* incoming
@ 2007-05-02 22:02 Andrew Morton
2007-05-02 22:31 ` incoming Benjamin Herrenschmidt
` (2 more replies)
0 siblings, 3 replies; 348+ messages in thread
From: Andrew Morton @ 2007-05-02 22:02 UTC (permalink / raw)
To: Linus Torvalds
Cc: Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen,
Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel,
linux-mm
So this is what I have lined up for the first mm->2.6.22 batch. I won't be
sending it off for another 12-24 hours yet. To give people time for final
comment and to give me time to see if it actually works.
- A few serial bits.
- A few pcmcia bits.
- Some of the MM queue. Includes:
- An enhancement to /proc/pid/smaps to permit monitoring of a running
program's working set.
There's another patchset which builds on this quite a lot from Matt
Mackall, but it's not quite ready yet.
- The SLUB allocator. It's pretty green but I do want to push ahead
with this pretty aggressively with a view to replacing slab altogether.
If it ends up not working out then we should remove slub altogether
again, but I doubt if that will occur.
If SLUB isn't in good shape by 2.6.22 we should hide it in Kconfig
to prevent people from hitting known problems. It'll remain
EXPERIMENTAL.
- generic pagetable quicklist management. We have x86_64 and ia64
and sparc64 implementations, but I'll only include David's sparc64
implementation here. I'll send the x86_64 and ia64 implementations
through maintainers.
- Various random MM bits
- Benh's teach-get_unmapped_area-about-MAP_FIXED changes
- madvise(MADV_FREE)
This means I'm holding back Mel's page allocator work, and Andy's
lumpy-reclaim.
A shame in a way - I have high hopes for lumpy reclaim against the
moveable zone, but these things are not to be done lightly.
A few MM things have been held back awaiting subsystem tree merges
(probably x86 - I didn't check).
- One little security patch
- the blackfin architecture
- small h8300 update
- small alpha update
- swsusp updates
- m68k bits
- cris udpates
- Lots of UML updates
- v850, xtensa
slab-introduce-krealloc.patch
at91_cf-minor-fix.patch
add-new_id-to-pcmcia-drivers.patch
ide-cs-recognize-2gb-compactflash-from-transcend.patch
serial-driver-pmc-msp71xx.patch
rm9000-serial-driver.patch
serial-define-fixed_port-flag-for-serial_core.patch
serial-use-resource_size_t-for-serial-port-io-addresses.patch
mpsc-serial-driver-tx-locking.patch
8250_pci-fix-pci-must_checks.patch
serial-serial_core-use-pr_debug.patch
add-apply_to_page_range-which-applies-a-function-to-a-pte-range.patch
safer-nr_node_ids-and-nr_node_ids-determination-and-initial.patch
use-zvc-counters-to-establish-exact-size-of-dirtyable-pages.patch
proper-prototype-for-hugetlb_get_unmapped_area.patch
mm-remove-gcc-workaround.patch
slab-ensure-cache_alloc_refill-terminates.patch
mm-make-read_cache_page-synchronous.patch
fs-buffer-dont-pageuptodate-without-page-locked.patch
allow-oom_adj-of-saintly-processes.patch
introduce-config_has_dma.patch
mm-slabc-proper-prototypes.patch
add-pfn_valid_within-helper-for-sub-max_order-hole-detection.patch
mm-simplify-filemap_nopage.patch
add-unitialized_var-macro-for-suppressing-gcc-warnings.patch
i386-add-ptep_test_and_clear_dirtyyoung.patch
i386-use-pte_update_defer-in-ptep_test_and_clear_dirtyyoung.patch
smaps-extract-pmd-walker-from-smaps-code.patch
smaps-add-pages-referenced-count-to-smaps.patch
smaps-add-clear_refs-file-to-clear-reference.patch
readahead-improve-heuristic-detecting-sequential-reads.patch
readahead-code-cleanup.patch
slab-use-num_possible_cpus-in-enable_cpucache.patch
slab-dont-allocate-empty-shared-caches.patch
slab-numa-kmem_cache-diet.patch
do-not-disable-interrupts-when-reading-min_free_kbytes.patch
slab-mark-set_up_list3s-__init.patch
cpusets-allow-tif_memdie-threads-to-allocate-anywhere.patch
i386-use-page-allocator-to-allocate-thread_info-structure.patch
slub-core.patch
make-page-private-usable-in-compound-pages-v1.patch
optimize-compound_head-by-avoiding-a-shared-page.patch
add-virt_to_head_page-and-consolidate-code-in-slab-and-slub.patch
slub-fix-object-tracking.patch
slub-enable-tracking-of-full-slabs.patch
slub-validation-of-slabs-metadata-and-guard-zones.patch
slub-add-min_partial.patch
slub-add-ability-to-list-alloc--free-callers-per-slab.patch
slub-free-slabs-and-sort-partial-slab-lists-in-kmem_cache_shrink.patch
slub-remove-object-activities-out-of-checking-functions.patch
slub-user-documentation.patch
slub-add-slabinfo-tool.patch
quicklists-for-page-table-pages.patch
quicklist-support-for-sparc64.patch
slob-handle-slab_panic-flag.patch
include-kern_-constant-in-printk-calls-in-mm-slabc.patch
mm-madvise-avoid-exclusive-mmap_sem.patch
mm-remove-destroy_dirty_buffers-from-invalidate_bdev.patch
mm-optimize-kill_bdev.patch
mm-optimize-acorn-partition-truncate.patch
slab-allocators-remove-obsolete-slab_must_hwcache_align.patch
kmem_cache-simplify-slab-cache-creation.patch
slab-allocators-remove-multiple-alignment-specifications.patch
fault-injection-fix-failslab-with-config_numa.patch
mm-fix-handling-of-panic_on_oom-when-cpusets-are-in-use.patch
oom-fix-constraint-deadlock.patch
get_unmapped_area-handles-map_fixed-on-powerpc.patch
get_unmapped_area-handles-map_fixed-on-alpha.patch
get_unmapped_area-handles-map_fixed-on-arm.patch
get_unmapped_area-handles-map_fixed-on-frv.patch
get_unmapped_area-handles-map_fixed-on-i386.patch
get_unmapped_area-handles-map_fixed-on-ia64.patch
get_unmapped_area-handles-map_fixed-on-parisc.patch
get_unmapped_area-handles-map_fixed-on-sparc64.patch
get_unmapped_area-handles-map_fixed-on-x86_64.patch
get_unmapped_area-handles-map_fixed-in-hugetlbfs.patch
get_unmapped_area-handles-map_fixed-in-generic-code.patch
get_unmapped_area-doesnt-need-hugetlbfs-hacks-anymore.patch
slab-allocators-remove-slab_debug_initial-flag.patch
slab-allocators-remove-slab_ctor_atomic.patch
slab-allocators-remove-useless-__gfp_no_grow-flag.patch
lazy-freeing-of-memory-through-madv_free.patch
restore-madv_dontneed-to-its-original-linux-behaviour.patch
hugetlbfs-add-null-check-in-hugetlb_zero_setup.patch
slob-fix-page-order-calculation-on-not-4kb-page.patch
page-migration-only-migrate-pages-if-allocation-in-the-highest-zone-is-possible.patch
return-eperm-not-echild-on-security_task_wait-failure.patch
blackfin-arch.patch
driver_bfin_serial_core.patch
blackfin-on-chip-ethernet-mac-controller-driver.patch
blackfin-patch-add-blackfin-support-in-smc91x.patch
blackfin-on-chip-rtc-controller-driver.patch
blackfin-blackfin-on-chip-spi-controller-driver.patch
convert-h8-300-to-generic-timekeeping.patch
h8300-generic-irq.patch
h8300-add-zimage-support.patch
round_up-macro-cleanup-in-arch-alpha-kernel-osf_sysc.patch
alpha-fix-bootp-image-creation.patch
alpha-prctl-macros.patch
srmcons-fix-kmallocgfp_kernel-inside-spinlock.patch
arm26-remove-useless-config-option-generic_bust_spinlock.patch
fix-refrigerator-vs-thaw_process-race.patch
swsusp-use-inline-functions-for-changing-page-flags.patch
swsusp-do-not-use-page-flags.patch
mm-remove-unused-page-flags.patch
swsusp-fix-error-paths-in-snapshot_open.patch
swsusp-use-gfp_kernel-for-creating-basic-data-structures.patch
freezer-remove-pf_nofreeze-from-handle_initrd.patch
swsusp-use-rbtree-for-tracking-allocated-swap.patch
freezer-fix-racy-usage-of-try_to_freeze-in-kswapd.patch
remove-software_suspend.patch
power-management-change-sys-power-disk-display.patch
kconfig-mentioneds-hibernation-not-just-swsusp.patch
swsusp-fix-snapshot_release.patch
swsusp-free-more-memory.patch
remove-unused-header-file-arch-m68k-atari-atasoundh.patch
spin_lock_unlocked-cleanup-in-arch-m68k.patch
remove-unused-header-file-drivers-serial-crisv10h.patch
cris-check-for-memory-allocation.patch
cris-remove-code-related-to-pre-22-kernel.patch
uml-delete-unused-code.patch
uml-formatting-fixes.patch
uml-host_info-tidying.patch
uml-mark-tt-mode-code-for-future-removal.patch
uml-print-coredump-limits.patch
uml-handle-block-device-hotplug-errors.patch
uml-driver-formatting-fixes.patch
uml-driver-formatting-fixes-fix.patch
uml-network-interface-hotplug-error-handling.patch
array_size-check-for-type.patch
uml-move-sigio-testing-to-sigioc.patch
uml-create-archh.patch
uml-create-as-layouth.patch
uml-move-remaining-useful-contents-of-user_utilh.patch
uml-remove-user_utilh.patch
uml-add-missing-__init-declarations.patch
remove-unused-header-file-arch-um-kernel-tt-include-mode_kern-tth.patch
uml-improve-checking-and-diagnostics-of-ethernet-macs.patch
uml-eliminate-temporary-buffer-in-eth_configure.patch
uml-replace-one-element-array-with-zero-element-array.patch
uml-fix-umid-in-xterm-titles.patch
uml-speed-up-exec.patch
uml-no-locking-needed-in-tlsc.patch
uml-tidy-processc.patch
uml-remove-page_size.patch
uml-kernel_thread-shouldnt-panic.patch
uml-tidy-fault-code.patch
uml-kernel-segfaults-should-dump-proper-registers.patch
uml-comment-early-boot-locking.patch
uml-irq-locking-commentary.patch
uml-delete-host_frame_size.patch
uml-drivers-get-release-methods.patch
uml-dump-registers-on-ptrace-or-wait-failure.patch
uml-speed-up-page-table-walking.patch
uml-remove-unused-x86_64-code.patch
uml-start-fixing-os_read_file-and-os_write_file.patch
uml-tidy-libc-code.patch
uml-convert-libc-layer-to-call-read-and-write.patch
uml-batch-i-o-requests.patch
uml-send-pointers-instead-of-structures-to-i-o-thread.patch
uml-send-pointers-instead-of-structures-to-i-o-thread-fix.patch
uml-dump-core-on-panic.patch
uml-dont-try-to-handle-signals-on-initial-process-stack.patch
uml-change-remaining-callers-of-os_read_write_file.patch
uml-formatting-fixes-around-os_read_write_file-callers.patch
uml-remove-debugging-remnants.patch
uml-rename-os_read_write_file_k-back-to-os_read_write_file.patch
uml-aio-deadlock-avoidance.patch
uml-speed-page-fault-path.patch
uml-eliminate-a-piece-of-debugging-code.patch
uml-more-page-fault-path-trimming.patch
uml-only-flush-areas-covered-by-vma.patch
uml-out-of-tmpfs-space-error-clarification.patch
uml-virtualized-time-fix.patch
uml-fix-prototypes.patch
v850-generic-timekeeping-conversion.patch
xtensa-strlcpy-is-smart-enough.patch
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2007-05-02 22:02 incoming Andrew Morton
@ 2007-05-02 22:31 ` Benjamin Herrenschmidt
2007-05-03 7:55 ` incoming Russell King
2007-05-04 13:37 ` incoming Greg KH
2 siblings, 0 replies; 348+ messages in thread
From: Benjamin Herrenschmidt @ 2007-05-02 22:31 UTC (permalink / raw)
To: Andrew Morton
Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller,
Andi Kleen, Luck, Tony, Rik van Riel, linux-kernel, linux-mm
On Wed, 2007-05-02 at 15:02 -0700, Andrew Morton wrote:
> So this is what I have lined up for the first mm->2.6.22 batch. I won't be
> sending it off for another 12-24 hours yet. To give people time for final
> comment and to give me time to see if it actually works.
Thanks.
I have some powerpc bits that depend on that stuff that will go through
Paulus after these show up in git and I've rebased.
Cheers,
Ben.
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2007-05-02 22:02 incoming Andrew Morton
2007-05-02 22:31 ` incoming Benjamin Herrenschmidt
@ 2007-05-03 7:55 ` Russell King
2007-05-03 8:05 ` incoming Andrew Morton
2007-05-04 13:37 ` incoming Greg KH
2 siblings, 1 reply; 348+ messages in thread
From: Russell King @ 2007-05-03 7:55 UTC (permalink / raw)
To: Andrew Morton
Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller,
Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt,
linux-kernel, linux-mm
On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote:
> So this is what I have lined up for the first mm->2.6.22 batch. I won't be
> sending it off for another 12-24 hours yet. To give people time for final
> comment and to give me time to see if it actually works.
I assume you're going to update this list with my comments I sent
yesterday?
--
Russell King
Linux kernel 2.6 ARM Linux - http://www.arm.linux.org.uk/
maintainer of:
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2007-05-03 7:55 ` incoming Russell King
@ 2007-05-03 8:05 ` Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2007-05-03 8:05 UTC (permalink / raw)
To: Russell King
Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller,
Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt,
linux-kernel, linux-mm
On Thu, 3 May 2007 08:55:43 +0100 Russell King <rmk+lkml@arm.linux.org.uk> wrote:
> On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote:
> > So this is what I have lined up for the first mm->2.6.22 batch. I won't be
> > sending it off for another 12-24 hours yet. To give people time for final
> > comment and to give me time to see if it actually works.
>
> I assume you're going to update this list with my comments I sent
> yesterday?
>
Serial drivers? Well you saw me drop a bunch of them. I now have:
serial-driver-pmc-msp71xx.patch
rm9000-serial-driver.patch
serial-define-fixed_port-flag-for-serial_core.patch
mpsc-serial-driver-tx-locking.patch
serial-serial_core-use-pr_debug.patch
I'll also be holding off on MADV_FREE - Nick has some performance things to
share and I'm assuming they're not as good as he'd like.
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2007-05-02 22:02 incoming Andrew Morton
2007-05-02 22:31 ` incoming Benjamin Herrenschmidt
2007-05-03 7:55 ` incoming Russell King
@ 2007-05-04 13:37 ` Greg KH
2007-05-04 16:14 ` incoming Andrew Morton
2 siblings, 1 reply; 348+ messages in thread
From: Greg KH @ 2007-05-04 13:37 UTC (permalink / raw)
To: Andrew Morton
Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller,
Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt,
linux-kernel, linux-mm
On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote:
> - One little security patch
Care to cc: linux-stable with it so we can do a new 2.6.21 release with
it if needed?
thanks,
greg k-h
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2007-05-04 13:37 ` incoming Greg KH
@ 2007-05-04 16:14 ` Andrew Morton
2007-05-04 17:02 ` incoming Greg KH
2007-05-04 18:57 ` incoming Roland McGrath
0 siblings, 2 replies; 348+ messages in thread
From: Andrew Morton @ 2007-05-04 16:14 UTC (permalink / raw)
To: Greg KH
Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller,
Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt,
linux-kernel, linux-mm, Roland McGrath, Stephen Smalley
On Fri, 4 May 2007 06:37:28 -0700 Greg KH <greg@kroah.com> wrote:
> On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote:
> > - One little security patch
>
> Care to cc: linux-stable with it so we can do a new 2.6.21 release with
> it if needed?
>
Ah. The patch affects security code, but it doesn't actually address any
insecurity. I didn't think it was needed for -stable?
From: Roland McGrath <roland@redhat.com>
wait* syscalls return -ECHILD even when an individual PID of a live child
was requested explicitly, when security_task_wait denies the operation.
This means that something like a broken SELinux policy can produce an
unexpected failure that looks just like a bug with wait or ptrace or
something.
This patch makes do_wait return -EACCES (or other appropriate error returned
from security_task_wait() instead of -ECHILD if some children were ruled out
solely because security_task_wait failed.
[jmorris@namei.org: switch error code to EACCES]
Signed-off-by: Roland McGrath <roland@redhat.com>
Cc: Stephen Smalley <sds@tycho.nsa.gov>
Cc: Chris Wright <chrisw@sous-sol.org>
Cc: James Morris <jmorris@namei.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
kernel/exit.c | 17 +++++++++++++++--
1 files changed, 15 insertions(+), 2 deletions(-)
diff -puN kernel/exit.c~return-eperm-not-echild-on-security_task_wait-failure kernel/exit.c
--- a/kernel/exit.c~return-eperm-not-echild-on-security_task_wait-failure
+++ a/kernel/exit.c
@@ -1033,6 +1033,8 @@ asmlinkage void sys_exit_group(int error
static int eligible_child(pid_t pid, int options, struct task_struct *p)
{
+ int err;
+
if (pid > 0) {
if (p->pid != pid)
return 0;
@@ -1066,8 +1068,9 @@ static int eligible_child(pid_t pid, int
if (delay_group_leader(p))
return 2;
- if (security_task_wait(p))
- return 0;
+ err = security_task_wait(p);
+ if (err)
+ return err;
return 1;
}
@@ -1449,6 +1452,7 @@ static long do_wait(pid_t pid, int optio
DECLARE_WAITQUEUE(wait, current);
struct task_struct *tsk;
int flag, retval;
+ int allowed, denied;
add_wait_queue(¤t->signal->wait_chldexit,&wait);
repeat:
@@ -1457,6 +1461,7 @@ repeat:
* match our criteria, even if we are not able to reap it yet.
*/
flag = 0;
+ allowed = denied = 0;
current->state = TASK_INTERRUPTIBLE;
read_lock(&tasklist_lock);
tsk = current;
@@ -1472,6 +1477,12 @@ repeat:
if (!ret)
continue;
+ if (unlikely(ret < 0)) {
+ denied = ret;
+ continue;
+ }
+ allowed = 1;
+
switch (p->state) {
case TASK_TRACED:
/*
@@ -1570,6 +1581,8 @@ check_continued:
goto repeat;
}
retval = -ECHILD;
+ if (unlikely(denied) && !allowed)
+ retval = denied;
end:
current->state = TASK_RUNNING;
remove_wait_queue(¤t->signal->wait_chldexit,&wait);
_
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2007-05-04 16:14 ` incoming Andrew Morton
@ 2007-05-04 17:02 ` Greg KH
2007-05-04 18:57 ` incoming Roland McGrath
1 sibling, 0 replies; 348+ messages in thread
From: Greg KH @ 2007-05-04 17:02 UTC (permalink / raw)
To: Andrew Morton
Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller,
Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt,
linux-kernel, linux-mm, Roland McGrath, Stephen Smalley
On Fri, May 04, 2007 at 09:14:34AM -0700, Andrew Morton wrote:
> On Fri, 4 May 2007 06:37:28 -0700 Greg KH <greg@kroah.com> wrote:
>
> > On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote:
> > > - One little security patch
> >
> > Care to cc: linux-stable with it so we can do a new 2.6.21 release with
> > it if needed?
> >
>
> Ah. The patch affects security code, but it doesn't actually address any
> insecurity. I didn't think it was needed for -stable?
Ah, ok, I read "security" as fixing a insecure problem, my mistake :)
thanks,
greg k-h
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2007-05-04 16:14 ` incoming Andrew Morton
2007-05-04 17:02 ` incoming Greg KH
@ 2007-05-04 18:57 ` Roland McGrath
2007-05-04 19:24 ` incoming Greg KH
1 sibling, 1 reply; 348+ messages in thread
From: Roland McGrath @ 2007-05-04 18:57 UTC (permalink / raw)
To: Andrew Morton
Cc: Greg KH, Linus Torvalds, Hugh Dickins, Christoph Lameter,
David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel,
Benjamin Herrenschmidt, linux-kernel, linux-mm, Stephen Smalley
> Ah. The patch affects security code, but it doesn't actually address any
> insecurity. I didn't think it was needed for -stable?
I would not recommend it for -stable.
It is an ABI change for the case of a security refusal.
Thanks,
Roland
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2007-05-04 18:57 ` incoming Roland McGrath
@ 2007-05-04 19:24 ` Greg KH
2007-05-04 19:29 ` incoming Roland McGrath
0 siblings, 1 reply; 348+ messages in thread
From: Greg KH @ 2007-05-04 19:24 UTC (permalink / raw)
To: Roland McGrath
Cc: Andrew Morton, Linus Torvalds, Hugh Dickins, Christoph Lameter,
David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel,
Benjamin Herrenschmidt, linux-kernel, linux-mm, Stephen Smalley
On Fri, May 04, 2007 at 11:57:21AM -0700, Roland McGrath wrote:
> > Ah. The patch affects security code, but it doesn't actually address any
> > insecurity. I didn't think it was needed for -stable?
>
> I would not recommend it for -stable.
> It is an ABI change for the case of a security refusal.
ABI changes are not a problem for -stable, so don't let that stop anyone
:)
thanks,
greg k-h
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2007-05-04 19:24 ` incoming Greg KH
@ 2007-05-04 19:29 ` Roland McGrath
0 siblings, 0 replies; 348+ messages in thread
From: Roland McGrath @ 2007-05-04 19:29 UTC (permalink / raw)
To: Greg KH
Cc: Andrew Morton, Linus Torvalds, Hugh Dickins, Christoph Lameter,
David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel,
Benjamin Herrenschmidt, linux-kernel, linux-mm, Stephen Smalley
> ABI changes are not a problem for -stable, so don't let that stop anyone
> :)
In fact this is the harmless sort (changes only the error code of a
failure case) that might actually go in if there were any important
reason. But the smiley stands.
Thanks,
Roland
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
[not found] <20190716162536.bb52b8f34a8ecf5331a86a42@linux-foundation.org>
@ 2019-07-17 8:47 ` Vlastimil Babka
2019-07-17 8:57 ` incoming Bhaskar Chowdhury
2019-07-17 16:13 ` incoming Linus Torvalds
0 siblings, 2 replies; 348+ messages in thread
From: Vlastimil Babka @ 2019-07-17 8:47 UTC (permalink / raw)
To: linux-kernel, Linus Torvalds
Cc: linux-mm, Jonathan Corbet, Thorsten Leemhuis, LKML
On 7/17/19 1:25 AM, Andrew Morton wrote:
>
> Most of the rest of MM and just about all of the rest of everything
> else.
Hi,
as I've mentioned at LSF/MM [1], I think it would be nice if mm pull
requests had summaries similar to other subsystems. I see they are now
more structured (thanks!), but they are now probably hitting the limit
of what scripting can do to produce a high-level summary for human
readers (unless patch authors themselves provide a blurb that can be
extracted later?).
So I've tried now to provide an example what I had in mind, below. Maybe
it's too concise - if there were "larger" features in this pull request,
they would probably benefit from more details. I'm CCing the known (to
me) consumers of these mails to judge :) Note I've only covered mm, and
core stuff that I think will be interesting to wide audience (change in
LIST_POISON2 value? I'm sure as hell glad to know about that one :)
Feel free to include this in the merge commit, if you find it useful.
Thanks,
Vlastimil
[1] https://lwn.net/Articles/787705/
-----
- z3fold fixes and enhancements by Henry Burns and Vitaly Wool
- more accurate reclaimed slab caches calculations by Yafang Shao
- fix MAP_UNINITIALIZED UAPI symbol to not depend on config, by
Christoph Hellwig
- !CONFIG_MMU fixes by Christoph Hellwig
- new novmcoredd parameter to omit device dumps from vmcore, by Kairui Song
- new test_meminit module for testing heap and pagealloc initialization,
by Alexander Potapenko
- ioremap improvements for huge mappings, by Anshuman Khandual
- generalize kprobe page fault handling, by Anshuman Khandual
- device-dax hotplug fixes and improvements, by Pavel Tatashin
- enable synchronous DAX fault on powerpc, by Aneesh Kumar K.V
- add pte_devmap() support for arm64, by Robin Murphy
- unify locked_vm accounting with a helper, by Daniel Jordan
- several misc fixes
core/lib
- new typeof_member() macro including some users, by Alexey Dobriyan
- make BIT() and GENMASK() available in asm, by Masahiro Yamada
- changed LIST_POISON2 on x86_64 to 0xdead000000000122 for better code
generation, by Alexey Dobriyan
- rbtree code size optimizations, by Michel Lespinasse
- convert struct pid count to refcount_t, by Joel Fernandes
get_maintainer.pl
- add --no-moderated switch to skip moderated ML's, by Joe Perches
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2019-07-17 8:47 ` incoming Vlastimil Babka
@ 2019-07-17 8:57 ` Bhaskar Chowdhury
2019-07-17 16:13 ` incoming Linus Torvalds
1 sibling, 0 replies; 348+ messages in thread
From: Bhaskar Chowdhury @ 2019-07-17 8:57 UTC (permalink / raw)
To: Vlastimil Babka
Cc: linux-kernel, Linus Torvalds, linux-mm, Jonathan Corbet,
Thorsten Leemhuis
[-- Attachment #1: Type: text/plain, Size: 2496 bytes --]
Cool !!
On 10:47 Wed 17 Jul , Vlastimil Babka wrote:
>On 7/17/19 1:25 AM, Andrew Morton wrote:
>>
>> Most of the rest of MM and just about all of the rest of everything
>> else.
>
>Hi,
>
>as I've mentioned at LSF/MM [1], I think it would be nice if mm pull
>requests had summaries similar to other subsystems. I see they are now
>more structured (thanks!), but they are now probably hitting the limit
>of what scripting can do to produce a high-level summary for human
>readers (unless patch authors themselves provide a blurb that can be
>extracted later?).
>
>So I've tried now to provide an example what I had in mind, below. Maybe
>it's too concise - if there were "larger" features in this pull request,
>they would probably benefit from more details. I'm CCing the known (to
>me) consumers of these mails to judge :) Note I've only covered mm, and
>core stuff that I think will be interesting to wide audience (change in
>LIST_POISON2 value? I'm sure as hell glad to know about that one :)
>
>Feel free to include this in the merge commit, if you find it useful.
