policy_handler(struct ctl
 	 * The deviation of sync_overcommit_as could be big with loose policy
 	 * like OVERCOMMIT_ALWAYS/OVERCOMMIT_GUESS. When changing policy to
 	 * strict OVERCOMMIT_NEVER, we need to reduce the deviation to comply
-	 * with the strict "NEVER", and to avoid possible race condtion (even
+	 * with the strict "NEVER", and to avoid possible race condition (even
 	 * though user usually won't too frequently do the switching to policy
 	 * OVERCOMMIT_NEVER), the switch is done in the following order:
 	 *	1. changing the batch
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 110/143] mm/gup: don't pin migrated cma pages in movable zone
  2021-05-05  1:32 incoming Andrew Morton
                   ` (105 preceding siblings ...)
  2021-05-05  1:38 ` [patch 109/143] mm/util.c: fix typo Andrew Morton
@ 2021-05-05  1:38 ` Andrew Morton
  2021-05-05  1:38 ` [patch 111/143] mm/gup: check every subpage of a compound page during isolation Andrew Morton
                   ` (33 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:38 UTC (permalink / raw)
  To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
	jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
	mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
	peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
	willy

From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: don't pin migrated cma pages in movable zone

Patch series "prohibit pinning pages in ZONE_MOVABLE", v11.

When page is pinned it cannot be moved and its physical address stays
the same until pages is unpinned.

This is useful functionality to allows userland to implementation DMA
access. For example, it is used by vfio in vfio_pin_pages().

However, this functionality breaks memory hotplug/hotremove assumptions
that pages in ZONE_MOVABLE can always be migrated.

This patch series fixes this issue by forcing new allocations during
page pinning to omit ZONE_MOVABLE, and also to migrate any existing
pages from ZONE_MOVABLE during pinning.

It uses the same scheme logic that is currently used by CMA, and extends
the functionality for all allocations.

For more information read the discussion [1] about this problem.
[1] https://lore.kernel.org/lkml/CA+CK2bBffHBxjmb9jmSKacm0fJMinyt3Nhk8Nx6iudcQSj80_w@mail.gmail.com


This patch (of 14):

In order not to fragment CMA the pinned pages are migrated.  However, they
are migrated to ZONE_MOVABLE, which also should not have pinned pages.

Remove __GFP_MOVABLE, so pages can be migrated to zones where pinning is
allowed.

Link: https://lkml.kernel.org/r/20210215161349.246722-1-pasha.tatashin@soleen.com
Link: https://lkml.kernel.org/r/20210215161349.246722-2-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Michal Hocko <mhocko@suse.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: David Rientjes <rientjes@google.com>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Michal Hocko <mhocko@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/gup.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/mm/gup.c~mm-gup-dont-pin-migrated-cma-pages-in-movable-zone
+++ a/mm/gup.c
@@ -1616,7 +1616,7 @@ static long check_and_migrate_cma_pages(
 	long ret = nr_pages;
 	struct migration_target_control mtc = {
 		.nid = NUMA_NO_NODE,
-		.gfp_mask = GFP_USER | __GFP_MOVABLE | __GFP_NOWARN,
+		.gfp_mask = GFP_USER | __GFP_NOWARN,
 	};
 
 check_again:
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 111/143] mm/gup: check every subpage of a compound page during isolation
  2021-05-05  1:32 incoming Andrew Morton
                   ` (106 preceding siblings ...)
  2021-05-05  1:38 ` [patch 110/143] mm/gup: don't pin migrated cma pages in movable zone Andrew Morton
@ 2021-05-05  1:38 ` Andrew Morton
  2021-05-05  1:38 ` [patch 112/143] mm/gup: return an error on migration failure Andrew Morton
                   ` (32 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:38 UTC (permalink / raw)
  To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
	jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
	mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
	peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
	willy

From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: check every subpage of a compound page during isolation

When pages are isolated in check_and_migrate_movable_pages() we skip
compound number of pages at a time.  However, as Jason noted, it is not
necessary correct that pages[i] corresponds to the pages that we skipped. 
This is because it is possible that the addresses in this range had
split_huge_pmd()/split_huge_pud(), and these functions do not update the
compound page metadata.

The problem can be reproduced if something like this occurs:

1. User faulted huge pages.
2. split_huge_pmd() was called for some reason
3. User has unmapped some sub-pages in the range
4. User tries to longterm pin the addresses.

The resulting pages[i] might end-up having pages which are not compound
size page aligned.

Link: https://lkml.kernel.org/r/20210215161349.246722-3-pasha.tatashin@soleen.com
Fixes: aa712399c1e8 ("mm/gup: speed up check_and_migrate_cma_pages() on huge page")
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reported-by: Jason Gunthorpe <jgg@nvidia.com>
Reviewed-by: Jason Gunthorpe <jgg@nvidia.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/gup.c |   19 +++++++------------
 1 file changed, 7 insertions(+), 12 deletions(-)

--- a/mm/gup.c~mm-gup-check-every-subpage-of-a-compound-page-during-isolation
+++ a/mm/gup.c
@@ -1609,26 +1609,23 @@ static long check_and_migrate_cma_pages(
 					unsigned int gup_flags)
 {
 	unsigned long i;
-	unsigned long step;
 	bool drain_allow = true;
 	bool migrate_allow = true;
 	LIST_HEAD(cma_page_list);
 	long ret = nr_pages;
+	struct page *prev_head, *head;
 	struct migration_target_control mtc = {
 		.nid = NUMA_NO_NODE,
 		.gfp_mask = GFP_USER | __GFP_NOWARN,
 	};
 
 check_again:
-	for (i = 0; i < nr_pages;) {
-
-		struct page *head = compound_head(pages[i]);
-
-		/*
-		 * gup may start from a tail page. Advance step by the left
-		 * part.
-		 */
-		step = compound_nr(head) - (pages[i] - head);
+	prev_head = NULL;
+	for (i = 0; i < nr_pages; i++) {
+		head = compound_head(pages[i]);
+		if (head == prev_head)
+			continue;
+		prev_head = head;
 		/*
 		 * If we get a page from the CMA zone, since we are going to
 		 * be pinning these entries, we might as well move them out
@@ -1652,8 +1649,6 @@ check_again:
 				}
 			}
 		}
-
-		i += step;
 	}
 
 	if (!list_empty(&cma_page_list)) {
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 112/143] mm/gup: return an error on migration failure
  2021-05-05  1:32 incoming Andrew Morton
                   ` (107 preceding siblings ...)
  2021-05-05  1:38 ` [patch 111/143] mm/gup: check every subpage of a compound page during isolation Andrew Morton
@ 2021-05-05  1:38 ` Andrew Morton
  2021-05-05  1:38 ` [patch 113/143] mm/gup: check for isolation errors Andrew Morton
                   ` (31 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:38 UTC (permalink / raw)
  To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
	jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
	mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
	peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
	willy

From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: return an error on migration failure

When migration failure occurs, we still pin pages, which means
that we may pin CMA movable pages which should never be the case.

Instead return an error without pinning pages when migration failure
happens.

No need to retry migrating, because migrate_pages() already retries
10 times.

Link: https://lkml.kernel.org/r/20210215161349.246722-4-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: Jason Gunthorpe <jgg@nvidia.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/gup.c |   17 +++++++----------
 1 file changed, 7 insertions(+), 10 deletions(-)

--- a/mm/gup.c~mm-gup-return-an-error-on-migration-failure
+++ a/mm/gup.c
@@ -1610,7 +1610,6 @@ static long check_and_migrate_cma_pages(
 {
 	unsigned long i;
 	bool drain_allow = true;
-	bool migrate_allow = true;
 	LIST_HEAD(cma_page_list);
 	long ret = nr_pages;
 	struct page *prev_head, *head;
@@ -1661,17 +1660,15 @@ check_again:
 			for (i = 0; i < nr_pages; i++)
 				put_page(pages[i]);
 
-		if (migrate_pages(&cma_page_list, alloc_migration_target, NULL,
-			(unsigned long)&mtc, MIGRATE_SYNC, MR_CONTIG_RANGE)) {
-			/*
-			 * some of the pages failed migration. Do get_user_pages
-			 * without migration.
-			 */
-			migrate_allow = false;
-
+		ret = migrate_pages(&cma_page_list, alloc_migration_target,
+				    NULL, (unsigned long)&mtc, MIGRATE_SYNC,
+				    MR_CONTIG_RANGE);
+		if (ret) {
 			if (!list_empty(&cma_page_list))
 				putback_movable_pages(&cma_page_list);
+			return ret > 0 ? -ENOMEM : ret;
 		}
+
 		/*
 		 * We did migrate all the pages, Try to get the page references
 		 * again migrating any new CMA pages which we failed to isolate
@@ -1681,7 +1678,7 @@ check_again:
 						   pages, vmas, NULL,
 						   gup_flags);
 
-		if ((ret > 0) && migrate_allow) {
+		if (ret > 0) {
 			nr_pages = ret;
 			drain_allow = true;
 			goto check_again;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 113/143] mm/gup: check for isolation errors
  2021-05-05  1:32 incoming Andrew Morton
                   ` (108 preceding siblings ...)
  2021-05-05  1:38 ` [patch 112/143] mm/gup: return an error on migration failure Andrew Morton
@ 2021-05-05  1:38 ` Andrew Morton
  2021-05-05  1:38 ` [patch 114/143] mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN Andrew Morton
                   ` (30 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:38 UTC (permalink / raw)
  To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
	jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
	mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
	peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
	willy

From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: check for isolation errors

It is still possible that we pin movable CMA pages if there are isolation
errors and cma_page_list stays empty when we check again.

Check for isolation errors, and return success only when there are no
isolation errors, and cma_page_list is empty after checking.

Because isolation errors are transient, we retry indefinitely.

Link: https://lkml.kernel.org/r/20210215161349.246722-5-pasha.tatashin@soleen.com
Fixes: 9a4e9f3b2d73 ("mm: update get_user_pages_longterm to migrate pages allocated from CMA region")
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: Jason Gunthorpe <jgg@nvidia.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/gup.c |   60 ++++++++++++++++++++++++++++++-----------------------
 1 file changed, 34 insertions(+), 26 deletions(-)

--- a/mm/gup.c~mm-gup-check-for-isolation-errors
+++ a/mm/gup.c
@@ -1608,8 +1608,8 @@ static long check_and_migrate_cma_pages(
 					struct vm_area_struct **vmas,
 					unsigned int gup_flags)
 {
-	unsigned long i;
-	bool drain_allow = true;
+	unsigned long i, isolation_error_count;
+	bool drain_allow;
 	LIST_HEAD(cma_page_list);
 	long ret = nr_pages;
 	struct page *prev_head, *head;
@@ -1620,6 +1620,8 @@ static long check_and_migrate_cma_pages(
 
 check_again:
 	prev_head = NULL;
+	isolation_error_count = 0;
+	drain_allow = true;
 	for (i = 0; i < nr_pages; i++) {
 		head = compound_head(pages[i]);
 		if (head == prev_head)
@@ -1631,25 +1633,35 @@ check_again:
 		 * of the CMA zone if possible.
 		 */
 		if (is_migrate_cma_page(head)) {
-			if (PageHuge(head))
-				isolate_huge_page(head, &cma_page_list);
-			else {
+			if (PageHuge(head)) {
+				if (!isolate_huge_page(head, &cma_page_list))
+					isolation_error_count++;
+			} else {
 				if (!PageLRU(head) && drain_allow) {
 					lru_add_drain_all();
 					drain_allow = false;
 				}
 
-				if (!isolate_lru_page(head)) {
-					list_add_tail(&head->lru, &cma_page_list);
-					mod_node_page_state(page_pgdat(head),
-							    NR_ISOLATED_ANON +
-							    page_is_file_lru(head),
-							    thp_nr_pages(head));
+				if (isolate_lru_page(head)) {
+					isolation_error_count++;
+					continue;
 				}
+				list_add_tail(&head->lru, &cma_page_list);
+				mod_node_page_state(page_pgdat(head),
+						    NR_ISOLATED_ANON +
+						    page_is_file_lru(head),
+						    thp_nr_pages(head));
 			}
 		}
 	}
 
+	/*
+	 * If list is empty, and no isolation errors, means that all pages are
+	 * in the correct zone.
+	 */
+	if (list_empty(&cma_page_list) && !isolation_error_count)
+		return ret;
+
 	if (!list_empty(&cma_page_list)) {
 		/*
 		 * drop the above get_user_pages reference.
@@ -1669,23 +1681,19 @@ check_again:
 			return ret > 0 ? -ENOMEM : ret;
 		}
 
-		/*
-		 * We did migrate all the pages, Try to get the page references
-		 * again migrating any new CMA pages which we failed to isolate
-		 * earlier.
-		 */
-		ret = __get_user_pages_locked(mm, start, nr_pages,
-						   pages, vmas, NULL,
-						   gup_flags);
-
-		if (ret > 0) {
-			nr_pages = ret;
-			drain_allow = true;
-			goto check_again;
-		}
+		/* We unpinned pages before migration, pin them again */
+		ret = __get_user_pages_locked(mm, start, nr_pages, pages, vmas,
+					      NULL, gup_flags);
+		if (ret <= 0)
+			return ret;
+		nr_pages = ret;
 	}
 
-	return ret;
+	/*
+	 * check again because pages were unpinned, and we also might have
+	 * had isolation errors and need more pages to migrate.
+	 */
+	goto check_again;
 }
 #else
 static long check_and_migrate_cma_pages(struct mm_struct *mm,
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 114/143] mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN
  2021-05-05  1:32 incoming Andrew Morton
                   ` (109 preceding siblings ...)
  2021-05-05  1:38 ` [patch 113/143] mm/gup: check for isolation errors Andrew Morton
@ 2021-05-05  1:38 ` Andrew Morton
  2021-05-05  1:38 ` [patch 115/143] mm: apply per-task gfp constraints in fast path Andrew Morton
                   ` (29 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:38 UTC (permalink / raw)
  To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
	jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
	mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
	peterz, rientjes, rostedt, rppt, sashal, torvalds, tyhicks,
	vbabka, willy

From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN

PF_MEMALLOC_NOCMA is used ot guarantee that the allocator will not return
pages that might belong to CMA region.  This is currently used for long
term gup to make sure that such pins are not going to be done on any CMA
pages.

When PF_MEMALLOC_NOCMA has been introduced we haven't realized that it is
focusing on CMA pages too much and that there is larger class of pages
that need the same treatment.  MOVABLE zone cannot contain any long term
pins as well so it makes sense to reuse and redefine this flag for that
usecase as well.  Rename the flag to PF_MEMALLOC_PIN which defines an
allocation context which can only get pages suitable for long-term pins.

Also rename: memalloc_nocma_save()/memalloc_nocma_restore to
memalloc_pin_save()/memalloc_pin_restore() and make the new functions
common.

[rppt@linux.ibm.com: fix renaming of PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN]
  Link: https://lkml.kernel.org/r/20210331163816.11517-1-rppt@kernel.org
Link: https://lkml.kernel.org/r/20210215161349.246722-6-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/sched.h    |    2 +-
 include/linux/sched/mm.h |   21 +++++----------------
 mm/gup.c                 |    4 ++--
 mm/hugetlb.c             |    4 ++--
 mm/page_alloc.c          |    4 ++--
 5 files changed, 12 insertions(+), 23 deletions(-)

--- a/include/linux/sched.h~mm-cma-rename-pf_memalloc_nocma-to-pf_memalloc_pin
+++ a/include/linux/sched.h
@@ -1583,7 +1583,7 @@ extern struct pid *cad_pid;
 #define PF_SWAPWRITE		0x00800000	/* Allowed to write to swap */
 #define PF_NO_SETAFFINITY	0x04000000	/* Userland is not allowed to meddle with cpus_mask */
 #define PF_MCE_EARLY		0x08000000      /* Early kill for mce process policy */
-#define PF_MEMALLOC_NOCMA	0x10000000	/* All allocation request will have _GFP_MOVABLE cleared */
+#define PF_MEMALLOC_PIN		0x10000000	/* Allocation context constrained to zones which allow long term pinning. */
 #define PF_FREEZER_SKIP		0x40000000	/* Freezer should not count it as freezable */
 #define PF_SUSPEND_TASK		0x80000000      /* This thread called freeze_processes() and should not be frozen */
 
--- a/include/linux/sched/mm.h~mm-cma-rename-pf_memalloc_nocma-to-pf_memalloc_pin
+++ a/include/linux/sched/mm.h
@@ -271,29 +271,18 @@ static inline void memalloc_noreclaim_re
 	current->flags = (current->flags & ~PF_MEMALLOC) | flags;
 }
 
-#ifdef CONFIG_CMA
-static inline unsigned int memalloc_nocma_save(void)
+static inline unsigned int memalloc_pin_save(void)
 {
-	unsigned int flags = current->flags & PF_MEMALLOC_NOCMA;
+	unsigned int flags = current->flags & PF_MEMALLOC_PIN;
 
-	current->flags |= PF_MEMALLOC_NOCMA;
+	current->flags |= PF_MEMALLOC_PIN;
 	return flags;
 }
 
-static inline void memalloc_nocma_restore(unsigned int flags)
+static inline void memalloc_pin_restore(unsigned int flags)
 {
-	current->flags = (current->flags & ~PF_MEMALLOC_NOCMA) | flags;
+	current->flags = (current->flags & ~PF_MEMALLOC_PIN) | flags;
 }
-#else
-static inline unsigned int memalloc_nocma_save(void)
-{
-	return 0;
-}
-
-static inline void memalloc_nocma_restore(unsigned int flags)
-{
-}
-#endif
 
 #ifdef CONFIG_MEMCG
 DECLARE_PER_CPU(struct mem_cgroup *, int_active_memcg);
--- a/mm/gup.c~mm-cma-rename-pf_memalloc_nocma-to-pf_memalloc_pin
+++ a/mm/gup.c
@@ -1722,7 +1722,7 @@ static long __gup_longterm_locked(struct
 	long rc;
 
 	if (gup_flags & FOLL_LONGTERM)
-		flags = memalloc_nocma_save();
+		flags = memalloc_pin_save();
 
 	rc = __get_user_pages_locked(mm, start, nr_pages, pages, vmas, NULL,
 				     gup_flags);
@@ -1731,7 +1731,7 @@ static long __gup_longterm_locked(struct
 		if (rc > 0)
 			rc = check_and_migrate_cma_pages(mm, start, rc, pages,
 							 vmas, gup_flags);
-		memalloc_nocma_restore(flags);
+		memalloc_pin_restore(flags);
 	}
 	return rc;
 }
--- a/mm/hugetlb.c~mm-cma-rename-pf_memalloc_nocma-to-pf_memalloc_pin
+++ a/mm/hugetlb.c
@@ -1079,11 +1079,11 @@ static void enqueue_huge_page(struct hst
 static struct page *dequeue_huge_page_node_exact(struct hstate *h, int nid)
 {
 	struct page *page;
-	bool nocma = !!(current->flags & PF_MEMALLOC_NOCMA);
+	bool pin = !!(current->flags & PF_MEMALLOC_PIN);
 
 	lockdep_assert_held(&hugetlb_lock);
 	list_for_each_entry(page, &h->hugepage_freelists[nid], lru) {
-		if (nocma && is_migrate_cma_page(page))
+		if (pin && is_migrate_cma_page(page))
 			continue;
 
 		if (PageHWPoison(page))
--- a/mm/page_alloc.c~mm-cma-rename-pf_memalloc_nocma-to-pf_memalloc_pin
+++ a/mm/page_alloc.c
@@ -3865,8 +3865,8 @@ static inline unsigned int current_alloc
 #ifdef CONFIG_CMA
 	unsigned int pflags = current->flags;
 
-	if (!(pflags & PF_MEMALLOC_NOCMA) &&
-			gfp_migratetype(gfp_mask) == MIGRATE_MOVABLE)
+	if (!(pflags & PF_MEMALLOC_PIN) &&
+	    gfp_migratetype(gfp_mask) == MIGRATE_MOVABLE)
 		alloc_flags |= ALLOC_CMA;
 
 #endif
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 115/143] mm: apply per-task gfp constraints in fast path
  2021-05-05  1:32 incoming Andrew Morton
                   ` (110 preceding siblings ...)
  2021-05-05  1:38 ` [patch 114/143] mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN Andrew Morton
@ 2021-05-05  1:38 ` Andrew Morton
  2021-05-05  1:39 ` [patch 116/143] mm: honor PF_MEMALLOC_PIN for all movable pages Andrew Morton
                   ` (28 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:38 UTC (permalink / raw)
  To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
	jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
	mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
	peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
	willy

From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm: apply per-task gfp constraints in fast path

Function current_gfp_context() is called after fast path.  However, soon
we will add more constraints which will also limit zones based on context.
Move this call into fast path, and apply the correct constraints for all
allocations.

Also update .reclaim_idx based on value returned by current_gfp_context()
because it soon will modify the allowed zones.

Note:
With this patch we will do one extra current->flags load during fast path,
but we already load current->flags in fast-path:

__alloc_pages()
 prepare_alloc_pages()
  current_alloc_flags(gfp_mask, *alloc_flags);

Later, when we add the zone constrain logic to current_gfp_context() we
will be able to remove current->flags load from current_alloc_flags, and
therefore return fast-path to the current performance level.

Link: https://lkml.kernel.org/r/20210215161349.246722-7-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Suggested-by: Michal Hocko <mhocko@kernel.org>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/page_alloc.c |   15 ++++++++-------
 1 file changed, 8 insertions(+), 7 deletions(-)

--- a/mm/page_alloc.c~mm-apply-per-task-gfp-constraints-in-fast-path
+++ a/mm/page_alloc.c
@@ -5180,6 +5180,13 @@ struct page *__alloc_pages(gfp_t gfp, un
 	}
 
 	gfp &= gfp_allowed_mask;
+	/*
+	 * Apply scoped allocation constraints. This is mainly about GFP_NOFS
+	 * resp. GFP_NOIO which has to be inherited for all allocation requests
+	 * from a particular context which has been marked by
+	 * memalloc_no{fs,io}_{save,restore}.
+	 */
+	gfp = current_gfp_context(gfp);
 	alloc_gfp = gfp;
 	if (!prepare_alloc_pages(gfp, order, preferred_nid, nodemask, &ac,
 			&alloc_gfp, &alloc_flags))
@@ -5196,13 +5203,7 @@ struct page *__alloc_pages(gfp_t gfp, un
 	if (likely(page))
 		goto out;
 
-	/*
-	 * Apply scoped allocation constraints. This is mainly about GFP_NOFS
-	 * resp. GFP_NOIO which has to be inherited for all allocation requests
-	 * from a particular context which has been marked by
-	 * memalloc_no{fs,io}_{save,restore}.
-	 */
-	alloc_gfp = current_gfp_context(gfp);
+	alloc_gfp = gfp;
 	ac.spread_dirty_pages = false;
 
 	/*
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 116/143] mm: honor PF_MEMALLOC_PIN for all movable pages
  2021-05-05  1:32 incoming Andrew Morton
                   ` (111 preceding siblings ...)
  2021-05-05  1:38 ` [patch 115/143] mm: apply per-task gfp constraints in fast path Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 117/143] mm/gup: do not migrate zero page Andrew Morton
                   ` (27 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
	jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
	mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
	peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
	willy

From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm: honor PF_MEMALLOC_PIN for all movable pages

PF_MEMALLOC_PIN is only honored for CMA pages, extend this flag to work
for any allocations from ZONE_MOVABLE by removing __GFP_MOVABLE from
gfp_mask when this flag is passed in the current context.

Add is_pinnable_page() to return true if page is in a pinnable page.  A
pinnable page is not in ZONE_MOVABLE and not of MIGRATE_CMA type.