>
>Thanks,
>Vlastimil
>
>[1] https://lwn.net/Articles/787705/
>
>-----
>
>- z3fold fixes and enhancements by Henry Burns and Vitaly Wool
>- more accurate reclaimed slab caches calculations by Yafang Shao
>- fix MAP_UNINITIALIZED UAPI symbol to not depend on config, by
>Christoph Hellwig
>- !CONFIG_MMU fixes by Christoph Hellwig
>- new novmcoredd parameter to omit device dumps from vmcore, by Kairui Song
>- new test_meminit module for testing heap and pagealloc initialization,
>by Alexander Potapenko
>- ioremap improvements for huge mappings, by Anshuman Khandual
>- generalize kprobe page fault handling, by Anshuman Khandual
>- device-dax hotplug fixes and improvements, by Pavel Tatashin
>- enable synchronous DAX fault on powerpc, by Aneesh Kumar K.V
>- add pte_devmap() support for arm64, by Robin Murphy
>- unify locked_vm accounting with a helper, by Daniel Jordan
>- several misc fixes
>
>core/lib
>- new typeof_member() macro including some users, by Alexey Dobriyan
>- make BIT() and GENMASK() available in asm, by Masahiro Yamada
>- changed LIST_POISON2 on x86_64 to 0xdead000000000122 for better code
>generation, by Alexey Dobriyan
>- rbtree code size optimizations, by Michel Lespinasse
>- convert struct pid count to refcount_t, by Joel Fernandes
>
>get_maintainer.pl
>- add --no-moderated switch to skip moderated ML's, by Joe Perches
>
>
[-- Attachment #2: signature.asc --]
[-- Type: application/pgp-signature, Size: 488 bytes --]
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2019-07-17 8:47 ` incoming Vlastimil Babka
2019-07-17 8:57 ` incoming Bhaskar Chowdhury
@ 2019-07-17 16:13 ` Linus Torvalds
2019-07-17 17:09 ` incoming Christian Brauner
2019-07-17 18:13 ` incoming Vlastimil Babka
1 sibling, 2 replies; 348+ messages in thread
From: Linus Torvalds @ 2019-07-17 16:13 UTC (permalink / raw)
To: Vlastimil Babka
Cc: Linux List Kernel Mailing, linux-mm, Jonathan Corbet,
Thorsten Leemhuis
On Wed, Jul 17, 2019 at 1:47 AM Vlastimil Babka <vbabka@suse.cz> wrote:
>
> So I've tried now to provide an example what I had in mind, below.
I'll take it as a trial. I added one-line notes about coda and the
PTRACE_GET_SYSCALL_INFO interface too.
I do hope that eventually I'll just get pull requests, and they'll
have more of a "theme" than this all (*)
Linus
(*) Although in many ways, the theme for Andrew is "falls through the
cracks otherwise" so I'm not really complaining. This has been working
for years and years.
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2019-07-17 16:13 ` incoming Linus Torvalds
@ 2019-07-17 17:09 ` Christian Brauner
2019-07-17 18:13 ` incoming Vlastimil Babka
1 sibling, 0 replies; 348+ messages in thread
From: Christian Brauner @ 2019-07-17 17:09 UTC (permalink / raw)
To: Linus Torvalds
Cc: Vlastimil Babka, Linux List Kernel Mailing, linux-mm,
Jonathan Corbet, Thorsten Leemhuis
On Wed, Jul 17, 2019 at 09:13:26AM -0700, Linus Torvalds wrote:
> On Wed, Jul 17, 2019 at 1:47 AM Vlastimil Babka <vbabka@suse.cz> wrote:
> >
> > So I've tried now to provide an example what I had in mind, below.
>
> I'll take it as a trial. I added one-line notes about coda and the
> PTRACE_GET_SYSCALL_INFO interface too.
>
> I do hope that eventually I'll just get pull requests, and they'll
> have more of a "theme" than this all (*)
>
> Linus
>
> (*) Although in many ways, the theme for Andrew is "falls through the
> cracks otherwise" so I'm not really complaining. This has been working
I put all pid{fd}/clone{3} which is mostly related to pid.c, exit.c,
fork.c into my tree and try to give it a consistent theme for the prs I
sent. And that at least from my perspective that worked and was pretty
easy to coordinate with Andrew. That should hopefully make it a little
easier to theme the -mm tree overall going forward.
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2019-07-17 16:13 ` incoming Linus Torvalds
2019-07-17 17:09 ` incoming Christian Brauner
@ 2019-07-17 18:13 ` Vlastimil Babka
1 sibling, 0 replies; 348+ messages in thread
From: Vlastimil Babka @ 2019-07-17 18:13 UTC (permalink / raw)
To: Linus Torvalds
Cc: Linux List Kernel Mailing, linux-mm, Jonathan Corbet,
Thorsten Leemhuis
On 7/17/19 6:13 PM, Linus Torvalds wrote:
> On Wed, Jul 17, 2019 at 1:47 AM Vlastimil Babka <vbabka@suse.cz> wrote:
>>
>> So I've tried now to provide an example what I had in mind, below.
>
> I'll take it as a trial. I added one-line notes about coda and the
> PTRACE_GET_SYSCALL_INFO interface too.
Thanks.
> I do hope that eventually I'll just get pull requests,
Very much agree, that was also discussed at length in the LSF/MM mm
process session I've linked.
> and they'll
> have more of a "theme" than this all (*)
I'll check if the first patch bomb would be more amenable to that, as I
plan to fill in the mm part for 5.3 on LinuxChanges wiki, but for a
merge commit it's too late.
> Linus
>
> (*) Although in many ways, the theme for Andrew is "falls through the
> cracks otherwise" so I'm not really complaining. This has been working
> for years and years.
Nevermind the misc stuff that much, but I think mm itself is more
important and deserves what other subsystems have.
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2019-08-25 0:54 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2019-08-25 0:54 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
11 fixes, based on 361469211f876e67d7ca3d3d29e6d1c3e313d0f1:
Henry Burns <henryburns@google.com>:
mm/z3fold.c: fix race between migration and destruction
David Rientjes <rientjes@google.com>:
mm, page_alloc: move_freepages should not examine struct page of reserved memory
Qian Cai <cai@lca.pw>:
parisc: fix compilation errrors
Roman Gushchin <guro@fb.com>:
mm: memcontrol: flush percpu vmstats before releasing memcg
mm: memcontrol: flush percpu vmevents before releasing memcg
Jason Xing <kerneljasonxing@linux.alibaba.com>:
psi: get poll_work to run when calling poll syscall next time
Oleg Nesterov <oleg@redhat.com>:
userfaultfd_release: always remove uffd flags and clear vm_userfaultfd_ctx
Vlastimil Babka <vbabka@suse.cz>:
mm, page_owner: handle THP splits correctly
Henry Burns <henryburns@google.com>:
mm/zsmalloc.c: migration can leave pages in ZS_EMPTY indefinitely
mm/zsmalloc.c: fix race condition in zs_destroy_pool
Andrey Ryabinin <aryabinin@virtuozzo.com>:
mm/kasan: fix false positive invalid-free reports with CONFIG_KASAN_SW_TAGS=y
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2019-08-30 23:04 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2019-08-30 23:04 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
7 fixes, based on 846d2db3e00048da3f650e0cfb0b8d67669cec3e:
Roman Gushchin <guro@fb.com>:
mm: memcontrol: flush percpu slab vmstats on kmem offlining
Andrew Morton <akpm@linux-foundation.org>:
mm/zsmalloc.c: fix build when CONFIG_COMPACTION=n
Roman Gushchin <guro@fb.com>:
mm, memcg: partially revert "mm/memcontrol.c: keep local VM counters in sync with the hierarchical ones"
"Gustavo A. R. Silva" <gustavo@embeddedor.com>:
mm/z3fold.c: fix lock/unlock imbalance in z3fold_page_isolate
Dmitry Safonov <dima@arista.com>:
mailmap: add aliases for Dmitry Safonov
Michal Hocko <mhocko@suse.com>:
mm, memcg: do not set reclaim_state on soft limit reclaim
Shakeel Butt <shakeelb@google.com>:
mm: memcontrol: fix percpu vmstats and vmevents flush
.mailmap | 3 ++
include/linux/mmzone.h | 5 ++--
mm/memcontrol.c | 53 ++++++++++++++++++++++++++++++++-----------------
mm/vmscan.c | 5 ++--
mm/z3fold.c | 1
mm/zsmalloc.c | 2 +
6 files changed, 47 insertions(+), 22 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2019-09-23 22:31 Andrew Morton
2019-09-24 0:55 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2019-09-23 22:31 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- a few hot fixes
- ocfs2 updates
- almost all of -mm, as below.
134 patches, based on 619e17cf75dd58905aa67ccd494a6ba5f19d6cc6:
Subsystems affected by this patch series:
hotfixes
ocfs2
slab-generic
slab
slub
kmemleak
kasan
cleanups
debug
pagecache
memcg
gup
pagemap
memory-hotplug
sparsemem
vmalloc
initialization
z3fold
compaction
mempolicy
oom-kill
hugetlb
migration
thp
mmap
madvise
shmem
zswap
zsmalloc
Subsystem: hotfixes
OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
fat: work around race with userspace's read via blockdev while mounting
Vitaly Wool <vitalywool@gmail.com>:
Revert "mm/z3fold.c: fix race between migration and destruction"
Arnd Bergmann <arnd@arndb.de>:
mm: add dummy can_do_mlock() helper
Vitaly Wool <vitalywool@gmail.com>:
z3fold: fix retry mechanism in page reclaim
Greg Thelen <gthelen@google.com>:
kbuild: clean compressed initramfs image
Subsystem: ocfs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: use jbd2_inode dirty range scoping
jbd2: remove jbd2_journal_inode_add_[write|wait]
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
ocfs2: further debugfs cleanups
Guozhonghua <guozhonghua@h3c.com>:
ocfs2: remove unused ocfs2_calc_tree_trunc_credits()
ocfs2: remove unused ocfs2_orphan_scan_exit() declaration
zhengbin <zhengbin13@huawei.com>:
fs/ocfs2/namei.c: remove set but not used variables
fs/ocfs2/file.c: remove set but not used variables
fs/ocfs2/dir.c: remove set but not used variables
Markus Elfring <elfring@users.sourceforge.net>:
ocfs2: delete unnecessary checks before brelse()
Changwei Ge <gechangwei@live.cn>:
ocfs2: wait for recovering done after direct unlock request
ocfs2: checkpoint appending truncate log transaction before flushing
Colin Ian King <colin.king@canonical.com>:
ocfs2: fix spelling mistake "ambigous" -> "ambiguous"
Subsystem: slab-generic
Waiman Long <longman@redhat.com>:
mm, slab: extend slab/shrink to shrink all memcg caches
Subsystem: slab
Waiman Long <longman@redhat.com>:
mm, slab: move memcg_cache_params structure to mm/slab.h
Subsystem: slub
Qian Cai <cai@lca.pw>:
mm/slub.c: fix -Wunused-function compiler warnings
Subsystem: kmemleak
Nicolas Boichat <drinkcat@chromium.org>:
kmemleak: increase DEBUG_KMEMLEAK_EARLY_LOG_SIZE default to 16K
Catalin Marinas <catalin.marinas@arm.com>:
Patch series "mm: kmemleak: Use a memory pool for kmemleak object:
mm: kmemleak: make the tool tolerant to struct scan_area allocation failures
mm: kmemleak: simple memory allocation pool for kmemleak objects
mm: kmemleak: use the memory pool for early allocations
Qian Cai <cai@lca.pw>:
mm/kmemleak.c: record the current memory pool size
mm/kmemleak: increase the max mem pool to 1M
Subsystem: kasan
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: add memory corruption identification for software tag-based mode
Mark Rutland <mark.rutland@arm.com>:
lib/test_kasan.c: add roundtrip tests
Subsystem: cleanups
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
mm/page_poison.c: fix a typo in a comment
YueHaibing <yuehaibing@huawei.com>:
mm/rmap.c: remove set but not used variable 'cstart'
Matthew Wilcox (Oracle) <willy@infradead.org>:
Patch series "Make working with compound pages easier", v2:
mm: introduce page_size()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: introduce page_shift()
Matthew Wilcox (Oracle) <willy@infradead.org>:
mm: introduce compound_nr()
Yu Zhao <yuzhao@google.com>:
mm: replace list_move_tail() with add_page_to_lru_list_tail()
Subsystem: debug
Vlastimil Babka <vbabka@suse.cz>:
Patch series "debug_pagealloc improvements through page_owner", v2:
mm, page_owner: record page owner for each subpage
mm, page_owner: keep owner info when freeing the page
mm, page_owner, debug_pagealloc: save and dump freeing stack trace
Subsystem: pagecache
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
mm/filemap.c: don't initiate writeback if mapping has no dirty pages
mm/filemap.c: rewrite mapping_needs_writeback in less fancy manner
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: page cache: store only head pages in i_pages
Subsystem: memcg
Chris Down <chris@chrisdown.name>:
mm, memcg: throttle allocators when failing reclaim over memory.high
Roman Gushchin <guro@fb.com>:
mm: memcontrol: switch to rcu protection in drain_all_stock()
Johannes Weiner <hannes@cmpxchg.org>:
mm: vmscan: do not share cgroup iteration between reclaimers
Subsystem: gup
[11~From: John Hubbard <jhubbard@nvidia.com>:
Patch series "mm/gup: add make_dirty arg to put_user_pages_dirty_lock()",:
mm/gup: add make_dirty arg to put_user_pages_dirty_lock()
John Hubbard <jhubbard@nvidia.com>:
drivers/gpu/drm/via: convert put_page() to put_user_page*()
net/xdp: convert put_page() to put_user_page*()
Subsystem: pagemap
Wei Yang <richardw.yang@linux.intel.com>:
mm: remove redundant assignment of entry
Minchan Kim <minchan@kernel.org>:
mm: release the spinlock on zap_pte_range
Nicholas Piggin <npiggin@gmail.com>:
Patch series "mm: remove quicklist page table caches":
mm: remove quicklist page table caches
Mike Rapoport <rppt@linux.ibm.com>:
ia64: switch to generic version of pte allocation
sh: switch to generic version of pte allocation
microblaze: switch to generic version of pte allocation
mm: consolidate pgtable_cache_init() and pgd_cache_init()
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: do not hash address in print_bad_pte()
Subsystem: memory-hotplug
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: remove move_pfn_range()
drivers/base/node.c: simplify unregister_memory_block_under_nodes()
drivers/base/memory.c: fixup documentation of removable/phys_index/block_size_bytes
driver/base/memory.c: validate memory block size early
drivers/base/memory.c: don't store end_section_nr in memory blocks
Wei Yang <richardw.yang@linux.intel.com>:
mm/memory_hotplug.c: prevent memory leak when reusing pgdat
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: online_pages() cleanups", v2:
mm/memory_hotplug.c: use PFN_UP / PFN_DOWN in walk_system_ram_range()
mm/memory_hotplug: drop PageReserved() check in online_pages_range()
mm/memory_hotplug: simplify online_pages_range()
mm/memory_hotplug: make sure the pfn is aligned to the order when onlining
mm/memory_hotplug: online_pages cannot be 0 in online_pages()
Alastair D'Silva <alastair@d-silva.org>:
Patch series "Add bounds check for Hotplugged memory", v3:
mm/memory_hotplug.c: add a bounds check to check_hotplug_memory_range()
mm/memremap.c: add a bounds check in devm_memremap_pages()
Souptick Joarder <jrdr.linux@gmail.com>:
mm/memory_hotplug.c: s/is/if
Subsystem: sparsemem
Lecopzer Chen <lecopzer.chen@mediatek.com>:
mm/sparse.c: fix memory leak of sparsemap_buf in aligned memory
mm/sparse.c: fix ALIGN() without power of 2 in sparse_buffer_alloc()
Wei Yang <richardw.yang@linux.intel.com>:
mm/sparse.c: use __nr_to_section(section_nr) to get mem_section
Alastair D'Silva <alastair@d-silva.org>:
mm/sparse.c: don't manually decrement num_poisoned_pages
"Alastair D'Silva" <alastair@d-silva.org>:
mm/sparse.c: remove NULL check in clear_hwpoisoned_pages()
Subsystem: vmalloc
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: do not keep unpurged areas in the busy tree
Pengfei Li <lpf.vector@gmail.com>:
mm/vmalloc: modify struct vmap_area to reduce its size
Austin Kim <austindh.kim@gmail.com>:
mm/vmalloc.c: move 'area->pages' after if statement
Subsystem: initialization
Mike Rapoport <rppt@linux.ibm.com>:
mm: use CPU_BITS_NONE to initialize init_mm.cpu_bitmask
Qian Cai <cai@lca.pw>:
mm: silence -Woverride-init/initializer-overrides
Subsystem: z3fold
Vitaly Wool <vitalywool@gmail.com>:
z3fold: fix memory leak in kmem cache
Subsystem: compaction
Yafang Shao <laoar.shao@gmail.com>:
mm/compaction.c: clear total_{migrate,free}_scanned before scanning a new zone
Pengfei Li <lpf.vector@gmail.com>:
mm/compaction.c: remove unnecessary zone parameter in isolate_migratepages()
Subsystem: mempolicy
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm/mempolicy.c: remove unnecessary nodemask check in kernel_migrate_pages()
Subsystem: oom-kill
Joel Savitz <jsavitz@redhat.com>:
mm/oom_kill.c: add task UID to info message on an oom kill
Tetsuo Handa <penguin-kernel@i-love.sakura.ne.jp>:
memcg, oom: don't require __GFP_FS when invoking memcg OOM killer
Edward Chron <echron@arista.com>:
mm/oom: add oom_score_adj and pgtables to Killed process message
Yi Wang <wang.yi59@zte.com.cn>:
mm/oom_kill.c: fix oom_cpuset_eligible() comment
Michal Hocko <mhocko@suse.com>:
mm, oom: consider present pages for the node size
Qian Cai <cai@lca.pw>:
mm/memcontrol.c: fix a -Wunused-function warning
Michal Hocko <mhocko@suse.com>:
memcg, kmem: deprecate kmem.limit_in_bytes
Subsystem: hugetlb
Hillf Danton <hdanton@sina.com>:
Patch series "address hugetlb page allocation stalls", v2:
mm, reclaim: make should_continue_reclaim perform dryrun detection
Vlastimil Babka <vbabka@suse.cz>:
mm, reclaim: cleanup should_continue_reclaim()
mm, compaction: raise compaction priority after it withdrawns
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlbfs: don't retry when pool page allocations start to fail
Subsystem: migration
Pingfan Liu <kernelfans@gmail.com>:
mm/migrate.c: clean up useless code in migrate_vma_collect_pmd()
Subsystem: thp
Kefeng Wang <wangkefeng.wang@huawei.com>:
thp: update split_huge_page_pmd() comment
Song Liu <songliubraving@fb.com>:
Patch series "Enable THP for text section of non-shmem files", v10;:
filemap: check compound_head(page)->mapping in filemap_fault()
filemap: check compound_head(page)->mapping in pagecache_get_page()
filemap: update offset check in filemap_fault()
mm,thp: stats for file backed THP
khugepaged: rename collapse_shmem() and khugepaged_scan_shmem()
mm,thp: add read-only THP support for (non-shmem) FS
mm,thp: avoid writes to file with THP in pagecache
Yang Shi <yang.shi@linux.alibaba.com>:
Patch series "Make deferred split shrinker memcg aware", v6:
mm: thp: extract split_queue_* into a struct
mm: move mem_cgroup_uncharge out of __page_cache_release()
mm: shrinker: make shrinker not depend on memcg kmem
mm: thp: make deferred split shrinker memcg aware
Song Liu <songliubraving@fb.com>:
Patch series "THP aware uprobe", v13:
mm: move memcmp_pages() and pages_identical()
uprobe: use original page when all uprobes are removed
mm, thp: introduce FOLL_SPLIT_PMD
uprobe: use FOLL_SPLIT_PMD instead of FOLL_SPLIT
khugepaged: enable collapse pmd for pte-mapped THP
uprobe: collapse THP pmd after removing all uprobes
Subsystem: mmap
Alexandre Ghiti <alex@ghiti.fr>:
Patch series "Provide generic top-down mmap layout functions", v6:
mm, fs: move randomize_stack_top from fs to mm
arm64: make use of is_compat_task instead of hardcoding this test
arm64: consider stack randomization for mmap base only when necessary
arm64, mm: move generic mmap layout functions to mm
arm64, mm: make randomization selected by generic topdown mmap layout
arm: properly account for stack randomization and stack guard gap
arm: use STACK_TOP when computing mmap base address
arm: use generic mmap top-down layout and brk randomization
mips: properly account for stack randomization and stack guard gap
mips: use STACK_TOP when computing mmap base address
mips: adjust brk randomization offset to fit generic version
mips: replace arch specific way to determine 32bit task with generic version
mips: use generic mmap top-down layout and brk randomization
riscv: make mmap allocation top-down by default
Wei Yang <richardw.yang@linux.intel.com>:
mm/mmap.c: refine find_vma_prev() with rb_last()
Ivan Khoronzhuk <ivan.khoronzhuk@linaro.org>:
mm: mmap: increase sockets maximum memory size pgoff for 32bits
Subsystem: madvise
Mike Rapoport <rppt@linux.ibm.com>:
mm/madvise: reduce code duplication in error handling paths
Subsystem: shmem
Miles Chen <miles.chen@mediatek.com>:
shmem: fix obsolete comment in shmem_getpage_gfp()
Subsystem: zswap
Hui Zhu <teawaterz@linux.alibaba.com>:
zpool: add malloc_support_movable to zpool_driver
zswap: use movable memory if zpool support allocate movable memory
Vitaly Wool <vitalywool@gmail.com>:
zswap: do not map same object twice
Subsystem: zsmalloc
Qian Cai <cai@lca.pw>:
mm/zsmalloc.c: fix a -Wunused-function warning
Documentation/ABI/testing/sysfs-kernel-slab | 13
Documentation/admin-guide/cgroup-v1/memory.rst | 4
Documentation/admin-guide/kernel-parameters.txt | 2
arch/Kconfig | 11
arch/alpha/include/asm/pgalloc.h | 2
arch/alpha/include/asm/pgtable.h | 5
arch/arc/include/asm/pgalloc.h | 1
arch/arc/include/asm/pgtable.h | 5
arch/arm/Kconfig | 1
arch/arm/include/asm/pgalloc.h | 2
arch/arm/include/asm/pgtable-nommu.h | 5
arch/arm/include/asm/pgtable.h | 2
arch/arm/include/asm/processor.h | 2
arch/arm/kernel/process.c | 5
arch/arm/mm/flush.c | 7
arch/arm/mm/mmap.c | 80 -----
arch/arm64/Kconfig | 2
arch/arm64/include/asm/pgalloc.h | 2
arch/arm64/include/asm/pgtable.h | 2
arch/arm64/include/asm/processor.h | 2
arch/arm64/kernel/process.c | 8
arch/arm64/mm/flush.c | 3
arch/arm64/mm/mmap.c | 84 -----
arch/arm64/mm/pgd.c | 2
arch/c6x/include/asm/pgtable.h | 5
arch/csky/include/asm/pgalloc.h | 2
arch/csky/include/asm/pgtable.h | 5
arch/h8300/include/asm/pgtable.h | 6
arch/hexagon/include/asm/pgalloc.h | 2
arch/hexagon/include/asm/pgtable.h | 3
arch/hexagon/mm/Makefile | 2
arch/hexagon/mm/pgalloc.c | 10
arch/ia64/Kconfig | 4
arch/ia64/include/asm/pgalloc.h | 64 ----
arch/ia64/include/asm/pgtable.h | 5
arch/ia64/mm/init.c | 2
arch/m68k/include/asm/pgtable_mm.h | 7
arch/m68k/include/asm/pgtable_no.h | 7
arch/microblaze/include/asm/pgalloc.h | 128 --------
arch/microblaze/include/asm/pgtable.h | 7
arch/microblaze/mm/pgtable.c | 4
arch/mips/Kconfig | 2
arch/mips/include/asm/pgalloc.h | 2
arch/mips/include/asm/pgtable.h | 5
arch/mips/include/asm/processor.h | 5
arch/mips/mm/mmap.c | 124 +-------
arch/nds32/include/asm/pgalloc.h | 2
arch/nds32/include/asm/pgtable.h | 2
arch/nios2/include/asm/pgalloc.h | 2
arch/nios2/include/asm/pgtable.h | 2
arch/openrisc/include/asm/pgalloc.h | 2
arch/openrisc/include/asm/pgtable.h | 5
arch/parisc/include/asm/pgalloc.h | 2
arch/parisc/include/asm/pgtable.h | 2
arch/powerpc/include/asm/pgalloc.h | 2
arch/powerpc/include/asm/pgtable.h | 1
arch/powerpc/mm/book3s64/hash_utils.c | 2
arch/powerpc/mm/book3s64/iommu_api.c | 7
arch/powerpc/mm/hugetlbpage.c | 2
arch/riscv/Kconfig | 12
arch/riscv/include/asm/pgalloc.h | 4
arch/riscv/include/asm/pgtable.h | 5
arch/s390/include/asm/pgtable.h | 6
arch/sh/include/asm/pgalloc.h | 56 ---
arch/sh/include/asm/pgtable.h | 5
arch/sh/mm/Kconfig | 3
arch/sh/mm/nommu.c | 4
arch/sparc/include/asm/pgalloc_32.h | 2
arch/sparc/include/asm/pgalloc_64.h | 2
arch/sparc/include/asm/pgtable_32.h | 5
arch/sparc/include/asm/pgtable_64.h | 1
arch/sparc/mm/init_32.c | 1
arch/um/include/asm/pgalloc.h | 2
arch/um/include/asm/pgtable.h | 2
arch/unicore32/include/asm/pgalloc.h | 2
arch/unicore32/include/asm/pgtable.h | 2
arch/x86/include/asm/pgtable_32.h | 2
arch/x86/include/asm/pgtable_64.h | 3
arch/x86/mm/pgtable.c | 6
arch/xtensa/include/asm/pgtable.h | 1
arch/xtensa/include/asm/tlbflush.h | 3
drivers/base/memory.c | 44 +-
drivers/base/node.c | 55 +--
drivers/crypto/chelsio/chtls/chtls_io.c | 5
drivers/gpu/drm/via/via_dmablit.c | 10
drivers/infiniband/core/umem.c | 5
drivers/infiniband/hw/hfi1/user_pages.c | 5
drivers/infiniband/hw/qib/qib_user_pages.c | 5
drivers/infiniband/hw/usnic/usnic_uiom.c | 5
drivers/infiniband/sw/siw/siw_mem.c | 10
drivers/staging/android/ion/ion_system_heap.c | 4
drivers/target/tcm_fc/tfc_io.c | 3
drivers/vfio/vfio_iommu_spapr_tce.c | 8
fs/binfmt_elf.c | 20 -
fs/fat/dir.c | 13
fs/fat/fatent.c | 3
fs/inode.c | 3
fs/io_uring.c | 2
fs/jbd2/journal.c | 2
fs/jbd2/transaction.c | 12
fs/ocfs2/alloc.c | 20 +
fs/ocfs2/aops.c | 13
fs/ocfs2/blockcheck.c | 26 -
fs/ocfs2/cluster/heartbeat.c | 109 +------
fs/ocfs2/dir.c | 3
fs/ocfs2/dlm/dlmcommon.h | 1
fs/ocfs2/dlm/dlmdebug.c | 55 ---
fs/ocfs2/dlm/dlmdebug.h | 16 -
fs/ocfs2/dlm/dlmdomain.c | 7
fs/ocfs2/dlm/dlmunlock.c | 23 +
fs/ocfs2/dlmglue.c | 29 -
fs/ocfs2/extent_map.c | 3
fs/ocfs2/file.c | 13
fs/ocfs2/inode.c | 2
fs/ocfs2/journal.h | 42 --
fs/ocfs2/namei.c | 2
fs/ocfs2/ocfs2.h | 3
fs/ocfs2/super.c | 10
fs/open.c | 8
fs/proc/meminfo.c | 8
fs/proc/task_mmu.c | 6
include/asm-generic/pgalloc.h | 5
include/asm-generic/pgtable.h | 7
include/linux/compaction.h | 22 +
include/linux/fs.h | 32 ++
include/linux/huge_mm.h | 9
include/linux/hugetlb.h | 2
include/linux/jbd2.h | 2
include/linux/khugepaged.h | 12
include/linux/memcontrol.h | 23 -
include/linux/memory.h | 7
include/linux/memory_hotplug.h | 1
include/linux/mm.h | 37 ++
include/linux/mm_types.h | 1
include/linux/mmzone.h | 14
include/linux/page_ext.h | 1
include/linux/pagemap.h | 10
include/linux/quicklist.h | 94 ------
include/linux/shrinker.h | 7
include/linux/slab.h | 62 ----
include/linux/vmalloc.h | 20 -
include/linux/zpool.h | 3
init/main.c | 6
kernel/events/uprobes.c | 81 ++++-
kernel/resource.c | 4
kernel/sched/idle.c | 1
kernel/sysctl.c | 6
lib/Kconfig.debug | 15
lib/Kconfig.kasan | 8
lib/iov_iter.c | 2
lib/show_mem.c | 5
lib/test_kasan.c | 41 ++
mm/Kconfig | 16 -
mm/Kconfig.debug | 4
mm/Makefile | 4
mm/compaction.c | 50 +--
mm/filemap.c | 168 ++++------
mm/gup.c | 125 +++-----
mm/huge_memory.c | 129 ++++++--
mm/hugetlb.c | 89 +++++
mm/hugetlb_cgroup.c | 2
mm/init-mm.c | 2
mm/kasan/common.c | 32 +-
mm/kasan/kasan.h | 14
mm/kasan/report.c | 44 ++
mm/kasan/tags_report.c | 24 +
mm/khugepaged.c | 372 ++++++++++++++++++++----
mm/kmemleak.c | 338 +++++----------------
mm/ksm.c | 18 -
mm/madvise.c | 52 +--
mm/memcontrol.c | 188 ++++++++++--
mm/memfd.c | 2
mm/memory.c | 21 +
mm/memory_hotplug.c | 120 ++++---
mm/mempolicy.c | 4
mm/memremap.c | 5
mm/migrate.c | 13
mm/mmap.c | 12
mm/mmu_gather.c | 2
mm/nommu.c | 2
mm/oom_kill.c | 30 +
mm/page_alloc.c | 27 +
mm/page_owner.c | 127 +++++---
mm/page_poison.c | 2
mm/page_vma_mapped.c | 3
mm/quicklist.c | 103 ------
mm/rmap.c | 25 -
mm/shmem.c | 12
mm/slab.h | 64 ++++
mm/slab_common.c | 37 ++
mm/slob.c | 2
mm/slub.c | 22 -
mm/sparse.c | 25 +
mm/swap.c | 16 -
mm/swap_state.c | 6
mm/util.c | 126 +++++++-
mm/vmalloc.c | 84 +++--
mm/vmscan.c | 163 ++++------
mm/vmstat.c | 2
mm/z3fold.c | 154 ++-------
mm/zpool.c | 16 +
mm/zsmalloc.c | 23 -
mm/zswap.c | 15
net/xdp/xdp_umem.c | 9
net/xdp/xsk.c | 2
usr/Makefile | 3
206 files changed, 2385 insertions(+), 2533 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2019-09-23 22:31 incoming Andrew Morton
@ 2019-09-24 0:55 ` Linus Torvalds
2019-09-24 4:31 ` incoming Andrew Morton
0 siblings, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2019-09-24 0:55 UTC (permalink / raw)
To: Andrew Morton, David Rientjes, Vlastimil Babka, Michal Hocko,
Andrea Arcangeli
Cc: mm-commits, Linux-MM
On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> - almost all of -mm, as below.
I was hoping that we could at least test the THP locality thing? Is it
in your queue at all, or am I supposed to just do it myself?
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2019-09-24 0:55 ` incoming Linus Torvalds
@ 2019-09-24 4:31 ` Andrew Morton
2019-09-24 7:48 ` incoming Michal Hocko
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2019-09-24 4:31 UTC (permalink / raw)
To: Linus Torvalds
Cc: David Rientjes, Vlastimil Babka, Michal Hocko, Andrea Arcangeli,
mm-commits, Linux-MM
On Mon, 23 Sep 2019 17:55:24 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > - almost all of -mm, as below.
>
> I was hoping that we could at least test the THP locality thing? Is it
> in your queue at all, or am I supposed to just do it myself?
>
Confused. I saw a privately emailed patch from David which nobody
seems to have tested yet. I parked that for consideration after -rc1.
Or are you referring to something else?
This thing keeps stalling. It would be nice to push this along and get
something nailed down which we can at least get into 5.4-rc, perhaps
with a backport-this tag?
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2019-09-24 4:31 ` incoming Andrew Morton
@ 2019-09-24 7:48 ` Michal Hocko
2019-09-24 15:34 ` incoming Linus Torvalds
2019-09-24 19:55 ` incoming Vlastimil Babka
0 siblings, 2 replies; 348+ messages in thread
From: Michal Hocko @ 2019-09-24 7:48 UTC (permalink / raw)
To: Andrew Morton
Cc: Linus Torvalds, David Rientjes, Vlastimil Babka, Andrea Arcangeli,
mm-commits, Linux-MM
On Mon 23-09-19 21:31:53, Andrew Morton wrote:
> On Mon, 23 Sep 2019 17:55:24 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
>
> > On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> > >
> > > - almost all of -mm, as below.
> >
> > I was hoping that we could at least test the THP locality thing? Is it
> > in your queue at all, or am I supposed to just do it myself?
> >
>
> Confused. I saw a privately emailed patch from David which nobody
> seems to have tested yet. I parked that for consideration after -rc1.
> Or are you referring to something else?
>
> This thing keeps stalling. It would be nice to push this along and get
> something nailed down which we can at least get into 5.4-rc, perhaps
> with a backport-this tag?
The patch proposed by David is really non trivial wrt. potential side
effects. I have provided my review feedback [1] and it didn't get
any reaction. I really believe that we need to debug this properly. A
reproducer would be useful for others to work on that.
There is a more fundamental problem here and we need to address it
rather than to duck tape it and whack a mole afterwards.
[1] http://lkml.kernel.org/r/20190909193020.GD2063@dhcp22.suse.cz
--
Michal Hocko
SUSE Labs
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2019-09-24 7:48 ` incoming Michal Hocko
@ 2019-09-24 15:34 ` Linus Torvalds
2019-09-25 6:36 ` incoming Michal Hocko
2019-09-24 19:55 ` incoming Vlastimil Babka
1 sibling, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2019-09-24 15:34 UTC (permalink / raw)
To: Michal Hocko
Cc: Andrew Morton, David Rientjes, Vlastimil Babka, Andrea Arcangeli,
mm-commits, Linux-MM
On Tue, Sep 24, 2019 at 12:48 AM Michal Hocko <mhocko@kernel.org> wrote:
>
> The patch proposed by David is really non trivial wrt. potential side
> effects.
The thing is, that's not an argument when we know that the current
state is garbage and has a lot of these non-trivial side effects that
are bad.
So the patch by David _fixes_ a non-trivial bad side effect.
You can't then say "there may be other non-trivial side effects that I
don't even know about" as an argument for saying it's bad. David at
least has numbers and an argument for his patch.
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2019-09-24 7:48 ` incoming Michal Hocko
2019-09-24 15:34 ` incoming Linus Torvalds
@ 2019-09-24 19:55 ` Vlastimil Babka
1 sibling, 0 replies; 348+ messages in thread
From: Vlastimil Babka @ 2019-09-24 19:55 UTC (permalink / raw)
To: Michal Hocko, Andrew Morton
Cc: Linus Torvalds, David Rientjes, Andrea Arcangeli, mm-commits,
Linux-MM
On 9/24/19 9:48 AM, Michal Hocko wrote:
> On Mon 23-09-19 21:31:53, Andrew Morton wrote:
>> On Mon, 23 Sep 2019 17:55:24 -0700 Linus Torvalds
>> <torvalds@linux-foundation.org> wrote:
>>
>>> On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton
>>> <akpm@linux-foundation.org> wrote:
>>>>
>>>> - almost all of -mm, as below.
>>>
>>> I was hoping that we could at least test the THP locality thing?
>>> Is it in your queue at all, or am I supposed to just do it
>>> myself?
>>>
>>
>> Confused. I saw a privately emailed patch from David which nobody
>> seems to have tested yet. I parked that for consideration after
>> -rc1. Or are you referring to something else?
>>
>> This thing keeps stalling. It would be nice to push this along and
>> get something nailed down which we can at least get into 5.4-rc,
>> perhaps with a backport-this tag?
>
> The patch proposed by David is really non trivial wrt. potential
> side effects. I have provided my review feedback [1] and it didn't
> get any reaction. I really believe that we need to debug this
> properly. A reproducer would be useful for others to work on that.
>
> There is a more fundamental problem here and we need to address it
> rather than to duck tape it and whack a mole afterwards.
I believe we found a problem when investigating over-reclaim in this
thread [1] where it seems madvised THP allocation attempt can result in
4MB reclaimed, if there is a small zone such as ZONE_DMA on the node. As
it happens, the patch "[patch 090/134] mm, reclaim: make
should_continue_reclaim perform dryrun detection" in Andrew's pile
should change this 4MB to 32 pages reclaimed (as a side-effect), but
that has to be tested. I'm also working on a patch to not reclaim even
those few pages. Of course there might be more fundamental issues with
reclaim/compaction interaction, but this one seems to become hopefully
clear now.
[1]
https://lore.kernel.org/linux-mm/4b4ba042-3741-7b16-2292-198c569da2aa@profihost.ag/
> [1] http://lkml.kernel.org/r/20190909193020.GD2063@dhcp22.suse.cz
>
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2019-09-24 15:34 ` incoming Linus Torvalds
@ 2019-09-25 6:36 ` Michal Hocko
0 siblings, 0 replies; 348+ messages in thread
From: Michal Hocko @ 2019-09-25 6:36 UTC (permalink / raw)
To: Linus Torvalds
Cc: Andrew Morton, David Rientjes, Vlastimil Babka, Andrea Arcangeli,
mm-commits, Linux-MM
On Tue 24-09-19 08:34:20, Linus Torvalds wrote:
> On Tue, Sep 24, 2019 at 12:48 AM Michal Hocko <mhocko@kernel.org> wrote:
> >
> > The patch proposed by David is really non trivial wrt. potential side
> > effects.
>
> The thing is, that's not an argument when we know that the current
> state is garbage and has a lot of these non-trivial side effects that
> are bad.
>
> So the patch by David _fixes_ a non-trivial bad side effect.
>
> You can't then say "there may be other non-trivial side effects that I
> don't even know about" as an argument for saying it's bad. David at
> least has numbers and an argument for his patch.
All I am saying is that I am not able to wrap my head around this patch
to provide a competent Ack. I also believe that the fix is targetting a
wrong layer of the problem as explained in my review feedback. Appart
from reclaim/compaction interaction mentioned by Vlastimil, it seems
that it is an overly eager fallback to a remote node in the fast path
that is causing a large part of the problem as well. Kcompactd is not
eager enough to keep high order allocations ready for the fast path.
This is not specific to THP we have many other high order allocations
which are going to follow the same pattern, likely not visible in any
counters but still having performance implications.
Let's discuss technical details in the respective email thread
--
Michal Hocko
SUSE Labs
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2019-09-25 23:45 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2019-09-25 23:45 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- almost all of the rest of -mm
- various other subsystems
76 patches, based on 351c8a09b00b5c51c8f58b016fffe51f87e2d820:
Subsystems affected by this patch series:
memcg
misc
core-kernel
lib
checkpatch
reiserfs
fat
fork
cpumask
kexec
uaccess
kconfig
kgdb
bug
ipc
lzo
kasan
madvise
cleanups
pagemap
Subsystem: memcg
Michal Hocko <mhocko@suse.com>:
memcg, kmem: do not fail __GFP_NOFAIL charges
Subsystem: misc
Masahiro Yamada <yamada.masahiro@socionext.com>:
linux/coff.h: add include guard
Subsystem: core-kernel
Valdis Kletnieks <valdis.kletnieks@vt.edu>:
kernel/elfcore.c: include proper prototypes
Subsystem: lib
Michel Lespinasse <walken@google.com>:
rbtree: avoid generating code twice for the cached versions (tools copy)
Patch series "make RB_DECLARE_CALLBACKS more generic", v3:
augmented rbtree: add comments for RB_DECLARE_CALLBACKS macro
augmented rbtree: add new RB_DECLARE_CALLBACKS_MAX macro
augmented rbtree: rework the RB_DECLARE_CALLBACKS macro definition
Joe Perches <joe@perches.com>:
kernel-doc: core-api: include string.h into core-api
Qian Cai <cai@lca.pw>:
include/trace/events/writeback.h: fix -Wstringop-truncation warnings
Kees Cook <keescook@chromium.org>:
strscpy: reject buffer sizes larger than INT_MAX
Valdis Kletnieks <valdis.kletnieks@vt.edu>:
lib/generic-radix-tree.c: make 2 functions static inline
lib/extable.c: add missing prototypes
Stephen Boyd <swboyd@chromium.org>:
lib/hexdump: make print_hex_dump_bytes() a nop on !DEBUG builds
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: don't interpret stack dumps as commit IDs
checkpatch: improve SPDX license checking
Matteo Croce <mcroce@redhat.com>:
checkpatch.pl: warn on invalid commit id
Brendan Jackman <brendan.jackman@bluwireless.co.uk>:
checkpatch: exclude sizeof sub-expressions from MACRO_ARG_REUSE
Joe Perches <joe@perches.com>:
checkpatch: prefer __section over __attribute__((section(...)))
checkpatch: allow consecutive close braces
Sean Christopherson <sean.j.christopherson@intel.com>:
checkpatch: remove obsolete period from "ambiguous SHA1" query
Joe Perches <joe@perches.com>:
checkpatch: make git output use LANGUAGE=en_US.utf8
Subsystem: reiserfs
Jia-Ju Bai <baijiaju1990@gmail.com>:
fs: reiserfs: remove unnecessary check of bh in remove_from_transaction()
zhengbin <zhengbin13@huawei.com>:
fs/reiserfs/journal.c: remove set but not used variables
fs/reiserfs/stree.c: remove set but not used variables
fs/reiserfs/lbalance.c: remove set but not used variables
fs/reiserfs/objectid.c: remove set but not used variables
fs/reiserfs/prints.c: remove set but not used variables
fs/reiserfs/fix_node.c: remove set but not used variables
fs/reiserfs/do_balan.c: remove set but not used variables
Jason Yan <yanaijie@huawei.com>:
fs/reiserfs/journal.c: remove set but not used variable
fs/reiserfs/do_balan.c: remove set but not used variable
Subsystem: fat
Markus Elfring <elfring@users.sourceforge.net>:
fat: delete an unnecessary check before brelse()
Subsystem: fork
Sai Praneeth Prakhya <sai.praneeth.prakhya@intel.com>:
fork: improve error message for corrupted page tables
Subsystem: cpumask
Alexey Dobriyan <adobriyan@gmail.com>:
cpumask: nicer for_each_cpumask_and() signature
Subsystem: kexec
Tetsuo Handa <penguin-kernel@I-love.SAKURA.ne.jp>:
kexec: bail out upon SIGKILL when allocating memory.
Vasily Gorbik <gor@linux.ibm.com>:
kexec: restore arch_kexec_kernel_image_probe declaration
Subsystem: uaccess
Kees Cook <keescook@chromium.org>:
uaccess: add missing __must_check attributes
Subsystem: kconfig
Masahiro Yamada <yamada.masahiro@socionext.com>:
compiler: enable CONFIG_OPTIMIZE_INLINING forcibly
Subsystem: kgdb
Douglas Anderson <dianders@chromium.org>:
kgdb: don't use a notifier to enter kgdb at panic; call directly
scripts/gdb: handle split debug
Subsystem: bug
Kees Cook <keescook@chromium.org>:
Patch series "Clean up WARN() "cut here" handling", v2:
bug: refactor away warn_slowpath_fmt_taint()
bug: rename __WARN_printf_taint() to __WARN_printf()
bug: consolidate warn_slowpath_fmt() usage
bug: lift "cut here" out of __warn()
bug: clean up helper macros to remove __WARN_TAINT()
bug: consolidate __WARN_FLAGS usage
bug: move WARN_ON() "cut here" into exception handler
Subsystem: ipc
Markus Elfring <elfring@users.sourceforge.net>:
ipc/mqueue.c: delete an unnecessary check before the macro call dev_kfree_skb()
ipc/mqueue: improve exception handling in do_mq_notify()
"Joel Fernandes (Google)" <joel@joelfernandes.org>:
ipc/sem.c: convert to use built-in RCU list checking
Subsystem: lzo
Dave Rodgman <dave.rodgman@arm.com>:
lib/lzo/lzo1x_compress.c: fix alignment bug in lzo-rle
Subsystem: kasan
Andrey Konovalov <andreyknvl@google.com>:
Patch series "arm64: untag user pointers passed to the kernel", v19:
lib: untag user pointers in strn*_user
mm: untag user pointers passed to memory syscalls
mm: untag user pointers in mm/gup.c
mm: untag user pointers in get_vaddr_frames
fs/namespace: untag user pointers in copy_mount_options
userfaultfd: untag user pointers
drm/amdgpu: untag user pointers
drm/radeon: untag user pointers in radeon_gem_userptr_ioctl
media/v4l2-core: untag user pointers in videobuf_dma_contig_user_get
tee/shm: untag user pointers in tee_shm_register
vfio/type1: untag user pointers in vaddr_get_pfn
Catalin Marinas <catalin.marinas@arm.com>:
mm: untag user pointers in mmap/munmap/mremap/brk
Subsystem: madvise
Minchan Kim <minchan@kernel.org>:
Patch series "Introduce MADV_COLD and MADV_PAGEOUT", v7:
mm: introduce MADV_COLD
mm: change PAGEREF_RECLAIM_CLEAN with PAGE_REFRECLAIM
mm: introduce MADV_PAGEOUT
mm: factor out common parts between MADV_COLD and MADV_PAGEOUT
Subsystem: cleanups
Mike Rapoport <rppt@linux.ibm.com>:
hexagon: drop empty and unused free_initrd_mem
Denis Efremov <efremov@linux.com>:
checkpatch: check for nested (un)?likely() calls
xen/events: remove unlikely() from WARN() condition
fs: remove unlikely() from WARN_ON() condition
wimax/i2400m: remove unlikely() from WARN*() condition
xfs: remove unlikely() from WARN_ON() condition
IB/hfi1: remove unlikely() from IS_ERR*() condition
ntfs: remove (un)?likely() from IS_ERR() conditions
Subsystem: pagemap
Mark Rutland <mark.rutland@arm.com>:
mm: treewide: clarify pgtable_page_{ctor,dtor}() naming
Documentation/core-api/kernel-api.rst | 3
Documentation/vm/split_page_table_lock.rst | 10
arch/alpha/include/uapi/asm/mman.h | 3
arch/arc/include/asm/pgalloc.h | 4
arch/arm/include/asm/tlb.h | 2
arch/arm/mm/mmu.c | 2
arch/arm64/include/asm/tlb.h | 2
arch/arm64/mm/mmu.c | 2
arch/csky/include/asm/pgalloc.h | 2
arch/hexagon/include/asm/pgalloc.h | 2
arch/hexagon/mm/init.c | 13
arch/m68k/include/asm/mcf_pgalloc.h | 6
arch/m68k/include/asm/motorola_pgalloc.h | 6
arch/m68k/include/asm/sun3_pgalloc.h | 2
arch/mips/include/asm/pgalloc.h | 2
arch/mips/include/uapi/asm/mman.h | 3
arch/nios2/include/asm/pgalloc.h | 2
arch/openrisc/include/asm/pgalloc.h | 6
arch/parisc/include/uapi/asm/mman.h | 3
arch/powerpc/mm/pgtable-frag.c | 6
arch/riscv/include/asm/pgalloc.h | 2
arch/s390/mm/pgalloc.c | 6
arch/sh/include/asm/pgalloc.h | 2
arch/sparc/include/asm/pgtable_64.h | 5
arch/sparc/mm/init_64.c | 4
arch/sparc/mm/srmmu.c | 4
arch/um/include/asm/pgalloc.h | 2
arch/unicore32/include/asm/tlb.h | 2
arch/x86/mm/pat_rbtree.c | 19
arch/x86/mm/pgtable.c | 2
arch/xtensa/include/asm/pgalloc.h | 4
arch/xtensa/include/uapi/asm/mman.h | 3
drivers/block/drbd/drbd_interval.c | 29 -
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gpuvm.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_gem.c | 2
drivers/gpu/drm/radeon/radeon_gem.c | 2
drivers/infiniband/hw/hfi1/verbs.c | 2
drivers/media/v4l2-core/videobuf-dma-contig.c | 9
drivers/net/wimax/i2400m/tx.c | 3
drivers/tee/tee_shm.c | 1
drivers/vfio/vfio_iommu_type1.c | 2
drivers/xen/events/events_base.c | 2
fs/fat/dir.c | 4
fs/namespace.c | 2
fs/ntfs/mft.c | 12
fs/ntfs/namei.c | 2
fs/ntfs/runlist.c | 2
fs/ntfs/super.c | 2
fs/open.c | 2
fs/reiserfs/do_balan.c | 15
fs/reiserfs/fix_node.c | 6
fs/reiserfs/journal.c | 22
fs/reiserfs/lbalance.c | 3
fs/reiserfs/objectid.c | 3
fs/reiserfs/prints.c | 3
fs/reiserfs/stree.c | 4
fs/userfaultfd.c | 22
fs/xfs/xfs_buf.c | 4
include/asm-generic/bug.h | 71 +-
include/asm-generic/pgalloc.h | 8
include/linux/cpumask.h | 14
include/linux/interval_tree_generic.h | 22
include/linux/kexec.h | 2
include/linux/kgdb.h | 2
include/linux/mm.h | 4
include/linux/mm_types_task.h | 4
include/linux/printk.h | 22
include/linux/rbtree_augmented.h | 114 +++-
include/linux/string.h | 5
include/linux/swap.h | 2
include/linux/thread_info.h | 2
include/linux/uaccess.h | 21
include/trace/events/writeback.h | 38 -
include/uapi/asm-generic/mman-common.h | 3
include/uapi/linux/coff.h | 5
ipc/mqueue.c | 22
ipc/sem.c | 3
kernel/debug/debug_core.c | 31 -
kernel/elfcore.c | 1
kernel/fork.c | 16
kernel/kexec_core.c | 2
kernel/panic.c | 48 -
lib/Kconfig.debug | 4
lib/bug.c | 11
lib/extable.c | 1
lib/generic-radix-tree.c | 4
lib/hexdump.c | 21
lib/lzo/lzo1x_compress.c | 14
lib/rbtree_test.c | 37 -
lib/string.c | 12
lib/strncpy_from_user.c | 3
lib/strnlen_user.c | 3
mm/frame_vector.c | 2
mm/gup.c | 4
mm/internal.h | 2
mm/madvise.c | 562 ++++++++++++++++-------
mm/memcontrol.c | 10
mm/mempolicy.c | 3
mm/migrate.c | 2
mm/mincore.c | 2
mm/mlock.c | 4
mm/mmap.c | 34 -
mm/mprotect.c | 2
mm/mremap.c | 13
mm/msync.c | 2
mm/oom_kill.c | 2
mm/swap.c | 42 +
mm/vmalloc.c | 5
mm/vmscan.c | 62 ++
scripts/checkpatch.pl | 69 ++
scripts/gdb/linux/symbols.py | 4
tools/include/linux/rbtree.h | 71 +-
tools/include/linux/rbtree_augmented.h | 145 +++--
tools/lib/rbtree.c | 37 -
114 files changed, 1195 insertions(+), 754 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2019-10-07 0:57 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2019-10-07 0:57 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
The usual shower of hotfixes.
Chris's memcg patches aren't actually fixes - they're mature but a few
niggling review issues were late to arrive.
The ocfs2 fixes are quite old - those took some time to get
reviewer attention.
18 patches, based on 4ea655343ce4180fe9b2c7ec8cb8ef9884a47901.