Link: https://lkml.kernel.org/r/20210215161349.246722-8-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/mm.h       |   18 ++++++++++++++++++
 include/linux/sched/mm.h |    6 +++++-
 mm/hugetlb.c             |    2 +-
 mm/page_alloc.c          |   20 +++++++++-----------
 4 files changed, 33 insertions(+), 13 deletions(-)

--- a/include/linux/mm.h~mm-honor-pf_memalloc_pin-for-all-movable-pages
+++ a/include/linux/mm.h
@@ -1141,6 +1141,11 @@ static inline bool is_zone_device_page(c
 }
 #endif
 
+static inline bool is_zone_movable_page(const struct page *page)
+{
+	return page_zonenum(page) == ZONE_MOVABLE;
+}
+
 #ifdef CONFIG_DEV_PAGEMAP_OPS
 void free_devmap_managed_page(struct page *page);
 DECLARE_STATIC_KEY_FALSE(devmap_managed_key);
@@ -1550,6 +1555,19 @@ static inline unsigned long page_to_sect
 }
 #endif
 
+/* MIGRATE_CMA and ZONE_MOVABLE do not allow pin pages */
+#ifdef CONFIG_MIGRATION
+static inline bool is_pinnable_page(struct page *page)
+{
+	return !is_zone_movable_page(page) && !is_migrate_cma_page(page);
+}
+#else
+static inline bool is_pinnable_page(struct page *page)
+{
+	return true;
+}
+#endif
+
 static inline void set_page_zone(struct page *page, enum zone_type zone)
 {
 	page->flags &= ~(ZONES_MASK << ZONES_PGSHIFT);
--- a/include/linux/sched/mm.h~mm-honor-pf_memalloc_pin-for-all-movable-pages
+++ a/include/linux/sched/mm.h
@@ -151,12 +151,13 @@ static inline bool in_vfork(struct task_
  * Applies per-task gfp context to the given allocation flags.
  * PF_MEMALLOC_NOIO implies GFP_NOIO
  * PF_MEMALLOC_NOFS implies GFP_NOFS
+ * PF_MEMALLOC_PIN  implies !GFP_MOVABLE
  */
 static inline gfp_t current_gfp_context(gfp_t flags)
 {
 	unsigned int pflags = READ_ONCE(current->flags);
 
-	if (unlikely(pflags & (PF_MEMALLOC_NOIO | PF_MEMALLOC_NOFS))) {
+	if (unlikely(pflags & (PF_MEMALLOC_NOIO | PF_MEMALLOC_NOFS | PF_MEMALLOC_PIN))) {
 		/*
 		 * NOIO implies both NOIO and NOFS and it is a weaker context
 		 * so always make sure it makes precedence
@@ -165,6 +166,9 @@ static inline gfp_t current_gfp_context(
 			flags &= ~(__GFP_IO | __GFP_FS);
 		else if (pflags & PF_MEMALLOC_NOFS)
 			flags &= ~__GFP_FS;
+
+		if (pflags & PF_MEMALLOC_PIN)
+			flags &= ~__GFP_MOVABLE;
 	}
 	return flags;
 }
--- a/mm/hugetlb.c~mm-honor-pf_memalloc_pin-for-all-movable-pages
+++ a/mm/hugetlb.c
@@ -1083,7 +1083,7 @@ static struct page *dequeue_huge_page_no
 
 	lockdep_assert_held(&hugetlb_lock);
 	list_for_each_entry(page, &h->hugepage_freelists[nid], lru) {
-		if (pin && is_migrate_cma_page(page))
+		if (pin && !is_pinnable_page(page))
 			continue;
 
 		if (PageHWPoison(page))
--- a/mm/page_alloc.c~mm-honor-pf_memalloc_pin-for-all-movable-pages
+++ a/mm/page_alloc.c
@@ -3859,16 +3859,13 @@ alloc_flags_nofragment(struct zone *zone
 	return alloc_flags;
 }
 
-static inline unsigned int current_alloc_flags(gfp_t gfp_mask,
-					unsigned int alloc_flags)
+/* Must be called after current_gfp_context() which can change gfp_mask */
+static inline unsigned int gfp_to_alloc_flags_cma(gfp_t gfp_mask,
+						  unsigned int alloc_flags)
 {
 #ifdef CONFIG_CMA
-	unsigned int pflags = current->flags;
-
-	if (!(pflags & PF_MEMALLOC_PIN) &&
-	    gfp_migratetype(gfp_mask) == MIGRATE_MOVABLE)
+	if (gfp_migratetype(gfp_mask) == MIGRATE_MOVABLE)
 		alloc_flags |= ALLOC_CMA;
-
 #endif
 	return alloc_flags;
 }
@@ -4526,7 +4523,7 @@ gfp_to_alloc_flags(gfp_t gfp_mask)
 	} else if (unlikely(rt_task(current)) && !in_interrupt())
 		alloc_flags |= ALLOC_HARDER;
 
-	alloc_flags = current_alloc_flags(gfp_mask, alloc_flags);
+	alloc_flags = gfp_to_alloc_flags_cma(gfp_mask, alloc_flags);
 
 	return alloc_flags;
 }
@@ -4828,7 +4825,7 @@ retry:
 
 	reserve_flags = __gfp_pfmemalloc_flags(gfp_mask);
 	if (reserve_flags)
-		alloc_flags = current_alloc_flags(gfp_mask, reserve_flags);
+		alloc_flags = gfp_to_alloc_flags_cma(gfp_mask, reserve_flags);
 
 	/*
 	 * Reset the nodemask and zonelist iterators if memory policies can be
@@ -4997,7 +4994,7 @@ static inline bool prepare_alloc_pages(g
 	if (should_fail_alloc_page(gfp_mask, order))
 		return false;
 
-	*alloc_flags = current_alloc_flags(gfp_mask, *alloc_flags);
+	*alloc_flags = gfp_to_alloc_flags_cma(gfp_mask, *alloc_flags);
 
 	/* Dirty zone balancing only done in the fast path */
 	ac->spread_dirty_pages = (gfp_mask & __GFP_WRITE);
@@ -5184,7 +5181,8 @@ struct page *__alloc_pages(gfp_t gfp, un
 	 * Apply scoped allocation constraints. This is mainly about GFP_NOFS
 	 * resp. GFP_NOIO which has to be inherited for all allocation requests
 	 * from a particular context which has been marked by
-	 * memalloc_no{fs,io}_{save,restore}.
+	 * memalloc_no{fs,io}_{save,restore}. And PF_MEMALLOC_PIN which ensures
+	 * movable zones are not used during allocation.
 	 */
 	gfp = current_gfp_context(gfp);
 	alloc_gfp = gfp;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 117/143] mm/gup: do not migrate zero page
  2021-05-05  1:32 incoming Andrew Morton
                   ` (112 preceding siblings ...)
  2021-05-05  1:39 ` [patch 116/143] mm: honor PF_MEMALLOC_PIN for all movable pages Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 118/143] mm/gup: migrate pinned pages out of movable zone Andrew Morton
                   ` (26 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
	jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
	mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
	peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
	willy

From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: do not migrate zero page

On some platforms ZERO_PAGE(0) might end-up in a movable zone.  Do not
migrate zero page in gup during longterm pinning as migration of zero page
is not allowed.

For example, in x86 QEMU with 16G of memory and kernelcore=5G parameter, I
see the following:

Boot#1: zero_pfn  0x48a8d zero_pfn zone: ZONE_DMA32
Boot#2: zero_pfn 0x20168d zero_pfn zone: ZONE_MOVABLE

On x86, empty_zero_page is declared in .bss and depending on the loader
may end up in different physical locations during boots.

Also, move is_zero_pfn() my_zero_pfn() functions under CONFIG_MMU, because
zero_pfn that they are using is declared in memory.c which is compiled
with CONFIG_MMU.

Link: https://lkml.kernel.org/r/20210215161349.246722-9-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/mm.h      |    3 ++-
 include/linux/mmzone.h  |    4 ++++
 include/linux/pgtable.h |   12 ++++++++++++
 3 files changed, 18 insertions(+), 1 deletion(-)

--- a/include/linux/mm.h~mm-gup-do-not-migrate-zero-page
+++ a/include/linux/mm.h
@@ -1559,7 +1559,8 @@ static inline unsigned long page_to_sect
 #ifdef CONFIG_MIGRATION
 static inline bool is_pinnable_page(struct page *page)
 {
-	return !is_zone_movable_page(page) && !is_migrate_cma_page(page);
+	return !(is_zone_movable_page(page) || is_migrate_cma_page(page)) ||
+		is_zero_pfn(page_to_pfn(page));
 }
 #else
 static inline bool is_pinnable_page(struct page *page)
--- a/include/linux/mmzone.h~mm-gup-do-not-migrate-zero-page
+++ a/include/linux/mmzone.h
@@ -427,6 +427,10 @@ enum zone_type {
 	 *    techniques might use alloc_contig_range() to hide previously
 	 *    exposed pages from the buddy again (e.g., to implement some sort
 	 *    of memory unplug in virtio-mem).
+	 * 6. ZERO_PAGE(0), kernelcore/movablecore setups might create
+	 *    situations where ZERO_PAGE(0) which is allocated differently
+	 *    on different platforms may end up in a movable zone. ZERO_PAGE(0)
+	 *    cannot be migrated.
 	 *
 	 * In general, no unmovable allocations that degrade memory offlining
 	 * should end up in ZONE_MOVABLE. Allocators (like alloc_contig_range())
--- a/include/linux/pgtable.h~mm-gup-do-not-migrate-zero-page
+++ a/include/linux/pgtable.h
@@ -1111,6 +1111,7 @@ extern void untrack_pfn(struct vm_area_s
 extern void untrack_pfn_moved(struct vm_area_struct *vma);
 #endif
 
+#ifdef CONFIG_MMU
 #ifdef __HAVE_COLOR_ZERO_PAGE
 static inline int is_zero_pfn(unsigned long pfn)
 {
@@ -1134,6 +1135,17 @@ static inline unsigned long my_zero_pfn(
 	return zero_pfn;
 }
 #endif
+#else
+static inline int is_zero_pfn(unsigned long pfn)
+{
+	return 0;
+}
+
+static inline unsigned long my_zero_pfn(unsigned long addr)
+{
+	return 0;
+}
+#endif /* CONFIG_MMU */
 
 #ifdef CONFIG_MMU
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 118/143] mm/gup: migrate pinned pages out of movable zone
  2021-05-05  1:32 incoming Andrew Morton
                   ` (113 preceding siblings ...)
  2021-05-05  1:39 ` [patch 117/143] mm/gup: do not migrate zero page Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 119/143] memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning Andrew Morton
                   ` (25 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
	jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
	mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
	peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
	willy

From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: migrate pinned pages out of movable zone

We should not pin pages in ZONE_MOVABLE.  Currently, we do not pin only
movable CMA pages.  Generalize the function that migrates CMA pages to
migrate all movable pages.  Use is_pinnable_page() to check which pages
need to be migrated

Link: https://lkml.kernel.org/r/20210215161349.246722-10-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/migrate.h        |    1 
 include/linux/mmzone.h         |    9 +++-
 include/trace/events/migrate.h |    3 -
 mm/gup.c                       |   67 +++++++++++++++----------------
 4 files changed, 44 insertions(+), 36 deletions(-)

--- a/include/linux/migrate.h~mm-gup-migrate-pinned-pages-out-of-movable-zone
+++ a/include/linux/migrate.h
@@ -27,6 +27,7 @@ enum migrate_reason {
 	MR_MEMPOLICY_MBIND,
 	MR_NUMA_MISPLACED,
 	MR_CONTIG_RANGE,
+	MR_LONGTERM_PIN,
 	MR_TYPES
 };
 
--- a/include/linux/mmzone.h~mm-gup-migrate-pinned-pages-out-of-movable-zone
+++ a/include/linux/mmzone.h
@@ -407,8 +407,13 @@ enum zone_type {
 	 * to increase the number of THP/huge pages. Notable special cases are:
 	 *
 	 * 1. Pinned pages: (long-term) pinning of movable pages might
-	 *    essentially turn such pages unmovable. Memory offlining might
-	 *    retry a long time.
+	 *    essentially turn such pages unmovable. Therefore, we do not allow
+	 *    pinning long-term pages in ZONE_MOVABLE. When pages are pinned and
+	 *    faulted, they come from the right zone right away. However, it is
+	 *    still possible that address space already has pages in
+	 *    ZONE_MOVABLE at the time when pages are pinned (i.e. user has
+	 *    touches that memory before pinning). In such case we migrate them
+	 *    to a different zone. When migration fails - pinning fails.
 	 * 2. memblock allocations: kernelcore/movablecore setups might create
 	 *    situations where ZONE_MOVABLE contains unmovable allocations
 	 *    after boot. Memory offlining and allocations fail early.
--- a/include/trace/events/migrate.h~mm-gup-migrate-pinned-pages-out-of-movable-zone
+++ a/include/trace/events/migrate.h
@@ -20,7 +20,8 @@
 	EM( MR_SYSCALL,		"syscall_or_cpuset")		\
 	EM( MR_MEMPOLICY_MBIND,	"mempolicy_mbind")		\
 	EM( MR_NUMA_MISPLACED,	"numa_misplaced")		\
-	EMe(MR_CONTIG_RANGE,	"contig_range")
+	EM( MR_CONTIG_RANGE,	"contig_range")			\
+	EMe(MR_LONGTERM_PIN,	"longterm_pin")
 
 /*
  * First define the enums in the above macros to be exported to userspace
--- a/mm/gup.c~mm-gup-migrate-pinned-pages-out-of-movable-zone
+++ a/mm/gup.c
@@ -87,11 +87,12 @@ __maybe_unused struct page *try_grab_com
 		int orig_refs = refs;
 
 		/*
-		 * Can't do FOLL_LONGTERM + FOLL_PIN with CMA in the gup fast
-		 * path, so fail and let the caller fall back to the slow path.
+		 * Can't do FOLL_LONGTERM + FOLL_PIN gup fast path if not in a
+		 * right zone, so fail and let the caller fall back to the slow
+		 * path.
 		 */
-		if (unlikely(flags & FOLL_LONGTERM) &&
-				is_migrate_cma_page(page))
+		if (unlikely((flags & FOLL_LONGTERM) &&
+			     !is_pinnable_page(page)))
 			return NULL;
 
 		/*
@@ -1600,17 +1601,17 @@ struct page *get_dump_page(unsigned long
 }
 #endif /* CONFIG_ELF_CORE */
 
-#ifdef CONFIG_CMA
-static long check_and_migrate_cma_pages(struct mm_struct *mm,
-					unsigned long start,
-					unsigned long nr_pages,
-					struct page **pages,
-					struct vm_area_struct **vmas,
-					unsigned int gup_flags)
+#ifdef CONFIG_MIGRATION
+static long check_and_migrate_movable_pages(struct mm_struct *mm,
+					    unsigned long start,
+					    unsigned long nr_pages,
+					    struct page **pages,
+					    struct vm_area_struct **vmas,
+					    unsigned int gup_flags)
 {
 	unsigned long i, isolation_error_count;
 	bool drain_allow;
-	LIST_HEAD(cma_page_list);
+	LIST_HEAD(movable_page_list);
 	long ret = nr_pages;
 	struct page *prev_head, *head;
 	struct migration_target_control mtc = {
@@ -1628,13 +1629,12 @@ check_again:
 			continue;
 		prev_head = head;
 		/*
-		 * If we get a page from the CMA zone, since we are going to
-		 * be pinning these entries, we might as well move them out
-		 * of the CMA zone if possible.
+		 * If we get a movable page, since we are going to be pinning
+		 * these entries, try to move them out if possible.
 		 */
-		if (is_migrate_cma_page(head)) {
+		if (!is_pinnable_page(head)) {
 			if (PageHuge(head)) {
-				if (!isolate_huge_page(head, &cma_page_list))
+				if (!isolate_huge_page(head, &movable_page_list))
 					isolation_error_count++;
 			} else {
 				if (!PageLRU(head) && drain_allow) {
@@ -1646,7 +1646,7 @@ check_again:
 					isolation_error_count++;
 					continue;
 				}
-				list_add_tail(&head->lru, &cma_page_list);
+				list_add_tail(&head->lru, &movable_page_list);
 				mod_node_page_state(page_pgdat(head),
 						    NR_ISOLATED_ANON +
 						    page_is_file_lru(head),
@@ -1659,10 +1659,10 @@ check_again:
 	 * If list is empty, and no isolation errors, means that all pages are
 	 * in the correct zone.
 	 */
-	if (list_empty(&cma_page_list) && !isolation_error_count)
+	if (list_empty(&movable_page_list) && !isolation_error_count)
 		return ret;
 
-	if (!list_empty(&cma_page_list)) {
+	if (!list_empty(&movable_page_list)) {
 		/*
 		 * drop the above get_user_pages reference.
 		 */
@@ -1672,12 +1672,12 @@ check_again:
 			for (i = 0; i < nr_pages; i++)
 				put_page(pages[i]);
 
-		ret = migrate_pages(&cma_page_list, alloc_migration_target,
+		ret = migrate_pages(&movable_page_list, alloc_migration_target,
 				    NULL, (unsigned long)&mtc, MIGRATE_SYNC,
-				    MR_CONTIG_RANGE);
+				    MR_LONGTERM_PIN);
 		if (ret) {
-			if (!list_empty(&cma_page_list))
-				putback_movable_pages(&cma_page_list);
+			if (!list_empty(&movable_page_list))
+				putback_movable_pages(&movable_page_list);
 			return ret > 0 ? -ENOMEM : ret;
 		}
 
@@ -1696,16 +1696,16 @@ check_again:
 	goto check_again;
 }
 #else
-static long check_and_migrate_cma_pages(struct mm_struct *mm,
-					unsigned long start,
-					unsigned long nr_pages,
-					struct page **pages,
-					struct vm_area_struct **vmas,
-					unsigned int gup_flags)
+static long check_and_migrate_movable_pages(struct mm_struct *mm,
+					    unsigned long start,
+					    unsigned long nr_pages,
+					    struct page **pages,
+					    struct vm_area_struct **vmas,
+					    unsigned int gup_flags)
 {
 	return nr_pages;
 }
-#endif /* CONFIG_CMA */
+#endif /* CONFIG_MIGRATION */
 
 /*
  * __gup_longterm_locked() is a wrapper for __get_user_pages_locked which
@@ -1729,8 +1729,9 @@ static long __gup_longterm_locked(struct
 
 	if (gup_flags & FOLL_LONGTERM) {
 		if (rc > 0)
-			rc = check_and_migrate_cma_pages(mm, start, rc, pages,
-							 vmas, gup_flags);
+			rc = check_and_migrate_movable_pages(mm, start, rc,
+							     pages, vmas,
+							     gup_flags);
 		memalloc_pin_restore(flags);
 	}
 	return rc;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 119/143] memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning
  2021-05-05  1:32 incoming Andrew Morton
                   ` (114 preceding siblings ...)
  2021-05-05  1:39 ` [patch 118/143] mm/gup: migrate pinned pages out of movable zone Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 120/143] mm/gup: change index type to long as it counts pages Andrew Morton
                   ` (24 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
	jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
	mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
	peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
	willy

From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning

Document the special handling of page pinning when ZONE_MOVABLE present.

Link: https://lkml.kernel.org/r/20210215161349.246722-11-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Suggested-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 Documentation/admin-guide/mm/memory-hotplug.rst |    9 +++++++++
 1 file changed, 9 insertions(+)

--- a/Documentation/admin-guide/mm/memory-hotplug.rst~memory-hotplugrst-add-a-note-about-zone_movable-and-page-pinning
+++ a/Documentation/admin-guide/mm/memory-hotplug.rst
@@ -357,6 +357,15 @@ creates ZONE_MOVABLE as following.
    Unfortunately, there is no information to show which memory block belongs
    to ZONE_MOVABLE. This is TBD.
 
+.. note::
+   Techniques that rely on long-term pinnings of memory (especially, RDMA and
+   vfio) are fundamentally problematic with ZONE_MOVABLE and, therefore, memory
+   hot remove. Pinned pages cannot reside on ZONE_MOVABLE, to guarantee that
+   memory can still get hot removed - be aware that pinning can fail even if
+   there is plenty of free memory in ZONE_MOVABLE. In addition, using
+   ZONE_MOVABLE might make page pinning more expensive, because pages have to be
+   migrated off that zone first.
+
 .. _memory_hotplug_how_to_offline_memory:
 
 How to offline memory
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 120/143] mm/gup: change index type to long as it counts pages
  2021-05-05  1:32 incoming Andrew Morton
                   ` (115 preceding siblings ...)
  2021-05-05  1:39 ` [patch 119/143] memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 121/143] mm/gup: longterm pin migration cleanup Andrew Morton
                   ` (23 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
	jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
	mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
	peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
	willy

From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: change index type to long as it counts pages

In __get_user_pages_locked() i counts number of pages which should be
long, as long is used in all other places to contain number of pages, and
32-bit becomes increasingly small for handling page count proportional
values.

Link: https://lkml.kernel.org/r/20210215161349.246722-12-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/gup.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/mm/gup.c~mm-gup-change-index-type-to-long-as-it-counts-pages
+++ a/mm/gup.c
@@ -1528,7 +1528,7 @@ static long __get_user_pages_locked(stru
 {
 	struct vm_area_struct *vma;
 	unsigned long vm_flags;
-	int i;
+	long i;
 
 	/* calculate required read or write permissions.
 	 * If FOLL_FORCE is set, we only require the "MAY" flags.
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 121/143] mm/gup: longterm pin migration cleanup
  2021-05-05  1:32 incoming Andrew Morton
                   ` (116 preceding siblings ...)
  2021-05-05  1:39 ` [patch 120/143] mm/gup: change index type to long as it counts pages Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 122/143] selftests/vm: gup_test: fix test flag Andrew Morton
                   ` (22 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
	jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
	mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
	peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
	willy

From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: longterm pin migration cleanup

When pages are longterm pinned, we must migrated them out of movable zone.
The function that migrates them has a hidden loop with goto.  The loop is
to retry on isolation failures, and after successful migration.

Make this code better by moving this loop to the caller.

Link: https://lkml.kernel.org/r/20210215161349.246722-13-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: Jason Gunthorpe <jgg@nvidia.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/gup.c |   93 +++++++++++++++++++++--------------------------------
 1 file changed, 37 insertions(+), 56 deletions(-)

--- a/mm/gup.c~mm-gup-longterm-pin-migration-cleanup
+++ a/mm/gup.c
@@ -1602,27 +1602,28 @@ struct page *get_dump_page(unsigned long
 #endif /* CONFIG_ELF_CORE */
 
 #ifdef CONFIG_MIGRATION
-static long check_and_migrate_movable_pages(struct mm_struct *mm,
-					    unsigned long start,
-					    unsigned long nr_pages,
+/*
+ * Check whether all pages are pinnable, if so return number of pages.  If some
+ * pages are not pinnable, migrate them, and unpin all pages. Return zero if
+ * pages were migrated, or if some pages were not successfully isolated.
+ * Return negative error if migration fails.
+ */
+static long check_and_migrate_movable_pages(unsigned long nr_pages,
 					    struct page **pages,
-					    struct vm_area_struct **vmas,
 					    unsigned int gup_flags)
 {
-	unsigned long i, isolation_error_count;
-	bool drain_allow;
+	unsigned long i;
+	unsigned long isolation_error_count = 0;
+	bool drain_allow = true;
 	LIST_HEAD(movable_page_list);
-	long ret = nr_pages;
-	struct page *prev_head, *head;
+	long ret = 0;
+	struct page *prev_head = NULL;
+	struct page *head;
 	struct migration_target_control mtc = {
 		.nid = NUMA_NO_NODE,
 		.gfp_mask = GFP_USER | __GFP_NOWARN,
 	};
 
-check_again:
-	prev_head = NULL;
-	isolation_error_count = 0;
-	drain_allow = true;
 	for (i = 0; i < nr_pages; i++) {
 		head = compound_head(pages[i]);
 		if (head == prev_head)
@@ -1660,47 +1661,27 @@ check_again:
 	 * in the correct zone.
 	 */
 	if (list_empty(&movable_page_list) && !isolation_error_count)
-		return ret;
+		return nr_pages;
 
+	if (gup_flags & FOLL_PIN) {
+		unpin_user_pages(pages, nr_pages);
+	} else {
+		for (i = 0; i < nr_pages; i++)
+			put_page(pages[i]);
+	}
 	if (!list_empty(&movable_page_list)) {
-		/*
-		 * drop the above get_user_pages reference.
-		 */
-		if (gup_flags & FOLL_PIN)
-			unpin_user_pages(pages, nr_pages);
-		else
-			for (i = 0; i < nr_pages; i++)
-				put_page(pages[i]);
-
 		ret = migrate_pages(&movable_page_list, alloc_migration_target,
 				    NULL, (unsigned long)&mtc, MIGRATE_SYNC,
 				    MR_LONGTERM_PIN);
-		if (ret) {
-			if (!list_empty(&movable_page_list))
-				putback_movable_pages(&movable_page_list);
-			return ret > 0 ? -ENOMEM : ret;
-		}
-
-		/* We unpinned pages before migration, pin them again */
-		ret = __get_user_pages_locked(mm, start, nr_pages, pages, vmas,
-					      NULL, gup_flags);
-		if (ret <= 0)
-			return ret;
-		nr_pages = ret;
+		if (ret && !list_empty(&movable_page_list))
+			putback_movable_pages(&movable_page_list);
 	}
 
-	/*
-	 * check again because pages were unpinned, and we also might have
-	 * had isolation errors and need more pages to migrate.
-	 */
-	goto check_again;
+	return ret > 0 ? -ENOMEM : ret;
 }
 #else
-static long check_and_migrate_movable_pages(struct mm_struct *mm,
-					    unsigned long start,
-					    unsigned long nr_pages,
+static long check_and_migrate_movable_pages(unsigned long nr_pages,
 					    struct page **pages,
-					    struct vm_area_struct **vmas,
 					    unsigned int gup_flags)
 {
 	return nr_pages;
@@ -1718,22 +1699,22 @@ static long __gup_longterm_locked(struct
 				  struct vm_area_struct **vmas,
 				  unsigned int gup_flags)
 {
-	unsigned long flags = 0;
+	unsigned int flags;
 	long rc;
 
-	if (gup_flags & FOLL_LONGTERM)
-		flags = memalloc_pin_save();
-
-	rc = __get_user_pages_locked(mm, start, nr_pages, pages, vmas, NULL,
-				     gup_flags);
+	if (!(gup_flags & FOLL_LONGTERM))
+		return __get_user_pages_locked(mm, start, nr_pages, pages, vmas,
+					       NULL, gup_flags);
+	flags = memalloc_pin_save();
+	do {
+		rc = __get_user_pages_locked(mm, start, nr_pages, pages, vmas,
+					     NULL, gup_flags);
+		if (rc <= 0)
+			break;
+		rc = check_and_migrate_movable_pages(rc, pages, gup_flags);
+	} while (!rc);
+	memalloc_pin_restore(flags);
 
-	if (gup_flags & FOLL_LONGTERM) {
-		if (rc > 0)
-			rc = check_and_migrate_movable_pages(mm, start, rc,
-							     pages, vmas,
-							     gup_flags);
-		memalloc_pin_restore(flags);
-	}
 	return rc;
 }
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 122/143] selftests/vm: gup_test: fix test flag
  2021-05-05  1:32 incoming Andrew Morton
                   ` (117 preceding siblings ...)
  2021-05-05  1:39 ` [patch 121/143] mm/gup: longterm pin migration cleanup Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 123/143] selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages Andrew Morton
                   ` (21 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
	jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
	mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
	peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
	willy

From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: selftests/vm: gup_test: fix test flag

In gup_test both gup_flags and test_flags use the same flags field.  This
is broken.

Farther, in the actual gup_test.c all the passed gup_flags are erased and
unconditionally replaced with FOLL_WRITE.

Which means that test_flags are ignored, and code like this always
performs pin dump test:

155  			if (gup->flags & GUP_TEST_FLAG_DUMP_PAGES_USE_PIN)
156  				nr = pin_user_pages(addr, nr, gup->flags,
157  						    pages + i, NULL);
158  			else
159  				nr = get_user_pages(addr, nr, gup->flags,
160  						    pages + i, NULL);
161  			break;

Add a new test_flags field, to allow raw gup_flags to work.  Add a new
subcommand for DUMP_USER_PAGES_TEST to specify that pin test should be
performed.

Remove unconditional overwriting of gup_flags via FOLL_WRITE.  But,
preserve the previous behaviour where FOLL_WRITE was the default flag, and
add a new option "-W" to unset FOLL_WRITE.

Rename flags with gup_flags.

With the fix, dump works like this:

root@virtme:/# gup_test  -c
---- page #0, starting from user virt addr: 0x7f8acb9e4000
page:00000000d3d2ee27 refcount:2 mapcount:1 mapping:0000000000000000
index:0x0 pfn:0x100bcf
anon flags: 0x300000000080016(referenced|uptodate|lru|swapbacked)
raw: 0300000000080016 ffffd0e204021608 ffffd0e208df2e88 ffff8ea04243ec61
raw: 0000000000000000 0000000000000000 0000000200000000 0000000000000000
page dumped because: gup_test: dump_pages() test
DUMP_USER_PAGES_TEST: done

root@virtme:/# gup_test  -c -p
---- page #0, starting from user virt addr: 0x7fd19701b000
page:00000000baed3c7d refcount:1025 mapcount:1 mapping:0000000000000000
index:0x0 pfn:0x108008
anon flags: 0x300000000080014(uptodate|lru|swapbacked)
raw: 0300000000080014 ffffd0e204200188 ffffd0e205e09088 ffff8ea04243ee71
raw: 0000000000000000 0000000000000000 0000040100000000 0000000000000000
page dumped because: gup_test: dump_pages() test
DUMP_USER_PAGES_TEST: done

Refcount shows the difference between pin vs no-pin case.
Also change type of nr from int to long, as it counts number of pages.

Link: https://lkml.kernel.org/r/20210215161349.246722-14-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/gup_test.c                         |   23 ++++++++++-------------
 mm/gup_test.h                         |    3 ++-
 tools/testing/selftests/vm/gup_test.c |   15 +++++++++++----
 3 files changed, 23 insertions(+), 18 deletions(-)

--- a/mm/gup_test.c~selftests-vm-gup_test-fix-test-flag
+++ a/mm/gup_test.c
@@ -94,7 +94,7 @@ static int __gup_test_ioctl(unsigned int
 {
 	ktime_t start_time, end_time;
 	unsigned long i, nr_pages, addr, next;
-	int nr;
+	long nr;
 	struct page **pages;
 	int ret = 0;
 	bool needs_mmap_lock =
@@ -126,37 +126,34 @@ static int __gup_test_ioctl(unsigned int
 			nr = (next - addr) / PAGE_SIZE;
 		}
 
-		/* Filter out most gup flags: only allow a tiny subset here: */
-		gup->flags &= FOLL_WRITE;
-
 		switch (cmd) {
 		case GUP_FAST_BENCHMARK:
-			nr = get_user_pages_fast(addr, nr, gup->flags,
+			nr = get_user_pages_fast(addr, nr, gup->gup_flags,
 						 pages + i);
 			break;
 		case GUP_BASIC_TEST:
-			nr = get_user_pages(addr, nr, gup->flags, pages + i,
+			nr = get_user_pages(addr, nr, gup->gup_flags, pages + i,
 					    NULL);
 			break;
 		case PIN_FAST_BENCHMARK:
-			nr = pin_user_pages_fast(addr, nr, gup->flags,
+			nr = pin_user_pages_fast(addr, nr, gup->gup_flags,
 						 pages + i);
 			break;
 		case PIN_BASIC_TEST:
-			nr = pin_user_pages(addr, nr, gup->flags, pages + i,
+			nr = pin_user_pages(addr, nr, gup->gup_flags, pages + i,
 					    NULL);
 			break;
 		case PIN_LONGTERM_BENCHMARK:
 			nr = pin_user_pages(addr, nr,
-					    gup->flags | FOLL_LONGTERM,
+					    gup->gup_flags | FOLL_LONGTERM,
 					    pages + i, NULL);
 			break;
 		case DUMP_USER_PAGES_TEST:
-			if (gup->flags & GUP_TEST_FLAG_DUMP_PAGES_USE_PIN)
-				nr = pin_user_pages(addr, nr, gup->flags,
+			if (gup->test_flags & GUP_TEST_FLAG_DUMP_PAGES_USE_PIN)
+				nr = pin_user_pages(addr, nr, gup->gup_flags,
 						    pages + i, NULL);
 			else
-				nr = get_user_pages(addr, nr, gup->flags,
+				nr = get_user_pages(addr, nr, gup->gup_flags,
 						    pages + i, NULL);
 			break;
 		default:
@@ -187,7 +184,7 @@ static int __gup_test_ioctl(unsigned int
 
 	start_time = ktime_get();
 
-	put_back_pages(cmd, pages, nr_pages, gup->flags);
+	put_back_pages(cmd, pages, nr_pages, gup->test_flags);
 
 	end_time = ktime_get();
 	gup->put_delta_usec = ktime_us_delta(end_time, start_time);
--- a/mm/gup_test.h~selftests-vm-gup_test-fix-test-flag
+++ a/mm/gup_test.h
@@ -21,7 +21,8 @@ struct gup_test {
 	__u64 addr;
 	__u64 size;
 	__u32 nr_pages_per_call;
-	__u32 flags;
+	__u32 gup_flags;
+	__u32 test_flags;
 	/*
 	 * Each non-zero entry is the number of the page (1-based: first page is
 	 * page 1, so that zero entries mean "do nothing") from the .addr base.
--- a/tools/testing/selftests/vm/gup_test.c~selftests-vm-gup_test-fix-test-flag
+++ a/tools/testing/selftests/vm/gup_test.c
@@ -37,13 +37,13 @@ int main(int argc, char **argv)
 {
 	struct gup_test gup = { 0 };
 	unsigned long size = 128 * MB;
-	int i, fd, filed, opt, nr_pages = 1, thp = -1, repeats = 1, write = 0;
+	int i, fd, filed, opt, nr_pages = 1, thp = -1, repeats = 1, write = 1;
 	unsigned long cmd = GUP_FAST_BENCHMARK;
 	int flags = MAP_PRIVATE;
 	char *file = "/dev/zero";
 	char *p;
 
-	while ((opt = getopt(argc, argv, "m:r:n:F:f:abctTLUuwSH")) != -1) {
+	while ((opt = getopt(argc, argv, "m:r:n:F:f:abctTLUuwWSHp")) != -1) {
 		switch (opt) {
 		case 'a':
 			cmd = PIN_FAST_BENCHMARK;
@@ -65,9 +65,13 @@ int main(int argc, char **argv)
 			 */
 			gup.which_pages[0] = 1;
 			break;
+		case 'p':
+			/* works only with DUMP_USER_PAGES_TEST */
+			gup.test_flags |= GUP_TEST_FLAG_DUMP_PAGES_USE_PIN;
+			break;
 		case 'F':
 			/* strtol, so you can pass flags in hex form */
-			gup.flags = strtol(optarg, 0, 0);
+			gup.gup_flags = strtol(optarg, 0, 0);
 			break;
 		case 'm':
 			size = atoi(optarg) * MB;
@@ -93,6 +97,9 @@ int main(int argc, char **argv)
 		case 'w':
 			write = 1;
 			break;
+		case 'W':
+			write = 0;
+			break;
 		case 'f':
 			file = optarg;
 			break;
@@ -140,7 +147,7 @@ int main(int argc, char **argv)
 
 	gup.nr_pages_per_call = nr_pages;
 	if (write)
-		gup.flags |= FOLL_WRITE;
+		gup.gup_flags |= FOLL_WRITE;
 
 	fd = open("/sys/kernel/debug/gup_test", O_RDWR);
 	if (fd == -1) {
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 123/143] selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages
  2021-05-05  1:32 incoming Andrew Morton
                   ` (118 preceding siblings ...)
  2021-05-05  1:39 ` [patch 122/143] selftests/vm: gup_test: fix test flag Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 124/143] mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove Andrew Morton
                   ` (20 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
	jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
	mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
	peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
	willy

From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages

When pages are pinned they can be faulted in userland and migrated, and
they can be faulted right in kernel without migration.

In either case, the pinned pages must end-up being pinnable (not movable).

Add a new test to gup_test, to help verify that the gup/pup
(get_user_pages() / pin_user_pages()) behavior with respect to pinnable
and movable pages is reasonable and correct.  Specifically, provide a way
to:

1) Verify that only "pinnable" pages are pinned.  This is checked
   automatically for you.

2) Verify that gup/pup performance is reasonable.  This requires
   comparing benchmarks between doing gup/pup on pages that have been
   pre-faulted in from user space, vs.  doing gup/pup on pages that are
   not faulted in until gup/pup time (via FOLL_TOUCH).  This decision is
   controlled with the new -z command line option.

Link: https://lkml.kernel.org/r/20210215161349.246722-15-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/gup_test.c                         |    6 ++++++
 tools/testing/selftests/vm/gup_test.c |   23 +++++++++++++++++++----
 2 files changed, 25 insertions(+), 4 deletions(-)

--- a/mm/gup_test.c~selftests-vm-gup_test-test-faulting-in-kernel-and-verify-pinnable-pages
+++ a/mm/gup_test.c
@@ -52,6 +52,12 @@ static void verify_dma_pinned(unsigned i
 
 				dump_page(page, "gup_test failure");
 				break;
+			} else if (cmd == PIN_LONGTERM_BENCHMARK &&
+				WARN(!is_pinnable_page(page),
+				     "pages[%lu] is NOT pinnable but pinned\n",
+				     i)) {
+				dump_page(page, "gup_test failure");
+				break;
 			}
 		}
 		break;
--- a/tools/testing/selftests/vm/gup_test.c~selftests-vm-gup_test-test-faulting-in-kernel-and-verify-pinnable-pages
+++ a/tools/testing/selftests/vm/gup_test.c
@@ -13,6 +13,7 @@
 
 /* Just the flags we need, copied from mm.h: */
 #define FOLL_WRITE	0x01	/* check pte is writable */
+#define FOLL_TOUCH	0x02	/* mark page accessed */
 
 static char *cmd_to_str(unsigned long cmd)
 {
@@ -39,11 +40,11 @@ int main(int argc, char **argv)
 	unsigned long size = 128 * MB;
 	int i, fd, filed, opt, nr_pages = 1, thp = -1, repeats = 1, write = 1;
 	unsigned long cmd = GUP_FAST_BENCHMARK;
-	int flags = MAP_PRIVATE;
+	int flags = MAP_PRIVATE, touch = 0;
 	char *file = "/dev/zero";
 	char *p;
 
-	while ((opt = getopt(argc, argv, "m:r:n:F:f:abctTLUuwWSHp")) != -1) {
+	while ((opt = getopt(argc, argv, "m:r:n:F:f:abctTLUuwWSHpz")) != -1) {
 		switch (opt) {
 		case 'a':
 			cmd = PIN_FAST_BENCHMARK;
@@ -110,6 +111,10 @@ int main(int argc, char **argv)
 		case 'H':
 			flags |= (MAP_HUGETLB | MAP_ANONYMOUS);
 			break;
+		case 'z':
+			/* fault pages in gup, do not fault in userland */
+			touch = 1;
+			break;
 		default:
 			return -1;
 		}
@@ -167,8 +172,18 @@ int main(int argc, char **argv)
 	else if (thp == 0)
 		madvise(p, size, MADV_NOHUGEPAGE);
 
-	for (; (unsigned long)p < gup.addr + size; p += PAGE_SIZE)
-		p[0] = 0;
+	/*
+	 * FOLL_TOUCH, in gup_test, is used as an either/or case: either
+	 * fault pages in from the kernel via FOLL_TOUCH, or fault them
+	 * in here, from user space. This allows comparison of performance
+	 * between those two cases.
+	 */
+	if (touch) {
+		gup.gup_flags |= FOLL_TOUCH;
+	} else {
+		for (; (unsigned long)p < gup.addr + size; p += PAGE_SIZE)
+			p[0] = 0;
+	}
 
 	/* Only report timing information on the *_BENCHMARK commands: */
 	if ((cmd == PIN_FAST_BENCHMARK) || (cmd == GUP_FAST_BENCHMARK) ||
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 124/143] mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove
  2021-05-05  1:32 incoming Andrew Morton
                   ` (119 preceding siblings ...)
  2021-05-05  1:39 ` [patch 123/143] selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 125/143] drivers/base/memory: introduce memory_block_{online,offline} Andrew Morton
                   ` (19 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, alexander.h.duyck, david, linux-mm, mgorman, mhocko,
	minchan, mm-commits, mst, osalvador, torvalds, vbabka

From: Mel Gorman <mgorman@techsingularity.net>
Subject: mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove

zone_pcp_reset allegedly protects against a race with drain_pages using
local_irq_save but this is bogus.  local_irq_save only operates on the
local CPU.  If memory hotplug is running on CPU A and drain_pages is
running on CPU B, disabling IRQs on CPU A does not affect CPU B and offers
no protection.

This patch deletes IRQ disable/enable on the grounds that IRQs protect
nothing and assumes the existing hotplug paths guarantees the PCP cannot
be used after zone_pcp_enable().  That should be the case already because
all the pages have been freed and there is no page to put on the PCP
lists.

Link: https://lkml.kernel.org/r/20210412090346.GQ3697@techsingularity.net
Signed-off-by: Mel Gorman <mgorman@techsingularity.net>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Cc: "Michael S. Tsirkin" <mst@redhat.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Alexander Duyck <alexander.h.duyck@linux.intel.com>
Cc: Minchan Kim <minchan@kernel.org>
Cc: David Hildenbrand <david@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/page_alloc.c |    4 ----
 1 file changed, 4 deletions(-)

--- a/mm/page_alloc.c~mm-memory_hotplug-make-unpopulated-zones-pcp-structures-unreachable-during-hot-remove
+++ a/mm/page_alloc.c
@@ -9020,12 +9020,9 @@ void zone_pcp_enable(struct zone *zone)
 
 void zone_pcp_reset(struct zone *zone)
 {
-	unsigned long flags;
 	int cpu;
 	struct per_cpu_pageset *pset;
 
-	/* avoid races with drain_pages()  */
-	local_irq_save(flags);
 	if (zone->pageset != &boot_pageset) {
 		for_each_online_cpu(cpu) {
 			pset = per_cpu_ptr(zone->pageset, cpu);
@@ -9034,7 +9031,6 @@ void zone_pcp_reset(struct zone *zone)
 		free_percpu(zone->pageset);
 		zone->pageset = &boot_pageset;
 	}
-	local_irq_restore(flags);
 }
 
 #ifdef CONFIG_MEMORY_HOTREMOVE
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 125/143] drivers/base/memory: introduce memory_block_{online,offline}
  2021-05-05  1:32 incoming Andrew Morton
                   ` (120 preceding siblings ...)
  2021-05-05  1:39 ` [patch 124/143] mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 126/143] mm,memory_hotplug: relax fully spanned sections check Andrew Morton
                   ` (18 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
	osalvador, pasha.tatashin, torvalds, vbabka

From: Oscar Salvador <osalvador@suse.de>
Subject: drivers/base/memory: introduce memory_block_{online,offline}

Patch series "Allocate memmap from hotadded memory (per device)", v10.

The primary goal of this patchset is to reduce memory overhead of the
hot-added memory (at least for SPARSEMEM_VMEMMAP memory model).  The
current way we use to populate memmap (struct page array) has two main
drawbacks:

a) it consumes an additional memory until the hotadded memory itself is
   onlined and

b) memmap might end up on a different numa node which is especially
   true for movable_node configuration.

c) due to fragmentation we might end up populating memmap with base
   pages

One way to mitigate all these issues is to simply allocate memmap array
(which is the largest memory footprint of the physical memory hotplug)
from the hot-added memory itself.  SPARSEMEM_VMEMMAP memory model allows
us to map any pfn range so the memory doesn't need to be online to be
usable for the array.  See patch 4 for more details.  This feature is only
usable when CONFIG_SPARSEMEM_VMEMMAP is set.

[Overall design]:

Implementation wise we reuse vmem_altmap infrastructure to override the
default allocator used by vmemap_populate.  memory_block structure gains a
new field called nr_vmemmap_pages, which accounts for the number of
vmemmap pages used by that memory_block.  E.g: On x86_64, that is 512
vmemmap pages on small memory bloks and 4096 on large memory blocks (1GB)

We also introduce new two functions: memory_block_{online,offline}.  These
functions take care of initializing/unitializing vmemmap pages prior to
calling {online,offline}_pages, so the latter functions can remain totally
untouched.

More details can be found in the respective changelogs.


This patch (of 8):

This is a preparatory patch that introduces two new functions:
memory_block_online() and memory_block_offline().

For now, these functions will only call online_pages() and offline_pages()
respectively, but they will be later in charge of preparing the vmemmap
pages, carrying out the initialization and proper accounting of such
pages.

Since memory_block struct contains all the information, pass this struct
down the chain till the end functions.

Link: https://lkml.kernel.org/r/20210421102701.25051-1-osalvador@suse.de
Link: https://lkml.kernel.org/r/20210421102701.25051-2-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 drivers/base/memory.c |   33 +++++++++++++++++++++------------
 1 file changed, 21 insertions(+), 12 deletions(-)

--- a/drivers/base/memory.c~drivers-base-memory-introduce-memory_block_onlineoffline
+++ a/drivers/base/memory.c
@@ -169,30 +169,41 @@ int memory_notify(unsigned long val, voi
 	return blocking_notifier_call_chain(&memory_chain, val, v);
 }
 
+static int memory_block_online(struct memory_block *mem)
+{
+	unsigned long start_pfn = section_nr_to_pfn(mem->start_section_nr);
+	unsigned long nr_pages = PAGES_PER_SECTION * sections_per_block;
+
+	return online_pages(start_pfn, nr_pages, mem->online_type, mem->nid);
+}
+
+static int memory_block_offline(struct memory_block *mem)
+{
+	unsigned long start_pfn = section_nr_to_pfn(mem->start_section_nr);
+	unsigned long nr_pages = PAGES_PER_SECTION * sections_per_block;
+
+	return offline_pages(start_pfn, nr_pages);
+}
+
 /*
  * MEMORY_HOTPLUG depends on SPARSEMEM in mm/Kconfig, so it is
  * OK to have direct references to sparsemem variables in here.
  */
 static int
-memory_block_action(unsigned long start_section_nr, unsigned long action,
-		    int online_type, int nid)
+memory_block_action(struct memory_block *mem, unsigned long action)
 {
-	unsigned long start_pfn;
-	unsigned long nr_pages = PAGES_PER_SECTION * sections_per_block;
 	int ret;
 
-	start_pfn = section_nr_to_pfn(start_section_nr);
-
 	switch (action) {
 	case MEM_ONLINE:
-		ret = online_pages(start_pfn, nr_pages, online_type, nid);
+		ret = memory_block_online(mem);
 		break;
 	case MEM_OFFLINE:
-		ret = offline_pages(start_pfn, nr_pages);
+		ret = memory_block_offline(mem);
 		break;
 	default:
 		WARN(1, KERN_WARNING "%s(%ld, %ld) unknown action: "
-		     "%ld\n", __func__, start_section_nr, action, action);
+		     "%ld\n", __func__, mem->start_section_nr, action, action);
 		ret = -EINVAL;
 	}
 
@@ -210,9 +221,7 @@ static int memory_block_change_state(str
 	if (to_state == MEM_OFFLINE)
 		mem->state = MEM_GOING_OFFLINE;
 
-	ret = memory_block_action(mem->start_section_nr, to_state,
-				  mem->online_type, mem->nid);
-
+	ret = memory_block_action(mem, to_state);
 	mem->state = ret ? from_state_req : to_state;
 
 	return ret;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 126/143] mm,memory_hotplug: relax fully spanned sections check
  2021-05-05  1:32 incoming Andrew Morton
                   ` (121 preceding siblings ...)
  2021-05-05  1:39 ` [patch 125/143] drivers/base/memory: introduce memory_block_{online,offline} Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 127/143] mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count() Andrew Morton
                   ` (17 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
	osalvador, pasha.tatashin, torvalds, vbabka

From: Oscar Salvador <osalvador@suse.de>
Subject: mm,memory_hotplug: relax fully spanned sections check

We want {online,offline}_pages to operate on whole memblocks, but
memmap_on_memory will poke pageblock_nr_pages aligned holes in the
beginning, which is a special case we want to allow.  Relax the check to
account for that case.

Link: https://lkml.kernel.org/r/20210421102701.25051-3-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/memory_hotplug.c |   22 ++++++++++++++++++----
 1 file changed, 18 insertions(+), 4 deletions(-)

--- a/mm/memory_hotplug.c~mmmemory_hotplug-relax-fully-spanned-sections-check
+++ a/mm/memory_hotplug.c
@@ -838,9 +838,16 @@ int __ref online_pages(unsigned long pfn
 	int ret;
 	struct memory_notify arg;
 
-	/* We can only online full sections (e.g., SECTION_IS_ONLINE) */
+	/*
+	 * {on,off}lining is constrained to full memory sections (or more
+	 * precisly to memory blocks from the user space POV).
+	 * memmap_on_memory is an exception because it reserves initial part
+	 * of the physical memory space for vmemmaps. That space is pageblock
+	 * aligned.
+	 */
 	if (WARN_ON_ONCE(!nr_pages ||
-			 !IS_ALIGNED(pfn | nr_pages, PAGES_PER_SECTION)))
+			 !IS_ALIGNED(pfn, pageblock_nr_pages) ||
+			 !IS_ALIGNED(pfn + nr_pages, PAGES_PER_SECTION)))
 		return -EINVAL;
 
 	mem_hotplug_begin();
@@ -1573,9 +1580,16 @@ int __ref offline_pages(unsigned long st
 	int ret, node;
 	char *reason;
 
-	/* We can only offline full sections (e.g., SECTION_IS_ONLINE) */
+	/*
+	 * {on,off}lining is constrained to full memory sections (or more
+	 * precisly to memory blocks from the user space POV).
+	 * memmap_on_memory is an exception because it reserves initial part
+	 * of the physical memory space for vmemmaps. That space is pageblock
+	 * aligned.
+	 */
 	if (WARN_ON_ONCE(!nr_pages ||
-			 !IS_ALIGNED(start_pfn | nr_pages, PAGES_PER_SECTION)))
+			 !IS_ALIGNED(start_pfn, pageblock_nr_pages) ||
+			 !IS_ALIGNED(start_pfn + nr_pages, PAGES_PER_SECTION)))
 		return -EINVAL;
 
 	mem_hotplug_begin();
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 127/143] mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count()
  2021-05-05  1:32 incoming Andrew Morton
                   ` (122 preceding siblings ...)
  2021-05-05  1:39 ` [patch 126/143] mm,memory_hotplug: relax fully spanned sections check Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 128/143] mm,memory_hotplug: allocate memmap from the added memory range Andrew Morton
                   ` (16 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
	osalvador, pasha.tatashin, torvalds, vbabka

From: David Hildenbrand <david@redhat.com>
Subject: mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count()

Let's have a single place (inspired by adjust_managed_page_count()) where
we adjust present pages.  In contrast to adjust_managed_page_count(), only
memory onlining/offlining is allowed to modify the number of present
pages.

Link: https://lkml.kernel.org/r/20210421102701.25051-4-osalvador@suse.de
Signed-off-by: David Hildenbrand <david@redhat.com>
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/memory_hotplug.c |   22 ++++++++++++----------
 1 file changed, 12 insertions(+), 10 deletions(-)

--- a/mm/memory_hotplug.c~mmmemory_hotplug-factor-out-adjusting-present-pages-into-adjust_present_page_count
+++ a/mm/memory_hotplug.c
@@ -829,6 +829,16 @@ struct zone * zone_for_pfn_range(int onl
 	return default_zone_for_pfn(nid, start_pfn, nr_pages);
 }
 
+static void adjust_present_page_count(struct zone *zone, long nr_pages)
+{
+	unsigned long flags;
+
+	zone->present_pages += nr_pages;
+	pgdat_resize_lock(zone->zone_pgdat, &flags);
+	zone->zone_pgdat->node_present_pages += nr_pages;
+	pgdat_resize_unlock(zone->zone_pgdat, &flags);
+}
+
 int __ref online_pages(unsigned long pfn, unsigned long nr_pages,
 		       int online_type, int nid)
 {
@@ -884,11 +894,7 @@ int __ref online_pages(unsigned long pfn
 	}
 
 	online_pages_range(pfn, nr_pages);
-	zone->present_pages += nr_pages;
-
-	pgdat_resize_lock(zone->zone_pgdat, &flags);
-	zone->zone_pgdat->node_present_pages += nr_pages;
-	pgdat_resize_unlock(zone->zone_pgdat, &flags);
+	adjust_present_page_count(zone, nr_pages);
 
 	node_states_set_node(nid, &arg);
 	if (need_zonelists_rebuild)
@@ -1706,11 +1712,7 @@ int __ref offline_pages(unsigned long st
 
 	/* removal success */
 	adjust_managed_page_count(pfn_to_page(start_pfn), -nr_pages);
-	zone->present_pages -= nr_pages;
-
-	pgdat_resize_lock(zone->zone_pgdat, &flags);
-	zone->zone_pgdat->node_present_pages -= nr_pages;
-	pgdat_resize_unlock(zone->zone_pgdat, &flags);
+	adjust_present_page_count(zone, -nr_pages);
 
 	init_per_zone_wmark_min();
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 128/143] mm,memory_hotplug: allocate memmap from the added memory range
  2021-05-05  1:32 incoming Andrew Morton
                   ` (123 preceding siblings ...)
  2021-05-05  1:39 ` [patch 127/143] mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count() Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 129/143] acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported Andrew Morton
                   ` (15 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
	osalvador, pasha.tatashin, torvalds, vbabka

From: Oscar Salvador <osalvador@suse.de>
Subject: mm,memory_hotplug: allocate memmap from the added memory range

Physical memory hotadd has to allocate a memmap (struct page array) for
the newly added memory section.  Currently, alloc_pages_node() is used for
those allocations.