Subsystems affected by this patch series:
ocfs2
hotfixes
mm/memcg
mm/slab-generic
Subsystem: ocfs2
Jia Guo <guojia12@huawei.com>:
ocfs2: clear zero in unaligned direct IO
Jia-Ju Bai <baijiaju1990@gmail.com>:
fs: ocfs2: fix possible null-pointer dereferences in ocfs2_xa_prepare_entry()
fs: ocfs2: fix a possible null-pointer dereference in ocfs2_write_end_nolock()
fs: ocfs2: fix a possible null-pointer dereference in ocfs2_info_scan_inode_alloc()
Subsystem: hotfixes
Will Deacon <will@kernel.org>:
panic: ensure preemption is disabled during panic()
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/memremap: drop unused SECTION_SIZE and SECTION_MASK
Tejun Heo <tj@kernel.org>:
writeback: fix use-after-free in finish_writeback_work()
Yi Wang <wang.yi59@zte.com.cn>:
mm: fix -Wmissing-prototypes warnings
Baoquan He <bhe@redhat.com>:
memcg: only record foreign writebacks with dirty pages when memcg is not disabled
Michal Hocko <mhocko@suse.com>:
kernel/sysctl.c: do not override max_threads provided by userspace
Vitaly Wool <vitalywool@gmail.com>:
mm/z3fold.c: claim page in the beginning of free
Qian Cai <cai@lca.pw>:
mm/page_alloc.c: fix a crash in free_pages_prepare()
Dan Carpenter <dan.carpenter@oracle.com>:
mm/vmpressure.c: fix a signedness bug in vmpressure_register_event()
Subsystem: mm/memcg
Chris Down <chris@chrisdown.name>:
mm, memcg: proportional memory.{low,min} reclaim
mm, memcg: make memory.emin the baseline for utilisation determination
mm, memcg: make scan aggression always exclude protection
Subsystem: mm/slab-generic
Vlastimil Babka <vbabka@suse.cz>:
Patch series "guarantee natural alignment for kmalloc()", v2:
mm, sl[ou]b: improve memory accounting
mm, sl[aou]b: guarantee natural alignment for kmalloc(power-of-two)
Documentation/admin-guide/cgroup-v2.rst | 20 +-
Documentation/core-api/memory-allocation.rst | 4
fs/fs-writeback.c | 9 -
fs/ocfs2/aops.c | 25 +++
fs/ocfs2/ioctl.c | 2
fs/ocfs2/xattr.c | 56 +++----
include/linux/memcontrol.h | 67 ++++++---
include/linux/slab.h | 4
kernel/fork.c | 4
kernel/panic.c | 1
mm/memcontrol.c | 5
mm/memremap.c | 2
mm/page_alloc.c | 8 -
mm/shuffle.c | 2
mm/slab_common.c | 19 ++
mm/slob.c | 62 ++++++--
mm/slub.c | 14 +
mm/sparse.c | 2
mm/vmpressure.c | 20 +-
mm/vmscan.c | 198 +++++++++++++++++----------
mm/z3fold.c | 10 +
21 files changed, 363 insertions(+), 171 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2019-10-14 21:11 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2019-10-14 21:11 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
The usual shower of hotfixes and some followups to the recently merged
page_owner enhancements.
16 patches, based on 2abd839aa7e615f2bbc50c8ba7deb9e40d186768.
Subsystems affected by this patch series:
Vlastimil Babka <vbabka@suse.cz>:
Patch series "followups to debug_pagealloc improvements through page_owner", v3:
mm, page_owner: fix off-by-one error in __set_page_owner_handle()
mm, page_owner: decouple freeing stack trace from debug_pagealloc
mm, page_owner: rename flag indicating that page is allocated
Qian Cai <cai@lca.pw>:
mm/slub: fix a deadlock in show_slab_objects()
Eric Biggers <ebiggers@google.com>:
lib/generic-radix-tree.c: add kmemleak annotations
Alexander Potapenko <glider@google.com>:
mm/slub.c: init_on_free=1 should wipe freelist ptr for bulk allocations
lib/test_meminit: add a kmem_cache_alloc_bulk() test
David Rientjes <rientjes@google.com>:
mm, hugetlb: allow hugepage allocations to reclaim as needed
Vlastimil Babka <vbabka@suse.cz>:
mm, compaction: fix wrong pfn handling in __reset_isolation_pfn()
Randy Dunlap <rdunlap@infradead.org>:
fs/direct-io.c: fix kernel-doc warning
fs/libfs.c: fix kernel-doc warning
fs/fs-writeback.c: fix kernel-doc warning
bitmap.h: fix kernel-doc warning and typo
xarray.h: fix kernel-doc warning
mm/slab.c: fix kernel-doc warning for __ksize()
Jane Chu <jane.chu@oracle.com>:
mm/memory-failure: poison read receives SIGKILL instead of SIGBUS if mmaped more than once
Documentation/dev-tools/kasan.rst | 3 ++
fs/direct-io.c | 3 --
fs/fs-writeback.c | 2 -
fs/libfs.c | 3 --
include/linux/bitmap.h | 3 +-
include/linux/page_ext.h | 10 ++++++
include/linux/xarray.h | 4 +-
lib/generic-radix-tree.c | 32 +++++++++++++++++-----
lib/test_meminit.c | 27 ++++++++++++++++++
mm/compaction.c | 7 ++--
mm/memory-failure.c | 22 ++++++++-------
mm/page_alloc.c | 6 ++--
mm/page_ext.c | 23 ++++++---------
mm/page_owner.c | 55 +++++++++++++-------------------------
mm/slab.c | 3 ++
mm/slub.c | 35 ++++++++++++++++++------
16 files changed, 152 insertions(+), 86 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2019-10-19 3:19 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2019-10-19 3:19 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
Rather a lot of fixes, almost all affecting mm/.
26 patches, based on b9959c7a347d6adbb558fba7e36e9fef3cba3b07:
David Hildenbrand <david@redhat.com>:
drivers/base/memory.c: don't access uninitialized memmaps in soft_offline_page_store()
fs/proc/page.c: don't access uninitialized memmaps in fs/proc/page.c
mm/memory-failure.c: don't access uninitialized memmaps in memory_failure()
Joel Colledge <joel.colledge@linbit.com>:
scripts/gdb: fix lx-dmesg when CONFIG_PRINTK_CALLER is set
Qian Cai <cai@lca.pw>:
mm/page_owner: don't access uninitialized memmaps when reading /proc/pagetypeinfo
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: don't access uninitialized memmaps in shrink_pgdat_span()
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "mm/memory_hotplug: Shrink zones before removing memory", v6:
mm/memunmap: don't access uninitialized memmap in memunmap_pages()
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: fix panic in __free_slab() caused by premature memcg pointer release
Chengguang Xu <cgxu519@mykernel.net>:
ocfs2: fix error handling in ocfs2_setattr()
John Hubbard <jhubbard@nvidia.com>:
mm/gup_benchmark: add a missing "w" to getopt string
mm/gup: fix a misnamed "write" argument, and a related bug
Honglei Wang <honglei.wang@oracle.com>:
mm: memcg: get number of pages on the LRU list in memcgroup base on lru_zone_size
Mike Rapoport <rppt@linux.ibm.com>:
mm: memblock: do not enforce current limit for memblock_phys* family
David Hildenbrand <david@redhat.com>:
hugetlbfs: don't access uninitialized memmaps in pfn_range_valid_gigantic()
Yi Li <yilikernel@gmail.com>:
ocfs2: fix panic due to ocfs2_wq is null
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
mm/memcontrol: update lruvec counters in mem_cgroup_move_account
Chenwandun <chenwandun@huawei.com>:
zram: fix race between backing_dev_show and backing_dev_store
Ben Dooks <ben.dooks@codethink.co.uk>:
mm: include <linux/huge_mm.h> for is_vma_temporary_stack
mm/filemap.c: include <linux/ramfs.h> for generic_file_vm_ops definition
"Ben Dooks (Codethink)" <ben.dooks@codethink.co.uk>:
mm/init-mm.c: include <linux/mman.h> for vm_committed_as_batch
"Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
Patch series "Fixes for THP in page cache", v2:
proc/meminfo: fix output alignment
mm/thp: fix node page state in split_huge_page_to_list()
William Kucharski <william.kucharski@oracle.com>:
mm/vmscan.c: support removing arbitrary sized pages from mapping
"Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
mm/thp: allow dropping THP from page cache
Song Liu <songliubraving@fb.com>:
kernel/events/uprobes.c: only do FOLL_SPLIT_PMD for uprobe register
Ilya Leoshkevich <iii@linux.ibm.com>:
scripts/gdb: fix debugging modules on s390
drivers/base/memory.c | 3 +
drivers/block/zram/zram_drv.c | 5 +
fs/ocfs2/file.c | 2
fs/ocfs2/journal.c | 3 -
fs/ocfs2/localalloc.c | 3 -
fs/proc/meminfo.c | 4 -
fs/proc/page.c | 28 ++++++----
kernel/events/uprobes.c | 13 ++++-
mm/filemap.c | 1
mm/gup.c | 14 +++--
mm/huge_memory.c | 9 ++-
mm/hugetlb.c | 5 -
mm/init-mm.c | 1
mm/memblock.c | 6 +-
mm/memcontrol.c | 18 ++++---
mm/memory-failure.c | 14 +++--
mm/memory_hotplug.c | 74 ++++++-----------------------
mm/memremap.c | 11 ++--
mm/page_owner.c | 5 +
mm/rmap.c | 1
mm/slab_common.c | 9 +--
mm/truncate.c | 12 ++++
mm/vmscan.c | 14 ++---
scripts/gdb/linux/dmesg.py | 16 ++++--
scripts/gdb/linux/symbols.py | 8 ++-
scripts/gdb/linux/utils.py | 25 +++++----
tools/testing/selftests/vm/gup_benchmark.c | 2
27 files changed, 166 insertions(+), 140 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2019-11-06 5:16 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2019-11-06 5:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
17 fixes, based on 26bc672134241a080a83b2ab9aa8abede8d30e1c:
Shakeel Butt <shakeelb@google.com>:
mm: memcontrol: fix NULL-ptr deref in percpu stats flush
John Hubbard <jhubbard@nvidia.com>:
mm/gup_benchmark: fix MAP_HUGETLB case
Mel Gorman <mgorman@techsingularity.net>:
mm, meminit: recalculate pcpu batch and high limits after init completes
Yang Shi <yang.shi@linux.alibaba.com>:
mm: thp: handle page cache THP correctly in PageTransCompoundMap
Shuning Zhang <sunny.s.zhang@oracle.com>:
ocfs2: protect extent tree in ocfs2_prepare_inode_for_write()
Jason Gunthorpe <jgg@mellanox.com>:
mm/mmu_notifiers: use the right return code for WARN_ON
Michal Hocko <mhocko@suse.com>:
mm, vmstat: hide /proc/pagetypeinfo from normal users
mm, vmstat: reduce zone->lock holding time by /proc/pagetypeinfo
Ville Syrjälä <ville.syrjala@linux.intel.com>:
mm/khugepaged: fix might_sleep() warn with CONFIG_HIGHPTE=y
Johannes Weiner <hannes@cmpxchg.org>:
mm/page_alloc.c: ratelimit allocation failure warnings more aggressively
Vitaly Wool <vitaly.wool@konsulko.com>:
zswap: add Vitaly to the maintainers list
Kevin Hao <haokexin@gmail.com>:
dump_stack: avoid the livelock of the dump_lock
Song Liu <songliubraving@fb.com>:
MAINTAINERS: update information for "MEMORY MANAGEMENT"
Roman Gushchin <guro@fb.com>:
mm: slab: make page_cgroup_ino() to recognize non-compound slab pages properly
Ilya Leoshkevich <iii@linux.ibm.com>:
scripts/gdb: fix debugging modules compiled with hot/cold partitioning
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: fix updating the node span
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: fix network errors from failing __GFP_ATOMIC charges
MAINTAINERS | 5 +
fs/ocfs2/file.c | 125 ++++++++++++++++++++++-------
include/linux/mm.h | 5 -
include/linux/mm_types.h | 5 +
include/linux/page-flags.h | 20 ++++
lib/dump_stack.c | 7 +
mm/khugepaged.c | 7 -
mm/memcontrol.c | 23 +++--
mm/memory_hotplug.c | 8 +
mm/mmu_notifier.c | 2
mm/page_alloc.c | 17 ++-
mm/slab.h | 4
mm/vmstat.c | 25 ++++-
scripts/gdb/linux/symbols.py | 3
tools/testing/selftests/vm/gup_benchmark.c | 2
15 files changed, 197 insertions(+), 61 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2019-11-16 1:34 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2019-11-16 1:34 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
11 fixes, based on 875fef493f21e54d20d71a581687990aaa50268c:
Yang Shi <yang.shi@linux.alibaba.com>:
mm: mempolicy: fix the wrong return value and potential pages leak of mbind
zhong jiang <zhongjiang@huawei.com>:
mm: fix trying to reclaim unevictable lru page when calling madvise_pageout
Lasse Collin <lasse.collin@tukaani.org>:
lib/xz: fix XZ_DYNALLOC to avoid useless memory reallocations
Roman Gushchin <guro@fb.com>:
mm: memcg: switch to css_tryget() in get_mem_cgroup_from_mm()
mm: hugetlb: switch to css_tryget() in hugetlb_cgroup_charge_cgroup()
Laura Abbott <labbott@redhat.com>:
mm: slub: really fix slab walking for init_on_free
Song Liu <songliubraving@fb.com>:
mm,thp: recheck each page before collapsing file THP
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: fix try_offline_node()
Vinayak Menon <vinmenon@codeaurora.org>:
mm/page_io.c: do not free shared swap slots
Ralph Campbell <rcampbell@nvidia.com>:
mm/debug.c: __dump_page() prints an extra line
mm/debug.c: PageAnon() is true for PageKsm() pages
drivers/base/memory.c | 36 ++++++++++++++++++++++++++++++++++++
include/linux/memory.h | 1 +
lib/xz/xz_dec_lzma2.c | 1 +
mm/debug.c | 33 ++++++++++++++++++---------------
mm/hugetlb_cgroup.c | 2 +-
mm/khugepaged.c | 28 ++++++++++++++++------------
mm/madvise.c | 16 ++++++++++++----
mm/memcontrol.c | 2 +-
mm/memory_hotplug.c | 47 +++++++++++++++++++++++++++++------------------
mm/mempolicy.c | 14 +++++++++-----
mm/page_io.c | 6 +++---
mm/slub.c | 39 +++++++++------------------------------
12 files changed, 136 insertions(+), 89 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2019-11-22 1:53 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2019-11-22 1:53 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
4 fixes, based on 81429eb8d9ca40b0c65bb739d29fa856c5d5e958:
Vincent Whitchurch <vincent.whitchurch@axis.com>:
mm/sparse: consistently do not zero memmap
Joseph Qi <joseph.qi@linux.alibaba.com>:
Revert "fs: ocfs2: fix possible null-pointer dereferences in ocfs2_xa_prepare_entry()"
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: don't access uninitialized memmaps in shrink_zone_span()
Andrey Ryabinin <aryabinin@virtuozzo.com>:
mm/ksm.c: don't WARN if page is still mapped in remove_stable_node()
fs/ocfs2/xattr.c | 56 ++++++++++++++++++++++++++++++----------------------
mm/ksm.c | 14 ++++++-------
mm/memory_hotplug.c | 16 ++++++++++++--
mm/sparse.c | 2 -
4 files changed, 54 insertions(+), 34 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2019-12-01 1:47 Andrew Morton
2019-12-01 5:17 ` incoming James Bottomley
2019-12-01 21:07 ` incoming Linus Torvalds
0 siblings, 2 replies; 348+ messages in thread
From: Andrew Morton @ 2019-12-01 1:47 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- a small number of updates to scripts/, ocfs2 and fs/buffer.c
- most of MM. I still have quite a lot of material (mostly not MM)
staged after linux-next due to -next dependencies. I'll send thos
across next week as the preprequisites get merged up.
158 patches, based on 32ef9553635ab1236c33951a8bd9b5af1c3b1646.
Subsystems affected by this patch series:
scripts
ocfs2
vfs
mm/slab
mm/slub
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/memfd
mm/memory-failure
mm/memory-hotplug
mm/sparsemem
mm/vmalloc
mm/kasan
mm/pagealloc
mm/vmscan
mm/proc
mm/z3fold
mm/mempolicy
mm/memblock
mm/hugetlbfs
mm/hugetlb
mm/migration
mm/thp
mm/cma
mm/autonuma
mm/page-poison
mm/mmap
mm/madvise
mm/userfaultfd
mm/shmem
mm/cleanups
mm/support
Subsystem: scripts
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ocfs2
Ding Xiang <dingxiang@cmss.chinamobile.com>:
ocfs2: fix passing zero to 'PTR_ERR' warning
Subsystem: vfs
Saurav Girepunje <saurav.girepunje@gmail.com>:
fs/buffer.c: fix use true/false for bool type
Ben Dooks <ben.dooks@codethink.co.uk>:
fs/buffer.c: include internal.h for missing declarations
Subsystem: mm/slab
Pengfei Li <lpf.vector@gmail.com>:
Patch series "mm, slab: Make kmalloc_info[] contain all types of names", v6:
mm, slab: make kmalloc_info[] contain all types of names
mm, slab: remove unused kmalloc_size()
mm, slab_common: use enum kmalloc_cache_type to iterate over kmalloc caches
Subsystem: mm/slub
Miles Chen <miles.chen@mediatek.com>:
mm: slub: print the offset of fault addresses
Yu Zhao <yuzhao@google.com>:
mm/slub.c: update comments
mm/slub.c: clean up validate_slab()
Subsystem: mm/pagecache
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
mm/filemap.c: remove redundant cache invalidation after async direct-io write
fs/direct-io.c: keep dio_warn_stale_pagecache() when CONFIG_BLOCK=n
mm/filemap.c: warn if stale pagecache is left after direct write
Subsystem: mm/gup
zhong jiang <zhongjiang@huawei.com>:
mm/gup.c: allow CMA migration to propagate errors back to caller
Liu Xiang <liuxiang_1999@126.com>:
mm/gup.c: fix comments of __get_user_pages() and get_user_pages_remote()
Subsystem: mm/swap
Naohiro Aota <naohiro.aota@wdc.com>:
mm, swap: disallow swapon() on zoned block devices
Fengguang Wu <fengguang.wu@intel.com>:
mm/swap.c: trivial mark_page_accessed() cleanup
Subsystem: mm/memcg
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: clean up reclaim iter array
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: remove dead code from memory_max_write()
mm: memcontrol: try harder to set a new memory.high
Hao Lee <haolee.swjtu@gmail.com>:
include/linux/memcontrol.h: fix comments based on per-node memcg
Shakeel Butt <shakeelb@google.com>:
mm: vmscan: memcontrol: remove mem_cgroup_select_victim_node()
Chris Down <chris@chrisdown.name>:
Documentation/admin-guide/cgroup-v2.rst: document why inactive_X + active_X may not equal X
Subsystem: mm/pagemap
Johannes Weiner <hannes@cmpxchg.org>:
mm: drop mmap_sem before calling balance_dirty_pages() in write fault
"Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
shmem: pin the file in shmem_fault() if mmap_sem is dropped
"Joel Fernandes (Google)" <joel@joelfernandes.org>:
mm: emit tracepoint when RSS changes
rss_stat: add support to detect RSS updates of external mm
Wei Yang <richardw.yang@linux.intel.com>:
mm/mmap.c: remove a never-triggered warning in __vma_adjust()
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
mm/swap.c: piggyback lru_add_drain_all() calls
Wei Yang <richardw.yang@linux.intel.com>:
mm/mmap.c: prev could be retrieved from vma->vm_prev
mm/mmap.c: __vma_unlink_prev() is not necessary now
mm/mmap.c: extract __vma_unlink_list() as counterpart for __vma_link_list()
mm/mmap.c: rb_parent is not necessary in __vma_link_list()
mm/rmap.c: don't reuse anon_vma if we just want a copy
mm/rmap.c: reuse mergeable anon_vma as parent when fork
Gaowei Pu <pugaowei@gmail.com>:
mm/mmap.c: use IS_ERR_VALUE to check return value of get_unmapped_area
Vineet Gupta <Vineet.Gupta1@synopsys.com>:
Patch series "elide extraneous generated code for folded p4d/pud/pmd", v3:
ARC: mm: remove __ARCH_USE_5LEVEL_HACK
asm-generic/tlb: stub out pud_free_tlb() if nopud ...
asm-generic/tlb: stub out p4d_free_tlb() if nop4d ...