This has some disadvantages:
 a) an existing memory is consumed for that purpose
    (eg: ~2MB per 128MB memory section on x86_64)
    This can even lead to extreme cases where system goes OOM because
    the physically hotplugged memory depletes the available memory before
    it is onlined.
 b) if the whole node is movable then we have off-node struct pages
    which has performance drawbacks.
 c) It might be there are no PMD_ALIGNED chunks so memmap array gets
    populated with base pages.

This can be improved when CONFIG_SPARSEMEM_VMEMMAP is enabled.

Vmemap page tables can map arbitrary memory.  That means that we can
reserve a part of the physically hotadded memory to back vmemmap page
tables.  This implementation uses the beginning of the hotplugged memory
for that purpose.

There are some non-obviously things to consider though.  Vmemmap pages are
allocated/freed during the memory hotplug events (add_memory_resource(),
try_remove_memory()) when the memory is added/removed.  This means that
the reserved physical range is not online although it is used.  The most
obvious side effect is that pfn_to_online_page() returns NULL for those
pfns.  The current design expects that this should be OK as the hotplugged
memory is considered a garbage until it is onlined.  For example
hibernation wouldn't save the content of those vmmemmaps into the image so
it wouldn't be restored on resume but this should be OK as there no real
content to recover anyway while metadata is reachable from other data
structures (e.g.  vmemmap page tables).

The reserved space is therefore (de)initialized during the {on,off}line
events (mhp_{de}init_memmap_on_memory).  That is done by extracting page
allocator independent initialization from the regular onlining path.  The
primary reason to handle the reserved space outside of {on,off}line_pages
is to make each initialization specific to the purpose rather than special
case them in a single function.

As per above, the functions that are introduced are:

 - mhp_init_memmap_on_memory:
   Initializes vmemmap pages by calling move_pfn_range_to_zone(), calls
   kasan_add_zero_shadow(), and onlines as many sections as vmemmap pages
   fully span.

 - mhp_deinit_memmap_on_memory:
   Offlines as many sections as vmemmap pages fully span, removes the
   range from zhe zone by remove_pfn_range_from_zone(), and calls
   kasan_remove_zero_shadow() for the range.

The new function memory_block_online() calls mhp_init_memmap_on_memory()
before doing the actual online_pages().  Should online_pages() fail, we
clean up by calling mhp_deinit_memmap_on_memory().  Adjusting of
present_pages is done at the end once we know that online_pages()
succedeed.

On offline, memory_block_offline() needs to unaccount vmemmap pages from
present_pages() before calling offline_pages().  This is necessary because
offline_pages() tears down some structures based on the fact whether the
node or the zone become empty.  If offline_pages() fails, we account back
vmemmap pages.  If it succeeds, we call mhp_deinit_memmap_on_memory().

Hot-remove:

 We need to be careful when removing memory, as adding and
 removing memory needs to be done with the same granularity.
 To check that this assumption is not violated, we check the
 memory range we want to remove and if a) any memory block has
 vmemmap pages and b) the range spans more than a single memory
 block, we scream out loud and refuse to proceed.

 If all is good and the range was using memmap on memory (aka vmemmap pages),
 we construct an altmap structure so free_hugepage_table does the right
 thing and calls vmem_altmap_free instead of free_pagetable.

Link: https://lkml.kernel.org/r/20210421102701.25051-5-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 drivers/base/memory.c          |   72 ++++++++++++-
 include/linux/memory.h         |    8 +
 include/linux/memory_hotplug.h |   15 ++
 include/linux/memremap.h       |    2 
 include/linux/mmzone.h         |    7 -
 mm/Kconfig                     |    5 
 mm/memory_hotplug.c            |  161 +++++++++++++++++++++++++++++--
 mm/sparse.c                    |    2 
 8 files changed, 250 insertions(+), 22 deletions(-)

--- a/drivers/base/memory.c~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/drivers/base/memory.c
@@ -173,16 +173,73 @@ static int memory_block_online(struct me
 {
 	unsigned long start_pfn = section_nr_to_pfn(mem->start_section_nr);
 	unsigned long nr_pages = PAGES_PER_SECTION * sections_per_block;
+	unsigned long nr_vmemmap_pages = mem->nr_vmemmap_pages;
+	struct zone *zone;
+	int ret;
+
+	zone = zone_for_pfn_range(mem->online_type, mem->nid, start_pfn, nr_pages);
+
+	/*
+	 * Although vmemmap pages have a different lifecycle than the pages
+	 * they describe (they remain until the memory is unplugged), doing
+	 * their initialization and accounting at memory onlining/offlining
+	 * stage helps to keep accounting easier to follow - e.g vmemmaps
+	 * belong to the same zone as the memory they backed.
+	 */
+	if (nr_vmemmap_pages) {
+		ret = mhp_init_memmap_on_memory(start_pfn, nr_vmemmap_pages, zone);
+		if (ret)
+			return ret;
+	}
+
+	ret = online_pages(start_pfn + nr_vmemmap_pages,
+			   nr_pages - nr_vmemmap_pages, zone);
+	if (ret) {
+		if (nr_vmemmap_pages)
+			mhp_deinit_memmap_on_memory(start_pfn, nr_vmemmap_pages);
+		return ret;
+	}
+
+	/*
+	 * Account once onlining succeeded. If the zone was unpopulated, it is
+	 * now already properly populated.
+	 */
+	if (nr_vmemmap_pages)
+		adjust_present_page_count(zone, nr_vmemmap_pages);
 
-	return online_pages(start_pfn, nr_pages, mem->online_type, mem->nid);
+	return ret;
 }
 
 static int memory_block_offline(struct memory_block *mem)
 {
 	unsigned long start_pfn = section_nr_to_pfn(mem->start_section_nr);
 	unsigned long nr_pages = PAGES_PER_SECTION * sections_per_block;
+	unsigned long nr_vmemmap_pages = mem->nr_vmemmap_pages;
+	struct zone *zone;
+	int ret;
+
+	zone = page_zone(pfn_to_page(start_pfn));
+
+	/*
+	 * Unaccount before offlining, such that unpopulated zone and kthreads
+	 * can properly be torn down in offline_pages().
+	 */
+	if (nr_vmemmap_pages)
+		adjust_present_page_count(zone, -nr_vmemmap_pages);
 
-	return offline_pages(start_pfn, nr_pages);
+	ret = offline_pages(start_pfn + nr_vmemmap_pages,
+			    nr_pages - nr_vmemmap_pages);
+	if (ret) {
+		/* offline_pages() failed. Account back. */
+		if (nr_vmemmap_pages)
+			adjust_present_page_count(zone, nr_vmemmap_pages);
+		return ret;
+	}
+
+	if (nr_vmemmap_pages)
+		mhp_deinit_memmap_on_memory(start_pfn, nr_vmemmap_pages);
+
+	return ret;
 }
 
 /*
@@ -576,7 +633,8 @@ int register_memory(struct memory_block
 	return ret;
 }
 
-static int init_memory_block(unsigned long block_id, unsigned long state)
+static int init_memory_block(unsigned long block_id, unsigned long state,
+			     unsigned long nr_vmemmap_pages)
 {
 	struct memory_block *mem;
 	int ret = 0;
@@ -593,6 +651,7 @@ static int init_memory_block(unsigned lo
 	mem->start_section_nr = block_id * sections_per_block;
 	mem->state = state;
 	mem->nid = NUMA_NO_NODE;
+	mem->nr_vmemmap_pages = nr_vmemmap_pages;
 
 	ret = register_memory(mem);
 
@@ -612,7 +671,7 @@ static int add_memory_block(unsigned lon
 	if (section_count == 0)
 		return 0;
 	return init_memory_block(memory_block_id(base_section_nr),
-				 MEM_ONLINE);
+				 MEM_ONLINE, 0);
 }
 
 static void unregister_memory(struct memory_block *memory)
@@ -634,7 +693,8 @@ static void unregister_memory(struct mem
  *
  * Called under device_hotplug_lock.
  */
-int create_memory_block_devices(unsigned long start, unsigned long size)
+int create_memory_block_devices(unsigned long start, unsigned long size,
+				unsigned long vmemmap_pages)
 {
 	const unsigned long start_block_id = pfn_to_block_id(PFN_DOWN(start));
 	unsigned long end_block_id = pfn_to_block_id(PFN_DOWN(start + size));
@@ -647,7 +707,7 @@ int create_memory_block_devices(unsigned
 		return -EINVAL;
 
 	for (block_id = start_block_id; block_id != end_block_id; block_id++) {
-		ret = init_memory_block(block_id, MEM_OFFLINE);
+		ret = init_memory_block(block_id, MEM_OFFLINE, vmemmap_pages);
 		if (ret)
 			break;
 	}
--- a/include/linux/memory.h~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/include/linux/memory.h
@@ -29,6 +29,11 @@ struct memory_block {
 	int online_type;		/* for passing data to online routine */
 	int nid;			/* NID for this memory block */
 	struct device dev;
+	/*
+	 * Number of vmemmap pages. These pages
+	 * lay at the beginning of the memory block.
+	 */
+	unsigned long nr_vmemmap_pages;
 };
 
 int arch_get_memory_phys_device(unsigned long start_pfn);
@@ -80,7 +85,8 @@ static inline int memory_notify(unsigned
 #else
 extern int register_memory_notifier(struct notifier_block *nb);
 extern void unregister_memory_notifier(struct notifier_block *nb);
-int create_memory_block_devices(unsigned long start, unsigned long size);
+int create_memory_block_devices(unsigned long start, unsigned long size,
+				unsigned long vmemmap_pages);
 void remove_memory_block_devices(unsigned long start, unsigned long size);
 extern void memory_dev_init(void);
 extern int memory_notify(unsigned long val, void *v);
--- a/include/linux/memory_hotplug.h~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/include/linux/memory_hotplug.h
@@ -56,6 +56,14 @@ typedef int __bitwise mhp_t;
 #define MHP_MERGE_RESOURCE	((__force mhp_t)BIT(0))
 
 /*
+ * We want memmap (struct page array) to be self contained.
+ * To do so, we will use the beginning of the hot-added range to build
+ * the page tables for the memmap array that describes the entire range.
+ * Only selected architectures support it with SPARSE_VMEMMAP.
+ */
+#define MHP_MEMMAP_ON_MEMORY   ((__force mhp_t)BIT(1))
+
+/*
  * Extended parameters for memory hotplug:
  * altmap: alternative allocator for memmap array (optional)
  * pgprot: page protection flags to apply to newly created page tables
@@ -99,9 +107,13 @@ static inline void zone_seqlock_init(str
 extern int zone_grow_free_lists(struct zone *zone, unsigned long new_nr_pages);
 extern int zone_grow_waitqueues(struct zone *zone, unsigned long nr_pages);
 extern int add_one_highpage(struct page *page, int pfn, int bad_ppro);
+extern void adjust_present_page_count(struct zone *zone, long nr_pages);
 /* VM interface that may be used by firmware interface */
+extern int mhp_init_memmap_on_memory(unsigned long pfn, unsigned long nr_pages,
+				     struct zone *zone);
+extern void mhp_deinit_memmap_on_memory(unsigned long pfn, unsigned long nr_pages);
 extern int online_pages(unsigned long pfn, unsigned long nr_pages,
-			int online_type, int nid);
+			struct zone *zone);
 extern struct zone *test_pages_in_a_zone(unsigned long start_pfn,
 					 unsigned long end_pfn);
 extern void __offline_isolated_pages(unsigned long start_pfn,
@@ -359,6 +371,7 @@ extern struct zone *zone_for_pfn_range(i
 extern int arch_create_linear_mapping(int nid, u64 start, u64 size,
 				      struct mhp_params *params);
 void arch_remove_linear_mapping(u64 start, u64 size);
+extern bool mhp_supports_memmap_on_memory(unsigned long size);
 #endif /* CONFIG_MEMORY_HOTPLUG */
 
 #endif /* __LINUX_MEMORY_HOTPLUG_H */
--- a/include/linux/memremap.h~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/include/linux/memremap.h
@@ -17,7 +17,7 @@ struct device;
  * @alloc: track pages consumed, private to vmemmap_populate()
  */
 struct vmem_altmap {
-	const unsigned long base_pfn;
+	unsigned long base_pfn;
 	const unsigned long end_pfn;
 	const unsigned long reserve;
 	unsigned long free;
--- a/include/linux/mmzone.h~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/include/linux/mmzone.h
@@ -436,6 +436,11 @@ enum zone_type {
 	 *    situations where ZERO_PAGE(0) which is allocated differently
 	 *    on different platforms may end up in a movable zone. ZERO_PAGE(0)
 	 *    cannot be migrated.
+	 * 7. Memory-hotplug: when using memmap_on_memory and onlining the
+	 *    memory to the MOVABLE zone, the vmemmap pages are also placed in
+	 *    such zone. Such pages cannot be really moved around as they are
+	 *    self-stored in the range, but they are treated as movable when
+	 *    the range they describe is about to be offlined.
 	 *
 	 * In general, no unmovable allocations that degrade memory offlining
 	 * should end up in ZONE_MOVABLE. Allocators (like alloc_contig_range())
@@ -1392,10 +1397,8 @@ static inline int online_section_nr(unsi
 
 #ifdef CONFIG_MEMORY_HOTPLUG
 void online_mem_sections(unsigned long start_pfn, unsigned long end_pfn);
-#ifdef CONFIG_MEMORY_HOTREMOVE
 void offline_mem_sections(unsigned long start_pfn, unsigned long end_pfn);
 #endif
-#endif
 
 static inline struct mem_section *__pfn_to_section(unsigned long pfn)
 {
--- a/mm/Kconfig~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/mm/Kconfig
@@ -188,6 +188,11 @@ config MEMORY_HOTREMOVE
 	depends on MEMORY_HOTPLUG && ARCH_ENABLE_MEMORY_HOTREMOVE
 	depends on MIGRATION
 
+config MHP_MEMMAP_ON_MEMORY
+	def_bool y
+	depends on MEMORY_HOTPLUG && SPARSEMEM_VMEMMAP
+	depends on ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
+
 # Heavily threaded applications may benefit from splitting the mm-wide
 # page_table_lock, so that faults on different parts of the user address
 # space can be handled with less contention: split it at this NR_CPUS.
--- a/mm/memory_hotplug.c~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/mm/memory_hotplug.c
@@ -42,6 +42,8 @@
 #include "internal.h"
 #include "shuffle.h"
 
+static bool memmap_on_memory;
+
 /*
  * online_page_callback contains pointer to current page onlining function.
  * Initially it is generic_online_page(). If it is required it could be
@@ -648,9 +650,16 @@ static void online_pages_range(unsigned
 	 * decide to not expose all pages to the buddy (e.g., expose them
 	 * later). We account all pages as being online and belonging to this
 	 * zone ("present").
+	 * When using memmap_on_memory, the range might not be aligned to
+	 * MAX_ORDER_NR_PAGES - 1, but pageblock aligned. __ffs() will detect
+	 * this and the first chunk to online will be pageblock_nr_pages.
 	 */
-	for (pfn = start_pfn; pfn < end_pfn; pfn += MAX_ORDER_NR_PAGES)
-		(*online_page_callback)(pfn_to_page(pfn), MAX_ORDER - 1);
+	for (pfn = start_pfn; pfn < end_pfn;) {
+		int order = min(MAX_ORDER - 1UL, __ffs(pfn));
+
+		(*online_page_callback)(pfn_to_page(pfn), order);
+		pfn += (1UL << order);
+	}
 
 	/* mark all involved sections as online */
 	online_mem_sections(start_pfn, end_pfn);
@@ -829,7 +838,11 @@ struct zone * zone_for_pfn_range(int onl
 	return default_zone_for_pfn(nid, start_pfn, nr_pages);
 }
 
-static void adjust_present_page_count(struct zone *zone, long nr_pages)
+/*
+ * This function should only be called by memory_block_{online,offline},
+ * and {online,offline}_pages.
+ */
+void adjust_present_page_count(struct zone *zone, long nr_pages)
 {
 	unsigned long flags;
 
@@ -839,12 +852,54 @@ static void adjust_present_page_count(st
 	pgdat_resize_unlock(zone->zone_pgdat, &flags);
 }
 
-int __ref online_pages(unsigned long pfn, unsigned long nr_pages,
-		       int online_type, int nid)
+int mhp_init_memmap_on_memory(unsigned long pfn, unsigned long nr_pages,
+			      struct zone *zone)
+{
+	unsigned long end_pfn = pfn + nr_pages;
+	int ret;
+
+	ret = kasan_add_zero_shadow(__va(PFN_PHYS(pfn)), PFN_PHYS(nr_pages));
+	if (ret)
+		return ret;
+
+	move_pfn_range_to_zone(zone, pfn, nr_pages, NULL, MIGRATE_UNMOVABLE);
+
+	/*
+	 * It might be that the vmemmap_pages fully span sections. If that is
+	 * the case, mark those sections online here as otherwise they will be
+	 * left offline.
+	 */
+	if (nr_pages >= PAGES_PER_SECTION)
+	        online_mem_sections(pfn, ALIGN_DOWN(end_pfn, PAGES_PER_SECTION));
+
+	return ret;
+}
+
+void mhp_deinit_memmap_on_memory(unsigned long pfn, unsigned long nr_pages)
+{
+	unsigned long end_pfn = pfn + nr_pages;
+
+	/*
+	 * It might be that the vmemmap_pages fully span sections. If that is
+	 * the case, mark those sections offline here as otherwise they will be
+	 * left online.
+	 */
+	if (nr_pages >= PAGES_PER_SECTION)
+		offline_mem_sections(pfn, ALIGN_DOWN(end_pfn, PAGES_PER_SECTION));
+
+        /*
+	 * The pages associated with this vmemmap have been offlined, so
+	 * we can reset its state here.
+	 */
+	remove_pfn_range_from_zone(page_zone(pfn_to_page(pfn)), pfn, nr_pages);
+	kasan_remove_zero_shadow(__va(PFN_PHYS(pfn)), PFN_PHYS(nr_pages));
+}
+
+int __ref online_pages(unsigned long pfn, unsigned long nr_pages, struct zone *zone)
 {
 	unsigned long flags;
-	struct zone *zone;
 	int need_zonelists_rebuild = 0;
+	const int nid = zone_to_nid(zone);
 	int ret;
 	struct memory_notify arg;
 
@@ -863,7 +918,6 @@ int __ref online_pages(unsigned long pfn
 	mem_hotplug_begin();
 
 	/* associate pfn range with the zone */
-	zone = zone_for_pfn_range(online_type, nid, pfn, nr_pages);
 	move_pfn_range_to_zone(zone, pfn, nr_pages, NULL, MIGRATE_ISOLATE);
 
 	arg.start_pfn = pfn;
@@ -1077,6 +1131,45 @@ static int online_memory_block(struct me
 	return device_online(&mem->dev);
 }
 
+bool mhp_supports_memmap_on_memory(unsigned long size)
+{
+	unsigned long nr_vmemmap_pages = size / PAGE_SIZE;
+	unsigned long vmemmap_size = nr_vmemmap_pages * sizeof(struct page);
+	unsigned long remaining_size = size - vmemmap_size;
+
+	/*
+	 * Besides having arch support and the feature enabled at runtime, we
+	 * need a few more assumptions to hold true:
+	 *
+	 * a) We span a single memory block: memory onlining/offlinin;g happens
+	 *    in memory block granularity. We don't want the vmemmap of online
+	 *    memory blocks to reside on offline memory blocks. In the future,
+	 *    we might want to support variable-sized memory blocks to make the
+	 *    feature more versatile.
+	 *
+	 * b) The vmemmap pages span complete PMDs: We don't want vmemmap code
+	 *    to populate memory from the altmap for unrelated parts (i.e.,
+	 *    other memory blocks)
+	 *
+	 * c) The vmemmap pages (and thereby the pages that will be exposed to
+	 *    the buddy) have to cover full pageblocks: memory onlining/offlining
+	 *    code requires applicable ranges to be page-aligned, for example, to
+	 *    set the migratetypes properly.
+	 *
+	 * TODO: Although we have a check here to make sure that vmemmap pages
+	 *       fully populate a PMD, it is not the right place to check for
+	 *       this. A much better solution involves improving vmemmap code
+	 *       to fallback to base pages when trying to populate vmemmap using
+	 *       altmap as an alternative source of memory, and we do not exactly
+	 *       populate a single PMD.
+	 */
+	return memmap_on_memory &&
+	       IS_ENABLED(CONFIG_MHP_MEMMAP_ON_MEMORY) &&
+	       size == memory_block_size_bytes() &&
+	       IS_ALIGNED(vmemmap_size, PMD_SIZE) &&
+	       IS_ALIGNED(remaining_size, (pageblock_nr_pages << PAGE_SHIFT));
+}
+
 /*
  * NOTE: The caller must call lock_device_hotplug() to serialize hotplug
  * and online/offline operations (triggered e.g. by sysfs).
@@ -1086,6 +1179,7 @@ static int online_memory_block(struct me
 int __ref add_memory_resource(int nid, struct resource *res, mhp_t mhp_flags)
 {
 	struct mhp_params params = { .pgprot = pgprot_mhp(PAGE_KERNEL) };
+	struct vmem_altmap mhp_altmap = {};
 	u64 start, size;
 	bool new_node = false;
 	int ret;
@@ -1112,13 +1206,26 @@ int __ref add_memory_resource(int nid, s
 		goto error;
 	new_node = ret;
 
+	/*
+	 * Self hosted memmap array
+	 */
+	if (mhp_flags & MHP_MEMMAP_ON_MEMORY) {
+		if (!mhp_supports_memmap_on_memory(size)) {
+			ret = -EINVAL;
+			goto error;
+		}
+		mhp_altmap.free = PHYS_PFN(size);
+		mhp_altmap.base_pfn = PHYS_PFN(start);
+		params.altmap = &mhp_altmap;
+	}
+
 	/* call arch's memory hotadd */
 	ret = arch_add_memory(nid, start, size, &params);
 	if (ret < 0)
 		goto error;
 
 	/* create memory block devices after memory was added */
-	ret = create_memory_block_devices(start, size);
+	ret = create_memory_block_devices(start, size, mhp_altmap.alloc);
 	if (ret) {
 		arch_remove_memory(nid, start, size, NULL);
 		goto error;
@@ -1767,6 +1874,14 @@ static int check_memblock_offlined_cb(st
 	return 0;
 }
 
+static int get_nr_vmemmap_pages_cb(struct memory_block *mem, void *arg)
+{
+	/*
+	 * If not set, continue with the next block.
+	 */
+	return mem->nr_vmemmap_pages;
+}
+
 static int check_cpu_on_node(pg_data_t *pgdat)
 {
 	int cpu;
@@ -1841,6 +1956,9 @@ EXPORT_SYMBOL(try_offline_node);
 static int __ref try_remove_memory(int nid, u64 start, u64 size)
 {
 	int rc = 0;
+	struct vmem_altmap mhp_altmap = {};
+	struct vmem_altmap *altmap = NULL;
+	unsigned long nr_vmemmap_pages;
 
 	BUG_ON(check_hotplug_memory_range(start, size));
 
@@ -1853,6 +1971,31 @@ static int __ref try_remove_memory(int n
 	if (rc)
 		return rc;
 
+	/*
+	 * We only support removing memory added with MHP_MEMMAP_ON_MEMORY in
+	 * the same granularity it was added - a single memory block.
+	 */
+	if (memmap_on_memory) {
+		nr_vmemmap_pages = walk_memory_blocks(start, size, NULL,
+						      get_nr_vmemmap_pages_cb);
+		if (nr_vmemmap_pages) {
+			if (size != memory_block_size_bytes()) {
+				pr_warn("Refuse to remove %#llx - %#llx,"
+					"wrong granularity\n",
+					start, start + size);
+				return -EINVAL;
+			}
+
+			/*
+			 * Let remove_pmd_table->free_hugepage_table do the
+			 * right thing if we used vmem_altmap when hot-adding
+			 * the range.
+			 */
+			mhp_altmap.alloc = nr_vmemmap_pages;
+			altmap = &mhp_altmap;
+		}
+	}
+
 	/* remove memmap entry */
 	firmware_map_remove(start, start + size, "System RAM");
 
@@ -1864,7 +2007,7 @@ static int __ref try_remove_memory(int n
 
 	mem_hotplug_begin();
 
-	arch_remove_memory(nid, start, size, NULL);
+	arch_remove_memory(nid, start, size, altmap);
 
 	if (IS_ENABLED(CONFIG_ARCH_KEEP_MEMBLOCK)) {
 		memblock_free(start, size);
--- a/mm/sparse.c~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/mm/sparse.c
@@ -624,7 +624,6 @@ void online_mem_sections(unsigned long s
 	}
 }
 
-#ifdef CONFIG_MEMORY_HOTREMOVE
 /* Mark all memory sections within the pfn range as offline */
 void offline_mem_sections(unsigned long start_pfn, unsigned long end_pfn)
 {
@@ -645,7 +644,6 @@ void offline_mem_sections(unsigned long
 		ms->section_mem_map &= ~SECTION_IS_ONLINE;
 	}
 }
-#endif
 
 #ifdef CONFIG_SPARSEMEM_VMEMMAP
 static struct page * __meminit populate_section_memmap(unsigned long pfn,
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 129/143] acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported
  2021-05-05  1:32 incoming Andrew Morton
                   ` (124 preceding siblings ...)
  2021-05-05  1:39 ` [patch 128/143] mm,memory_hotplug: allocate memmap from the added memory range Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 130/143] mm,memory_hotplug: add kernel boot option to enable memmap_on_memory Andrew Morton
                   ` (14 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
	osalvador, pasha.tatashin, torvalds, vbabka

From: Oscar Salvador <osalvador@suse.de>
Subject: acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported

Let the caller check whether it can pass MHP_MEMMAP_ON_MEMORY by checking
mhp_supports_memmap_on_memory().  MHP_MEMMAP_ON_MEMORY can only be set in
case ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE is enabled, the architecture
supports altmap, and the range to be added spans a single memory block.