asm-generic/tlb: stub out pmd_free_tlb() if nopmd
asm-generic/mm: stub out p{4,u}d_clear_bad() if __PAGETABLE_P{4,U}D_FOLDED
Miles Chen <miles.chen@mediatek.com>:
mm/rmap.c: fix outdated comment in page_get_anon_vma()
Yang Shi <yang.shi@linux.alibaba.com>:
mm/rmap.c: use VM_BUG_ON_PAGE() in __page_check_anon_rmap()
Thomas Hellstrom <thellstrom@vmware.com>:
mm: move the backup x_devmap() functions to asm-generic/pgtable.h
mm/memory.c: fix a huge pud insertion race during faulting
Steven Price <steven.price@arm.com>:
Patch series "Generic page walk and ptdump", v15:
mm: add generic p?d_leaf() macros
arc: mm: add p?d_leaf() definitions
arm: mm: add p?d_leaf() definitions
arm64: mm: add p?d_leaf() definitions
mips: mm: add p?d_leaf() definitions
powerpc: mm: add p?d_leaf() definitions
riscv: mm: add p?d_leaf() definitions
s390: mm: add p?d_leaf() definitions
sparc: mm: add p?d_leaf() definitions
x86: mm: add p?d_leaf() definitions
mm: pagewalk: add p4d_entry() and pgd_entry()
mm: pagewalk: allow walking without vma
mm: pagewalk: add test_p?d callbacks
mm: pagewalk: add 'depth' parameter to pte_hole
x86: mm: point to struct seq_file from struct pg_state
x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct
x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct
x86: mm: convert ptdump_walk_pgd_level_core() to take an mm_struct
mm: add generic ptdump
x86: mm: convert dump_pagetables to use walk_page_range
arm64: mm: convert mm/dump.c to use walk_page_range()
arm64: mm: display non-present entries in ptdump
mm: ptdump: reduce level numbers by 1 in note_page()
Subsystem: mm/memfd
Nicolas Geoffray <ngeoffray@google.com>:
mm, memfd: fix COW issue on MAP_PRIVATE and F_SEAL_FUTURE_WRITE mappings
"Joel Fernandes (Google)" <joel@joelfernandes.org>:
memfd: add test for COW on MAP_PRIVATE and F_SEAL_FUTURE_WRITE mappings
Subsystem: mm/memory-failure
Jane Chu <jane.chu@oracle.com>:
mm/memory-failure.c clean up around tk pre-allocation
Naoya Horiguchi <nao.horiguchi@gmail.com>:
mm, soft-offline: convert parameter to pfn
Yunfeng Ye <yeyunfeng@huawei.com>:
mm/memory-failure.c: use page_shift() in add_to_kill()
Subsystem: mm/memory-hotplug
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/hotplug: reorder memblock_[free|remove]() calls in try_remove_memory()
Alastair D'Silva <alastair@d-silva.org>:
mm/memory_hotplug.c: add a bounds check to __add_pages()
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: Export generic_online_page()":
mm/memory_hotplug: export generic_online_page()
hv_balloon: use generic_online_page()
mm/memory_hotplug: remove __online_page_free() and __online_page_increment_counters()
Patch series "mm: Memory offlining + page isolation cleanups", v2:
mm/page_alloc.c: don't set pages PageReserved() when offlining
mm/page_isolation.c: convert SKIP_HWPOISON to MEMORY_OFFLINE
"Ben Dooks (Codethink)" <ben.dooks@codethink.co.uk>:
include/linux/memory_hotplug.h: move definitions of {set,clear}_zone_contiguous
David Hildenbrand <david@redhat.com>:
drivers/base/memory.c: drop the mem_sysfs_mutex
mm/memory_hotplug.c: don't allow to online/offline memory blocks with holes
Subsystem: mm/sparsemem
Vincent Whitchurch <vincent.whitchurch@axis.com>:
mm/sparse: consistently do not zero memmap
Ilya Leoshkevich <iii@linux.ibm.com>:
mm/sparse.c: mark populate_section_memmap as __meminit
Michal Hocko <mhocko@suse.com>:
mm/sparse.c: do not waste pre allocated memmap space
Subsystem: mm/vmalloc
Liu Xiang <liuxiang_1999@126.com>:
mm/vmalloc.c: remove unnecessary highmem_mask from parameter of gfpflags_allow_blocking()
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: remove preempt_disable/enable when doing preloading
mm/vmalloc: respect passed gfp_mask when doing preloading
mm/vmalloc: add more comments to the adjust_va_to_fit_type()
Anders Roxell <anders.roxell@linaro.org>:
selftests: vm: add fragment CONFIG_TEST_VMALLOC
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: rework vmap_area_lock
Subsystem: mm/kasan
Daniel Axtens <dja@axtens.net>:
Patch series "kasan: support backing vmalloc space with real shadow:
kasan: support backing vmalloc space with real shadow memory
kasan: add test for vmalloc
fork: support VMAP_STACK with KASAN_VMALLOC
x86/kasan: support KASAN_VMALLOC
Subsystem: mm/pagealloc
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/page_alloc: add alloc_contig_pages()
Mel Gorman <mgorman@techsingularity.net>:
mm, pcp: share common code between memory hotplug and percpu sysctl handler
mm, pcpu: make zone pcp updates and reset internal to the mm
Hao Lee <haolee.swjtu@gmail.com>:
include/linux/mmzone.h: fix comment for ISOLATE_UNMAPPED macro
lijiazi <jqqlijiazi@gmail.com>:
mm/page_alloc.c: print reserved_highatomic info
Subsystem: mm/vmscan
Andrey Ryabinin <aryabinin@virtuozzo.com>:
mm/vmscan: remove unused lru_pages argument
Yang Shi <yang.shi@linux.alibaba.com>:
mm/vmscan.c: remove unused scan_control parameter from pageout()
Johannes Weiner <hannes@cmpxchg.org>:
Patch series "mm: vmscan: cgroup-related cleanups":
mm: vmscan: simplify lruvec_lru_size()
mm: clean up and clarify lruvec lookup procedure
mm: vmscan: move inactive_list_is_low() swap check to the caller
mm: vmscan: naming fixes: global_reclaim() and sane_reclaim()
mm: vmscan: replace shrink_node() loop with a retry jump
mm: vmscan: turn shrink_node_memcg() into shrink_lruvec()
mm: vmscan: split shrink_node() into node part and memcgs part
mm: vmscan: harmonize writeback congestion tracking for nodes & memcgs
Patch series "mm: fix page aging across multiple cgroups":
mm: vmscan: move file exhaustion detection to the node level
mm: vmscan: detect file thrashing at the reclaim root
mm: vmscan: enforce inactive:active ratio at the reclaim root
Xianting Tian <xianting_tian@126.com>:
mm/vmscan.c: fix typo in comment
Subsystem: mm/proc
Johannes Weiner <hannes@cmpxchg.org>:
kernel: sysctl: make drop_caches write-only
Subsystem: mm/z3fold
Vitaly Wool <vitaly.wool@konsulko.com>:
mm/z3fold.c: add inter-page compaction
Subsystem: mm/mempolicy
Li Xinhai <lixinhai.lxh@gmail.com>:
Patch series "mm: Fix checking unmapped holes for mbind", v4:
mm/mempolicy.c: check range first in queue_pages_test_walk
mm/mempolicy.c: fix checking unmapped holes for mbind
Subsystem: mm/memblock
Cao jin <caoj.fnst@cn.fujitsu.com>:
mm/memblock.c: cleanup doc
mm/memblock: correct doc for function
Yunfeng Ye <yeyunfeng@huawei.com>:
mm: support memblock alloc on the exact node for sparse_buffer_init()
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlbfs: hugetlb_fault_mutex_hash() cleanup
mm/hugetlbfs: fix error handling when setting up mounts
Patch series "hugetlbfs: convert macros to static inline, fix sparse warning":
powerpc/mm: remove pmd_huge/pud_huge stubs and include hugetlb.h
hugetlbfs: convert macros to static inline, fix sparse warning
Piotr Sarna <p.sarna@tlen.pl>:
hugetlbfs: add O_TMPFILE support
Waiman Long <longman@redhat.com>:
hugetlbfs: take read_lock on i_mmap for PMD sharing
Subsystem: mm/hugetlb
Mina Almasry <almasrymina@google.com>:
hugetlb: region_chg provides only cache entry
hugetlb: remove duplicated code
Wei Yang <richardw.yang@linux.intel.com>:
hugetlb: remove unused hstate in hugetlb_fault_mutex_hash()
Zhigang Lu <tonnylu@tencent.com>:
mm/hugetlb: avoid looping to the same hugepage if !pages and !vmas
zhong jiang <zhongjiang@huawei.com>:
mm/huge_memory.c: split_huge_pages_fops should be defined with DEFINE_DEBUGFS_ATTRIBUTE
Subsystem: mm/migration
Yang Shi <yang.shi@linux.alibaba.com>:
mm/migrate.c: handle freed page at the first place
Subsystem: mm/thp
"Kirill A. Shutemov" <kirill@shutemov.name>:
mm, thp: do not queue fully unmapped pages for deferred split
Song Liu <songliubraving@fb.com>:
mm/thp: flush file for !is_shmem PageDirty() case in collapse_file()
Subsystem: mm/cma
Yunfeng Ye <yeyunfeng@huawei.com>:
mm/cma.c: switch to bitmap_zalloc() for cma bitmap allocation
zhong jiang <zhongjiang@huawei.com>:
mm/cma_debug.c: use DEFINE_DEBUGFS_ATTRIBUTE to define debugfs fops
Subsystem: mm/autonuma
Huang Ying <ying.huang@intel.com>:
autonuma: fix watermark checking in migrate_balanced_pgdat()
autonuma: reduce cache footprint when scanning page tables
Subsystem: mm/page-poison
zhong jiang <zhongjiang@huawei.com>:
mm/hwpoison-inject: use DEFINE_DEBUGFS_ATTRIBUTE to define debugfs fops
Subsystem: mm/mmap
Wei Yang <richardw.yang@linux.intel.com>:
mm/mmap.c: make vma_merge() comment more easy to understand
Subsystem: mm/madvise
Yunfeng Ye <yeyunfeng@huawei.com>:
mm/madvise.c: replace with page_size() in madvise_inject_error()
Wei Yang <richardw.yang@linux.intel.com>:
mm/madvise.c: use PAGE_ALIGN[ED] for range checking
Subsystem: mm/userfaultfd
Wei Yang <richardw.yang@linux.intel.com>:
userfaultfd: use vma_pagesize for all huge page size calculation
userfaultfd: remove unnecessary WARN_ON() in __mcopy_atomic_hugetlb()
userfaultfd: wrap the common dst_vma check into an inlined function
Andrea Arcangeli <aarcange@redhat.com>:
fs/userfaultfd.c: wp: clear VM_UFFD_MISSING or VM_UFFD_WP during userfaultfd_register()
Mike Rapoport <rppt@linux.ibm.com>:
userfaultfd: require CAP_SYS_PTRACE for UFFD_FEATURE_EVENT_FORK
Subsystem: mm/shmem
Colin Ian King <colin.king@canonical.com>:
mm/shmem.c: make array 'values' static const, makes object smaller
Yang Shi <yang.shi@linux.alibaba.com>:
mm: shmem: use proper gfp flags for shmem_writepage()
Chen Jun <chenjun102@huawei.com>:
mm/shmem.c: cast the type of unmap_start to u64
Subsystem: mm/cleanups
Hao Lee <haolee.swjtu@gmail.com>:
mm: fix struct member name in function comments
Wei Yang <richardw.yang@linux.intel.com>:
mm: fix typos in comments when calling __SetPageUptodate()
Souptick Joarder <jrdr.linux@gmail.com>:
mm/memory_hotplug.c: remove __online_page_set_limits()
Krzysztof Kozlowski <krzk@kernel.org>:
mm/Kconfig: fix indentation
Randy Dunlap <rdunlap@infradead.org>:
mm/Kconfig: fix trivial help text punctuation
Subsystem: mm/support
Minchan Kim <minchan@google.com>:
mm/page_io.c: annotate refault stalls from swap_readpage
Documentation/admin-guide/cgroup-v2.rst | 7
Documentation/dev-tools/kasan.rst | 63 +
arch/Kconfig | 9
arch/arc/include/asm/pgtable.h | 2
arch/arc/mm/fault.c | 10
arch/arc/mm/highmem.c | 4
arch/arm/include/asm/pgtable-2level.h | 1
arch/arm/include/asm/pgtable-3level.h | 1
arch/arm64/Kconfig | 1
arch/arm64/Kconfig.debug | 19
arch/arm64/include/asm/pgtable.h | 2
arch/arm64/include/asm/ptdump.h | 8
arch/arm64/mm/Makefile | 4
arch/arm64/mm/dump.c | 148 +---
arch/arm64/mm/mmu.c | 4
arch/arm64/mm/ptdump_debugfs.c | 2
arch/mips/include/asm/pgtable.h | 5
arch/powerpc/include/asm/book3s/64/pgtable-4k.h | 3
arch/powerpc/include/asm/book3s/64/pgtable-64k.h | 3
arch/powerpc/include/asm/book3s/64/pgtable.h | 30
arch/powerpc/mm/book3s64/radix_pgtable.c | 1
arch/riscv/include/asm/pgtable-64.h | 7
arch/riscv/include/asm/pgtable.h | 7
arch/s390/include/asm/pgtable.h | 2
arch/sparc/include/asm/pgtable_64.h | 2
arch/x86/Kconfig | 2
arch/x86/Kconfig.debug | 20
arch/x86/include/asm/pgtable.h | 10
arch/x86/mm/Makefile | 4
arch/x86/mm/debug_pagetables.c | 8
arch/x86/mm/dump_pagetables.c | 431 +++---------
arch/x86/mm/kasan_init_64.c | 61 +
arch/x86/platform/efi/efi_32.c | 2
arch/x86/platform/efi/efi_64.c | 4
drivers/base/memory.c | 40 -
drivers/firmware/efi/arm-runtime.c | 2
drivers/hv/hv_balloon.c | 4
drivers/xen/balloon.c | 1
fs/buffer.c | 6
fs/direct-io.c | 21
fs/hugetlbfs/inode.c | 67 +
fs/ocfs2/acl.c | 4
fs/proc/task_mmu.c | 4
fs/userfaultfd.c | 21
include/asm-generic/4level-fixup.h | 1
include/asm-generic/5level-fixup.h | 1
include/asm-generic/pgtable-nop4d.h | 2
include/asm-generic/pgtable-nopmd.h | 2
include/asm-generic/pgtable-nopud.h | 2
include/asm-generic/pgtable.h | 71 ++
include/asm-generic/tlb.h | 4
include/linux/fs.h | 6
include/linux/gfp.h | 2
include/linux/hugetlb.h | 142 +++-
include/linux/kasan.h | 31
include/linux/memblock.h | 3
include/linux/memcontrol.h | 51 -
include/linux/memory_hotplug.h | 11
include/linux/mm.h | 42 -
include/linux/mmzone.h | 34
include/linux/moduleloader.h | 2
include/linux/page-isolation.h | 4
include/linux/pagewalk.h | 42 -
include/linux/ptdump.h | 22
include/linux/slab.h | 20
include/linux/string.h | 2
include/linux/swap.h | 2
include/linux/vmalloc.h | 12
include/trace/events/kmem.h | 53 +
kernel/events/uprobes.c | 2
kernel/fork.c | 4
kernel/sysctl.c | 2
lib/Kconfig.kasan | 16
lib/test_kasan.c | 26
lib/vsprintf.c | 40 -
mm/Kconfig | 40 -
mm/Kconfig.debug | 21
mm/Makefile | 1
mm/cma.c | 6
mm/cma_debug.c | 10
mm/filemap.c | 56 -
mm/gup.c | 40 -
mm/hmm.c | 8
mm/huge_memory.c | 2
mm/hugetlb.c | 298 ++------
mm/hwpoison-inject.c | 4
mm/internal.h | 27
mm/kasan/common.c | 233 ++++++
mm/kasan/generic_report.c | 3
mm/kasan/kasan.h | 1
mm/khugepaged.c | 18
mm/madvise.c | 14
mm/memblock.c | 113 ++-
mm/memcontrol.c | 167 ----
mm/memory-failure.c | 61 -
mm/memory.c | 56 +
mm/memory_hotplug.c | 86 +-
mm/mempolicy.c | 59 +
mm/migrate.c | 21
mm/mincore.c | 1
mm/mmap.c | 75 --
mm/mprotect.c | 8
mm/mremap.c | 4
mm/nommu.c | 10
mm/page_alloc.c | 137 +++
mm/page_io.c | 15
mm/page_isolation.c | 12
mm/pagewalk.c | 126 ++-
mm/pgtable-generic.c | 9
mm/ptdump.c | 167 ++++
mm/rmap.c | 65 +
mm/shmem.c | 29
mm/slab.c | 7
mm/slab.h | 6
mm/slab_common.c | 101 +-
mm/slub.c | 36 -
mm/sparse.c | 22
mm/swap.c | 29
mm/swapfile.c | 7
mm/userfaultfd.c | 77 +-
mm/util.c | 22
mm/vmalloc.c | 196 +++--
mm/vmscan.c | 798 +++++++++++------------
mm/workingset.c | 75 +-
mm/z3fold.c | 375 ++++++++--
scripts/spelling.txt | 28
tools/testing/selftests/memfd/memfd_test.c | 36 +
tools/testing/selftests/vm/config | 1
128 files changed, 3409 insertions(+), 2121 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2019-12-01 1:47 incoming Andrew Morton
@ 2019-12-01 5:17 ` James Bottomley
2019-12-01 21:07 ` incoming Linus Torvalds
1 sibling, 0 replies; 348+ messages in thread
From: James Bottomley @ 2019-12-01 5:17 UTC (permalink / raw)
To: Andrew Morton, Linus Torvalds; +Cc: mm-commits, linux-mm
On Sat, 2019-11-30 at 17:47 -0800, Andrew Morton wrote:
> - a small number of updates to scripts/, ocfs2 and fs/buffer.c
>
> - most of MM. I still have quite a lot of material (mostly not MM)
> staged after linux-next due to -next dependencies. I'll send thos
> across next week as the preprequisites get merged up.
>
> 158 patches, based on 32ef9553635ab1236c33951a8bd9b5af1c3b1646.
Hey, Andrew, would it be at all possible for you to thread these
patches under something like this incoming message? The selfish reason
I'm asking is so I can mark the thread as read instead of having to do
it individually for 158 messages ... my thumb would thank you for this.
Regards,
James
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2019-12-01 1:47 incoming Andrew Morton
2019-12-01 5:17 ` incoming James Bottomley
@ 2019-12-01 21:07 ` Linus Torvalds
2019-12-02 8:21 ` incoming Steven Price
1 sibling, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2019-12-01 21:07 UTC (permalink / raw)
To: Andrew Morton, Steven Price; +Cc: mm-commits, Linux-MM
On Sat, Nov 30, 2019 at 5:47 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> Steven Price <steven.price@arm.com>:
> Patch series "Generic page walk and ptdump", v15:
> mm: add generic p?d_leaf() macros
> arc: mm: add p?d_leaf() definitions
> arm: mm: add p?d_leaf() definitions
> arm64: mm: add p?d_leaf() definitions
> mips: mm: add p?d_leaf() definitions
> powerpc: mm: add p?d_leaf() definitions
> riscv: mm: add p?d_leaf() definitions
> s390: mm: add p?d_leaf() definitions
> sparc: mm: add p?d_leaf() definitions
> x86: mm: add p?d_leaf() definitions
> mm: pagewalk: add p4d_entry() and pgd_entry()
> mm: pagewalk: allow walking without vma
> mm: pagewalk: add test_p?d callbacks
> mm: pagewalk: add 'depth' parameter to pte_hole
> x86: mm: point to struct seq_file from struct pg_state
> x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct
> x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct
> x86: mm: convert ptdump_walk_pgd_level_core() to take an mm_struct
> mm: add generic ptdump
> x86: mm: convert dump_pagetables to use walk_page_range
> arm64: mm: convert mm/dump.c to use walk_page_range()
> arm64: mm: display non-present entries in ptdump
> mm: ptdump: reduce level numbers by 1 in note_page()
I've dropped these, and since they clearly weren't ready I don't want
to see them re-sent for 5.5.
If somebody figures out the bug, trying again for 5.6 sounds fine.
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2019-12-01 21:07 ` incoming Linus Torvalds
@ 2019-12-02 8:21 ` Steven Price
0 siblings, 0 replies; 348+ messages in thread
From: Steven Price @ 2019-12-02 8:21 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Andrew Morton, mm-commits@vger.kernel.org, Linux-MM
On Sun, Dec 01, 2019 at 09:07:47PM +0000, Linus Torvalds wrote:
> On Sat, Nov 30, 2019 at 5:47 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > Steven Price <steven.price@arm.com>:
> > Patch series "Generic page walk and ptdump", v15:
> > mm: add generic p?d_leaf() macros
> > arc: mm: add p?d_leaf() definitions
> > arm: mm: add p?d_leaf() definitions
> > arm64: mm: add p?d_leaf() definitions
> > mips: mm: add p?d_leaf() definitions
> > powerpc: mm: add p?d_leaf() definitions
> > riscv: mm: add p?d_leaf() definitions
> > s390: mm: add p?d_leaf() definitions
> > sparc: mm: add p?d_leaf() definitions
> > x86: mm: add p?d_leaf() definitions
> > mm: pagewalk: add p4d_entry() and pgd_entry()
> > mm: pagewalk: allow walking without vma
> > mm: pagewalk: add test_p?d callbacks
> > mm: pagewalk: add 'depth' parameter to pte_hole
> > x86: mm: point to struct seq_file from struct pg_state
> > x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct
> > x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct
> > x86: mm: convert ptdump_walk_pgd_level_core() to take an mm_struct
> > mm: add generic ptdump
> > x86: mm: convert dump_pagetables to use walk_page_range
> > arm64: mm: convert mm/dump.c to use walk_page_range()
> > arm64: mm: display non-present entries in ptdump
> > mm: ptdump: reduce level numbers by 1 in note_page()
>
> I've dropped these, and since they clearly weren't ready I don't want
> to see them re-sent for 5.5.
Sorry about this, I'll try to track down the cause of this and hopefully
resubmit for 5.6.
Thanks,
Steve
> If somebody figures out the bug, trying again for 5.6 sounds fine.
>
> Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2019-12-05 0:48 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2019-12-05 0:48 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
Most of the rest of MM and various other things. Some Kconfig rework
still awaits merges of dependent trees from linux-next.
86 patches, based on 63de37476ebd1e9bab6a9e17186dc5aa1da9ea99.
Subsystems affected by this patch series:
mm/hotfixes
mm/memcg
mm/vmstat
mm/thp
procfs
sysctl
misc
notifiers
core-kernel
bitops
lib
checkpatch
epoll
binfmt
init
rapidio
uaccess
kcov
ubsan
ipc
bitmap
mm/pagemap
Subsystem: mm/hotfixes
zhong jiang <zhongjiang@huawei.com>:
mm/kasan/common.c: fix compile error
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: wait for !root kmem_cache refcnt killing on root kmem_cache destruction
Subsystem: mm/vmstat
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
mm/vmstat: add helpers to get vmstat item names for each enum type
mm/memcontrol: use vmstat names for printing statistics
Subsystem: mm/thp
Yu Zhao <yuzhao@google.com>:
mm/memory.c: replace is_zero_pfn with is_huge_zero_pmd for thp
Subsystem: procfs
Alexey Dobriyan <adobriyan@gmail.com>:
proc: change ->nlink under proc_subdir_lock
fs/proc/generic.c: delete useless "len" variable
fs/proc/internal.h: shuffle "struct pde_opener"
Miaohe Lin <linmiaohe@huawei.com>:
include/linux/proc_fs.h: fix confusing macro arg name
Krzysztof Kozlowski <krzk@kernel.org>:
fs/proc/Kconfig: fix indentation
Subsystem: sysctl
Alessio Balsini <balsini@android.com>:
include/linux/sysctl.h: inline braces for ctl_table and ctl_table_header
Subsystem: misc
Stephen Boyd <swboyd@chromium.org>:
.gitattributes: use 'dts' diff driver for dts files
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
linux/build_bug.h: change type to int
Masahiro Yamada <yamada.masahiro@socionext.com>:
linux/scc.h: make uapi linux/scc.h self-contained
Krzysztof Kozlowski <krzk@kernel.org>:
arch/Kconfig: fix indentation
Joe Perches <joe@perches.com>:
scripts/get_maintainer.pl: add signatures from Fixes: <badcommit> lines in commit message
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: update comment about simple_strto<foo>() functions
auxdisplay: charlcd: deduplicate simple_strtoul()
Subsystem: notifiers
Xiaoming Ni <nixiaoming@huawei.com>:
kernel/notifier.c: intercept duplicate registrations to avoid infinite loops
kernel/notifier.c: remove notifier_chain_cond_register()
kernel/notifier.c: remove blocking_notifier_chain_cond_register()
Subsystem: core-kernel
Nathan Chancellor <natechancellor@gmail.com>:
kernel/profile.c: use cpumask_available to check for NULL cpumask
Joe Perches <joe@perches.com>:
kernel/sys.c: avoid copying possible padding bytes in copy_to_user
Subsystem: bitops
William Breathitt Gray <vilhelm.gray@gmail.com>:
bitops: introduce the for_each_set_clump8 macro
lib/test_bitmap.c: add for_each_set_clump8 test cases
gpio: 104-dio-48e: utilize for_each_set_clump8 macro
gpio: 104-idi-48: utilize for_each_set_clump8 macro
gpio: gpio-mm: utilize for_each_set_clump8 macro
gpio: ws16c48: utilize for_each_set_clump8 macro
gpio: pci-idio-16: utilize for_each_set_clump8 macro
gpio: pcie-idio-24: utilize for_each_set_clump8 macro
gpio: uniphier: utilize for_each_set_clump8 macro
gpio: 74x164: utilize the for_each_set_clump8 macro
thermal: intel: intel_soc_dts_iosf: Utilize for_each_set_clump8 macro
gpio: pisosr: utilize the for_each_set_clump8 macro
gpio: max3191x: utilize the for_each_set_clump8 macro
gpio: pca953x: utilize the for_each_set_clump8 macro
Subsystem: lib
Wei Yang <richardw.yang@linux.intel.com>:
lib/rbtree: set successor's parent unconditionally
lib/rbtree: get successor's color directly
Laura Abbott <labbott@redhat.com>:
lib/test_meminit.c: add bulk alloc/free tests
Trent Piepho <tpiepho@gmail.com>:
lib/math/rational.c: fix possible incorrect result from rational fractions helper
Huang Shijie <sjhuang@iluvatar.ai>:
lib/genalloc.c: export symbol addr_in_gen_pool
lib/genalloc.c: rename addr_in_gen_pool to gen_pool_has_addr
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: improve ignoring CamelCase SI style variants like mA
checkpatch: reduce is_maintained_obsolete lookup runtime
Subsystem: epoll
Jason Baron <jbaron@akamai.com>:
epoll: simplify ep_poll_safewake() for CONFIG_DEBUG_LOCK_ALLOC
Heiher <r@hev.cc>:
fs/epoll: remove unnecessary wakeups of nested epoll
selftests: add epoll selftests
Subsystem: binfmt
Alexey Dobriyan <adobriyan@gmail.com>:
fs/binfmt_elf.c: delete unused "interp_map_addr" argument
fs/binfmt_elf.c: extract elf_read() function
Subsystem: init
Krzysztof Kozlowski <krzk@kernel.org>:
init/Kconfig: fix indentation
Subsystem: rapidio
"Ben Dooks (Codethink)" <ben.dooks@codethink.co.uk>:
drivers/rapidio/rio-driver.c: fix missing include of <linux/rio_drv.h>
drivers/rapidio/rio-access.c: fix missing include of <linux/rio_drv.h>
Subsystem: uaccess
Daniel Vetter <daniel.vetter@ffwll.ch>:
drm: limit to INT_MAX in create_blob ioctl
Kees Cook <keescook@chromium.org>:
uaccess: disallow > INT_MAX copy sizes
Subsystem: kcov
Andrey Konovalov <andreyknvl@google.com>:
Patch series " kcov: collect coverage from usb and vhost", v3:
kcov: remote coverage support
usb, kcov: collect coverage from hub_event
vhost, kcov: collect coverage from vhost_worker
Subsystem: ubsan
Julien Grall <julien.grall@arm.com>:
lib/ubsan: don't serialize UBSAN report
Subsystem: ipc
Masahiro Yamada <yamada.masahiro@socionext.com>:
arch: ipcbuf.h: make uapi asm/ipcbuf.h self-contained
arch: msgbuf.h: make uapi asm/msgbuf.h self-contained
arch: sembuf.h: make uapi asm/sembuf.h self-contained
Subsystem: bitmap
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
Patch series "gpio: pca953x: Convert to bitmap (extended) API", v2:
lib/test_bitmap: force argument of bitmap_parselist_user() to proper address space
lib/test_bitmap: undefine macros after use
lib/test_bitmap: name EXP_BYTES properly
lib/test_bitmap: rename exp to exp1 to avoid ambiguous name
lib/test_bitmap: move exp1 and exp2 upper for others to use
lib/test_bitmap: fix comment about this file
lib/bitmap: introduce bitmap_replace() helper
gpio: pca953x: remove redundant variable and check in IRQ handler
gpio: pca953x: use input from regs structure in pca953x_irq_pending()
gpio: pca953x: convert to use bitmap API
gpio: pca953x: tighten up indentation
Subsystem: mm/pagemap
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: remove __ARCH_HAS_4LEVEL_HACK", v13:
alpha: use pgtable-nopud instead of 4level-fixup
arm: nommu: use pgtable-nopud instead of 4level-fixup
c6x: use pgtable-nopud instead of 4level-fixup
m68k: nommu: use pgtable-nopud instead of 4level-fixup
m68k: mm: use pgtable-nopXd instead of 4level-fixup
microblaze: use pgtable-nopmd instead of 4level-fixup
nds32: use pgtable-nopmd instead of 4level-fixup
parisc: use pgtable-nopXd instead of 4level-fixup
Helge Deller <deller@gmx.de>:
parisc/hugetlb: use pgtable-nopXd instead of 4level-fixup
Mike Rapoport <rppt@linux.ibm.com>:
sparc32: use pgtable-nopud instead of 4level-fixup
um: remove unused pxx_offset_proc() and addr_pte() functions
um: add support for folded p4d page tables
mm: remove __ARCH_HAS_4LEVEL_HACK and include/asm-generic/4level-fixup.h
.gitattributes | 2
Documentation/core-api/genalloc.rst | 2
Documentation/dev-tools/kcov.rst | 129
arch/Kconfig | 22
arch/alpha/include/asm/mmzone.h | 1
arch/alpha/include/asm/pgalloc.h | 4
arch/alpha/include/asm/pgtable.h | 24
arch/alpha/mm/init.c | 12
arch/arm/include/asm/pgtable.h | 2
arch/arm/mm/dma-mapping.c | 2
arch/c6x/include/asm/pgtable.h | 2
arch/m68k/include/asm/mcf_pgalloc.h | 7
arch/m68k/include/asm/mcf_pgtable.h | 28
arch/m68k/include/asm/mmu_context.h | 12
arch/m68k/include/asm/motorola_pgalloc.h | 4
arch/m68k/include/asm/motorola_pgtable.h | 32
arch/m68k/include/asm/page.h | 9
arch/m68k/include/asm/pgtable_mm.h | 11
arch/m68k/include/asm/pgtable_no.h | 2
arch/m68k/include/asm/sun3_pgalloc.h | 5
arch/m68k/include/asm/sun3_pgtable.h | 18
arch/m68k/kernel/sys_m68k.c | 10
arch/m68k/mm/init.c | 6
arch/m68k/mm/kmap.c | 39
arch/m68k/mm/mcfmmu.c | 16
arch/m68k/mm/motorola.c | 17
arch/m68k/sun3x/dvma.c | 7
arch/microblaze/include/asm/page.h | 3
arch/microblaze/include/asm/pgalloc.h | 16
arch/microblaze/include/asm/pgtable.h | 32
arch/microblaze/kernel/signal.c | 10
arch/microblaze/mm/init.c | 7
arch/microblaze/mm/pgtable.c | 13
arch/mips/include/uapi/asm/msgbuf.h | 1
arch/mips/include/uapi/asm/sembuf.h | 2
arch/nds32/include/asm/page.h | 3
arch/nds32/include/asm/pgalloc.h | 3
arch/nds32/include/asm/pgtable.h | 12
arch/nds32/include/asm/tlb.h | 1
arch/nds32/kernel/pm.c | 4
arch/nds32/mm/fault.c | 16
arch/nds32/mm/init.c | 11
arch/nds32/mm/mm-nds32.c | 6
arch/nds32/mm/proc.c | 26
arch/parisc/include/asm/page.h | 30
arch/parisc/include/asm/pgalloc.h | 41
arch/parisc/include/asm/pgtable.h | 52
arch/parisc/include/asm/tlb.h | 2
arch/parisc/include/uapi/asm/msgbuf.h | 1
arch/parisc/include/uapi/asm/sembuf.h | 1
arch/parisc/kernel/cache.c | 13
arch/parisc/kernel/pci-dma.c | 9
arch/parisc/mm/fixmap.c | 10
arch/parisc/mm/hugetlbpage.c | 18
arch/powerpc/include/uapi/asm/msgbuf.h | 2
arch/powerpc/include/uapi/asm/sembuf.h | 2
arch/s390/include/uapi/asm/ipcbuf.h | 2
arch/sparc/include/asm/pgalloc_32.h | 6
arch/sparc/include/asm/pgtable_32.h | 28
arch/sparc/include/uapi/asm/ipcbuf.h | 2
arch/sparc/include/uapi/asm/msgbuf.h | 2
arch/sparc/include/uapi/asm/sembuf.h | 2
arch/sparc/mm/fault_32.c | 11
arch/sparc/mm/highmem.c | 6
arch/sparc/mm/io-unit.c | 6
arch/sparc/mm/iommu.c | 6
arch/sparc/mm/srmmu.c | 51
arch/um/include/asm/pgtable-2level.h | 1
arch/um/include/asm/pgtable-3level.h | 1
arch/um/include/asm/pgtable.h | 3
arch/um/kernel/mem.c | 8
arch/um/kernel/skas/mmu.c | 12
arch/um/kernel/skas/uaccess.c | 7
arch/um/kernel/tlb.c | 85
arch/um/kernel/trap.c | 4
arch/x86/include/uapi/asm/msgbuf.h | 3
arch/x86/include/uapi/asm/sembuf.h | 2
arch/xtensa/include/uapi/asm/ipcbuf.h | 2
arch/xtensa/include/uapi/asm/msgbuf.h | 2
arch/xtensa/include/uapi/asm/sembuf.h | 1
drivers/auxdisplay/charlcd.c | 34
drivers/base/node.c | 9
drivers/gpio/gpio-104-dio-48e.c | 75
drivers/gpio/gpio-104-idi-48.c | 36
drivers/gpio/gpio-74x164.c | 19
drivers/gpio/gpio-gpio-mm.c | 75
drivers/gpio/gpio-max3191x.c | 19
drivers/gpio/gpio-pca953x.c | 209
drivers/gpio/gpio-pci-idio-16.c | 75
drivers/gpio/gpio-pcie-idio-24.c | 111
drivers/gpio/gpio-pisosr.c | 12
drivers/gpio/gpio-uniphier.c | 13
drivers/gpio/gpio-ws16c48.c | 73
drivers/gpu/drm/drm_property.c | 2
drivers/misc/sram-exec.c | 2
drivers/rapidio/rio-access.c | 2
drivers/rapidio/rio-driver.c | 1
drivers/thermal/intel/intel_soc_dts_iosf.c | 31
drivers/thermal/intel/intel_soc_dts_iosf.h | 2
drivers/usb/core/hub.c | 5
drivers/vhost/vhost.c | 6
drivers/vhost/vhost.h | 1
fs/binfmt_elf.c | 56
fs/eventpoll.c | 52
fs/proc/Kconfig | 8
fs/proc/generic.c | 37
fs/proc/internal.h | 2
include/asm-generic/4level-fixup.h | 39
include/asm-generic/bitops/find.h | 17
include/linux/bitmap.h | 51
include/linux/bitops.h | 12
include/linux/build_bug.h | 4
include/linux/genalloc.h | 2
include/linux/kcov.h | 23
include/linux/kernel.h | 19
include/linux/mm.h | 10
include/linux/notifier.h | 4
include/linux/proc_fs.h | 4
include/linux/rbtree_augmented.h | 6
include/linux/sched.h | 8
include/linux/sysctl.h | 6
include/linux/thread_info.h | 2
include/linux/vmstat.h | 54
include/uapi/asm-generic/ipcbuf.h | 2
include/uapi/asm-generic/msgbuf.h | 2
include/uapi/asm-generic/sembuf.h | 1
include/uapi/linux/kcov.h | 28
include/uapi/linux/scc.h | 1
init/Kconfig | 78
kernel/dma/remap.c | 2
kernel/kcov.c | 547 +
kernel/notifier.c | 45
kernel/profile.c | 6
kernel/sys.c | 4
lib/bitmap.c | 12
lib/find_bit.c | 14
lib/genalloc.c | 7
lib/math/rational.c | 63
lib/test_bitmap.c | 206
lib/test_meminit.c | 20
lib/ubsan.c | 64
mm/kasan/common.c | 1
mm/memcontrol.c | 52
mm/memory.c | 10
mm/slab_common.c | 12
mm/vmstat.c | 60
net/sunrpc/rpc_pipe.c | 2
scripts/checkpatch.pl | 13
scripts/get_maintainer.pl | 38
tools/testing/selftests/Makefile | 1
tools/testing/selftests/filesystems/epoll/.gitignore | 1
tools/testing/selftests/filesystems/epoll/Makefile | 7
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 3074 ++++++++++
usr/include/Makefile | 4
154 files changed, 5270 insertions(+), 1360 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2019-12-18 4:50 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2019-12-18 4:50 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
6 fixes based on 2187f215ebaac73ddbd814696d7c7fa34f0c3de0:
Andrey Ryabinin <aryabinin@virtuozzo.com>:
kasan: fix crashes on access to memory mapped by vm_map_ram()
Daniel Axtens <dja@axtens.net>:
mm/memory.c: add apply_to_existing_page_range() helper
kasan: use apply_to_existing_page_range() for releasing vmalloc shadow
kasan: don't assume percpu shadow allocations will succeed
Yang Shi <yang.shi@linux.alibaba.com>:
mm: vmscan: protect shrinker idr replace with CONFIG_MEMCG
Changbin Du <changbin.du@gmail.com>:
lib/Kconfig.debug: fix some messed up configurations
include/linux/kasan.h | 15 +++--
include/linux/mm.h | 3 +
lib/Kconfig.debug | 100 ++++++++++++++++++------------------
mm/kasan/common.c | 36 ++++++++-----
mm/memory.c | 136 ++++++++++++++++++++++++++++++++++----------------
mm/vmalloc.c | 133 ++++++++++++++++++++++++++++--------------------
mm/vmscan.c | 2
7 files changed, 260 insertions(+), 165 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-01-04 20:55 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-01-04 20:55 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
17 fixes, base on 5613970af3f5f8372c596b138bd64f3918513515:
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: shrink zones when offlining memory
Chanho Min <chanho.min@lge.com>:
mm/zsmalloc.c: fix the migrated zspage statistics.
Andrey Konovalov <andreyknvl@google.com>:
kcov: fix struct layout for kcov_remote_arg
Shakeel Butt <shakeelb@google.com>:
memcg: account security cred as well to kmemcg
Yang Shi <yang.shi@linux.alibaba.com>:
mm: move_pages: return valid node id in status if the page is already on the target node
Eric Biggers <ebiggers@google.com>:
fs/direct-io.c: include fs/internal.h for missing prototype
fs/nsfs.c: include headers for missing declarations
fs/namespace.c: make to_mnt_ns() static
Nick Desaulniers <ndesaulniers@google.com>:
hexagon: parenthesize registers in asm predicates
hexagon: work around compiler crash
Randy Dunlap <rdunlap@infradead.org>:
fs/posix_acl.c: fix kernel-doc warnings
Ilya Dryomov <idryomov@gmail.com>:
mm/oom: fix pgtables units mismatch in Killed process message
Navid Emamdoost <navid.emamdoost@gmail.com>:
mm/gup: fix memory leak in __gup_benchmark_ioctl
Waiman Long <longman@redhat.com>:
mm/hugetlb: defer freeing of huge pages if in non-task context
Kai Li <li.kai4@h3c.com>:
ocfs2: call journal flush to mark journal as empty after journal recovery when mount
Gang He <GHe@suse.com>:
ocfs2: fix the crash due to call ocfs2_get_dlm_debug once less
Nick Desaulniers <ndesaulniers@google.com>:
hexagon: define ioremap_uc
Documentation/dev-tools/kcov.rst | 10 +++----
arch/arm64/mm/mmu.c | 4 --
arch/hexagon/include/asm/atomic.h | 8 ++---
arch/hexagon/include/asm/bitops.h | 8 ++---
arch/hexagon/include/asm/cmpxchg.h | 2 -
arch/hexagon/include/asm/futex.h | 6 ++--
arch/hexagon/include/asm/io.h | 1
arch/hexagon/include/asm/spinlock.h | 20 +++++++-------
arch/hexagon/kernel/stacktrace.c | 4 --
arch/hexagon/kernel/vm_entry.S | 2 -
arch/ia64/mm/init.c | 4 --
arch/powerpc/mm/mem.c | 3 --
arch/s390/mm/init.c | 4 --
arch/sh/mm/init.c | 4 --
arch/x86/mm/init_32.c | 4 --
arch/x86/mm/init_64.c | 4 --
fs/direct-io.c | 2 +
fs/namespace.c | 2 -
fs/nsfs.c | 3 ++
fs/ocfs2/dlmglue.c | 1
fs/ocfs2/journal.c | 8 +++++
fs/posix_acl.c | 7 +++-
include/linux/memory_hotplug.h | 7 +++-
include/uapi/linux/kcov.h | 10 +++----
kernel/cred.c | 6 ++--
mm/gup_benchmark.c | 8 ++++-
mm/hugetlb.c | 51 +++++++++++++++++++++++++++++++++++-
mm/memory_hotplug.c | 31 +++++++++++----------
mm/memremap.c | 2 -
mm/migrate.c | 23 ++++++++++++----
mm/oom_kill.c | 2 -
mm/zsmalloc.c | 5 +++
32 files changed, 166 insertions(+), 90 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-01-14 0:28 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-01-14 0:28 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
11 MM fixes, based on b3a987b0264d3ddbb24293ebff10eddfc472f653:
Vlastimil Babka <vbabka@suse.cz>:
mm, thp: tweak reclaim/compaction effort of local-only and all-node allocations
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: don't free usage map when removing a re-added early section
"Kirill A. Shutemov" <kirill@shutemov.name>:
Patch series "Fix two above-47bit hint address vs. THP bugs":
mm/huge_memory.c: thp: fix conflict of above-47bit hint address and PMD alignment
mm/shmem.c: thp, shmem: fix conflict of above-47bit hint address and PMD alignment
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: fix percpu slab vmstats flushing
Vlastimil Babka <vbabka@suse.cz>:
mm, debug_pagealloc: don't rely on static keys too early
Wen Yang <wenyang@linux.alibaba.com>:
Patch series "use div64_ul() instead of div_u64() if the divisor is:
mm/page-writeback.c: avoid potential division by zero in wb_min_max_ratio()
mm/page-writeback.c: use div64_ul() for u64-by-unsigned-long divide
mm/page-writeback.c: improve arithmetic divisions
Adrian Huang <ahuang12@lenovo.com>:
mm: memcg/slab: call flush_memcg_workqueue() only if memcg workqueue is valid
Yang Shi <yang.shi@linux.alibaba.com>:
mm: khugepaged: add trace status description for SCAN_PAGE_HAS_PRIVATE
include/linux/mm.h | 18 +++++++++-
include/linux/mmzone.h | 5 +--
include/trace/events/huge_memory.h | 3 +
init/main.c | 1
mm/huge_memory.c | 38 ++++++++++++++---------
mm/memcontrol.c | 37 +++++-----------------
mm/mempolicy.c | 10 ++++--
mm/page-writeback.c | 10 +++---
mm/page_alloc.c | 61 ++++++++++---------------------------
mm/shmem.c | 7 ++--
mm/slab.c | 4 +-
mm/slab_common.c | 3 +
mm/slub.c | 2 -
mm/sparse.c | 9 ++++-
mm/vmalloc.c | 4 +-
15 files changed, 102 insertions(+), 110 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-01-31 6:10 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-01-31 6:10 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
Most of -mm and quite a number of other subsystems.
MM is fairly quiet this time. Holidays, I assume.
119 patches, based on 39bed42de2e7d74686a2d5a45638d6a5d7e7d473:
Subsystems affected by this patch series:
hotfixes
scripts
ocfs2
mm/slub
mm/kmemleak
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/tracing
mm/kasan
mm/initialization
mm/pagealloc
mm/vmscan
mm/tools
mm/memblock
mm/oom-kill
mm/hugetlb
mm/migration
mm/mmap
mm/memory-hotplug
mm/zswap
mm/cleanups
mm/zram
misc
lib
binfmt
init
reiserfs
exec
dma-mapping
kcov
Subsystem: hotfixes
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
lib/test_bitmap: correct test data offsets for 32-bit
"Theodore Ts'o" <tytso@mit.edu>:
memcg: fix a crash in wb_workfn when a device disappears
Dan Carpenter <dan.carpenter@oracle.com>:
mm/mempolicy.c: fix out of bounds write in mpol_parse_str()
Pingfan Liu <kernelfans@gmail.com>:
mm/sparse.c: reset section's mem_map when fully deactivated
Wei Yang <richardw.yang@linux.intel.com>:
mm/migrate.c: also overwrite error when it is bigger than zero
Dan Williams <dan.j.williams@intel.com>:
mm/memory_hotplug: fix remove_memory() lockdep splat
Wei Yang <richardw.yang@linux.intel.com>:
mm: thp: don't need care deferred split queue in memcg charge move path
Yang Shi <yang.shi@linux.alibaba.com>:
mm: move_pages: report the number of non-attempted pages
Subsystem: scripts
Xiong <xndchn@gmail.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Luca Ceresoli <luca@lucaceresoli.net>:
scripts/spelling.txt: add "issus" typo
Subsystem: ocfs2
Aditya Pakki <pakki001@umn.edu>:
fs: ocfs: remove unnecessary assertion in dlm_migrate_lockres
zhengbin <zhengbin13@huawei.com>:
ocfs2: remove unneeded semicolons
Masahiro Yamada <masahiroy@kernel.org>:
ocfs2: make local header paths relative to C files
Colin Ian King <colin.king@canonical.com>:
ocfs2/dlm: remove redundant assignment to ret
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
ocfs2/dlm: move BITS_TO_BYTES() to bitops.h for wider use
wangyan <wangyan122@huawei.com>:
ocfs2: fix a NULL pointer dereference when call ocfs2_update_inode_fsync_trans()
ocfs2: use ocfs2_update_inode_fsync_trans() to access t_tid in handle->h_transaction
Subsystem: mm/slub
Yu Zhao <yuzhao@google.com>:
mm/slub.c: avoid slub allocation while holding list_lock
Subsystem: mm/kmemleak
He Zhe <zhe.he@windriver.com>:
mm/kmemleak: turn kmemleak_lock and object->lock to raw_spinlock_t
Subsystem: mm/debug
Vlastimil Babka <vbabka@suse.cz>:
mm/debug.c: always print flags in dump_page()
Subsystem: mm/pagecache
Ira Weiny <ira.weiny@intel.com>:
mm/filemap.c: clean up filemap_write_and_wait()
Subsystem: mm/gup
Qiujun Huang <hqjagain@gmail.com>:
mm: fix gup_pud_range
Wei Yang <richardw.yang@linux.intel.com>:
mm/gup.c: use is_vm_hugetlb_page() to check whether to follow huge
John Hubbard <jhubbard@nvidia.com>:
Patch series "mm/gup: prereqs to track dma-pinned pages: FOLL_PIN", v12:
mm/gup: factor out duplicate code from four routines
mm/gup: move try_get_compound_head() to top, fix minor issues
Dan Williams <dan.j.williams@intel.com>:
mm: Cleanup __put_devmap_managed_page() vs ->page_free()
John Hubbard <jhubbard@nvidia.com>:
mm: devmap: refactor 1-based refcounting for ZONE_DEVICE pages
goldish_pipe: rename local pin_user_pages() routine
mm: fix get_user_pages_remote()'s handling of FOLL_LONGTERM
vfio: fix FOLL_LONGTERM use, simplify get_user_pages_remote() call
mm/gup: allow FOLL_FORCE for get_user_pages_fast()
IB/umem: use get_user_pages_fast() to pin DMA pages
media/v4l2-core: set pages dirty upon releasing DMA buffers
mm/gup: introduce pin_user_pages*() and FOLL_PIN
goldish_pipe: convert to pin_user_pages() and put_user_page()
IB/{core,hw,umem}: set FOLL_PIN via pin_user_pages*(), fix up ODP
mm/process_vm_access: set FOLL_PIN via pin_user_pages_remote()
drm/via: set FOLL_PIN via pin_user_pages_fast()
fs/io_uring: set FOLL_PIN via pin_user_pages()
net/xdp: set FOLL_PIN via pin_user_pages()
media/v4l2-core: pin_user_pages (FOLL_PIN) and put_user_page() conversion
vfio, mm: pin_user_pages (FOLL_PIN) and put_user_page() conversion
powerpc: book3s64: convert to pin_user_pages() and put_user_page()
mm/gup_benchmark: use proper FOLL_WRITE flags instead of hard-coding "1"
mm, tree-wide: rename put_user_page*() to unpin_user_page*()
Subsystem: mm/swap
Vasily Averin <vvs@virtuozzo.com>:
mm/swapfile.c: swap_next should increase position index
Subsystem: mm/memcg
Kaitao Cheng <pilgrimtao@gmail.com>:
mm/memcontrol.c: cleanup some useless code
Subsystem: mm/pagemap
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/page_vma_mapped.c: explicitly compare pfn for normal, hugetlbfs and THP page
Subsystem: mm/tracing
Junyong Sun <sunjy516@gmail.com>:
mm, tracing: print symbol name for kmem_alloc_node call_site events
Subsystem: mm/kasan
"Gustavo A. R. Silva" <gustavo@embeddedor.com>:
lib/test_kasan.c: fix memory leak in kmalloc_oob_krealloc_more()
Subsystem: mm/initialization
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
mm/early_ioremap.c: use %pa to print resource_size_t variables
Subsystem: mm/pagealloc
"Kirill A. Shutemov" <kirill@shutemov.name>:
mm/page_alloc: skip non present sections on zone initialization
David Hildenbrand <david@redhat.com>:
mm: remove the memory isolate notifier
mm: remove "count" parameter from has_unmovable_pages()
Subsystem: mm/vmscan
Liu Song <liu.song11@zte.com.cn>:
mm/vmscan.c: remove unused return value of shrink_node
Alex Shi <alex.shi@linux.alibaba.com>:
mm/vmscan: remove prefetch_prev_lru_page
mm/vmscan: remove unused RECLAIM_OFF/RECLAIM_ZONE
Subsystem: mm/tools
Daniel Wagner <dwagner@suse.de>:
tools/vm/slabinfo: fix sanity checks enabling
Subsystem: mm/memblock
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/memblock: define memblock_physmem_add()
memblock: Use __func__ in remaining memblock_dbg() call sites
Subsystem: mm/oom-kill
David Rientjes <rientjes@google.com>:
mm, oom: dump stack of victim when reaping failed
Subsystem: mm/hugetlb
Wei Yang <richardw.yang@linux.intel.com>:
mm/huge_memory.c: use head to check huge zero page
mm/huge_memory.c: use head to emphasize the purpose of page
mm/huge_memory.c: reduce critical section protected by split_queue_lock
Subsystem: mm/migration
Ralph Campbell <rcampbell@nvidia.com>:
mm/migrate: remove useless mask of start address
mm/migrate: clean up some minor coding style
mm/migrate: add stable check in migrate_vma_insert_page()
David Rientjes <rientjes@google.com>:
mm, thp: fix defrag setting if newline is not used
Subsystem: mm/mmap
Miaohe Lin <linmiaohe@huawei.com>:
mm/mmap.c: get rid of odd jump labels in find_mergeable_anon_vma()
Subsystem: mm/memory-hotplug
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: pass in nid to online_pages()":
mm/memory_hotplug: pass in nid to online_pages()
Qian Cai <cai@lca.pw>:
mm/hotplug: silence a lockdep splat with printk()
mm/page_isolation: fix potential warning from user
Subsystem: mm/zswap
Vitaly Wool <vitaly.wool@konsulko.com>:
mm/zswap.c: add allocation hysteresis if pool limit is hit
Dan Carpenter <dan.carpenter@oracle.com>:
zswap: potential NULL dereference on error in init_zswap()
Subsystem: mm/cleanups
Yu Zhao <yuzhao@google.com>:
include/linux/mm.h: clean up obsolete check on space in page->flags
Wei Yang <richardw.yang@linux.intel.com>:
include/linux/mm.h: remove dead code totalram_pages_set()
Anshuman Khandual <anshuman.khandual@arm.com>:
include/linux/memory.h: drop fields 'hw' and 'phys_callback' from struct memory_block
Hao Lee <haolee.swjtu@gmail.com>:
mm: fix comments related to node reclaim
Subsystem: mm/zram
Taejoon Song <taejoon.song@lge.com>:
zram: try to avoid worst-case scenario on same element pages
Colin Ian King <colin.king@canonical.com>:
drivers/block/zram/zram_drv.c: fix error return codes not being returned in writeback_store
Subsystem: misc
Akinobu Mita <akinobu.mita@gmail.com>:
Patch series "add header file for kelvin to/from Celsius conversion:
include/linux/units.h: add helpers for kelvin to/from Celsius conversion
ACPI: thermal: switch to use <linux/units.h> helpers
platform/x86: asus-wmi: switch to use <linux/units.h> helpers
platform/x86: intel_menlow: switch to use <linux/units.h> helpers
thermal: int340x: switch to use <linux/units.h> helpers
thermal: intel_pch: switch to use <linux/units.h> helpers
nvme: hwmon: switch to use <linux/units.h> helpers
thermal: remove kelvin to/from Celsius conversion helpers from <linux/thermal.h>
iwlegacy: use <linux/units.h> helpers
iwlwifi: use <linux/units.h> helpers
thermal: armada: remove unused TO_MCELSIUS macro
iio: adc: qcom-vadc-common: use <linux/units.h> helpers
Subsystem: lib
Mikhail Zaslonko <zaslonko@linux.ibm.com>:
Patch series "S390 hardware support for kernel zlib", v3:
lib/zlib: add s390 hardware support for kernel zlib_deflate
s390/boot: rename HEAP_SIZE due to name collision
lib/zlib: add s390 hardware support for kernel zlib_inflate
s390/boot: add dfltcc= kernel command line parameter
lib/zlib: add zlib_deflate_dfltcc_enabled() function
btrfs: use larger zlib buffer for s390 hardware compression
Nathan Chancellor <natechancellor@gmail.com>:
lib/scatterlist.c: adjust indentation in __sg_alloc_table
Yury Norov <yury.norov@gmail.com>:
uapi: rename ext2_swab() to swab() and share globally in swab.h
lib/find_bit.c: join _find_next_bit{_le}
lib/find_bit.c: uninline helper _find_next_bit()
Subsystem: binfmt
Alexey Dobriyan <adobriyan@gmail.com>:
fs/binfmt_elf.c: smaller code generation around auxv vector fill
fs/binfmt_elf.c: fix ->start_code calculation
fs/binfmt_elf.c: don't copy ELF header around
fs/binfmt_elf.c: better codegen around current->mm
fs/binfmt_elf.c: make BAD_ADDR() unlikely
fs/binfmt_elf.c: coredump: allocate core ELF header on stack
fs/binfmt_elf.c: coredump: delete duplicated overflow check
fs/binfmt_elf.c: coredump: allow process with empty address space to coredump
Subsystem: init
Arvind Sankar <nivedita@alum.mit.edu>:
init/main.c: log arguments and environment passed to init
init/main.c: remove unnecessary repair_env_string in do_initcall_level
Patch series "init/main.c: minor cleanup/bugfix of envvar handling", v2:
init/main.c: fix quoted value handling in unknown_bootoption
Christophe Leroy <christophe.leroy@c-s.fr>:
init/main.c: fix misleading "This architecture does not have kernel memory protection" message
Subsystem: reiserfs
Yunfeng Ye <yeyunfeng@huawei.com>:
reiserfs: prevent NULL pointer dereference in reiserfs_insert_item()
Subsystem: exec
Alexey Dobriyan <adobriyan@gmail.com>:
execve: warn if process starts with executable stack
Subsystem: dma-mapping
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
include/linux/io-mapping.h-mapping: use PHYS_PFN() macro in io_mapping_map_atomic_wc()
Subsystem: kcov
Dmitry Vyukov <dvyukov@google.com>:
kcov: ignore fault-inject and stacktrace
Documentation/admin-guide/kernel-parameters.txt | 12
Documentation/core-api/index.rst | 1
Documentation/core-api/pin_user_pages.rst | 234 +++++
Documentation/vm/zswap.rst | 13
arch/powerpc/mm/book3s64/iommu_api.c | 14
arch/s390/boot/compressed/decompressor.c | 8
arch/s390/boot/ipl_parm.c | 14
arch/s390/include/asm/setup.h | 7
arch/s390/kernel/setup.c | 14
drivers/acpi/thermal.c | 34
drivers/base/memory.c | 25
drivers/block/zram/zram_drv.c | 10
drivers/gpu/drm/via/via_dmablit.c | 6
drivers/iio/adc/qcom-vadc-common.c | 6
drivers/iio/adc/qcom-vadc-common.h | 1
drivers/infiniband/core/umem.c | 21
drivers/infiniband/core/umem_odp.c | 13
drivers/infiniband/hw/hfi1/user_pages.c | 4
drivers/infiniband/hw/mthca/mthca_memfree.c | 8
drivers/infiniband/hw/qib/qib_user_pages.c | 4
drivers/infiniband/hw/qib/qib_user_sdma.c | 8
drivers/infiniband/hw/usnic/usnic_uiom.c | 4
drivers/infiniband/sw/siw/siw_mem.c | 4
drivers/media/v4l2-core/videobuf-dma-sg.c | 20
drivers/net/ethernet/broadcom/bnx2x/bnx2x_init.h | 1
drivers/net/wireless/intel/iwlegacy/4965-mac.c | 3
drivers/net/wireless/intel/iwlegacy/4965.c | 17
drivers/net/wireless/intel/iwlegacy/common.h | 3
drivers/net/wireless/intel/iwlwifi/dvm/dev.h | 5
drivers/net/wireless/intel/iwlwifi/dvm/devices.c | 6
drivers/nvdimm/pmem.c | 6
drivers/nvme/host/hwmon.c | 13
drivers/platform/goldfish/goldfish_pipe.c | 39
drivers/platform/x86/asus-wmi.c | 7
drivers/platform/x86/intel_menlow.c | 9
drivers/thermal/armada_thermal.c | 2
drivers/thermal/intel/int340x_thermal/int340x_thermal_zone.c | 7
drivers/thermal/intel/intel_pch_thermal.c | 3
drivers/vfio/vfio_iommu_type1.c | 39
fs/binfmt_elf.c | 154 +--
fs/btrfs/compression.c | 2
fs/btrfs/zlib.c | 135 ++
fs/exec.c | 5
fs/fs-writeback.c | 2
fs/io_uring.c | 6
fs/ocfs2/cluster/quorum.c | 2
fs/ocfs2/dlm/Makefile | 2
fs/ocfs2/dlm/dlmast.c | 8
fs/ocfs2/dlm/dlmcommon.h | 4
fs/ocfs2/dlm/dlmconvert.c | 8
fs/ocfs2/dlm/dlmdebug.c | 8
fs/ocfs2/dlm/dlmdomain.c | 8
fs/ocfs2/dlm/dlmlock.c | 8
fs/ocfs2/dlm/dlmmaster.c | 10
fs/ocfs2/dlm/dlmrecovery.c | 10
fs/ocfs2/dlm/dlmthread.c | 8
fs/ocfs2/dlm/dlmunlock.c | 8
fs/ocfs2/dlmfs/Makefile | 2
fs/ocfs2/dlmfs/dlmfs.c | 4
fs/ocfs2/dlmfs/userdlm.c | 6
fs/ocfs2/dlmglue.c | 2
fs/ocfs2/journal.h | 8
fs/ocfs2/namei.c | 3
fs/reiserfs/stree.c | 3
include/linux/backing-dev.h | 10
include/linux/bitops.h | 1
include/linux/fs.h | 6
include/linux/io-mapping.h | 5
include/linux/memblock.h | 7
include/linux/memory.h | 29
include/linux/memory_hotplug.h | 3
include/linux/mm.h | 116 +-
include/linux/mmzone.h | 2
include/linux/page-isolation.h | 8
include/linux/swab.h | 1
include/linux/thermal.h | 11
include/linux/units.h | 84 +
include/linux/zlib.h | 6
include/trace/events/kmem.h | 4
include/trace/events/writeback.h | 37
include/uapi/linux/swab.h | 10
include/uapi/linux/sysctl.h | 2
init/main.c | 36
kernel/Makefile | 1
lib/Kconfig | 7
lib/Makefile | 2
lib/decompress_inflate.c | 13
lib/find_bit.c | 82 -
lib/scatterlist.c | 2
lib/test_bitmap.c | 9
lib/test_kasan.c | 1
lib/zlib_deflate/deflate.c | 85 +
lib/zlib_deflate/deflate_syms.c | 1
lib/zlib_deflate/deftree.c | 54 -
lib/zlib_deflate/defutil.h | 134 ++
lib/zlib_dfltcc/Makefile | 13
lib/zlib_dfltcc/dfltcc.c | 57 +
lib/zlib_dfltcc/dfltcc.h | 155 +++
lib/zlib_dfltcc/dfltcc_deflate.c | 280 ++++++
lib/zlib_dfltcc/dfltcc_inflate.c | 149 +++
lib/zlib_dfltcc/dfltcc_syms.c | 17
lib/zlib_dfltcc/dfltcc_util.h | 123 ++
lib/zlib_inflate/inflate.c | 32
lib/zlib_inflate/inflate.h | 8
lib/zlib_inflate/infutil.h | 18
mm/Makefile | 1
mm/backing-dev.c | 1
mm/debug.c | 18
mm/early_ioremap.c | 8
mm/filemap.c | 34
mm/gup.c | 503 ++++++-----
mm/gup_benchmark.c | 9
mm/huge_memory.c | 44
mm/kmemleak.c | 112 +-
mm/memblock.c | 22
mm/memcontrol.c | 25
mm/memory_hotplug.c | 24
mm/mempolicy.c | 6
mm/memremap.c | 95 --
mm/migrate.c | 77 +
mm/mmap.c | 30
mm/oom_kill.c | 2
mm/page_alloc.c | 83 +
mm/page_isolation.c | 69 -
mm/page_vma_mapped.c | 12
mm/process_vm_access.c | 32
mm/slub.c | 88 +
mm/sparse.c | 2
mm/swap.c | 27
mm/swapfile.c | 2
mm/vmscan.c | 24
mm/zswap.c | 88 +
net/xdp/xdp_umem.c | 4
scripts/spelling.txt | 14
tools/testing/selftests/vm/gup_benchmark.c | 6
tools/vm/slabinfo.c | 4
136 files changed, 2790 insertions(+), 1358 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-02-04 1:33 Andrew Morton
2020-02-04 2:27 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2020-02-04 1:33 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
The rest of MM and the rest of everything else.