Link: https://lkml.kernel.org/r/20210421102701.25051-6-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 drivers/acpi/acpi_memhotplug.c |    5 ++++-
 1 file changed, 4 insertions(+), 1 deletion(-)

--- a/drivers/acpi/acpi_memhotplug.c~acpimemhotplug-enable-mhp_memmap_on_memory-when-supported
+++ a/drivers/acpi/acpi_memhotplug.c
@@ -171,6 +171,7 @@ static int acpi_memory_enable_device(str
 	acpi_handle handle = mem_device->device->handle;
 	int result, num_enabled = 0;
 	struct acpi_memory_info *info;
+	mhp_t mhp_flags = MHP_NONE;
 	int node;
 
 	node = acpi_get_node(handle);
@@ -194,8 +195,10 @@ static int acpi_memory_enable_device(str
 		if (node < 0)
 			node = memory_add_physaddr_to_nid(info->start_addr);
 
+		if (mhp_supports_memmap_on_memory(info->length))
+			mhp_flags |= MHP_MEMMAP_ON_MEMORY;
 		result = __add_memory(node, info->start_addr, info->length,
-				      MHP_NONE);
+				      mhp_flags);
 
 		/*
 		 * If the memory block has been used by the kernel, add_memory()
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 130/143] mm,memory_hotplug: add kernel boot option to enable memmap_on_memory
  2021-05-05  1:32 incoming Andrew Morton
                   ` (125 preceding siblings ...)
  2021-05-05  1:39 ` [patch 129/143] acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 131/143] x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE Andrew Morton
                   ` (13 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
	osalvador, pasha.tatashin, torvalds, vbabka

From: Oscar Salvador <osalvador@suse.de>
Subject: mm,memory_hotplug: add kernel boot option to enable memmap_on_memory

Self stored memmap leads to a sparse memory situation which is unsuitable
for workloads that requires large contiguous memory chunks, so make this
an opt-in which needs to be explicitly enabled.

To control this, let memory_hotplug have its own memory space, as
suggested by David, so we can add memory_hotplug.memmap_on_memory
parameter.

Link: https://lkml.kernel.org/r/20210421102701.25051-7-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 Documentation/admin-guide/kernel-parameters.txt |   17 ++++++++++++++
 mm/Makefile                                     |    5 +++-
 mm/memory_hotplug.c                             |   10 +++++++-
 3 files changed, 30 insertions(+), 2 deletions(-)

--- a/Documentation/admin-guide/kernel-parameters.txt~mmmemory_hotplug-add-kernel-boot-option-to-enable-memmap_on_memory
+++ a/Documentation/admin-guide/kernel-parameters.txt
@@ -2801,6 +2801,23 @@
 			seconds.  Use this parameter to check at some
 			other rate.  0 disables periodic checking.
 
+	memory_hotplug.memmap_on_memory
+			[KNL,X86,ARM] Boolean flag to enable this feature.
+			Format: {on | off (default)}
+			When enabled, runtime hotplugged memory will
+			allocate its internal metadata (struct pages)
+			from the hotadded memory which will allow to
+			hotadd a lot of memory without requiring
+			additional memory to do so.
+			This feature is disabled by default because it
+			has some implication on large (e.g. GB)
+			allocations in some configurations (e.g. small
+			memory blocks).
+			The state of the flag can be read in
+			/sys/module/memory_hotplug/parameters/memmap_on_memory.
+			Note that even when enabled, there are a few cases where
+			the feature is not effective.
+
 	memtest=	[KNL,X86,ARM,PPC] Enable memtest
 			Format: <integer>
 			default : 0 <disable>
--- a/mm/Makefile~mmmemory_hotplug-add-kernel-boot-option-to-enable-memmap_on_memory
+++ a/mm/Makefile
@@ -58,9 +58,13 @@ obj-y			:= filemap.o mempool.o oom_kill.
 page-alloc-y := page_alloc.o
 page-alloc-$(CONFIG_SHUFFLE_PAGE_ALLOCATOR) += shuffle.o
 
+# Give 'memory_hotplug' its own module-parameter namespace
+memory-hotplug-$(CONFIG_MEMORY_HOTPLUG) += memory_hotplug.o
+
 obj-y += page-alloc.o
 obj-y += init-mm.o
 obj-y += memblock.o
+obj-y += $(memory-hotplug-y)
 
 ifdef CONFIG_MMU
 	obj-$(CONFIG_ADVISE_SYSCALLS)	+= madvise.o
@@ -83,7 +87,6 @@ obj-$(CONFIG_SLUB) += slub.o
 obj-$(CONFIG_KASAN)	+= kasan/
 obj-$(CONFIG_KFENCE) += kfence/
 obj-$(CONFIG_FAILSLAB) += failslab.o
-obj-$(CONFIG_MEMORY_HOTPLUG) += memory_hotplug.o
 obj-$(CONFIG_MEMTEST)		+= memtest.o
 obj-$(CONFIG_MIGRATION) += migrate.o
 obj-$(CONFIG_TRANSPARENT_HUGEPAGE) += huge_memory.o khugepaged.o
--- a/mm/memory_hotplug.c~mmmemory_hotplug-add-kernel-boot-option-to-enable-memmap_on_memory
+++ a/mm/memory_hotplug.c
@@ -42,7 +42,15 @@
 #include "internal.h"
 #include "shuffle.h"
 
-static bool memmap_on_memory;
+
+/*
+ * memory_hotplug.memmap_on_memory parameter
+ */
+static bool memmap_on_memory __ro_after_init;
+#ifdef CONFIG_MHP_MEMMAP_ON_MEMORY
+module_param(memmap_on_memory, bool, 0444);
+MODULE_PARM_DESC(memmap_on_memory, "Enable memmap on memory for memory hotplug");
+#endif
 
 /*
  * online_page_callback contains pointer to current page onlining function.
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 131/143] x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
  2021-05-05  1:32 incoming Andrew Morton
                   ` (126 preceding siblings ...)
  2021-05-05  1:39 ` [patch 130/143] mm,memory_hotplug: add kernel boot option to enable memmap_on_memory Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 132/143] arm64/Kconfig: " Andrew Morton
                   ` (12 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
	osalvador, pasha.tatashin, torvalds, vbabka

From: Oscar Salvador <osalvador@suse.de>
Subject: x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE

Enable x86_64 platform to use the MHP_MEMMAP_ON_MEMORY feature.

Link: https://lkml.kernel.org/r/20210421102701.25051-8-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/x86/Kconfig |    3 +++
 1 file changed, 3 insertions(+)

--- a/arch/x86/Kconfig~x86-kconfig-introduce-arch_mhp_memmap_on_memory_enable
+++ a/arch/x86/Kconfig
@@ -2432,6 +2432,9 @@ config ARCH_HAS_ADD_PAGES
 	def_bool y
 	depends on X86_64 && ARCH_ENABLE_MEMORY_HOTPLUG
 
+config ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
+	def_bool y
+
 config USE_PERCPU_NUMA_NODE_ID
 	def_bool y
 	depends on NUMA
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 132/143] arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
  2021-05-05  1:32 incoming Andrew Morton
                   ` (127 preceding siblings ...)
  2021-05-05  1:39 ` [patch 131/143] x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:39 ` [patch 133/143] mm/zswap.c: switch from strlcpy to strscpy Andrew Morton
                   ` (11 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
	osalvador, pasha.tatashin, torvalds, vbabka

From: Oscar Salvador <osalvador@suse.de>
Subject: arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE

Enable arm64 platform to use the MHP_MEMMAP_ON_MEMORY feature.

Link: https://lkml.kernel.org/r/20210421102701.25051-9-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/arm64/Kconfig |    3 +++
 1 file changed, 3 insertions(+)

--- a/arch/arm64/Kconfig~arm64-kconfig-introduce-arch_mhp_memmap_on_memory_enable
+++ a/arch/arm64/Kconfig
@@ -316,6 +316,9 @@ config ZONE_DMA32
 	bool "Support DMA32 zone" if EXPERT
 	default y
 
+config ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
+	def_bool y
+
 config SMP
 	def_bool y
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 133/143] mm/zswap.c: switch from strlcpy to strscpy
  2021-05-05  1:32 incoming Andrew Morton
                   ` (128 preceding siblings ...)
  2021-05-05  1:39 ` [patch 132/143] arm64/Kconfig: " Andrew Morton
@ 2021-05-05  1:39 ` Andrew Morton
  2021-05-05  1:40 ` [patch 134/143] mm/zsmalloc: use BUG_ON instead of if condition followed by BUG Andrew Morton
                   ` (10 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:39 UTC (permalink / raw)
  To: akpm, daizhiyuan, ddstreet, linux-mm, mm-commits, sjenning,
	torvalds, vitaly.wool

From: Zhiyuan Dai <daizhiyuan@phytium.com.cn>
Subject: mm/zswap.c: switch from strlcpy to strscpy

strlcpy is marked as deprecated in Documentation/process/deprecated.rst,
and there is no functional difference when the caller expects truncation
(when not checking the return value).  strscpy is relatively better as it
also avoids scanning the whole source string.

Link: https://lkml.kernel.org/r/1614227981-20367-1-git-send-email-daizhiyuan@phytium.com.cn
Signed-off-by: Zhiyuan Dai <daizhiyuan@phytium.com.cn>
Cc: Seth Jennings <sjenning@redhat.com>
Cc: Dan Streetman <ddstreet@ieee.org>
Cc: Vitaly Wool <vitaly.wool@konsulko.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/zswap.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/mm/zswap.c~mm-zswap-switch-from-strlcpy-to-strscpy
+++ a/mm/zswap.c
@@ -614,7 +614,7 @@ static struct zswap_pool *zswap_pool_cre
 	}
 	pr_debug("using %s zpool\n", zpool_get_type(pool->zpool));
 
-	strlcpy(pool->tfm_name, compressor, sizeof(pool->tfm_name));
+	strscpy(pool->tfm_name, compressor, sizeof(pool->tfm_name));
 
 	pool->acomp_ctx = alloc_percpu(*pool->acomp_ctx);
 	if (!pool->acomp_ctx) {
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 134/143] mm/zsmalloc: use BUG_ON instead of if condition followed by BUG.
  2021-05-05  1:32 incoming Andrew Morton
                   ` (129 preceding siblings ...)
  2021-05-05  1:39 ` [patch 133/143] mm/zswap.c: switch from strlcpy to strscpy Andrew Morton
@ 2021-05-05  1:40 ` Andrew Morton
  2021-05-05  1:40 ` [patch 135/143] iov_iter: lift memzero_page() to highmem.h Andrew Morton
                   ` (9 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:40 UTC (permalink / raw)
  To: akpm, linux-mm, minchan, mm-commits, sergey.senozhatsky.work,
	torvalds, zhouchuangao

From: zhouchuangao <zhouchuangao@vivo.com>
Subject: mm/zsmalloc: use BUG_ON instead of if condition followed by BUG.

It can be optimized at compile time.

Link: https://lkml.kernel.org/r/1616727798-9110-1-git-send-email-zhouchuangao@vivo.com
Signed-off-by: zhouchuangao <zhouchuangao@vivo.com>
Cc: Minchan Kim <minchan@kernel.org>
Cc: Sergey Senozhatsky <sergey.senozhatsky.work@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/zsmalloc.c |    6 ++----
 1 file changed, 2 insertions(+), 4 deletions(-)

--- a/mm/zsmalloc.c~mm-zsmalloc-use-bug_on-instead-of-if-condition-followed-by-bug
+++ a/mm/zsmalloc.c
@@ -1987,8 +1987,7 @@ static int zs_page_migrate(struct addres
 		head = obj_to_head(page, addr);
 		if (head & OBJ_ALLOCATED_TAG) {
 			handle = head & ~OBJ_ALLOCATED_TAG;
-			if (!testpin_tag(handle))
-				BUG();
+			BUG_ON(!testpin_tag(handle));
 
 			old_obj = handle_to_obj(handle);
 			obj_to_location(old_obj, &dummy, &obj_idx);
@@ -2035,8 +2034,7 @@ unpin_objects:
 		head = obj_to_head(page, addr);
 		if (head & OBJ_ALLOCATED_TAG) {
 			handle = head & ~OBJ_ALLOCATED_TAG;
-			if (!testpin_tag(handle))
-				BUG();
+			BUG_ON(!testpin_tag(handle));
 			unpin_tag(handle);
 		}
 	}
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 135/143] iov_iter: lift memzero_page() to highmem.h
  2021-05-05  1:32 incoming Andrew Morton
                   ` (130 preceding siblings ...)
  2021-05-05  1:40 ` [patch 134/143] mm/zsmalloc: use BUG_ON instead of if condition followed by BUG Andrew Morton
@ 2021-05-05  1:40 ` Andrew Morton
  2021-05-05  1:40 ` [patch 136/143] btrfs: use memzero_page() instead of open coded kmap pattern Andrew Morton
                   ` (8 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:40 UTC (permalink / raw)
  To: akpm, chaitanya.kulkarni, clm, dsterba, ira.weiny, josef,
	linux-mm, mm-commits, torvalds, viro

From: Ira Weiny <ira.weiny@intel.com>
Subject: iov_iter: lift memzero_page() to highmem.h

Patch series "btrfs: Convert kmap/memset/kunmap to memzero_user()".

Lifting memzero_user(), convert it to kmap_local_page() and then use it in
btrfs.


This patch (of 3):

memzero_page() can replace the kmap/memset/kunmap pattern in other places
in the code.  While zero_user() has the same interface it is not the same
call and its use should be limited and some of those calls may be better
converted from zero_user() to memzero_page().[1] But that is not addressed
in this series.

Lift memzero_page() to highmem.

[1] https://lore.kernel.org/lkml/CAHk-=wijdojzo56FzYqE5TOYw2Vws7ik3LEMGj9SPQaJJ+Z73Q@mail.gmail.com/

Link: https://lkml.kernel.org/r/20210309212137.2610186-1-ira.weiny@intel.com
Link: https://lkml.kernel.org/r/20210309212137.2610186-2-ira.weiny@intel.com
Signed-off-by: Ira Weiny <ira.weiny@intel.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: David Sterba <dsterba@suse.com>
Cc: Chris Mason <clm@fb.com>
Cc: Josef Bacik <josef@toxicpanda.com>
Cc: Chaitanya Kulkarni <chaitanya.kulkarni@wdc.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/highmem.h |    7 +++++++
 lib/iov_iter.c          |    8 +-------
 2 files changed, 8 insertions(+), 7 deletions(-)

--- a/include/linux/highmem.h~iov_iter-lift-memzero_page-to-highmemh
+++ a/include/linux/highmem.h
@@ -332,4 +332,11 @@ static inline void memcpy_to_page(struct
 	kunmap_local(to);
 }
 
+static inline void memzero_page(struct page *page, size_t offset, size_t len)
+{
+	char *addr = kmap_atomic(page);
+	memset(addr + offset, 0, len);
+	kunmap_atomic(addr);
+}
+
 #endif /* _LINUX_HIGHMEM_H */
--- a/lib/iov_iter.c~iov_iter-lift-memzero_page-to-highmemh
+++ a/lib/iov_iter.c
@@ -5,6 +5,7 @@
 #include <linux/fault-inject-usercopy.h>
 #include <linux/uio.h>
 #include <linux/pagemap.h>
+#include <linux/highmem.h>
 #include <linux/slab.h>
 #include <linux/vmalloc.h>
 #include <linux/splice.h>
@@ -507,13 +508,6 @@ void iov_iter_init(struct iov_iter *i, u
 }
 EXPORT_SYMBOL(iov_iter_init);
 
-static void memzero_page(struct page *page, size_t offset, size_t len)
-{
-	char *addr = kmap_atomic(page);
-	memset(addr + offset, 0, len);
-	kunmap_atomic(addr);
-}
-
 static inline bool allocated(struct pipe_buffer *buf)
 {
 	return buf->ops == &default_pipe_buf_ops;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 136/143] btrfs: use memzero_page() instead of open coded kmap pattern
  2021-05-05  1:32 incoming Andrew Morton
                   ` (131 preceding siblings ...)
  2021-05-05  1:40 ` [patch 135/143] iov_iter: lift memzero_page() to highmem.h Andrew Morton
@ 2021-05-05  1:40 ` Andrew Morton
  2021-05-05  1:40 ` [patch 137/143] mm/highmem.c: fix coding style issue Andrew Morton
                   ` (7 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:40 UTC (permalink / raw)
  To: akpm, chaitanya.kulkarni, clm, dsterba, ira.weiny, josef,
	linux-mm, mm-commits, torvalds, viro

From: Ira Weiny <ira.weiny@intel.com>
Subject: btrfs: use memzero_page() instead of open coded kmap pattern

There are many places where kmap/memset/kunmap patterns occur.

Use the newly lifted memzero_page() to eliminate direct uses of kmap and
leverage the new core functions use of kmap_local_page().

The development of this patch was aided by the following coccinelle
script:

// <smpl>
// SPDX-License-Identifier: GPL-2.0-only
// Find kmap/memset/kunmap pattern and replace with memset*page calls
//
// NOTE: Offsets and other expressions may be more complex than what the script
// will automatically generate.  Therefore a catchall rule is provided to find
// the pattern which then must be evaluated by hand.
//
// Confidence: Low
// Copyright: (C) 2021 Intel Corporation
// URL: http://coccinelle.lip6.fr/
// Comments:
// Options:

//
// Then the memset pattern
//
@ memset_rule1 @
expression page, V, L, Off;
identifier ptr;
type VP;
@@

(
-VP ptr = kmap(page);
|
-ptr = kmap(page);
|
-VP ptr = kmap_atomic(page);
|
-ptr = kmap_atomic(page);
)
<+...
(
-memset(ptr, 0, L);
+memzero_page(page, 0, L);
|
-memset(ptr + Off, 0, L);
+memzero_page(page, Off, L);
|
-memset(ptr, V, L);
+memset_page(page, V, 0, L);
|
-memset(ptr + Off, V, L);
+memset_page(page, V, Off, L);
)
...+>
(
-kunmap(page);
|
-kunmap_atomic(ptr);
)

// Remove any pointers left unused
@
depends on memset_rule1
@
identifier memset_rule1.ptr;
type VP, VP1;
@@

-VP ptr;
	... when != ptr;
? VP1 ptr;

//
// Catch all
//
@ memset_rule2 @
expression page;
identifier ptr;
expression GenTo, GenSize, GenValue;
type VP;
@@

(
-VP ptr = kmap(page);
|
-ptr = kmap(page);
|
-VP ptr = kmap_atomic(page);
|
-ptr = kmap_atomic(page);
)
<+...
(
//
// Some call sites have complex expressions within the memset/memcpy
// The follow are catch alls which need to be evaluated by hand.
//
-memset(GenTo, 0, GenSize);
+memzero_pageExtra(page, GenTo, GenSize);
|
-memset(GenTo, GenValue, GenSize);
+memset_pageExtra(page, GenValue, GenTo, GenSize);
)
...+>
(
-kunmap(page);
|
-kunmap_atomic(ptr);
)

// Remove any pointers left unused
@
depends on memset_rule2
@
identifier memset_rule2.ptr;
type VP, VP1;
@@

-VP ptr;
	... when != ptr;
? VP1 ptr;

// </smpl>

Link: https://lkml.kernel.org/r/20210309212137.2610186-4-ira.weiny@intel.com
Signed-off-by: Ira Weiny <ira.weiny@intel.com>
Reviewed-by: David Sterba <dsterba@suse.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Chaitanya Kulkarni <chaitanya.kulkarni@wdc.com>
Cc: Chris Mason <clm@fb.com>
Cc: Josef Bacik <josef@toxicpanda.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 fs/btrfs/compression.c |    5 +----
 fs/btrfs/extent_io.c   |   22 ++++------------------
 fs/btrfs/inode.c       |   33 ++++++++++-----------------------
 fs/btrfs/reflink.c     |    6 +-----
 fs/btrfs/zlib.c        |    5 +----
 fs/btrfs/zstd.c        |    5 +----
 6 files changed, 18 insertions(+), 58 deletions(-)

--- a/fs/btrfs/compression.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern
+++ a/fs/btrfs/compression.c
@@ -591,16 +591,13 @@ static noinline int add_ra_bio_pages(str
 		free_extent_map(em);
 
 		if (page->index == end_index) {
-			char *userpage;
 			size_t zero_offset = offset_in_page(isize);
 
 			if (zero_offset) {
 				int zeros;
 				zeros = PAGE_SIZE - zero_offset;
-				userpage = kmap_atomic(page);
-				memset(userpage + zero_offset, 0, zeros);
+				memzero_page(page, zero_offset, zeros);
 				flush_dcache_page(page);
-				kunmap_atomic(userpage);
 			}
 		}
 
--- a/fs/btrfs/extent_io.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern
+++ a/fs/btrfs/extent_io.c
@@ -3421,15 +3421,12 @@ int btrfs_do_readpage(struct page *page,
 	}
 
 	if (page->index == last_byte >> PAGE_SHIFT) {
-		char *userpage;
 		size_t zero_offset = offset_in_page(last_byte);
 
 		if (zero_offset) {
 			iosize = PAGE_SIZE - zero_offset;
-			userpage = kmap_atomic(page);
-			memset(userpage + zero_offset, 0, iosize);
+			memzero_page(page, zero_offset, iosize);
 			flush_dcache_page(page);
-			kunmap_atomic(userpage);
 		}
 	}
 	begin_page_read(fs_info, page);
@@ -3438,14 +3435,11 @@ int btrfs_do_readpage(struct page *page,
 		u64 disk_bytenr;
 
 		if (cur >= last_byte) {
-			char *userpage;
 			struct extent_state *cached = NULL;
 
 			iosize = PAGE_SIZE - pg_offset;
-			userpage = kmap_atomic(page);
-			memset(userpage + pg_offset, 0, iosize);
+			memzero_page(page, pg_offset, iosize);
 			flush_dcache_page(page);
-			kunmap_atomic(userpage);
 			set_extent_uptodate(tree, cur, cur + iosize - 1,
 					    &cached, GFP_NOFS);
 			unlock_extent_cached(tree, cur,
@@ -3528,13 +3522,10 @@ int btrfs_do_readpage(struct page *page,
 
 		/* we've found a hole, just zero and go on */
 		if (block_start == EXTENT_MAP_HOLE) {
-			char *userpage;
 			struct extent_state *cached = NULL;
 
-			userpage = kmap_atomic(page);
-			memset(userpage + pg_offset, 0, iosize);
+			memzero_page(page, pg_offset, iosize);
 			flush_dcache_page(page);
-			kunmap_atomic(userpage);
 
 			set_extent_uptodate(tree, cur, cur + iosize - 1,
 					    &cached, GFP_NOFS);
@@ -3845,12 +3836,7 @@ static int __extent_writepage(struct pag
 	}
 
 	if (page->index == end_index) {
-		char *userpage;
-
-		userpage = kmap_atomic(page);
-		memset(userpage + pg_offset, 0,
-		       PAGE_SIZE - pg_offset);
-		kunmap_atomic(userpage);
+		memzero_page(page, pg_offset, PAGE_SIZE - pg_offset);
 		flush_dcache_page(page);
 	}
 
--- a/fs/btrfs/inode.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern
+++ a/fs/btrfs/inode.c
@@ -646,17 +646,12 @@ again:
 		if (!ret) {
 			unsigned long offset = offset_in_page(total_compressed);
 			struct page *page = pages[nr_pages - 1];
-			char *kaddr;
 
 			/* zero the tail end of the last page, we might be
 			 * sending it down to disk
 			 */
-			if (offset) {
-				kaddr = kmap_atomic(page);
-				memset(kaddr + offset, 0,
-				       PAGE_SIZE - offset);
-				kunmap_atomic(kaddr);
-			}
+			if (offset)
+				memzero_page(page, offset, PAGE_SIZE - offset);
 			will_compress = 1;
 		}
 	}
@@ -4833,7 +4828,6 @@ int btrfs_truncate_block(struct btrfs_in
 	struct btrfs_ordered_extent *ordered;
 	struct extent_state *cached_state = NULL;
 	struct extent_changeset *data_reserved = NULL;
-	char *kaddr;
 	bool only_release_metadata = false;
 	u32 blocksize = fs_info->sectorsize;
 	pgoff_t index = from >> PAGE_SHIFT;
@@ -4925,15 +4919,13 @@ again:
 	if (offset != blocksize) {
 		if (!len)
 			len = blocksize - offset;
-		kaddr = kmap(page);
 		if (front)
-			memset(kaddr + (block_start - page_offset(page)),
-				0, offset);
+			memzero_page(page, (block_start - page_offset(page)),
+				     offset);
 		else
-			memset(kaddr + (block_start - page_offset(page)) +  offset,
-				0, len);
+			memzero_page(page, (block_start - page_offset(page)) + offset,
+				     len);
 		flush_dcache_page(page);
-		kunmap(page);
 	}
 	ClearPageChecked(page);
 	set_page_dirty(page);
@@ -6832,11 +6824,9 @@ static noinline int uncompress_inline(st
 	 * cover that region here.
 	 */
 
-	if (max_size + pg_offset < PAGE_SIZE) {
-		char *map = kmap(page);
-		memset(map + pg_offset + max_size, 0, PAGE_SIZE - max_size - pg_offset);
-		kunmap(page);
-	}
+	if (max_size + pg_offset < PAGE_SIZE)
+		memzero_page(page,  pg_offset + max_size,
+			     PAGE_SIZE - max_size - pg_offset);
 	kfree(tmp);
 	return ret;
 }
@@ -8506,7 +8496,6 @@ vm_fault_t btrfs_page_mkwrite(struct vm_
 	struct btrfs_ordered_extent *ordered;
 	struct extent_state *cached_state = NULL;
 	struct extent_changeset *data_reserved = NULL;
-	char *kaddr;
 	unsigned long zero_start;
 	loff_t size;
 	vm_fault_t ret;
@@ -8620,10 +8609,8 @@ again:
 		zero_start = PAGE_SIZE;
 
 	if (zero_start != PAGE_SIZE) {
-		kaddr = kmap(page);
-		memset(kaddr + zero_start, 0, PAGE_SIZE - zero_start);
+		memzero_page(page, zero_start, PAGE_SIZE - zero_start);
 		flush_dcache_page(page);
-		kunmap(page);
 	}
 	ClearPageChecked(page);
 	set_page_dirty(page);
--- a/fs/btrfs/reflink.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern
+++ a/fs/btrfs/reflink.c
@@ -129,12 +129,8 @@ static int copy_inline_to_page(struct bt
 	 * So what's in the range [500, 4095] corresponds to zeroes.
 	 */
 	if (datal < block_size) {
-		char *map;
-
-		map = kmap(page);
-		memset(map + datal, 0, block_size - datal);
+		memzero_page(page, datal, block_size - datal);
 		flush_dcache_page(page);
-		kunmap(page);
 	}
 
 	SetPageUptodate(page);
--- a/fs/btrfs/zlib.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern
+++ a/fs/btrfs/zlib.c
@@ -375,7 +375,6 @@ int zlib_decompress(struct list_head *ws
 	unsigned long bytes_left;
 	unsigned long total_out = 0;
 	unsigned long pg_offset = 0;
-	char *kaddr;
 
 	destlen = min_t(unsigned long, destlen, PAGE_SIZE);
 	bytes_left = destlen;
@@ -455,9 +454,7 @@ next:
 	 * end of the inline extent (destlen) to the end of the page
 	 */
 	if (pg_offset < destlen) {
-		kaddr = kmap_atomic(dest_page);
-		memset(kaddr + pg_offset, 0, destlen - pg_offset);
-		kunmap_atomic(kaddr);
+		memzero_page(dest_page, pg_offset, destlen - pg_offset);
 	}
 	return ret;
 }
--- a/fs/btrfs/zstd.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern
+++ a/fs/btrfs/zstd.c
@@ -631,7 +631,6 @@ int zstd_decompress(struct list_head *ws
 	size_t ret2;
 	unsigned long total_out = 0;
 	unsigned long pg_offset = 0;
-	char *kaddr;
 
 	stream = ZSTD_initDStream(
 			ZSTD_BTRFS_MAX_INPUT, workspace->mem, workspace->size);
@@ -696,9 +695,7 @@ int zstd_decompress(struct list_head *ws
 	ret = 0;
 finish:
 	if (pg_offset < destlen) {
-		kaddr = kmap_atomic(dest_page);
-		memset(kaddr + pg_offset, 0, destlen - pg_offset);
-		kunmap_atomic(kaddr);
+		memzero_page(dest_page, pg_offset, destlen - pg_offset);
 	}
 	return ret;
 }
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 137/143] mm/highmem.c: fix coding style issue
  2021-05-05  1:32 incoming Andrew Morton
                   ` (132 preceding siblings ...)
  2021-05-05  1:40 ` [patch 136/143] btrfs: use memzero_page() instead of open coded kmap pattern Andrew Morton
@ 2021-05-05  1:40 ` Andrew Morton
  2021-05-05  1:40 ` [patch 138/143] mm/mempool: minor coding style tweaks Andrew Morton
                   ` (6 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:40 UTC (permalink / raw)
  To: akpm, david, linux-mm, mm-commits, songqiang, torvalds

From: songqiang <songqiang@uniontech.com>
Subject: mm/highmem.c: fix coding style issue

Delete/add some blank lines and some blank spaces

Link: https://lkml.kernel.org/r/20210311095015.14277-1-songqiang@uniontech.com
Signed-off-by: songqiang <songqiang@uniontech.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/highmem.c |   11 +++++------
 1 file changed, 5 insertions(+), 6 deletions(-)

--- a/mm/highmem.c~mm-highmemc-fix-coding-style-issue
+++ a/mm/highmem.c
@@ -104,7 +104,7 @@ static inline wait_queue_head_t *get_pkm
 atomic_long_t _totalhigh_pages __read_mostly;
 EXPORT_SYMBOL(_totalhigh_pages);
 
-unsigned int __nr_free_highpages (void)
+unsigned int __nr_free_highpages(void)
 {
 	struct zone *zone;
 	unsigned int pages = 0;
@@ -120,7 +120,7 @@ unsigned int __nr_free_highpages (void)
 static int pkmap_count[LAST_PKMAP];
 static  __cacheline_aligned_in_smp DEFINE_SPINLOCK(kmap_lock);
 
-pte_t * pkmap_page_table;
+pte_t *pkmap_page_table;
 
 /*
  * Most architectures have no use for kmap_high_get(), so let's abstract
@@ -147,6 +147,7 @@ struct page *__kmap_to_page(void *vaddr)
 
 	if (addr >= PKMAP_ADDR(0) && addr < PKMAP_ADDR(LAST_PKMAP)) {
 		int i = PKMAP_NR(addr);
+
 		return pte_page(pkmap_page_table[i]);
 	}
 
@@ -278,9 +279,8 @@ void *kmap_high(struct page *page)
 	pkmap_count[PKMAP_NR(vaddr)]++;
 	BUG_ON(pkmap_count[PKMAP_NR(vaddr)] < 2);
 	unlock_kmap();
-	return (void*) vaddr;
+	return (void *) vaddr;
 }
-
 EXPORT_SYMBOL(kmap_high);
 
 #ifdef ARCH_NEEDS_KMAP_HIGH_GET
@@ -305,7 +305,7 @@ void *kmap_high_get(struct page *page)
 		pkmap_count[PKMAP_NR(vaddr)]++;
 	}
 	unlock_kmap_any(flags);
-	return (void*) vaddr;
+	return (void *) vaddr;
 }
 #endif
 
@@ -737,7 +737,6 @@ done:
 	spin_unlock_irqrestore(&pas->lock, flags);
 	return ret;
 }
-
 EXPORT_SYMBOL(page_address);
 
 /**
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 138/143] mm/mempool: minor coding style tweaks
  2021-05-05  1:32 incoming Andrew Morton
                   ` (133 preceding siblings ...)
  2021-05-05  1:40 ` [patch 137/143] mm/highmem.c: fix coding style issue Andrew Morton
@ 2021-05-05  1:40 ` Andrew Morton
  2021-05-05  1:40 ` [patch 139/143] mm/process_vm_access.c: remove duplicate include Andrew Morton
                   ` (5 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:40 UTC (permalink / raw)
  To: akpm, daizhiyuan, linux-mm, mm-commits, torvalds

From: Zhiyuan Dai <daizhiyuan@phytium.com.cn>
Subject: mm/mempool: minor coding style tweaks

Various coding style tweaks to various files under mm/

[daizhiyuan@phytium.com.cn: mm/swapfile: minor coding style tweaks]
  Link: https://lkml.kernel.org/r/1614223624-16055-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/sparse: minor coding style tweaks]
  Link: https://lkml.kernel.org/r/1614227288-19363-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/vmscan: minor coding style tweaks]
  Link: https://lkml.kernel.org/r/1614227649-19853-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/compaction: minor coding style tweaks]
  Link: https://lkml.kernel.org/r/1614228218-20770-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/oom_kill: minor coding style tweaks]
  Link: https://lkml.kernel.org/r/1614228360-21168-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/shmem: minor coding style tweaks]
  Link: https://lkml.kernel.org/r/1614228504-21491-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/page_alloc: minor coding style tweaks]
  Link: https://lkml.kernel.org/r/1614228613-21754-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/filemap: minor coding style tweaks]
  Link: https://lkml.kernel.org/r/1614228936-22337-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/mlock: minor coding style tweaks]
  Link: https://lkml.kernel.org/r/1613956588-2453-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/frontswap: minor coding style tweaks]
  Link: https://lkml.kernel.org/r/1613962668-15045-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/vmalloc: minor coding style tweaks]
  Link: https://lkml.kernel.org/r/1613963379-15988-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/memory_hotplug: minor coding style tweaks]
  Link: https://lkml.kernel.org/r/1613971784-24878-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/mempolicy: minor coding style tweaks]
  Link: https://lkml.kernel.org/r/1613972228-25501-1-git-send-email-daizhiyuan@phytium.com.cn
Link: https://lkml.kernel.org/r/1614222374-13805-1-git-send-email-daizhiyuan@phytium.com.cn
Signed-off-by: Zhiyuan Dai <daizhiyuan@phytium.com.cn>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/compaction.c     |    2 +-
 mm/filemap.c        |    8 ++++----
 mm/frontswap.c      |   12 ++++++++----
 mm/memory_hotplug.c |    2 +-
 mm/mempolicy.c      |    4 ++--
 mm/mempool.c        |    2 +-
 mm/mlock.c          |    4 ++--
 mm/oom_kill.c       |    2 +-
 mm/page_alloc.c     |    2 +-
 mm/shmem.c          |    2 +-
 mm/sparse.c         |    2 +-
 mm/swapfile.c       |    4 ++--
 mm/vmalloc.c        |    2 +-
 mm/vmscan.c         |    2 +-
 14 files changed, 27 insertions(+), 23 deletions(-)

--- a/mm/compaction.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/compaction.c
@@ -2885,7 +2885,7 @@ void wakeup_kcompactd(pg_data_t *pgdat,
  */
 static int kcompactd(void *p)
 {
-	pg_data_t *pgdat = (pg_data_t*)p;
+	pg_data_t *pgdat = (pg_data_t *)p;
 	struct task_struct *tsk = current;
 	unsigned int proactive_defer = 0;
 
--- a/mm/filemap.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/filemap.c
@@ -3267,7 +3267,7 @@ const struct vm_operations_struct generi
 
 /* This is used for a general mmap of a disk file */
 
-int generic_file_mmap(struct file * file, struct vm_area_struct * vma)
+int generic_file_mmap(struct file *file, struct vm_area_struct *vma)
 {
 	struct address_space *mapping = file->f_mapping;
 
@@ -3292,11 +3292,11 @@ vm_fault_t filemap_page_mkwrite(struct v
 {
 	return VM_FAULT_SIGBUS;
 }
-int generic_file_mmap(struct file * file, struct vm_area_struct * vma)
+int generic_file_mmap(struct file *file, struct vm_area_struct *vma)
 {
 	return -ENOSYS;
 }
-int generic_file_readonly_mmap(struct file * file, struct vm_area_struct * vma)
+int generic_file_readonly_mmap(struct file *file, struct vm_area_struct *vma)
 {
 	return -ENOSYS;
 }
@@ -3724,7 +3724,7 @@ EXPORT_SYMBOL(generic_perform_write);
 ssize_t __generic_file_write_iter(struct kiocb *iocb, struct iov_iter *from)
 {
 	struct file *file = iocb->ki_filp;
-	struct address_space * mapping = file->f_mapping;
+	struct address_space *mapping = file->f_mapping;
 	struct inode 	*inode = mapping->host;
 	ssize_t		written = 0;
 	ssize_t		err;
--- a/mm/frontswap.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/frontswap.c
@@ -60,16 +60,20 @@ static u64 frontswap_succ_stores;
 static u64 frontswap_failed_stores;
 static u64 frontswap_invalidates;
 
-static inline void inc_frontswap_loads(void) {
+static inline void inc_frontswap_loads(void)
+{
 	data_race(frontswap_loads++);
 }
-static inline void inc_frontswap_succ_stores(void) {
+static inline void inc_frontswap_succ_stores(void)
+{
 	data_race(frontswap_succ_stores++);
 }
-static inline void inc_frontswap_failed_stores(void) {
+static inline void inc_frontswap_failed_stores(void)
+{
 	data_race(frontswap_failed_stores++);
 }
-static inline void inc_frontswap_invalidates(void) {
+static inline void inc_frontswap_invalidates(void)
+{
 	data_race(frontswap_invalidates++);
 }
 #else
--- a/mm/memory_hotplug.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/memory_hotplug.c
@@ -834,7 +834,7 @@ static inline struct zone *default_zone_
 	return movable_node_enabled ? movable_zone : kernel_zone;
 }
 
-struct zone * zone_for_pfn_range(int online_type, int nid, unsigned start_pfn,
+struct zone *zone_for_pfn_range(int online_type, int nid, unsigned start_pfn,
 		unsigned long nr_pages)
 {
 	if (online_type == MMOP_ONLINE_KERNEL)
--- a/mm/mempolicy.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/mempolicy.c
@@ -330,7 +330,7 @@ static void mpol_rebind_nodemask(struct
 	else if (pol->flags & MPOL_F_RELATIVE_NODES)
 		mpol_relative_nodemask(&tmp, &pol->w.user_nodemask, nodes);
 	else {
-		nodes_remap(tmp, pol->v.nodes,pol->w.cpuset_mems_allowed,
+		nodes_remap(tmp, pol->v.nodes, pol->w.cpuset_mems_allowed,
 								*nodes);
 		pol->w.cpuset_mems_allowed = *nodes;
 	}
@@ -1161,7 +1161,7 @@ int do_migrate_pages(struct mm_struct *m
 
 	tmp = *from;
 	while (!nodes_empty(tmp)) {
-		int s,d;
+		int s, d;
 		int source = NUMA_NO_NODE;
 		int dest = 0;
 
--- a/mm/mempool.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/mempool.c
@@ -251,7 +251,7 @@ EXPORT_SYMBOL(mempool_init);
 mempool_t *mempool_create(int min_nr, mempool_alloc_t *alloc_fn,
 				mempool_free_t *free_fn, void *pool_data)
 {
-	return mempool_create_node(min_nr,alloc_fn,free_fn, pool_data,
+	return mempool_create_node(min_nr, alloc_fn, free_fn, pool_data,
 				   GFP_KERNEL, NUMA_NO_NODE);
 }
 EXPORT_SYMBOL(mempool_create);
--- a/mm/mlock.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/mlock.c
@@ -559,7 +559,7 @@ static int apply_vma_lock_flags(unsigned
 				vm_flags_t flags)
 {
 	unsigned long nstart, end, tmp;
-	struct vm_area_struct * vma, * prev;
+	struct vm_area_struct *vma, *prev;
 	int error;
 
 	VM_BUG_ON(offset_in_page(start));
@@ -737,7 +737,7 @@ SYSCALL_DEFINE2(munlock, unsigned long,
  */
 static int apply_mlockall_flags(int flags)
 {
-	struct vm_area_struct * vma, * prev = NULL;
+	struct vm_area_struct *vma, *prev = NULL;
 	vm_flags_t to_add = 0;
 
 	current->mm->def_flags &= VM_LOCKED_CLEAR_MASK;
--- a/mm/oom_kill.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/oom_kill.c
@@ -993,7 +993,7 @@ static void oom_kill_process(struct oom_
 	if (oom_group) {
 		mem_cgroup_print_oom_group(oom_group);
 		mem_cgroup_scan_tasks(oom_group, oom_kill_memcg_member,
-				      (void*)message);
+				      (void *)message);
 		mem_cgroup_put(oom_group);
 	}
 }
--- a/mm/page_alloc.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/page_alloc.c
@@ -8808,7 +8808,7 @@ int alloc_contig_range(unsigned long sta
 	ret = __alloc_contig_migrate_range(&cc, start, end);
 	if (ret && ret != -EBUSY)
 		goto done;
-	ret =0;
+	ret = 0;
 
 	/*
 	 * Pages from [start, end) are within a MAX_ORDER_NR_PAGES
--- a/mm/shmem.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/shmem.c
@@ -3508,7 +3508,7 @@ static int shmem_parse_options(struct fs
 			}
 		}
 		if (*this_char) {
-			char *value = strchr(this_char,'=');
+			char *value = strchr(this_char, '=');
 			size_t len = 0;
 			int err;
 
--- a/mm/sparse.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/sparse.c
@@ -257,7 +257,7 @@ static void __init memory_present(int ni
 	if (unlikely(!mem_section)) {
 		unsigned long size, align;
 
-		size = sizeof(struct mem_section*) * NR_SECTION_ROOTS;
+		size = sizeof(struct mem_section *) * NR_SECTION_ROOTS;
 		align = 1 << (INTERNODE_CACHE_SHIFT);
 		mem_section = memblock_alloc(size, align);
 		if (!mem_section)
--- a/mm/swapfile.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/swapfile.c
@@ -2780,7 +2780,7 @@ static int swap_show(struct seq_file *sw
 	unsigned int bytes, inuse;
 
 	if (si == SEQ_START_TOKEN) {
-		seq_puts(swap,"Filename\t\t\t\tType\t\tSize\t\tUsed\t\tPriority\n");
+		seq_puts(swap, "Filename\t\t\t\tType\t\tSize\t\tUsed\t\tPriority\n");
 		return 0;
 	}
 
@@ -3284,7 +3284,7 @@ SYSCALL_DEFINE2(swapon, const char __use
 					 sizeof(long),
 					 GFP_KERNEL);
 
-	if (p->bdev &&(swap_flags & SWAP_FLAG_DISCARD) && swap_discardable(p)) {
+	if (p->bdev && (swap_flags & SWAP_FLAG_DISCARD) && swap_discardable(p)) {
 		/*
 		 * When discard is enabled for swap with no particular
 		 * policy flagged, we set all swap discard flags here in
--- a/mm/vmalloc.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/vmalloc.c
@@ -3083,7 +3083,7 @@ EXPORT_SYMBOL(vzalloc_node);
  * 64b systems should always have either DMA or DMA32 zones. For others
  * GFP_DMA32 should do the right thing and use the normal zone.
  */
-#define GFP_VMALLOC32 GFP_DMA32 | GFP_KERNEL
+#define GFP_VMALLOC32 (GFP_DMA32 | GFP_KERNEL)
 #endif
 
 /**
--- a/mm/vmscan.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/vmscan.c
@@ -4059,7 +4059,7 @@ static int kswapd(void *p)
 {
 	unsigned int alloc_order, reclaim_order;
 	unsigned int highest_zoneidx = MAX_NR_ZONES - 1;
-	pg_data_t *pgdat = (pg_data_t*)p;
+	pg_data_t *pgdat = (pg_data_t *)p;
 	struct task_struct *tsk = current;
 	const struct cpumask *cpumask = cpumask_of_node(pgdat->node_id);
 
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 139/143] mm/process_vm_access.c: remove duplicate include
  2021-05-05  1:32 incoming Andrew Morton
                   ` (134 preceding siblings ...)
  2021-05-05  1:40 ` [patch 138/143] mm/mempool: minor coding style tweaks Andrew Morton
@ 2021-05-05  1:40 ` Andrew Morton
  2021-05-05  1:40 ` [patch 140/143] kfence: zero guard page after out-of-bounds access Andrew Morton
                   ` (4 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:40 UTC (permalink / raw)
  To: akpm, linux-mm, mm-commits, torvalds, zhang.yunkai

From: Zhang Yunkai <zhang.yunkai@zte.com.cn>
Subject: mm/process_vm_access.c: remove duplicate include

'linux/compat.h' included in 'process_vm_access.c' is duplicated.

Link: https://lkml.kernel.org/r/20210306132122.220431-1-zhang.yunkai@zte.com.cn
Signed-off-by: Zhang Yunkai <zhang.yunkai@zte.com.cn>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/process_vm_access.c |    1 -
 1 file changed, 1 deletion(-)

--- a/mm/process_vm_access.c~mm-process_vm_access-remove-duplicate-include
+++ a/mm/process_vm_access.c
@@ -9,7 +9,6 @@
 #include <linux/mm.h>
 #include <linux/uio.h>
 #include <linux/sched.h>
-#include <linux/compat.h>
 #include <linux/sched/mm.h>
 #include <linux/highmem.h>
 #include <linux/ptrace.h>
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 140/143] kfence: zero guard page after out-of-bounds access
  2021-05-05  1:32 incoming Andrew Morton
                   ` (135 preceding siblings ...)
  2021-05-05  1:40 ` [patch 139/143] mm/process_vm_access.c: remove duplicate include Andrew Morton
@ 2021-05-05  1:40 ` Andrew Morton
  2021-05-05  1:40 ` [patch 141/143] kfence: await for allocation using wait_event Andrew Morton
                   ` (3 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:40 UTC (permalink / raw)
  To: akpm, andreyknvl, dvyukov, elver, glider, jannh, linux-mm,
	mm-commits, torvalds

From: Marco Elver <elver@google.com>
Subject: kfence: zero guard page after out-of-bounds access

After an out-of-bounds accesses, zero the guard page before re-protecting
in kfence_guarded_free().  On one hand this helps make the failure mode of
subsequent out-of-bounds accesses more deterministic, but could also
prevent certain information leaks.

Link: https://lkml.kernel.org/r/20210312121653.348518-1-elver@google.com
Signed-off-by: Marco Elver <elver@google.com>
Acked-by: Alexander Potapenko <glider@google.com>
Cc: Dmitry Vyukov <dvyukov@google.com>
Cc: Andrey Konovalov <andreyknvl@google.com>
Cc: Jann Horn <jannh@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/kfence/core.c |    1 +
 1 file changed, 1 insertion(+)

--- a/mm/kfence/core.c~kfence-zero-guard-page-after-out-of-bounds-access
+++ a/mm/kfence/core.c
@@ -372,6 +372,7 @@ static void kfence_guarded_free(void *ad
 
 	/* Restore page protection if there was an OOB access. */
 	if (meta->unprotected_page) {
+		memzero_explicit((void *)ALIGN_DOWN(meta->unprotected_page, PAGE_SIZE), PAGE_SIZE);
 		kfence_protect(meta->unprotected_page);
 		meta->unprotected_page = 0;
 	}
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 141/143] kfence: await for allocation using wait_event
  2021-05-05  1:32 incoming Andrew Morton
                   ` (136 preceding siblings ...)
  2021-05-05  1:40 ` [patch 140/143] kfence: zero guard page after out-of-bounds access Andrew Morton
@ 2021-05-05  1:40 ` Andrew Morton
  2021-05-05  1:40 ` [patch 142/143] kfence: maximize allocation wait timeout duration Andrew Morton
                   ` (2 subsequent siblings)
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:40 UTC (permalink / raw)
  To: akpm, dvyukov, elver, glider, hdanton, jannh, linux-mm,
	mark.rutland, mm-commits, torvalds

From: Marco Elver <elver@google.com>
Subject: kfence: await for allocation using wait_event

Patch series "kfence: optimize timer scheduling", v2.

We have observed that mostly-idle systems with KFENCE enabled wake up
otherwise idle CPUs, preventing such to enter a lower power state. 
Debugging revealed that KFENCE spends too much active time in
toggle_allocation_gate().

While the first version of KFENCE was using all the right bits to be
scheduling optimal, and thus power efficient, by simply using wait_event()
+ wake_up(), that code was unfortunately removed.

As KFENCE was exposed to various different configs and tests, the
scheduling optimal code slowly disappeared.  First because of hung task
warnings, and finally because of deadlocks when an allocation is made by
timer code with debug objects enabled.  Clearly, the "fixes" were not too
friendly for devices that want to be power efficient.

Therefore, let's try a little harder to fix the hung task and deadlock
problems that we have with wait_event() + wake_up(), while remaining as
scheduling friendly and power efficient as possible.

Crucially, we need to defer the wake_up() to an irq_work, avoiding any
potential for deadlock.

The result with this series is that on the devices where we observed a
power regression, power usage returns back to baseline levels.


This patch (of 3):

On mostly-idle systems, we have observed that toggle_allocation_gate() is
a cause of frequent wake-ups, preventing an otherwise idle CPU to go into
a lower power state.

A late change in KFENCE's development, due to a potential deadlock [1],
required changing the scheduling-friendly wait_event_timeout() and
wake_up() to an open-coded wait-loop using schedule_timeout().  [1]
https://lkml.kernel.org/r/000000000000c0645805b7f982e4@google.com

To avoid unnecessary wake-ups, switch to using wait_event_timeout().

Unfortunately, we still cannot use a version with direct wake_up() in
__kfence_alloc() due to the same potential for deadlock as in [1]. 
Instead, add a level of indirection via an irq_work that is scheduled if
we determine that the kfence_timer requires a wake_up().