Subsystems affected by this patch series:
hotfixes
mm/pagealloc
mm/memory-hotplug
ipc
misc
mm/cleanups
mm/pagemap
procfs
lib
cleanups
arm
Subsystem: hotfixes
Gang He <GHe@suse.com>:
ocfs2: fix oops when writing cloned file
David Hildenbrand <david@redhat.com>:
Patch series "mm: fix max_pfn not falling on section boundary", v2:
mm/page_alloc.c: fix uninitialized memmaps on a partially populated last section
fs/proc/page.c: allow inspection of last section and fix end detection
mm/page_alloc.c: initialize memmap of unavailable memory directly
Subsystem: mm/pagealloc
David Hildenbrand <david@redhat.com>:
mm/page_alloc: fix and rework pfn handling in memmap_init_zone()
mm: factor out next_present_section_nr()
Subsystem: mm/memory-hotplug
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "mm/memory_hotplug: Shrink zones before removing memory", v6:
mm/memmap_init: update variable name in memmap_init_zone
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: poison memmap in remove_pfn_range_from_zone()
mm/memory_hotplug: we always have a zone in find_(smallest|biggest)_section_pfn
mm/memory_hotplug: don't check for "all holes" in shrink_zone_span()
mm/memory_hotplug: drop local variables in shrink_zone_span()
mm/memory_hotplug: cleanup __remove_pages()
mm/memory_hotplug: drop valid_start/valid_end from test_pages_in_a_zone()
Subsystem: ipc
Manfred Spraul <manfred@colorfullife.com>:
smp_mb__{before,after}_atomic(): update Documentation
Davidlohr Bueso <dave@stgolabs.net>:
ipc/mqueue.c: remove duplicated code
Manfred Spraul <manfred@colorfullife.com>:
ipc/mqueue.c: update/document memory barriers
ipc/msg.c: update and document memory barriers
ipc/sem.c: document and update memory barriers
Lu Shuaibing <shuaibinglu@126.com>:
ipc/msg.c: consolidate all xxxctl_down() functions
drivers/block/null_blk_main.c: fix layout
Subsystem: misc
Andrew Morton <akpm@linux-foundation.org>:
drivers/block/null_blk_main.c: fix layout
drivers/block/null_blk_main.c: fix uninitialized var warnings
Randy Dunlap <rdunlap@infradead.org>:
pinctrl: fix pxa2xx.c build warnings
Subsystem: mm/cleanups
Florian Westphal <fw@strlen.de>:
mm: remove __krealloc
Subsystem: mm/pagemap
Steven Price <steven.price@arm.com>:
Patch series "Generic page walk and ptdump", v17:
mm: add generic p?d_leaf() macros
arc: mm: add p?d_leaf() definitions
arm: mm: add p?d_leaf() definitions
arm64: mm: add p?d_leaf() definitions
mips: mm: add p?d_leaf() definitions
powerpc: mm: add p?d_leaf() definitions
riscv: mm: add p?d_leaf() definitions
s390: mm: add p?d_leaf() definitions
sparc: mm: add p?d_leaf() definitions
x86: mm: add p?d_leaf() definitions
mm: pagewalk: add p4d_entry() and pgd_entry()
mm: pagewalk: allow walking without vma
mm: pagewalk: don't lock PTEs for walk_page_range_novma()
mm: pagewalk: fix termination condition in walk_pte_range()
mm: pagewalk: add 'depth' parameter to pte_hole
x86: mm: point to struct seq_file from struct pg_state
x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct
x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct
mm: add generic ptdump
x86: mm: convert dump_pagetables to use walk_page_range
arm64: mm: convert mm/dump.c to use walk_page_range()
arm64: mm: display non-present entries in ptdump
mm: ptdump: reduce level numbers by 1 in note_page()
x86: mm: avoid allocating struct mm_struct on the stack
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "Fixup page directory freeing", v4:
powerpc/mmu_gather: enable RCU_TABLE_FREE even for !SMP case
Peter Zijlstra <peterz@infradead.org>:
mm/mmu_gather: invalidate TLB correctly on batch allocation failure and flush
asm-generic/tlb: avoid potential double flush
asm-gemeric/tlb: remove stray function declarations
asm-generic/tlb: add missing CONFIG symbol
asm-generic/tlb: rename HAVE_RCU_TABLE_FREE
asm-generic/tlb: rename HAVE_MMU_GATHER_PAGE_SIZE
asm-generic/tlb: rename HAVE_MMU_GATHER_NO_GATHER
asm-generic/tlb: provide MMU_GATHER_TABLE_FREE
Subsystem: procfs
Alexey Dobriyan <adobriyan@gmail.com>:
proc: decouple proc from VFS with "struct proc_ops"
proc: convert everything to "struct proc_ops"
Subsystem: lib
Yury Norov <yury.norov@gmail.com>:
Patch series "lib: rework bitmap_parse", v5:
lib/string: add strnchrnul()
bitops: more BITS_TO_* macros
lib: add test for bitmap_parse()
lib: make bitmap_parse_user a wrapper on bitmap_parse
lib: rework bitmap_parse()
lib: new testcases for bitmap_parse{_user}
include/linux/cpumask.h: don't calculate length of the input string
Subsystem: cleanups
Masahiro Yamada <masahiroy@kernel.org>:
treewide: remove redundant IS_ERR() before error code check
Subsystem: arm
Chen-Yu Tsai <wens@csie.org>:
ARM: dma-api: fix max_pfn off-by-one error in __dma_supported()
Documentation/memory-barriers.txt | 14
arch/Kconfig | 17
arch/alpha/kernel/srm_env.c | 17
arch/arc/include/asm/pgtable.h | 1
arch/arm/Kconfig | 2
arch/arm/include/asm/pgtable-2level.h | 1
arch/arm/include/asm/pgtable-3level.h | 1
arch/arm/include/asm/tlb.h | 6
arch/arm/kernel/atags_proc.c | 8
arch/arm/mm/alignment.c | 14
arch/arm/mm/dma-mapping.c | 2
arch/arm64/Kconfig | 3
arch/arm64/Kconfig.debug | 19
arch/arm64/include/asm/pgtable.h | 2
arch/arm64/include/asm/ptdump.h | 8
arch/arm64/mm/Makefile | 4
arch/arm64/mm/dump.c | 152 ++----
arch/arm64/mm/mmu.c | 4
arch/arm64/mm/ptdump_debugfs.c | 2
arch/ia64/kernel/salinfo.c | 24 -
arch/m68k/kernel/bootinfo_proc.c | 8
arch/mips/include/asm/pgtable.h | 5
arch/mips/lasat/picvue_proc.c | 31 -
arch/powerpc/Kconfig | 7
arch/powerpc/include/asm/book3s/32/pgalloc.h | 8
arch/powerpc/include/asm/book3s/64/pgalloc.h | 2
arch/powerpc/include/asm/book3s/64/pgtable.h | 3
arch/powerpc/include/asm/nohash/pgalloc.h | 8
arch/powerpc/include/asm/tlb.h | 11
arch/powerpc/kernel/proc_powerpc.c | 10
arch/powerpc/kernel/rtas-proc.c | 70 +--
arch/powerpc/kernel/rtas_flash.c | 34 -
arch/powerpc/kernel/rtasd.c | 14
arch/powerpc/mm/book3s64/pgtable.c | 7
arch/powerpc/mm/numa.c | 12
arch/powerpc/platforms/pseries/lpar.c | 24 -
arch/powerpc/platforms/pseries/lparcfg.c | 14
arch/powerpc/platforms/pseries/reconfig.c | 8
arch/powerpc/platforms/pseries/scanlog.c | 15
arch/riscv/include/asm/pgtable-64.h | 7
arch/riscv/include/asm/pgtable.h | 7
arch/s390/Kconfig | 4
arch/s390/include/asm/pgtable.h | 2
arch/sh/mm/alignment.c | 17
arch/sparc/Kconfig | 3
arch/sparc/include/asm/pgtable_64.h | 2
arch/sparc/include/asm/tlb_64.h | 11
arch/sparc/kernel/led.c | 15
arch/um/drivers/mconsole_kern.c | 9
arch/um/kernel/exitcode.c | 15
arch/um/kernel/process.c | 15
arch/x86/Kconfig | 3
arch/x86/Kconfig.debug | 20
arch/x86/include/asm/pgtable.h | 10
arch/x86/include/asm/tlb.h | 4
arch/x86/kernel/cpu/mtrr/if.c | 21
arch/x86/mm/Makefile | 4
arch/x86/mm/debug_pagetables.c | 18
arch/x86/mm/dump_pagetables.c | 418 +++++-------------
arch/x86/platform/efi/efi_32.c | 2
arch/x86/platform/efi/efi_64.c | 4
arch/x86/platform/uv/tlb_uv.c | 14
arch/xtensa/platforms/iss/simdisk.c | 10
crypto/af_alg.c | 2
drivers/acpi/battery.c | 15
drivers/acpi/proc.c | 15
drivers/acpi/scan.c | 2
drivers/base/memory.c | 9
drivers/block/null_blk_main.c | 58 +-
drivers/char/hw_random/bcm2835-rng.c | 2
drivers/char/hw_random/omap-rng.c | 4
drivers/clk/clk.c | 2
drivers/dma/mv_xor_v2.c | 2
drivers/firmware/efi/arm-runtime.c | 2
drivers/gpio/gpiolib-devres.c | 2
drivers/gpio/gpiolib-of.c | 8
drivers/gpio/gpiolib.c | 2
drivers/hwmon/dell-smm-hwmon.c | 15
drivers/i2c/busses/i2c-mv64xxx.c | 5
drivers/i2c/busses/i2c-synquacer.c | 2
drivers/ide/ide-proc.c | 19
drivers/input/input.c | 28 -
drivers/isdn/capi/kcapi_proc.c | 6
drivers/macintosh/via-pmu.c | 17
drivers/md/md.c | 15
drivers/misc/sgi-gru/gruprocfs.c | 42 -
drivers/mtd/ubi/build.c | 2
drivers/net/wireless/cisco/airo.c | 126 ++---
drivers/net/wireless/intel/ipw2x00/libipw_module.c | 15
drivers/net/wireless/intersil/hostap/hostap_hw.c | 4
drivers/net/wireless/intersil/hostap/hostap_proc.c | 14
drivers/net/wireless/intersil/hostap/hostap_wlan.h | 2
drivers/net/wireless/ray_cs.c | 20
drivers/of/device.c | 2
drivers/parisc/led.c | 17
drivers/pci/controller/pci-tegra.c | 2
drivers/pci/proc.c | 25 -
drivers/phy/phy-core.c | 4
drivers/pinctrl/pxa/pinctrl-pxa2xx.c | 1
drivers/platform/x86/thinkpad_acpi.c | 15
drivers/platform/x86/toshiba_acpi.c | 60 +-
drivers/pnp/isapnp/proc.c | 9
drivers/pnp/pnpbios/proc.c | 17
drivers/s390/block/dasd_proc.c | 15
drivers/s390/cio/blacklist.c | 14
drivers/s390/cio/css.c | 11
drivers/scsi/esas2r/esas2r_main.c | 9
drivers/scsi/scsi_devinfo.c | 15
drivers/scsi/scsi_proc.c | 29 -
drivers/scsi/sg.c | 30 -
drivers/spi/spi-orion.c | 3
drivers/staging/rtl8192u/ieee80211/ieee80211_module.c | 14
drivers/tty/sysrq.c | 8
drivers/usb/gadget/function/rndis.c | 17
drivers/video/fbdev/imxfb.c | 2
drivers/video/fbdev/via/viafbdev.c | 105 ++--
drivers/zorro/proc.c | 9
fs/cifs/cifs_debug.c | 108 ++--
fs/cifs/dfs_cache.c | 13
fs/cifs/dfs_cache.h | 2
fs/ext4/super.c | 2
fs/f2fs/node.c | 2
fs/fscache/internal.h | 2
fs/fscache/object-list.c | 11
fs/fscache/proc.c | 2
fs/jbd2/journal.c | 13
fs/jfs/jfs_debug.c | 14
fs/lockd/procfs.c | 12
fs/nfsd/nfsctl.c | 13
fs/nfsd/stats.c | 12
fs/ocfs2/file.c | 14
fs/ocfs2/suballoc.c | 2
fs/proc/cpuinfo.c | 12
fs/proc/generic.c | 38 -
fs/proc/inode.c | 76 +--
fs/proc/internal.h | 5
fs/proc/kcore.c | 13
fs/proc/kmsg.c | 14
fs/proc/page.c | 54 +-
fs/proc/proc_net.c | 32 -
fs/proc/proc_sysctl.c | 2
fs/proc/root.c | 2
fs/proc/stat.c | 12
fs/proc/task_mmu.c | 4
fs/proc/vmcore.c | 10
fs/sysfs/group.c | 2
include/asm-generic/pgtable.h | 20
include/asm-generic/tlb.h | 138 +++--
include/linux/bitmap.h | 8
include/linux/bitops.h | 4
include/linux/cpumask.h | 4
include/linux/memory_hotplug.h | 4
include/linux/mm.h | 6
include/linux/mmzone.h | 10
include/linux/pagewalk.h | 49 +-
include/linux/proc_fs.h | 23
include/linux/ptdump.h | 24 -
include/linux/seq_file.h | 13
include/linux/slab.h | 1
include/linux/string.h | 1
include/linux/sunrpc/stats.h | 4
ipc/mqueue.c | 123 ++++-
ipc/msg.c | 62 +-
ipc/sem.c | 66 +-
ipc/util.c | 14
kernel/configs.c | 9
kernel/irq/proc.c | 42 -
kernel/kallsyms.c | 12
kernel/latencytop.c | 14
kernel/locking/lockdep_proc.c | 15
kernel/module.c | 12
kernel/profile.c | 24 -
kernel/sched/psi.c | 48 +-
lib/bitmap.c | 195 ++++----
lib/string.c | 17
lib/test_bitmap.c | 105 ++++
mm/Kconfig.debug | 21
mm/Makefile | 1
mm/gup.c | 2
mm/hmm.c | 66 +-
mm/memory_hotplug.c | 104 +---
mm/memremap.c | 2
mm/migrate.c | 5
mm/mincore.c | 1
mm/mmu_gather.c | 158 ++++--
mm/page_alloc.c | 75 +--
mm/pagewalk.c | 167 +++++--
mm/ptdump.c | 159 ++++++
mm/slab_common.c | 37 -
mm/sparse.c | 10
mm/swapfile.c | 14
net/atm/mpoa_proc.c | 17
net/atm/proc.c | 8
net/core/dev.c | 2
net/core/filter.c | 2
net/core/pktgen.c | 44 -
net/ipv4/ipconfig.c | 10
net/ipv4/netfilter/ipt_CLUSTERIP.c | 16
net/ipv4/route.c | 24 -
net/netfilter/xt_recent.c | 17
net/sunrpc/auth_gss/svcauth_gss.c | 10
net/sunrpc/cache.c | 45 -
net/sunrpc/stats.c | 21
net/xfrm/xfrm_policy.c | 2
samples/kfifo/bytestream-example.c | 11
samples/kfifo/inttype-example.c | 11
samples/kfifo/record-example.c | 11
scripts/coccinelle/free/devm_free.cocci | 4
sound/core/info.c | 34 -
sound/soc/codecs/ak4104.c | 3
sound/soc/codecs/cs4270.c | 3
sound/soc/codecs/tlv320aic32x4.c | 6
sound/soc/sunxi/sun4i-spdif.c | 2
tools/include/linux/bitops.h | 9
214 files changed, 2589 insertions(+), 2227 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-02-04 1:33 incoming Andrew Morton
@ 2020-02-04 2:27 ` Linus Torvalds
2020-02-04 2:46 ` incoming Andrew Morton
0 siblings, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2020-02-04 2:27 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Tue, Feb 4, 2020 at 1:33 AM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> The rest of MM and the rest of everything else.
What's the base? You've changed your scripts or something, and that
information is no longer in your cover letter..
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-02-04 2:27 ` incoming Linus Torvalds
@ 2020-02-04 2:46 ` Andrew Morton
2020-02-04 3:11 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2020-02-04 2:46 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, Linux-MM
On Tue, 4 Feb 2020 02:27:48 +0000 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Tue, Feb 4, 2020 at 1:33 AM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > The rest of MM and the rest of everything else.
>
> What's the base? You've changed your scripts or something, and that
> information is no longer in your cover letter..
>
Crap, sorry, geriatric.
d4e9056daedca3891414fe3c91de3449a5dad0f2
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-02-04 2:46 ` incoming Andrew Morton
@ 2020-02-04 3:11 ` Linus Torvalds
0 siblings, 0 replies; 348+ messages in thread
From: Linus Torvalds @ 2020-02-04 3:11 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Tue, Feb 4, 2020 at 2:46 AM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> On Tue, 4 Feb 2020 02:27:48 +0000 Linus Torvalds <torvalds@linux-foundation.org> wrote:
>
> > What's the base? You've changed your scripts or something, and that
> > information is no longer in your cover letter..
>
> Crap, sorry, geriatric.
>
> d4e9056daedca3891414fe3c91de3449a5dad0f2
Ok, I've tentatively applied it with the MIME decoding fixes I found,
and I'll guess I'll let it build and sit for a while before merging it
into my tree.
I didn't find anything else odd in there. But...
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-02-21 4:00 Andrew Morton
2020-02-21 4:03 ` incoming Andrew Morton
2020-02-21 18:21 ` incoming Linus Torvalds
0 siblings, 2 replies; 348+ messages in thread
From: Andrew Morton @ 2020-02-21 4:00 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
- A few y2038 fixes which missed the merge window whiole dependencies
in NFS were being sorted out.
- A bunch of fixes. Some minor, some not.
Subsystems affected by this patch series:
Arnd Bergmann <arnd@arndb.de>:
y2038: remove ktime to/from timespec/timeval conversion
y2038: remove unused time32 interfaces
y2038: hide timeval/timespec/itimerval/itimerspec types
Ioanna Alifieraki <ioanna-maria.alifieraki@canonical.com>:
Revert "ipc,sem: remove uneeded sem_undo_list lock usage in exit_sem()"
Christian Borntraeger <borntraeger@de.ibm.com>:
include/uapi/linux/swab.h: fix userspace breakage, use __BITS_PER_LONG for swap
SeongJae Park <sjpark@amazon.de>:
selftests/vm: add missed tests in run_vmtests
Joe Perches <joe@perches.com>:
get_maintainer: remove uses of P: for maintainer name
Douglas Anderson <dianders@chromium.org>:
scripts/get_maintainer.pl: deprioritize old Fixes: addresses
Christoph Hellwig <hch@lst.de>:
mm/swapfile.c: fix a comment in sys_swapon()
Vasily Averin <vvs@virtuozzo.com>:
mm/memcontrol.c: lost css_put in memcg_expand_shrinker_maps()
Alexandru Ardelean <alexandru.ardelean@analog.com>:
lib/string.c: update match_string() doc-strings with correct behavior
Gavin Shan <gshan@redhat.com>:
mm/vmscan.c: don't round up scan size for online memory cgroup
Wei Yang <richardw.yang@linux.intel.com>:
mm/sparsemem: pfn_to_page is not valid yet on SPARSEMEM
Alexander Potapenko <glider@google.com>:
lib/stackdepot.c: fix global out-of-bounds in stack_slabs
Randy Dunlap <rdunlap@infradead.org>:
MAINTAINERS: use tabs for SAFESETID
MAINTAINERS | 8 -
include/linux/compat.h | 29 ------
include/linux/ktime.h | 37 -------
include/linux/time32.h | 154 ---------------------------------
include/linux/timekeeping32.h | 32 ------
include/linux/types.h | 5 -
include/uapi/asm-generic/posix_types.h | 2
include/uapi/linux/swab.h | 4
include/uapi/linux/time.h | 22 ++--
ipc/sem.c | 6 -
kernel/compat.c | 64 -------------
kernel/time/time.c | 43 ---------
lib/stackdepot.c | 8 +
lib/string.c | 16 +++
mm/memcontrol.c | 4
mm/sparse.c | 2
mm/swapfile.c | 2
mm/vmscan.c | 9 +
scripts/get_maintainer.pl | 32 ------
tools/testing/selftests/vm/run_vmtests | 33 +++++++
20 files changed, 93 insertions(+), 419 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-02-21 4:00 incoming Andrew Morton
@ 2020-02-21 4:03 ` Andrew Morton
2020-02-21 18:21 ` incoming Linus Torvalds
1 sibling, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-02-21 4:03 UTC (permalink / raw)
To: Linus Torvalds, linux-mm, mm-commits
On Thu, 20 Feb 2020 20:00:30 -0800 Andrew Morton <akpm@linux-foundation.org> wrote:
> - A few y2038 fixes which missed the merge window whiole dependencies
> in NFS were being sorted out.
>
> - A bunch of fixes. Some minor, some not.
15 patches, based on ca7e1fd1026c5af6a533b4b5447e1d2f153e28f2
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-02-21 4:00 incoming Andrew Morton
2020-02-21 4:03 ` incoming Andrew Morton
@ 2020-02-21 18:21 ` Linus Torvalds
2020-02-21 18:32 ` incoming Konstantin Ryabitsev
2020-02-21 19:33 ` incoming Linus Torvalds
1 sibling, 2 replies; 348+ messages in thread
From: Linus Torvalds @ 2020-02-21 18:21 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits
On Thu, Feb 20, 2020 at 8:00 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> - A few y2038 fixes which missed the merge window whiole dependencies
> in NFS were being sorted out.
>
> - A bunch of fixes. Some minor, some not.
Hmm. Konstantin's nice lore script _used_ to pick up your patches, but
now they don't.
I'm not sure what changed. It worked with your big series of 118 patches.
It doesn't work with this smaller series of fixes.