Link: https://lkml.kernel.org/r/20210421105132.3965998-1-elver@google.com
Link: https://lkml.kernel.org/r/20210421105132.3965998-2-elver@google.com
Fixes: 0ce20dd84089 ("mm: add Kernel Electric-Fence infrastructure")
Signed-off-by: Marco Elver <elver@google.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Dmitry Vyukov <dvyukov@google.com>
Cc: Jann Horn <jannh@google.com>
Cc: Mark Rutland <mark.rutland@arm.com>
Cc: Hillf Danton <hdanton@sina.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 lib/Kconfig.kfence |    1 +
 mm/kfence/core.c   |   43 ++++++++++++++++++++++++++++---------------
 2 files changed, 29 insertions(+), 15 deletions(-)

--- a/lib/Kconfig.kfence~kfence-await-for-allocation-using-wait_event
+++ a/lib/Kconfig.kfence
@@ -7,6 +7,7 @@ menuconfig KFENCE
 	bool "KFENCE: low-overhead sampling-based memory safety error detector"
 	depends on HAVE_ARCH_KFENCE && (SLAB || SLUB)
 	select STACKTRACE
+	select IRQ_WORK
 	help
 	  KFENCE is a low-overhead sampling-based detector of heap out-of-bounds
 	  access, use-after-free, and invalid-free errors. KFENCE is designed
--- a/mm/kfence/core.c~kfence-await-for-allocation-using-wait_event
+++ a/mm/kfence/core.c
@@ -10,6 +10,7 @@
 #include <linux/atomic.h>
 #include <linux/bug.h>
 #include <linux/debugfs.h>
+#include <linux/irq_work.h>
 #include <linux/kcsan-checks.h>
 #include <linux/kfence.h>
 #include <linux/kmemleak.h>
@@ -587,6 +588,17 @@ late_initcall(kfence_debugfs_init);
 
 /* === Allocation Gate Timer ================================================ */
 
+#ifdef CONFIG_KFENCE_STATIC_KEYS
+/* Wait queue to wake up allocation-gate timer task. */
+static DECLARE_WAIT_QUEUE_HEAD(allocation_wait);
+
+static void wake_up_kfence_timer(struct irq_work *work)
+{
+	wake_up(&allocation_wait);
+}
+static DEFINE_IRQ_WORK(wake_up_kfence_timer_work, wake_up_kfence_timer);
+#endif
+
 /*
  * Set up delayed work, which will enable and disable the static key. We need to
  * use a work queue (rather than a simple timer), since enabling and disabling a
@@ -604,25 +616,13 @@ static void toggle_allocation_gate(struc
 	if (!READ_ONCE(kfence_enabled))
 		return;
 
-	/* Enable static key, and await allocation to happen. */
 	atomic_set(&kfence_allocation_gate, 0);
 #ifdef CONFIG_KFENCE_STATIC_KEYS
+	/* Enable static key, and await allocation to happen. */
 	static_branch_enable(&kfence_allocation_key);
-	/*
-	 * Await an allocation. Timeout after 1 second, in case the kernel stops
-	 * doing allocations, to avoid stalling this worker task for too long.
-	 */
-	{
-		unsigned long end_wait = jiffies + HZ;
 
-		do {
-			set_current_state(TASK_UNINTERRUPTIBLE);
-			if (atomic_read(&kfence_allocation_gate) != 0)
-				break;
-			schedule_timeout(1);
-		} while (time_before(jiffies, end_wait));
-		__set_current_state(TASK_RUNNING);
-	}
+	wait_event_timeout(allocation_wait, atomic_read(&kfence_allocation_gate), HZ);
+
 	/* Disable static key and reset timer. */
 	static_branch_disable(&kfence_allocation_key);
 #endif
@@ -729,6 +729,19 @@ void *__kfence_alloc(struct kmem_cache *
 	 */
 	if (atomic_read(&kfence_allocation_gate) || atomic_inc_return(&kfence_allocation_gate) > 1)
 		return NULL;
+#ifdef CONFIG_KFENCE_STATIC_KEYS
+	/*
+	 * waitqueue_active() is fully ordered after the update of
+	 * kfence_allocation_gate per atomic_inc_return().
+	 */
+	if (waitqueue_active(&allocation_wait)) {
+		/*
+		 * Calling wake_up() here may deadlock when allocations happen
+		 * from within timer code. Use an irq_work to defer it.
+		 */
+		irq_work_queue(&wake_up_kfence_timer_work);
+	}
+#endif
 
 	if (!READ_ONCE(kfence_enabled))
 		return NULL;
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 142/143] kfence: maximize allocation wait timeout duration
  2021-05-05  1:32 incoming Andrew Morton
                   ` (137 preceding siblings ...)
  2021-05-05  1:40 ` [patch 141/143] kfence: await for allocation using wait_event Andrew Morton
@ 2021-05-05  1:40 ` Andrew Morton
  2021-05-05  1:40 ` [patch 143/143] kfence: use power-efficient work queue to run delayed work Andrew Morton
  2021-05-05  1:47 ` incoming Linus Torvalds
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:40 UTC (permalink / raw)
  To: akpm, dvyukov, elver, glider, hdanton, jannh, linux-mm,
	mark.rutland, mm-commits, torvalds

From: Marco Elver <elver@google.com>
Subject: kfence: maximize allocation wait timeout duration

The allocation wait timeout was initially added because of warnings due to
CONFIG_DETECT_HUNG_TASK=y [1].  While the 1 sec timeout is sufficient to
resolve the warnings (given the hung task timeout must be 1 sec or larger)
it may cause unnecessary wake-ups if the system is idle.  [1]
https://lkml.kernel.org/r/CADYN=9J0DQhizAGB0-jz4HOBBh+05kMBXb4c0cXMS7Qi5NAJiw@mail.gmail.com

Fix it by computing the timeout duration in terms of the current
sysctl_hung_task_timeout_secs value.

Link: https://lkml.kernel.org/r/20210421105132.3965998-3-elver@google.com
Signed-off-by: Marco Elver <elver@google.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Dmitry Vyukov <dvyukov@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: Jann Horn <jannh@google.com>
Cc: Mark Rutland <mark.rutland@arm.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/kfence/core.c |   12 +++++++++++-
 1 file changed, 11 insertions(+), 1 deletion(-)

--- a/mm/kfence/core.c~kfence-maximize-allocation-wait-timeout-duration
+++ a/mm/kfence/core.c
@@ -20,6 +20,7 @@
 #include <linux/moduleparam.h>
 #include <linux/random.h>
 #include <linux/rcupdate.h>
+#include <linux/sched/sysctl.h>
 #include <linux/seq_file.h>
 #include <linux/slab.h>
 #include <linux/spinlock.h>
@@ -621,7 +622,16 @@ static void toggle_allocation_gate(struc
 	/* Enable static key, and await allocation to happen. */
 	static_branch_enable(&kfence_allocation_key);
 
-	wait_event_timeout(allocation_wait, atomic_read(&kfence_allocation_gate), HZ);
+	if (sysctl_hung_task_timeout_secs) {
+		/*
+		 * During low activity with no allocations we might wait a
+		 * while; let's avoid the hung task warning.
+		 */
+		wait_event_timeout(allocation_wait, atomic_read(&kfence_allocation_gate),
+				   sysctl_hung_task_timeout_secs * HZ / 2);
+	} else {
+		wait_event(allocation_wait, atomic_read(&kfence_allocation_gate));
+	}
 
 	/* Disable static key and reset timer. */
 	static_branch_disable(&kfence_allocation_key);
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* [patch 143/143] kfence: use power-efficient work queue to run delayed work
  2021-05-05  1:32 incoming Andrew Morton
                   ` (138 preceding siblings ...)
  2021-05-05  1:40 ` [patch 142/143] kfence: maximize allocation wait timeout duration Andrew Morton
@ 2021-05-05  1:40 ` Andrew Morton
  2021-05-05  1:47 ` incoming Linus Torvalds
  140 siblings, 0 replies; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  1:40 UTC (permalink / raw)
  To: akpm, dvyukov, elver, glider, hdanton, jannh, linux-mm,
	mark.rutland, mm-commits, torvalds

From: Marco Elver <elver@google.com>
Subject: kfence: use power-efficient work queue to run delayed work

Use the power-efficient work queue, to avoid the pathological case where
we keep pinning ourselves on the same possibly idle CPU on systems that
want to be power-efficient (https://lwn.net/Articles/731052/).

Link: https://lkml.kernel.org/r/20210421105132.3965998-4-elver@google.com
Signed-off-by: Marco Elver <elver@google.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Dmitry Vyukov <dvyukov@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: Jann Horn <jannh@google.com>
Cc: Mark Rutland <mark.rutland@arm.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/kfence/core.c |    5 +++--
 1 file changed, 3 insertions(+), 2 deletions(-)

--- a/mm/kfence/core.c~kfence-use-power-efficient-work-queue-to-run-delayed-work
+++ a/mm/kfence/core.c
@@ -636,7 +636,8 @@ static void toggle_allocation_gate(struc
 	/* Disable static key and reset timer. */
 	static_branch_disable(&kfence_allocation_key);
 #endif
-	schedule_delayed_work(&kfence_timer, msecs_to_jiffies(kfence_sample_interval));
+	queue_delayed_work(system_power_efficient_wq, &kfence_timer,
+			   msecs_to_jiffies(kfence_sample_interval));
 }
 static DECLARE_DELAYED_WORK(kfence_timer, toggle_allocation_gate);
 
@@ -665,7 +666,7 @@ void __init kfence_init(void)
 	}
 
 	WRITE_ONCE(kfence_enabled, true);
-	schedule_delayed_work(&kfence_timer, 0);
+	queue_delayed_work(system_power_efficient_wq, &kfence_timer, 0);
 	pr_info("initialized - using %lu bytes for %d objects at 0x%p-0x%p\n", KFENCE_POOL_SIZE,
 		CONFIG_KFENCE_NUM_OBJECTS, (void *)__kfence_pool,
 		(void *)(__kfence_pool + KFENCE_POOL_SIZE));
_


^ permalink raw reply	[flat|nested] 146+ messages in thread

* Re: incoming
  2021-05-05  1:32 incoming Andrew Morton
                   ` (139 preceding siblings ...)
  2021-05-05  1:40 ` [patch 143/143] kfence: use power-efficient work queue to run delayed work Andrew Morton
@ 2021-05-05  1:47 ` Linus Torvalds
  2021-05-05  3:16   ` incoming Andrew Morton
  140 siblings, 1 reply; 146+ messages in thread
From: Linus Torvalds @ 2021-05-05  1:47 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 143 patches

Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.

Maybe just some mail delay? But at least right now

   https://lore.kernel.org/mm-commits/

doesn't show them (and thus 'b4' doesn't work).

I'll check again later.

             Linus


^ permalink raw reply	[flat|nested] 146+ messages in thread

* Re: incoming
  2021-05-05  1:47 ` incoming Linus Torvalds
@ 2021-05-05  3:16   ` Andrew Morton
  2021-05-05 17:10     ` incoming Linus Torvalds
  0 siblings, 1 reply; 146+ messages in thread
From: Andrew Morton @ 2021-05-05  3:16 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Linux-MM, mm-commits

On Tue, 4 May 2021 18:47:19 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 143 patches
> 
> Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.
> 
> Maybe just some mail delay? But at least right now
> 
>    https://lore.kernel.org/mm-commits/
> 
> doesn't show them (and thus 'b4' doesn't work).
> 
> I'll check again later.
> 

Well that's strange.  I see all three via cc:me, but not on linux-mm or
mm-commits.

Let me resend right now with the same in-reply-to.  Hopefully they will
land in the correct place.


^ permalink raw reply	[flat|nested] 146+ messages in thread

* Re: incoming
  2021-05-05  3:16   ` incoming Andrew Morton
@ 2021-05-05 17:10     ` Linus Torvalds
  2021-05-05 17:44       ` incoming Andrew Morton
  0 siblings, 1 reply; 146+ messages in thread
From: Linus Torvalds @ 2021-05-05 17:10 UTC (permalink / raw)
  To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits

On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> Let me resend right now with the same in-reply-to.  Hopefully they will
> land in the correct place.

Well, you re-sent it twice, and I have three copies in my own mailbox,
bot they still don't show up on the mm-commits mailing list.

So the list hates them for some odd reason.

I've picked them up locally, but adding Konstantin to the participants
to see if he can see what's up.

Konstantin: patches 103/106/107 are missing on lore out of Andrew's
series of 143. Odd.

             Linus


^ permalink raw reply	[flat|nested] 146+ messages in thread

* Re: incoming
  2021-05-05 17:10     ` incoming Linus Torvalds
@ 2021-05-05 17:44       ` Andrew Morton
  2021-05-06  3:19         ` incoming Anshuman Khandual
  0 siblings, 1 reply; 146+ messages in thread
From: Andrew Morton @ 2021-05-05 17:44 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits

[-- Attachment #1: Type: text/plain, Size: 1387 bytes --]

On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > Let me resend right now with the same in-reply-to.  Hopefully they will
> > land in the correct place.
> 
> Well, you re-sent it twice, and I have three copies in my own mailbox,
> bot they still don't show up on the mm-commits mailing list.
> 
> So the list hates them for some odd reason.
> 
> I've picked them up locally, but adding Konstantin to the participants
> to see if he can see what's up.
> 
> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
> series of 143. Odd.

It's weird.  They don't turn up on linux-mm either, and that's running
at kvack.org, also majordomo.  They don't get through when sent with
either heirloom-mailx or with sylpheed.

Also, it seems that when Anshuman originally sent the patch, linux-mm
and linux-kernel didn't send it back out.  So perhaps a spam filter
triggered?

I'm seeing

https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/

which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
server massacred that patch series.  Searching
https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
email series.

One of the emails (as sent my me) is attached, if that helps.



[-- Attachment #2: x.txt --]
[-- Type: text/plain, Size: 21048 bytes --]

Return-Path: <akpm@linux-foundation.org>
X-Spam-Checker-Version: SpamAssassin 3.4.1 (2015-04-28) on y
X-Spam-Level: (none)
X-Spam-Status: No, score=-101.5 required=2.5 tests=BAYES_00,T_DKIM_INVALID,
	USER_IN_WHITELIST autolearn=ham autolearn_force=no version=3.4.1
Received: from localhost.localdomain (localhost.localdomain [127.0.0.1])
	by localhost.localdomain (8.15.2/8.15.2/Debian-8ubuntu1) with ESMTP id 1453H2fk032202
	for <akpm@localhost>; Tue, 4 May 2021 20:17:03 -0700
Received: from imap.fastmail.com [66.111.4.135]
	by localhost.localdomain with IMAP (fetchmail-6.3.26)
	for <akpm@localhost> (single-drop); Tue, 04 May 2021 20:17:03 -0700 (PDT)
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
	 by sloti11d1t06 (Cyrus 3.5.0-alpha0-442-g5daca166b9-fm-20210428.001-g5daca166) with LMTPA;
	 Tue, 04 May 2021 23:16:31 -0400
X-Cyrus-Session-Id: sloti11d1t06-1620184591-1699471-2-6359664467419938249
X-Sieve: CMU Sieve 3.0
X-Resolved-to: akpm@mbx.kernel.org
X-Delivered-to: akpm@mbx.kernel.org
X-Mail-from: akpm@linux-foundation.org
Received: from mx6 ([10.202.2.205])
  by compute1.internal (LMTPProxy); Tue, 04 May 2021 23:16:31 -0400
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
	by mailmx.nyi.internal (Postfix) with ESMTP id 40796C800E1
	for <akpm@mbx.kernel.org>; Tue,  4 May 2021 23:16:31 -0400 (EDT)
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
    by mx6.messagingengine.com (Authentication Milter) with ESMTP
    id 14870833D7F;
    Tue, 4 May 2021 23:16:31 -0400
ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=messagingengine.com; s=fm2; t=
    1620184591; b=FBo7Gf3JFN+4QYg5Byan0oNm6RESv+sIf5HcaslVNsUd9SOTGS
    yI0+IsXr1CUpGH783hE6fmgEq9SyfOwQVZjdikLaJS1+7u0JtfAYQFU3RORCtXlr
    djJWrScfjVa8nAHX4rQCtzvtPYuzx5w7cTgGgeILgoJMxgLj7EC9xcT8BIf68+9W
    Lw+ohAmcuiKhL2ez+de4SMuwdh3dh2FwAIHQOsSjEU1/NV+WGxMLwYbxWgTrqQGH
    RQIzFNdq30qslW9huK47+e80uHOX2tXwxtshwbThFEn458bdV5LL6Y8Oh4ZWMbv1
    tFgTt515DVedonZknxc07XsXtAjaJyB8bfHw==
ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d=
    messagingengine.com; h=date:from:to:subject:message-id
    :in-reply-to; s=fm2; t=1620184591; bh=LuH7mbm3+zp863vKBEqKeoZtnp
    uFxYpIb5oTVwf56Es=; b=m5E1fbz2b+an/X406oY3BuG0Zm4/W05vWAki8Lsnud
    gPCc1LfPUFSuXaMppcEDPbLKprp4hH3T52itK4pivXMQCLEOyme7kVStaLMVTiky
    Xxqh5ZdhOWvygBfda/GjfuLBSbbj2gfm8HPKpbL7CA5foelknIBhJHDzGkJyxetZ
    YagZfVvtdo2OEwnC1mmjUCpKPO5+m5kaZO0ol6rPdl+TV0MKGhjLg+/i6Ia+0nFp
    zDwV4VeACvVcGb2xY7KG5Z+BtqVxeVFn+w5JcqpWUtxEKoSBR4bWARzjwHg6eouh
    7psOOKPTt/NzDKk+3f49lso5KlPiTF2xEU/+5SIttCkQ==
ARC-Authentication-Results: i=2; mx6.messagingengine.com;
    arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
    smtp.remote-ip=209.85.215.198;
    bimi=skipped (DMARC did not pass);
    dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
    header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
    header.s=korg x-bits=1024;
    dmarc=none policy.published-domain-policy=none
    policy.applied-disposition=none policy.evaluated-disposition=none
    (p=none,d=none,d.eval=none) policy.policy-from=p
    header.from=linux-foundation.org;
    iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
    spf=pass smtp.mailfrom=akpm@linux-foundation.org
    smtp.helo=mail-pg1-f198.google.com;
    x-aligned-from=pass (Address match);
    x-arc-spf=pass
    (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
    smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
    x-arc-domain=google.com (Trusted from aar.1.google.com);
    x-csa=none;
    x-google-dkim=fail (message has been altered, 2048-bit rsa key)
    header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-pg1-f198.google.com
    policy.ptr=mail-pg1-f198.google.com;
    x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
    (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
    (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
    smtp.bits=256/256;
    x-vs=clean score=40 state=0
Authentication-Results: mx6.messagingengine.com;
    arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
      smtp.remote-ip=209.85.215.198;
    bimi=skipped (DMARC did not pass);
    dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
      header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
      header.s=korg x-bits=1024;
    dmarc=none policy.published-domain-policy=none
      policy.applied-disposition=none policy.evaluated-disposition=none
      (p=none,d=none,d.eval=none) policy.policy-from=p
      header.from=linux-foundation.org;
    iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
    spf=pass smtp.mailfrom=akpm@linux-foundation.org
      smtp.helo=mail-pg1-f198.google.com;
    x-aligned-from=pass (Address match);
    x-arc-spf=pass
      (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
      smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
      x-arc-domain=google.com (Trusted from aar.1.google.com);
    x-csa=none;
    x-google-dkim=fail (message has been altered, 2048-bit rsa key)
      header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-pg1-f198.google.com
      policy.ptr=mail-pg1-f198.google.com;
    x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
      (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
      (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
      smtp.bits=256/256;
    x-vs=clean score=40 state=0
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrvdefjedgieegucetufdoteggodetrfdotf
    fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu
    rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucgoufhorhhtvggutfgvtg
    hiphdvucdlgedtmdenucfjughrpeffhffvuffkjggfsedttdertddtredtnecuhfhrohhm
    peetnhgurhgvficuofhorhhtohhnuceorghkphhmsehlihhnuhigqdhfohhunhgurghtih
    honhdrohhrgheqnecuggftrfgrthhtvghrnhepjeevfeduveffvddvudetkefhgeduveeu
    geevvdfhhfevhfekkedtieefgfduheeinecuffhomhgrihhnpehkvghrnhgvlhdrohhrgh
    enucfkphepvddtledrkeehrddvudehrdduleekpdduleekrddugeehrddvledrleelnecu
    uegrugftvghpuhhtkfhppeduleekrddugeehrddvledrleelnecuvehluhhsthgvrhfuih
    iivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudehrdduleekpdhhvghl
    ohepmhgrihhlqdhpghduqdhfudelkedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomh
    epoegrkhhpmheslhhinhhugidqfhhouhhnuggrthhiohhnrdhorhhgqe
X-ME-VSScore: 40
X-ME-VSCategory: clean
X-ME-CSA: none
Received-SPF: pass
    (linux-foundation.org: Sender is authorized to use 'akpm@linux-foundation.org' in 'mfrom' identity (mechanism 'include:_spf.google.com' matched))
    receiver=mx6.messagingengine.com;
    identity=mailfrom;
    envelope-from="akpm@linux-foundation.org";
    helo=mail-pg1-f198.google.com;
    client-ip=209.85.215.198
Received: from mail-pg1-f198.google.com (mail-pg1-f198.google.com [209.85.215.198])
	(using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)
	 key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256)
	(No client certificate requested)
	by mx6.messagingengine.com (Postfix) with ESMTPS
	for <akpm@mbx.kernel.org>; Tue,  4 May 2021 23:16:31 -0400 (EDT)
Received: by mail-pg1-f198.google.com with SMTP id g5-20020a63f4050000b02901f6c7b9a6d0so593624pgi.5
        for <akpm@mbx.kernel.org>; Tue, 04 May 2021 20:16:30 -0700 (PDT)
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
        d=1e100.net; s=20161025;
        h=x-gm-message-state:dkim-signature:date:from:to:subject:message-id
         :in-reply-to:user-agent;
        bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
        b=VZuDOxUfeHXJz1/CiFfcxuMVHkmW5RznvqYS+Py8Ub6nHHXprQJGE9Ze3WgH+1ylSe
         NJLEC7xgv15SR9A+e/MT4RTj3OVOwtd1Zi2vPav39a9K4tP+2uL2Ei+5d7FtT3LLZsjo
         feek/DqCGSkJ/EC5woLyU9BBkfLUuQ9/2HiDCk10BMetEfWdor69Slb39NOXES8br02X
         25Btabu9ZCWroyjQj7W5gwGr5Z6Hs2nbnnfAb+e92FalcUD/4ql77lNzRcWGi4/9TT8s
         ntqI2g46Xv+k5LURaRH5CRBpxkkKgzcrioRPYFUHkEgOEWy1hPzg9QPk8ZO35Xm9R9d2
         vl3Q==
X-Gm-Message-State: AOAM531IlYUTVWcMrsTunnxZWB7SKeeOmoZj5mZ1A5tl7N/JlZUueN8L
	tvyRKnvxHr6a5mDaGHN9Tb1N/iCzT0U5oQgRVTxTnj1qFGibRa9+leLQNKX0aGlNg9JiaMfromb
	xyOlCUpVXOlVvchuwTUSTn7rXum+Hh3PWQZm5II/EX+0AkzKqez62Z8U=
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203271pjq.53.1620184589161;
        Tue, 04 May 2021 20:16:29 -0700 (PDT)
X-Google-Smtp-Source: ABdhPJxffoGdRqAjUagWoMVD5p/Lk1KTEDftEhkWh8ewatgDmZLlxh0lO1hxYIdYYwoO5dsJ/i0z
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203198pjq.53.1620184588109;
        Tue, 04 May 2021 20:16:28 -0700 (PDT)
ARC-Seal: i=1; a=rsa-sha256; t=1620184588; cv=none;
        d=google.com; s=arc-20160816;
        b=Fr2b2AMXJr6OeNpSql45tq1korkuDOunp7t+DpARuEBnwvQnKfagyipQ93jywsRf/c
         /i/mP2eTmJwOLWNORClh1MGF/0VfBx1ULoB9W4CI3LpVgGFXGGFis8LTcvUYD5yvhlsV
         50rm2j34iS9lyo04FB/hbhGkwLtUhz2PGkLGuqHspTd+pUpUCf5SLxGJbZC5uCcUEsbO
         8WSDBWyvaCPjFzJQZK60gK70ticKW+fCG1xHtOG4qsFCbqEpFKBy8eVK83OBazo/dQDr
         DOheWNWyw2o/WMP4GpZMvZuj30dx3j8xnBahIpnMIQJaog6wLMcVX9pkQ8UJym3/PGNm
         pO/g==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816;
        h=user-agent:in-reply-to:message-id:subject:to:from:date
         :dkim-signature;
        bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
        b=vVN16NPMKjoxSJQ6b36VXFCkZqnmG7wABfilgE069txZqmHpEMyZb8lRStkHy557LM
         Kn7UfJFP3xwsP8ZTCipVDZ6tpFW/hYFU9o4th9G8asWs+MOf9xpWX2LQZ1FTmaao2Fg5
         uCHypz39cnAh0Z1EJfNsTcaTGIrkbBd6zje+mtBgs8hnfH8HcWBYTPCHCCx950Z928tb
         XOPd/Igs7yzD1ioBiGXZj/ciwPbWVTaZXBg4JOZSApxkDMfuMyfyLLOs++EVkyxJHUme
         TmgwvLkixcwEtKF7gIeqEhwvOUSVvilLuJLFVaLumwTcjJ1amVfGcJhBE7LIM9C3SMpA
         rOOg==
ARC-Authentication-Results: i=1; mx.google.com;
       dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
       spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: from mail.kernel.org (mail.kernel.org. [198.145.29.99])
        by mx.google.com with ESMTPS id c85si20173199pfb.8.2021.05.04.20.16.27
        (version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128);
        Tue, 04 May 2021 20:16:28 -0700 (PDT)
Received-SPF: pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) client-ip=198.145.29.99;
Authentication-Results: mx.google.com;
       dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
       spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: by mail.kernel.org (Postfix) with ESMTPSA id A4DB4610D2;
	Wed,  5 May 2021 03:16:26 +0000 (UTC)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=linux-foundation.org;
	s=korg; t=1620184587;
	bh=TxN4wgKcKf2UUem+5pL09m9GL/7U592mEalo2U6vwAU=;
	h=Date:From:To:Subject:In-Reply-To:From;
	b=Gdz/3wY9ktH3hOmn2DAOkfh0JXwPdMJ8xsNQFa9eI25K39Z3iHdRGo9jX3QtMDtog
	 D4Zakt52CQCYsV91c9oCai8KnCTkkAjJq/Ez7p8UHpz97Go3yYYxqg6DDl6d8HCQvN
	 H47dTaZAgeH2sw29bjB9fRzNuTx7k4RAPlqZIpiE=
Date: Tue, 04 May 2021 20:16:26 -0700
From: Andrew Morton <akpm@linux-foundation.org>
To: akpm@linux-foundation.org, anshuman.khandual@arm.com, aou@eecs.berkeley.edu, arnd@arndb.de, benh@kernel.crashing.org, borntraeger@de.ibm.com, bp@alien8.de, catalin.marinas@arm.com, dalias@libc.org, deller@gmx.de, gor@linux.ibm.com, hca@linux.ibm.com, hpa@zytor.com, James.Bottomley@HansenPartnership.com, linux-mm@kvack.org, linux@armlinux.org.uk, mingo@redhat.com, mm-commits@vger.kernel.org, mpe@ellerman.id.au, palmerdabbelt@google.com, paul.walmsley@sifive.com, paulus@samba.org, tglx@linutronix.de, torvalds@linux-foundation.org, tsbogend@alpha.franken.de, vgupta@synopsys.com, viro@zeniv.linux.org.uk, will@kernel.org, ysato@users.osdn.me
Subject: [patch 103/143] mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
Message-ID: <20210505031626.c8o4WL7KE%akpm@linux-foundation.org>
In-Reply-To: <20210504183219.a3cc46aee4013d77402276c5@linux-foundation.org>
User-Agent: s-nail v14.8.16
X-Gm-Original-To: akpm@linux-foundation.org

From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)

SYS_SUPPORTS_HUGETLBFS config has duplicate definitions on platforms that
subscribe it.  Instead, just make it a generic option which can be
selected on applicable platforms.  Also rename it as
ARCH_SUPPORTS_HUGETLBFS instead.  This reduces code duplication and makes
it cleaner.

Link: https://lkml.kernel.org/r/1617259448-22529-3-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com>	[arm64]
Acked-by: Palmer Dabbelt <palmerdabbelt@google.com>	[riscv]
Acked-by: Michael Ellerman <mpe@ellerman.id.au>		[powerpc]
Cc: Russell King <linux@armlinux.org.uk>
Cc: Will Deacon <will@kernel.org>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com>
Cc: Helge Deller <deller@gmx.de>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Cc: Rich Felker <dalias@libc.org>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/arm/Kconfig                       |    5 +----
 arch/arm64/Kconfig                     |    4 +---
 arch/mips/Kconfig                      |    6 +-----
 arch/parisc/Kconfig                    |    5 +----
 arch/powerpc/Kconfig                   |    3 ---
 arch/powerpc/platforms/Kconfig.cputype |    6 +++---
 arch/riscv/Kconfig                     |    5 +----
 arch/sh/Kconfig                        |    5 +----
 fs/Kconfig                             |    5 ++++-
 9 files changed, 13 insertions(+), 31 deletions(-)

--- a/arch/arm64/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm64/Kconfig
@@ -73,6 +73,7 @@ config ARM64
 	select ARCH_USE_QUEUED_SPINLOCKS
 	select ARCH_USE_SYM_ANNOTATIONS
 	select ARCH_SUPPORTS_DEBUG_PAGEALLOC
+	select ARCH_SUPPORTS_HUGETLBFS
 	select ARCH_SUPPORTS_MEMORY_FAILURE
 	select ARCH_SUPPORTS_SHADOW_CALL_STACK if CC_HAVE_SHADOW_CALL_STACK
 	select ARCH_SUPPORTS_LTO_CLANG if CPU_LITTLE_ENDIAN
@@ -1072,9 +1073,6 @@ config HW_PERF_EVENTS
 	def_bool y
 	depends on ARM_PMU
 
-config SYS_SUPPORTS_HUGETLBFS
-	def_bool y
-
 config ARCH_HAS_FILTER_PGPROT
 	def_bool y
 
--- a/arch/arm/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm/Kconfig
@@ -31,6 +31,7 @@ config ARM
 	select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT if CPU_V7
 	select ARCH_SUPPORTS_ATOMIC_RMW
+	select ARCH_SUPPORTS_HUGETLBFS if ARM_LPAE
 	select ARCH_USE_BUILTIN_BSWAP
 	select ARCH_USE_CMPXCHG_LOCKREF
 	select ARCH_USE_MEMTEST
@@ -1511,10 +1512,6 @@ config HW_PERF_EVENTS
 	def_bool y
 	depends on ARM_PMU
 
-config SYS_SUPPORTS_HUGETLBFS
-       def_bool y
-       depends on ARM_LPAE
-
 config HAVE_ARCH_TRANSPARENT_HUGEPAGE
        def_bool y
        depends on ARM_LPAE
--- a/arch/mips/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/mips/Kconfig
@@ -19,6 +19,7 @@ config MIPS
 	select ARCH_USE_MEMTEST
 	select ARCH_USE_QUEUED_RWLOCKS
 	select ARCH_USE_QUEUED_SPINLOCKS
+	select ARCH_SUPPORTS_HUGETLBFS if CPU_SUPPORTS_HUGEPAGES
 	select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
 	select ARCH_WANT_IPC_PARSE_VERSION
 	select ARCH_WANT_LD_ORPHAN_WARN
@@ -1287,11 +1288,6 @@ config SYS_SUPPORTS_BIG_ENDIAN
 config SYS_SUPPORTS_LITTLE_ENDIAN
 	bool
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-	depends on CPU_SUPPORTS_HUGEPAGES
-	default y
-
 config MIPS_HUGE_TLB_SUPPORT
 	def_bool HUGETLB_PAGE || TRANSPARENT_HUGEPAGE
 
--- a/arch/parisc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/parisc/Kconfig
@@ -12,6 +12,7 @@ config PARISC
 	select ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_HAS_UBSAN_SANITIZE_ALL
 	select ARCH_NO_SG_CHAIN
+	select ARCH_SUPPORTS_HUGETLBFS if PA20
 	select ARCH_SUPPORTS_MEMORY_FAILURE
 	select DMA_OPS
 	select RTC_CLASS
@@ -138,10 +139,6 @@ config PGTABLE_LEVELS
 	default 3 if 64BIT && PARISC_PAGE_SIZE_4KB
 	default 2
 
-config SYS_SUPPORTS_HUGETLBFS
-	def_bool y if PA20
-
-
 menu "Processor type and features"
 
 choice
--- a/arch/powerpc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/Kconfig
@@ -697,9 +697,6 @@ config ARCH_SPARSEMEM_DEFAULT
 	def_bool y
 	depends on PPC_BOOK3S_64
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-
 config ILLEGAL_POINTER_VALUE
 	hex
 	# This is roughly half way between the top of user space and the bottom
--- a/arch/powerpc/platforms/Kconfig.cputype~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/platforms/Kconfig.cputype
@@ -40,8 +40,8 @@ config PPC_85xx
 
 config PPC_8xx
 	bool "Freescale 8xx"
+	select ARCH_SUPPORTS_HUGETLBFS
 	select FSL_SOC
-	select SYS_SUPPORTS_HUGETLBFS
 	select PPC_HAVE_KUEP
 	select PPC_HAVE_KUAP
 	select HAVE_ARCH_VMAP_STACK
@@ -95,9 +95,9 @@ config PPC_BOOK3S_64
 	bool "Server processors"
 	select PPC_FPU
 	select PPC_HAVE_PMU_SUPPORT
-	select SYS_SUPPORTS_HUGETLBFS
 	select HAVE_ARCH_TRANSPARENT_HUGEPAGE
 	select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE
+	select ARCH_SUPPORTS_HUGETLBFS
 	select ARCH_SUPPORTS_NUMA_BALANCING
 	select IRQ_WORK
 	select PPC_MM_SLICES
@@ -278,9 +278,9 @@ config FSL_BOOKE
 # this is for common code between PPC32 & PPC64 FSL BOOKE
 config PPC_FSL_BOOK3E
 	bool
+	select ARCH_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
 	select FSL_EMB_PERFMON
 	select PPC_SMP_MUXED_IPI
-	select SYS_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
 	select PPC_DOORBELL
 	default y if FSL_BOOKE
 
--- a/arch/riscv/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/riscv/Kconfig
@@ -30,6 +30,7 @@ config RISCV
 	select ARCH_HAS_STRICT_KERNEL_RWX if MMU
 	select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT
+	select ARCH_SUPPORTS_HUGETLBFS if MMU
 	select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
 	select ARCH_WANT_FRAME_POINTERS
 	select ARCH_WANT_HUGE_PMD_SHARE if 64BIT
@@ -165,10 +166,6 @@ config ARCH_WANT_GENERAL_HUGETLB
 config ARCH_SUPPORTS_UPROBES
 	def_bool y
 
-config SYS_SUPPORTS_HUGETLBFS
-	depends on MMU
-	def_bool y
-
 config STACKTRACE_SUPPORT
 	def_bool y
 
--- a/arch/sh/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/sh/Kconfig
@@ -101,9 +101,6 @@ config SYS_SUPPORTS_APM_EMULATION
 	bool
 	select ARCH_SUSPEND_POSSIBLE
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-
 config SYS_SUPPORTS_SMP
 	bool
 
@@ -175,12 +172,12 @@ config CPU_SH3
 
 config CPU_SH4
 	bool
+	select ARCH_SUPPORTS_HUGETLBFS if MMU
 	select CPU_HAS_INTEVT
 	select CPU_HAS_SR_RB
 	select CPU_HAS_FPU if !CPU_SH4AL_DSP
 	select SH_INTC
 	select SYS_SUPPORTS_SH_TMU
-	select SYS_SUPPORTS_HUGETLBFS if MMU
 
 config CPU_SH4A
 	bool
--- a/fs/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/fs/Kconfig
@@ -223,10 +223,13 @@ config TMPFS_INODE64
 
 	  If unsure, say N.
 
+config ARCH_SUPPORTS_HUGETLBFS
+	def_bool n
+
 config HUGETLBFS
 	bool "HugeTLB file system support"
 	depends on X86 || IA64 || SPARC64 || (S390 && 64BIT) || \
-		   SYS_SUPPORTS_HUGETLBFS || BROKEN
+		   ARCH_SUPPORTS_HUGETLBFS || BROKEN
 	help
 	  hugetlbfs is a filesystem backing for HugeTLB pages, based on
 	  ramfs. For architectures that support it, say Y here and read
_

^ permalink raw reply	[flat|nested] 146+ messages in thread

* Re: incoming
  2021-05-05 17:44       ` incoming Andrew Morton
@ 2021-05-06  3:19         ` Anshuman Khandual
  0 siblings, 0 replies; 146+ messages in thread
From: Anshuman Khandual @ 2021-05-06  3:19 UTC (permalink / raw)
  To: Andrew Morton, Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits



On 5/5/21 11:14 PM, Andrew Morton wrote:
> On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> 
>> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>>> Let me resend right now with the same in-reply-to.  Hopefully they will
>>> land in the correct place.
>> Well, you re-sent it twice, and I have three copies in my own mailbox,
>> bot they still don't show up on the mm-commits mailing list.
>>
>> So the list hates them for some odd reason.
>>
>> I've picked them up locally, but adding Konstantin to the participants
>> to see if he can see what's up.
>>
>> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
>> series of 143. Odd.
> It's weird.  They don't turn up on linux-mm either, and that's running
> at kvack.org, also majordomo.  They don't get through when sent with
> either heirloom-mailx or with sylpheed.
> 
> Also, it seems that when Anshuman originally sent the patch, linux-mm
> and linux-kernel didn't send it back out.  So perhaps a spam filter
> triggered?
> 
> I'm seeing
> 
> https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/
> 
> which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
> server massacred that patch series.  Searching
> https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
> email series.

Yeah these patches faced problem from the very beginning getting
into the MM/LKML list for some strange reason.


^ permalink raw reply	[flat|nested] 146+ messages in thread

end of thread, other threads:[~2021-05-06  3:19 UTC | newest]

Thread overview: 146+ messages (download: mbox.gz follow: Atom feed
-- links below jump to the message on this page --
2021-05-05  1:32 incoming Andrew Morton
2021-05-05  1:32 ` [patch 001/143] mm: introduce and use mapping_empty() Andrew Morton
2021-05-05  1:32 ` [patch 002/143] mm: stop accounting shadow entries Andrew Morton
2021-05-05  1:32 ` [patch 003/143] dax: account DAX entries as nrpages Andrew Morton
2021-05-05  1:32 ` [patch 004/143] mm: remove nrexceptional from inode Andrew Morton
2021-05-05  1:32 ` [patch 005/143] mm: remove nrexceptional from inode: remove BUG_ON Andrew Morton
2021-05-05  1:33 ` [patch 006/143] hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share() Andrew Morton
2021-05-05  1:33 ` [patch 007/143] hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled Andrew Morton
2021-05-05  1:33 ` [patch 008/143] mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h Andrew Morton
2021-05-05  1:33 ` [patch 009/143] hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp Andrew Morton
2021-05-05  1:33 ` [patch 010/143] mm/hugetlb: remove redundant reservation check condition in alloc_huge_page() Andrew Morton
2021-05-05  1:33 ` [patch 011/143] mm: generalize HUGETLB_PAGE_SIZE_VARIABLE Andrew Morton
2021-05-05  1:33 ` [patch 012/143] mm/hugetlb: use some helper functions to cleanup code Andrew Morton
2021-05-05  1:33 ` [patch 013/143] mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state() Andrew Morton
2021-05-05  1:33 ` [patch 014/143] mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate() Andrew Morton
2021-05-05  1:33 ` [patch 015/143] mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page() Andrew Morton
2021-05-05  1:33 ` [patch 016/143] mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case Andrew Morton
2021-05-05  1:33 ` [patch 017/143] khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps() Andrew Morton
2021-05-05  1:33 ` [patch 018/143] khugepaged: reuse the smp_wmb() inside __SetPageUptodate() Andrew Morton
2021-05-05  1:33 ` [patch 019/143] khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter() Andrew Morton
2021-05-05  1:33 ` [patch 020/143] khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate() Andrew Morton
2021-05-05  1:33 ` [patch 021/143] mm/huge_memory.c: remove unnecessary local variable ret2 Andrew Morton
2021-05-05  1:33 ` [patch 022/143] mm/huge_memory.c: rework the function vma_adjust_trans_huge() Andrew Morton
2021-05-05  1:33 ` [patch 023/143] mm/huge_memory.c: make get_huge_zero_page() return bool Andrew Morton
2021-05-05  1:33 ` [patch 024/143] mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly Andrew Morton
2021-05-05  1:34 ` [patch 025/143] mm/huge_memory.c: remove redundant PageCompound() check Andrew Morton
2021-05-05  1:34 ` [patch 026/143] mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG Andrew Morton
2021-05-05  1:34 ` [patch 027/143] mm/huge_memory.c: use helper function migration_entry_to_page() Andrew Morton
2021-05-05  1:34 ` [patch 028/143] mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable Andrew Morton
2021-05-05  1:34 ` [patch 029/143] khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp() Andrew Morton
2021-05-05  1:34 ` [patch 030/143] khugepaged: remove unnecessary out label in collapse_huge_page() Andrew Morton
2021-05-05  1:34 ` [patch 031/143] khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd() Andrew Morton
2021-05-05  1:34 ` [patch 032/143] mm: huge_memory: a new debugfs interface for splitting THP tests Andrew Morton
2021-05-05  1:34 ` [patch 033/143] mm: huge_memory: debugfs for file-backed THP split Andrew Morton
2021-05-05  1:34 ` [patch 034/143] mm/hugeltb: remove redundant VM_BUG_ON() in region_add() Andrew Morton
2021-05-05  1:34 ` [patch 035/143] mm/hugeltb: simplify the return code of __vma_reservation_common() Andrew Morton
2021-05-05  1:34 ` [patch 036/143] mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages() Andrew Morton
2021-05-05  1:34 ` [patch 037/143] mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts() Andrew Morton
2021-05-05  1:34 ` [patch 038/143] mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages() Andrew Morton
2021-05-05  1:34 ` [patch 039/143] mm/cma: change cma mutex to irq safe spinlock Andrew Morton
2021-05-05  1:34 ` [patch 040/143] hugetlb: no need to drop hugetlb_lock to call cma_release Andrew Morton
2021-05-05  1:34 ` [patch 041/143] hugetlb: add per-hstate mutex to synchronize user adjustments Andrew Morton
2021-05-05  1:34 ` [patch 042/143] hugetlb: create remove_hugetlb_page() to separate functionality Andrew Morton
2021-05-05  1:34 ` [patch 043/143] hugetlb: call update_and_free_page without hugetlb_lock Andrew Morton
2021-05-05  1:35 ` [patch 044/143] hugetlb: change free_pool_huge_page to remove_pool_huge_page Andrew Morton
2021-05-05  1:35 ` [patch 045/143] hugetlb: make free_huge_page irq safe Andrew Morton
2021-05-05  1:35 ` [patch 046/143] hugetlb: add lockdep_assert_held() calls for hugetlb_lock Andrew Morton
2021-05-05  1:35 ` [patch 047/143] mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range Andrew Morton
2021-05-05  1:35 ` [patch 048/143] mm,compaction: let isolate_migratepages_{range,block} return error codes Andrew Morton
2021-05-05  1:35 ` [patch 049/143] mm,hugetlb: drop clearing of flag from prep_new_huge_page Andrew Morton
2021-05-05  1:35 ` [patch 050/143] mm,hugetlb: split prep_new_huge_page functionality Andrew Morton
2021-05-05  1:35 ` [patch 051/143] mm: make alloc_contig_range handle free hugetlb pages Andrew Morton
2021-05-05  1:35 ` [patch 052/143] mm: make alloc_contig_range handle in-use " Andrew Morton
2021-05-05  1:35 ` [patch 053/143] mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig Andrew Morton
2021-05-05  1:35 ` [patch 054/143] userfaultfd: add minor fault registration mode Andrew Morton
2021-05-05  1:35 ` [patch 055/143] userfaultfd: disable huge PMD sharing for MINOR registered VMAs Andrew Morton
2021-05-05  1:35 ` [patch 056/143] userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled Andrew Morton
2021-05-05  1:35 ` [patch 057/143] userfaultfd: add UFFDIO_CONTINUE ioctl Andrew Morton
2021-05-05  1:35 ` [patch 058/143] userfaultfd: update documentation to describe minor fault handling Andrew Morton
2021-05-05  1:35 ` [patch 059/143] userfaultfd/selftests: add test exercising " Andrew Morton
2021-05-05  1:36 ` [patch 060/143] mm/vmscan: move RECLAIM* bits to uapi header Andrew Morton
2021-05-05  1:36 ` [patch 061/143] mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks Andrew Morton
2021-05-05  1:36 ` [patch 062/143] mm: vmscan: use nid from shrink_control for tracepoint Andrew Morton
2021-05-05  1:36 ` [patch 063/143] mm: vmscan: consolidate shrinker_maps handling code Andrew Morton
2021-05-05  1:36 ` [patch 064/143] mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation Andrew Morton
2021-05-05  1:36 ` [patch 065/143] mm: vmscan: remove memcg_shrinker_map_size Andrew Morton
2021-05-05  1:36 ` [patch 066/143] mm: vmscan: use kvfree_rcu instead of call_rcu Andrew Morton
2021-05-05  1:36 ` [patch 067/143] mm: memcontrol: rename shrinker_map to shrinker_info Andrew Morton
2021-05-05  1:36 ` [patch 068/143] mm: vmscan: add shrinker_info_protected() helper Andrew Morton
2021-05-05  1:36 ` [patch 069/143] mm: vmscan: use a new flag to indicate shrinker is registered Andrew Morton
2021-05-05  1:36 ` [patch 070/143] mm: vmscan: add per memcg shrinker nr_deferred Andrew Morton
2021-05-05  1:36 ` [patch 071/143] mm: vmscan: use per memcg nr_deferred of shrinker Andrew Morton
2021-05-05  1:36 ` [patch 072/143] mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers Andrew Morton
2021-05-05  1:36 ` [patch 073/143] mm: memcontrol: reparent nr_deferred when memcg offline Andrew Morton
2021-05-05  1:36 ` [patch 074/143] mm: vmscan: shrink deferred objects proportional to priority Andrew Morton
2021-05-05  1:36 ` [patch 075/143] mm/compaction: remove unused variable sysctl_compact_memory Andrew Morton
2021-05-05  1:36 ` [patch 076/143] mm: compaction: update the COMPACT[STALL|FAIL] events properly Andrew Morton
2021-05-05  1:36 ` [patch 077/143] mm: disable LRU pagevec during the migration temporarily Andrew Morton
2021-05-05  1:36 ` [patch 078/143] mm: replace migrate_[prep|finish] with lru_cache_[disable|enable] Andrew Morton
2021-05-05  1:37 ` [patch 079/143] mm: fs: invalidate BH LRU during page migration Andrew Morton
2021-05-05  1:37 ` [patch 080/143] mm/migrate.c: make putback_movable_page() static Andrew Morton
2021-05-05  1:37 ` [patch 081/143] mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case Andrew Morton
2021-05-05  1:37 ` [patch 082/143] mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page() Andrew Morton
2021-05-05  1:37 ` [patch 083/143] mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole() Andrew Morton
2021-05-05  1:37 ` [patch 084/143] Revert "mm: migrate: skip shared exec THP for NUMA balancing" Andrew Morton
2021-05-05  1:37 ` [patch 085/143] mm: vmstat: add cma statistics Andrew Morton
2021-05-05  1:37 ` [patch 086/143] mm: cma: use pr_err_ratelimited for CMA warning Andrew Morton
2021-05-05  1:37 ` [patch 087/143] mm: cma: add trace events for CMA alloc perf testing Andrew Morton
2021-05-05  1:37 ` [patch 088/143] mm: cma: support sysfs Andrew Morton
2021-05-05  1:37 ` [patch 089/143] mm: cma: add the CMA instance name to cma trace events Andrew Morton
2021-05-05  1:37 ` [patch 090/143] mm: use proper type for cma_[alloc|release] Andrew Morton
2021-05-05  1:37 ` [patch 091/143] ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search() Andrew Morton
2021-05-05  1:37 ` [patch 092/143] ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree() Andrew Morton
2021-05-05  1:37 ` [patch 093/143] ksm: remove dedicated macro KSM_FLAG_MASK Andrew Morton
2021-05-05  1:37 ` [patch 094/143] ksm: fix potential missing rmap_item for stable_node Andrew Morton
2021-05-05  1:37 ` [patch 095/143] mm/ksm: remove unused parameter from remove_trailing_rmap_items() Andrew Morton
2021-05-05  1:37 ` [patch 096/143] mm: restore node stat checking in /proc/sys/vm/stat_refresh Andrew Morton
2021-05-05  1:37 ` [patch 097/143] mm: no more EINVAL from /proc/sys/vm/stat_refresh Andrew Morton
2021-05-05  1:37 ` [patch 098/143] mm: /proc/sys/vm/stat_refresh skip checking known negative stats Andrew Morton
2021-05-05  1:38 ` [patch 099/143] mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats Andrew Morton
2021-05-05  1:38 ` [patch 100/143] x86/mm: track linear mapping split events Andrew Morton
2021-05-05  1:38 ` [patch 101/143] mm/mmap.c: don't unlock VMAs in remap_file_pages() Andrew Morton
2021-05-05  1:38 ` [patch 102/143] mm: generalize ARCH_HAS_CACHE_LINE_SIZE Andrew Morton
2021-05-05  1:38 ` [patch 104/143] mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] Andrew Morton
2021-05-05  1:38 ` [patch 105/143] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION Andrew Morton
2021-05-05  1:38 ` [patch 108/143] mm/util.c: reduce mem_dump_obj() object size Andrew Morton
2021-05-05  1:38 ` [patch 109/143] mm/util.c: fix typo Andrew Morton
2021-05-05  1:38 ` [patch 110/143] mm/gup: don't pin migrated cma pages in movable zone Andrew Morton
2021-05-05  1:38 ` [patch 111/143] mm/gup: check every subpage of a compound page during isolation Andrew Morton
2021-05-05  1:38 ` [patch 112/143] mm/gup: return an error on migration failure Andrew Morton
2021-05-05  1:38 ` [patch 113/143] mm/gup: check for isolation errors Andrew Morton
2021-05-05  1:38 ` [patch 114/143] mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN Andrew Morton
2021-05-05  1:38 ` [patch 115/143] mm: apply per-task gfp constraints in fast path Andrew Morton
2021-05-05  1:39 ` [patch 116/143] mm: honor PF_MEMALLOC_PIN for all movable pages Andrew Morton
2021-05-05  1:39 ` [patch 117/143] mm/gup: do not migrate zero page Andrew Morton
2021-05-05  1:39 ` [patch 118/143] mm/gup: migrate pinned pages out of movable zone Andrew Morton
2021-05-05  1:39 ` [patch 119/143] memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning Andrew Morton
2021-05-05  1:39 ` [patch 120/143] mm/gup: change index type to long as it counts pages Andrew Morton
2021-05-05  1:39 ` [patch 121/143] mm/gup: longterm pin migration cleanup Andrew Morton
2021-05-05  1:39 ` [patch 122/143] selftests/vm: gup_test: fix test flag Andrew Morton
2021-05-05  1:39 ` [patch 123/143] selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages Andrew Morton
2021-05-05  1:39 ` [patch 124/143] mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove Andrew Morton
2021-05-05  1:39 ` [patch 125/143] drivers/base/memory: introduce memory_block_{online,offline} Andrew Morton
2021-05-05  1:39 ` [patch 126/143] mm,memory_hotplug: relax fully spanned sections check Andrew Morton
2021-05-05  1:39 ` [patch 127/143] mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count() Andrew Morton
2021-05-05  1:39 ` [patch 128/143] mm,memory_hotplug: allocate memmap from the added memory range Andrew Morton
2021-05-05  1:39 ` [patch 129/143] acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported Andrew Morton
2021-05-05  1:39 ` [patch 130/143] mm,memory_hotplug: add kernel boot option to enable memmap_on_memory Andrew Morton
2021-05-05  1:39 ` [patch 131/143] x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE Andrew Morton
2021-05-05  1:39 ` [patch 132/143] arm64/Kconfig: " Andrew Morton
2021-05-05  1:39 ` [patch 133/143] mm/zswap.c: switch from strlcpy to strscpy Andrew Morton
2021-05-05  1:40 ` [patch 134/143] mm/zsmalloc: use BUG_ON instead of if condition followed by BUG Andrew Morton
2021-05-05  1:40 ` [patch 135/143] iov_iter: lift memzero_page() to highmem.h Andrew Morton
2021-05-05  1:40 ` [patch 136/143] btrfs: use memzero_page() instead of open coded kmap pattern Andrew Morton
2021-05-05  1:40 ` [patch 137/143] mm/highmem.c: fix coding style issue Andrew Morton
2021-05-05  1:40 ` [patch 138/143] mm/mempool: minor coding style tweaks Andrew Morton
2021-05-05  1:40 ` [patch 139/143] mm/process_vm_access.c: remove duplicate include Andrew Morton
2021-05-05  1:40 ` [patch 140/143] kfence: zero guard page after out-of-bounds access Andrew Morton
2021-05-05  1:40 ` [patch 141/143] kfence: await for allocation using wait_event Andrew Morton
2021-05-05  1:40 ` [patch 142/143] kfence: maximize allocation wait timeout duration Andrew Morton
2021-05-05  1:40 ` [patch 143/143] kfence: use power-efficient work queue to run delayed work Andrew Morton
2021-05-05  1:47 ` incoming Linus Torvalds
2021-05-05  3:16   ` incoming Andrew Morton
2021-05-05 17:10     ` incoming Linus Torvalds
2021-05-05 17:44       ` incoming Andrew Morton
2021-05-06  3:19         ` incoming Anshuman Khandual

This is a public inbox, see mirroring instructions
for how to clone and mirror all data and code used for this inbox;
as well as URLs for NNTP newsgroup(s).