I think the difference is that you've done something bad to your patch
sending. That big series was properly threaded with each of the
patches being a reply to the 'incoming' message.
This series is not.
Please, Andrew, can you make your email flow more consistent so that I
can actually use the nice new tool to download a patch series?
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-02-21 18:21 ` incoming Linus Torvalds
@ 2020-02-21 18:32 ` Konstantin Ryabitsev
2020-02-27 9:59 ` incoming Vlastimil Babka
2020-02-21 19:33 ` incoming Linus Torvalds
1 sibling, 1 reply; 348+ messages in thread
From: Konstantin Ryabitsev @ 2020-02-21 18:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits
On Fri, Feb 21, 2020 at 10:21:19AM -0800, Linus Torvalds wrote:
> On Thu, Feb 20, 2020 at 8:00 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > - A few y2038 fixes which missed the merge window whiole dependencies
> > in NFS were being sorted out.
> >
> > - A bunch of fixes. Some minor, some not.
>
> Hmm. Konstantin's nice lore script _used_ to pick up your patches, but
> now they don't.
>
> I'm not sure what changed. It worked with your big series of 118 patches.
>
> It doesn't work with this smaller series of fixes.
>
> I think the difference is that you've done something bad to your patch
> sending. That big series was properly threaded with each of the
> patches being a reply to the 'incoming' message.
>
> This series is not.
This is correct -- each patch is posted without an in-reply-to, so
public-inbox doesn't group them into a thread.
E.g.:
https://lore.kernel.org/linux-mm/20200221040350.84HaG%25akpm@linux-foundation.org/
>
> Please, Andrew, can you make your email flow more consistent so that I
> can actually use the nice new tool to download a patch series?
Andrew, I'll be happy to provide you with a helper tool if you can
describe me your workflow. E.g. if you have a quilt directory of patches
plus a series file, it could easily be a tiny wrapper like:
send-patches --base-commit 1234abcd --cover cover.txt patchdir/series
-K
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-02-21 18:21 ` incoming Linus Torvalds
2020-02-21 18:32 ` incoming Konstantin Ryabitsev
@ 2020-02-21 19:33 ` Linus Torvalds
1 sibling, 0 replies; 348+ messages in thread
From: Linus Torvalds @ 2020-02-21 19:33 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits
Side note: I've obviously picked it up the old-fashioned way, but I
had been looking forward to seeing if I could just automate this more.
Linus
On Fri, Feb 21, 2020 at 10:21 AM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Please, Andrew, can you make your email flow more consistent so that I
> can actually use the nice new tool to download a patch series?
>
> Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-02-21 18:32 ` incoming Konstantin Ryabitsev
@ 2020-02-27 9:59 ` Vlastimil Babka
0 siblings, 0 replies; 348+ messages in thread
From: Vlastimil Babka @ 2020-02-27 9:59 UTC (permalink / raw)
To: Konstantin Ryabitsev, Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits
On 2/21/20 7:32 PM, Konstantin Ryabitsev wrote:
> On Fri, Feb 21, 2020 at 10:21:19AM -0800, Linus Torvalds wrote:
>> On Thu, Feb 20, 2020 at 8:00 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>> >
>> > - A few y2038 fixes which missed the merge window whiole dependencies
>> > in NFS were being sorted out.
>> >
>> > - A bunch of fixes. Some minor, some not.
>>
>> Hmm. Konstantin's nice lore script _used_ to pick up your patches, but
>> now they don't.
>>
>> I'm not sure what changed. It worked with your big series of 118 patches.
>>
>> It doesn't work with this smaller series of fixes.
>>
>> I think the difference is that you've done something bad to your patch
>> sending. That big series was properly threaded with each of the
>> patches being a reply to the 'incoming' message.
>>
>> This series is not.
>
> This is correct -- each patch is posted without an in-reply-to, so
> public-inbox doesn't group them into a thread.
>
> E.g.:
> https://lore.kernel.org/linux-mm/20200221040350.84HaG%25akpm@linux-foundation.org/
>
>>
>> Please, Andrew, can you make your email flow more consistent so that I
>> can actually use the nice new tool to download a patch series?
>
> Andrew, I'll be happy to provide you with a helper tool if you can
> describe me your workflow. E.g. if you have a quilt directory of patches
> plus a series file, it could easily be a tiny wrapper like:
>
> send-patches --base-commit 1234abcd --cover cover.txt patchdir/series
Once/if there is such tool, could it perhaps instead of mass e-mailing create
git commits, push them to korg repo and send a pull request?
Thanks,
Vlastimil
> -K
>
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-03-06 6:27 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-03-06 6:27 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
7 fixes, based on 9f65ed5fe41ce08ed1cb1f6a950f9ec694c142ad:
Mel Gorman <mgorman@techsingularity.net>:
mm, numa: fix bad pmd by atomically check for pmd_trans_huge when marking page tables prot_numa
Huang Ying <ying.huang@intel.com>:
mm: fix possible PMD dirty bit lost in set_pmd_migration_entry()
"Kirill A. Shutemov" <kirill@shutemov.name>:
mm: avoid data corruption on CoW fault into PFN-mapped VMA
OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
fat: fix uninit-memory access for partial initialized inode
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/z3fold.c: do not include rwlock.h directly
Vlastimil Babka <vbabka@suse.cz>:
mm, hotplug: fix page online with DEBUG_PAGEALLOC compiled but not enabled
Miroslav Benes <mbenes@suse.cz>:
arch/Kconfig: update HAVE_RELIABLE_STACKTRACE description
arch/Kconfig | 5 +++--
fs/fat/inode.c | 19 +++++++------------
include/linux/mm.h | 4 ++++
mm/huge_memory.c | 3 +--
mm/memory.c | 35 +++++++++++++++++++++++++++--------
mm/memory_hotplug.c | 8 +++++++-
mm/mprotect.c | 38 ++++++++++++++++++++++++++++++++++++--
mm/z3fold.c | 1 -
8 files changed, 85 insertions(+), 28 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-03-22 1:19 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-03-22 1:19 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
10 fixes, based on c63c50fc2ec9afc4de21ef9ead2eac64b178cce1:
Chunguang Xu <brookxu@tencent.com>:
memcg: fix NULL pointer dereference in __mem_cgroup_usage_unregister_event
Baoquan He <bhe@redhat.com>:
mm/hotplug: fix hot remove failure in SPARSEMEM|!VMEMMAP case
Qian Cai <cai@lca.pw>:
page-flags: fix a crash at SetPageError(THP_SWAP)
Chris Down <chris@chrisdown.name>:
mm, memcg: fix corruption on 64-bit divisor in memory.high throttling
mm, memcg: throttle allocators based on ancestral memory.high
Michal Hocko <mhocko@suse.com>:
mm: do not allow MADV_PAGEOUT for CoW pages
Roman Penyaev <rpenyaev@suse.de>:
epoll: fix possible lost wakeup on epoll_ctl() path
Qian Cai <cai@lca.pw>:
mm/mmu_notifier: silence PROVE_RCU_LIST warnings
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: prevent kmalloc_node crashes and memory leaks
Joerg Roedel <jroedel@suse.de>:
x86/mm: split vmalloc_sync_all()
arch/x86/mm/fault.c | 26 ++++++++++-
drivers/acpi/apei/ghes.c | 2
fs/eventpoll.c | 8 +--
include/linux/page-flags.h | 2
include/linux/vmalloc.h | 5 +-
kernel/notifier.c | 2
mm/madvise.c | 12 +++--
mm/memcontrol.c | 105 ++++++++++++++++++++++++++++-----------------
mm/mmu_notifier.c | 27 +++++++----
mm/nommu.c | 10 +++-
mm/slub.c | 26 +++++++----
mm/sparse.c | 8 ++-
mm/vmalloc.c | 11 +++-
13 files changed, 165 insertions(+), 79 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-03-29 2:14 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-03-29 2:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
5 fixes, based on 83fd69c93340177dcd66fd26ce6441fb581c1dbf:
Naohiro Aota <naohiro.aota@wdc.com>:
mm/swapfile.c: move inode_lock out of claim_swapfile
David Hildenbrand <david@redhat.com>:
drivers/base/memory.c: indicate all memory blocks as removable
Mina Almasry <almasrymina@google.com>:
hugetlb_cgroup: fix illegal access to memory
Roman Gushchin <guro@fb.com>:
mm: fork: fix kernel_stack memcg stats for various stack implementations
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/sparse: fix kernel crash with pfn_section_valid check
drivers/base/memory.c | 23 +++--------------------
include/linux/memcontrol.h | 12 ++++++++++++
kernel/fork.c | 4 ++--
mm/hugetlb_cgroup.c | 3 +--
mm/memcontrol.c | 38 ++++++++++++++++++++++++++++++++++++++
mm/sparse.c | 6 ++++++
mm/swapfile.c | 41 ++++++++++++++++++++---------------------
7 files changed, 82 insertions(+), 45 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-04-02 4:01 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-04-02 4:01 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
A large amount of MM, plenty more to come.
155 patches, based on GIT 1a323ea5356edbb3073dc59d51b9e6b86908857d
Subsystems affected by this patch series:
tools
kthread
kbuild
scripts
ocfs2
vfs
mm/slub
mm/kmemleak
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/mremap
mm/sparsemem
mm/kasan
mm/pagealloc
mm/vmscan
mm/compaction
mm/mempolicy
mm/hugetlbfs
mm/hugetlb
Subsystem: tools
David Ahern <dsahern@kernel.org>:
tools/accounting/getdelays.c: fix netlink attribute length
Subsystem: kthread
Petr Mladek <pmladek@suse.com>:
kthread: mark timer used by delayed kthread works as IRQ safe
Subsystem: kbuild
Masahiro Yamada <masahiroy@kernel.org>:
asm-generic: make more kernel-space headers mandatory
Subsystem: scripts
Jonathan Neuschäfer <j.neuschaefer@gmx.net>:
scripts/spelling.txt: add syfs/sysfs pattern
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ocfs2
Alex Shi <alex.shi@linux.alibaba.com>:
ocfs2: remove FS_OCFS2_NM
ocfs2: remove unused macros
ocfs2: use OCFS2_SEC_BITS in macro
ocfs2: remove dlm_lock_is_remote
wangyan <wangyan122@huawei.com>:
ocfs2: there is no need to log twice in several functions
ocfs2: correct annotation from "l_next_rec" to "l_next_free_rec"
Alex Shi <alex.shi@linux.alibaba.com>:
ocfs2: remove useless err
Jules Irenge <jbi.octave@gmail.com>:
ocfs2: Add missing annotations for ocfs2_refcount_cache_lock() and ocfs2_refcount_cache_unlock()
"Gustavo A. R. Silva" <gustavo@embeddedor.com>:
ocfs2: replace zero-length array with flexible-array member
ocfs2: cluster: replace zero-length array with flexible-array member
ocfs2: dlm: replace zero-length array with flexible-array member
ocfs2: ocfs2_fs.h: replace zero-length array with flexible-array member
wangjian <wangjian161@huawei.com>:
ocfs2: roll back the reference count modification of the parent directory if an error occurs
Takashi Iwai <tiwai@suse.de>:
ocfs2: use scnprintf() for avoiding potential buffer overflow
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
ocfs2: use memalloc_nofs_save instead of memalloc_noio_save
Subsystem: vfs
Kees Cook <keescook@chromium.org>:
fs_parse: Remove pr_notice() about each validation
Subsystem: mm/slub
chenqiwu <chenqiwu@xiaomi.com>:
mm/slub.c: replace cpu_slab->partial with wrapped APIs
mm/slub.c: replace kmem_cache->cpu_partial with wrapped APIs
Kees Cook <keescook@chromium.org>:
slub: improve bit diffusion for freelist ptr obfuscation
slub: relocate freelist pointer to middle of object
Vlastimil Babka <vbabka@suse.cz>:
Revert "topology: add support for node_to_mem_node() to determine the fallback node"
Subsystem: mm/kmemleak
Nathan Chancellor <natechancellor@gmail.com>:
mm/kmemleak.c: use address-of operator on section symbols
Qian Cai <cai@lca.pw>:
mm/Makefile: disable KCSAN for kmemleak
Subsystem: mm/pagecache
Jan Kara <jack@suse.cz>:
mm/filemap.c: don't bother dropping mmap_sem for zero size readahead
Mauricio Faria de Oliveira <mfo@canonical.com>:
mm/page-writeback.c: write_cache_pages(): deduplicate identical checks
Xianting Tian <xianting_tian@126.com>:
mm/filemap.c: clear page error before actual read
Souptick Joarder <jrdr.linux@gmail.com>:
mm/filemap.c: remove unused argument from shrink_readahead_size_eio()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap.c: use vm_fault error code directly
include/linux/pagemap.h: rename arguments to find_subpage
mm/page-writeback.c: use VM_BUG_ON_PAGE in clear_page_dirty_for_io
mm/filemap.c: unexport find_get_entry
mm/filemap.c: rewrite pagecache_get_page documentation
Subsystem: mm/gup
John Hubbard <jhubbard@nvidia.com>:
Patch series "mm/gup: track FOLL_PIN pages", v6:
mm/gup: split get_user_pages_remote() into two routines
mm/gup: pass a flags arg to __gup_device_* functions
mm: introduce page_ref_sub_return()
mm/gup: pass gup flags to two more routines
mm/gup: require FOLL_GET for get_user_pages_fast()
mm/gup: track FOLL_PIN pages
mm/gup: page->hpage_pinned_refcount: exact pin counts for huge pages
mm/gup: /proc/vmstat: pin_user_pages (FOLL_PIN) reporting
mm/gup_benchmark: support pin_user_pages() and related calls
selftests/vm: run_vmtests: invoke gup_benchmark with basic FOLL_PIN coverage
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: improve dump_page() for compound pages
John Hubbard <jhubbard@nvidia.com>:
mm: dump_page(): additional diagnostics for huge pinned pages
Claudio Imbrenda <imbrenda@linux.ibm.com>:
mm/gup/writeback: add callbacks for inaccessible pages
Pingfan Liu <kernelfans@gmail.com>:
mm/gup: rename nr as nr_pinned in get_user_pages_fast()
mm/gup: fix omission of check on FOLL_LONGTERM in gup fast path
Subsystem: mm/swap
Chen Wandun <chenwandun@huawei.com>:
mm/swapfile.c: fix comments for swapcache_prepare
Wei Yang <richardw.yang@linux.intel.com>:
mm/swap.c: not necessary to export __pagevec_lru_add()
Qian Cai <cai@lca.pw>:
mm/swapfile: fix data races in try_to_unuse()
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/swap_slots.c: assign|reset cache slot by value directly
Yang Shi <yang.shi@linux.alibaba.com>:
mm: swap: make page_evictable() inline
mm: swap: use smp_mb__after_atomic() to order LRU bit set
Wei Yang <richard.weiyang@gmail.com>:
mm/swap_state.c: use the same way to count page in [add_to|delete_from]_swap_cache
Subsystem: mm/memcg
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: fix build error around the usage of kmem_caches
Kirill Tkhai <ktkhai@virtuozzo.com>:
mm/memcontrol.c: allocate shrinker_map on appropriate NUMA node
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: use mem_cgroup_from_obj()
Patch series "mm: memcg: kmem API cleanup", v2:
mm: kmem: cleanup (__)memcg_kmem_charge_memcg() arguments
mm: kmem: cleanup memcg_kmem_uncharge_memcg() arguments
mm: kmem: rename memcg_kmem_(un)charge() into memcg_kmem_(un)charge_page()
mm: kmem: switch to nr_pages in (__)memcg_kmem_charge_memcg()
mm: memcg/slab: cache page number in memcg_(un)charge_slab()
mm: kmem: rename (__)memcg_kmem_(un)charge_memcg() to __memcg_kmem_(un)charge()
Johannes Weiner <hannes@cmpxchg.org>:
Patch series "mm: memcontrol: recursive memory.low protection", v3:
mm: memcontrol: fix memory.low proportional distribution
mm: memcontrol: clean up and document effective low/min calculations
mm: memcontrol: recursive memory.low protection
Shakeel Butt <shakeelb@google.com>:
memcg: css_tryget_online cleanups
Vincenzo Frascino <vincenzo.frascino@arm.com>:
mm/memcontrol.c: make mem_cgroup_id_get_many() __maybe_unused
Chris Down <chris@chrisdown.name>:
mm, memcg: prevent memory.high load/store tearing
mm, memcg: prevent memory.max load tearing
mm, memcg: prevent memory.low load/store tearing
mm, memcg: prevent memory.min load/store tearing
mm, memcg: prevent memory.swap.max load tearing
mm, memcg: prevent mem_cgroup_protected store tearing
Roman Gushchin <guro@fb.com>:
mm: memcg: make memory.oom.group tolerable to task migration
Subsystem: mm/pagemap
Thomas Hellstrom <thellstrom@vmware.com>:
mm/mapping_dirty_helpers: Update huge page-table entry callbacks
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/vma: some more minor changes", v2:
mm/vma: move VM_NO_KHUGEPAGED into generic header
mm/vma: make vma_is_foreign() available for general use
mm/vma: make is_vma_temporary_stack() available for general use
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: add pagemap.h to the fine documentation
Peter Xu <peterx@redhat.com>:
Patch series "mm: Page fault enhancements", v6:
mm/gup: rename "nonblocking" to "locked" where proper
mm/gup: fix __get_user_pages() on fault retry of hugetlb
mm: introduce fault_signal_pending()
x86/mm: use helper fault_signal_pending()
arc/mm: use helper fault_signal_pending()
arm64/mm: use helper fault_signal_pending()
powerpc/mm: use helper fault_signal_pending()
sh/mm: use helper fault_signal_pending()
mm: return faster for non-fatal signals in user mode faults
userfaultfd: don't retake mmap_sem to emulate NOPAGE
mm: introduce FAULT_FLAG_DEFAULT
mm: introduce FAULT_FLAG_INTERRUPTIBLE
mm: allow VM_FAULT_RETRY for multiple times
mm/gup: allow VM_FAULT_RETRY for multiple times
mm/gup: allow to react to fatal signals
mm/userfaultfd: honor FAULT_FLAG_KILLABLE in fault path
WANG Wenhu <wenhu.wang@vivo.com>:
mm: clarify a confusing comment for remap_pfn_range()
Wang Wenhu <wenhu.wang@vivo.com>:
mm/memory.c: clarify a confusing comment for vm_iomap_memory
Jaewon Kim <jaewon31.kim@samsung.com>:
Patch series "mm: mmap: add mmap trace point", v3:
mmap: remove inline of vm_unmapped_area
mm: mmap: add trace point of vm_unmapped_area
Subsystem: mm/mremap
Brian Geffon <bgeffon@google.com>:
mm/mremap: add MREMAP_DONTUNMAP to mremap()
selftests: add MREMAP_DONTUNMAP selftest
Subsystem: mm/sparsemem
Wei Yang <richardw.yang@linux.intel.com>:
mm/sparsemem: get address to page struct instead of address to pfn
Pingfan Liu <kernelfans@gmail.com>:
mm/sparse: rename pfn_present() to pfn_in_present_section()
Baoquan He <bhe@redhat.com>:
mm/sparse.c: use kvmalloc/kvfree to alloc/free memmap for the classic sparse
mm/sparse.c: allocate memmap preferring the given node
Subsystem: mm/kasan
Walter Wu <walter-zh.wu@mediatek.com>:
Patch series "fix the missing underflow in memory operation function", v4:
kasan: detect negative size in memory operation function
kasan: add test for invalid size in memmove
Subsystem: mm/pagealloc
Joel Savitz <jsavitz@redhat.com>:
mm/page_alloc: increase default min_free_kbytes bound
Mateusz Nosek <mateusznosek0@gmail.com>:
mm, pagealloc: micro-optimisation: save two branches on hot page allocation path
chenqiwu <chenqiwu@xiaomi.com>:
mm/page_alloc.c: use free_area_empty() instead of open-coding
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/page_alloc.c: micro-optimisation Remove unnecessary branch
chenqiwu <chenqiwu@xiaomi.com>:
mm/page_alloc: simplify page_is_buddy() for better code readability
Subsystem: mm/vmscan
Yang Shi <yang.shi@linux.alibaba.com>:
mm: vmpressure: don't need call kfree if kstrndup fails
mm: vmpressure: use mem_cgroup_is_root API
mm: vmscan: replace open codings to NUMA_NO_NODE
Wei Yang <richardw.yang@linux.intel.com>:
mm/vmscan.c: remove cpu online notification for now
Qian Cai <cai@lca.pw>:
mm/vmscan.c: fix data races using kswapd_classzone_idx
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/vmscan.c: Clean code by removing unnecessary assignment
Kirill Tkhai <ktkhai@virtuozzo.com>:
mm/vmscan.c: make may_enter_fs bool in shrink_page_list()
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/vmscan.c: do_try_to_free_pages(): clean code by removing unnecessary assignment
Michal Hocko <mhocko@suse.com>:
selftests: vm: drop dependencies on page flags from mlock2 tests
Subsystem: mm/compaction
Rik van Riel <riel@surriel.com>:
Patch series "fix THP migration for CMA allocations", v2:
mm,compaction,cma: add alloc_contig flag to compact_control
mm,thp,compaction,cma: allow THP migration for CMA allocations
Vlastimil Babka <vbabka@suse.cz>:
mm, compaction: fully assume capture is not NULL in compact_zone_order()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/compaction: really limit compact_unevictable_allowed to 0 and 1
mm/compaction: Disable compact_unevictable_allowed on RT
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/compaction.c: clean code by removing unnecessary assignment
Subsystem: mm/mempolicy
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/mempolicy: support MPOL_MF_STRICT for huge page mapping
mm/mempolicy: check hugepage migration is supported by arch in vma_migratable()
Yang Shi <yang.shi@linux.alibaba.com>:
mm: mempolicy: use VM_BUG_ON_VMA in queue_pages_test_walk()
Randy Dunlap <rdunlap@infradead.org>:
mm: mempolicy: require at least one nodeid for MPOL_PREFERRED
Colin Ian King <colin.king@canonical.com>:
mm/memblock.c: remove redundant assignment to variable max_addr
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "hugetlbfs: use i_mmap_rwsem for more synchronization", v2:
hugetlbfs: use i_mmap_rwsem for more pmd sharing synchronization
hugetlbfs: Use i_mmap_rwsem to address page fault/truncate race
Subsystem: mm/hugetlb
Mina Almasry <almasrymina@google.com>:
hugetlb_cgroup: add hugetlb_cgroup reservation counter
hugetlb_cgroup: add interface for charge/uncharge hugetlb reservations
mm/hugetlb_cgroup: fix hugetlb_cgroup migration
hugetlb_cgroup: add reservation accounting for private mappings
hugetlb: disable region_add file_region coalescing
hugetlb_cgroup: add accounting for shared mappings
hugetlb_cgroup: support noreserve mappings
hugetlb: support file_region coalescing again
hugetlb_cgroup: add hugetlb_cgroup reservation tests
hugetlb_cgroup: add hugetlb_cgroup reservation docs
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/hugetlb.c: clean code by removing unnecessary initialization
Vlastimil Babka <vbabka@suse.cz>:
mm/hugetlb: remove unnecessary memory fetch in PageHeadHuge()
Christophe Leroy <christophe.leroy@c-s.fr>:
selftests/vm: fix map_hugetlb length used for testing read and write
mm/hugetlb: fix build failure with HUGETLB_PAGE but not HUGEBTLBFS
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
include/linux/huge_mm.h: check PageTail in hpage_nr_pages even when !THP
Documentation/admin-guide/cgroup-v1/hugetlb.rst | 103 +-
Documentation/admin-guide/cgroup-v2.rst | 11
Documentation/admin-guide/sysctl/vm.rst | 3
Documentation/core-api/mm-api.rst | 3
Documentation/core-api/pin_user_pages.rst | 86 +
arch/alpha/include/asm/Kbuild | 11
arch/alpha/mm/fault.c | 6
arch/arc/include/asm/Kbuild | 21
arch/arc/mm/fault.c | 37
arch/arm/include/asm/Kbuild | 12
arch/arm/mm/fault.c | 7
arch/arm64/include/asm/Kbuild | 18
arch/arm64/mm/fault.c | 26
arch/c6x/include/asm/Kbuild | 37
arch/csky/include/asm/Kbuild | 36
arch/h8300/include/asm/Kbuild | 46
arch/hexagon/include/asm/Kbuild | 33
arch/hexagon/mm/vm_fault.c | 5
arch/ia64/include/asm/Kbuild | 7
arch/ia64/mm/fault.c | 5
arch/m68k/include/asm/Kbuild | 24
arch/m68k/mm/fault.c | 7
arch/microblaze/include/asm/Kbuild | 29
arch/microblaze/mm/fault.c | 5
arch/mips/include/asm/Kbuild | 13
arch/mips/mm/fault.c | 5
arch/nds32/include/asm/Kbuild | 37
arch/nds32/mm/fault.c | 5
arch/nios2/include/asm/Kbuild | 38
arch/nios2/mm/fault.c | 7
arch/openrisc/include/asm/Kbuild | 36
arch/openrisc/mm/fault.c | 5
arch/parisc/include/asm/Kbuild | 18
arch/parisc/mm/fault.c | 8
arch/powerpc/include/asm/Kbuild | 4
arch/powerpc/mm/book3s64/pkeys.c | 12
arch/powerpc/mm/fault.c | 20
arch/powerpc/platforms/pseries/hotplug-memory.c | 2
arch/riscv/include/asm/Kbuild | 28
arch/riscv/mm/fault.c | 9
arch/s390/include/asm/Kbuild | 15
arch/s390/mm/fault.c | 10
arch/sh/include/asm/Kbuild | 16
arch/sh/mm/fault.c | 13
arch/sparc/include/asm/Kbuild | 14
arch/sparc/mm/fault_32.c | 5
arch/sparc/mm/fault_64.c | 5
arch/um/kernel/trap.c | 3
arch/unicore32/include/asm/Kbuild | 34
arch/unicore32/mm/fault.c | 8
arch/x86/include/asm/Kbuild | 2
arch/x86/include/asm/mmu_context.h | 15
arch/x86/mm/fault.c | 32
arch/xtensa/include/asm/Kbuild | 26
arch/xtensa/mm/fault.c | 5
drivers/base/node.c | 2
drivers/gpu/drm/ttm/ttm_bo_vm.c | 12
fs/fs_parser.c | 2
fs/hugetlbfs/inode.c | 30
fs/ocfs2/alloc.c | 3
fs/ocfs2/cluster/heartbeat.c | 12
fs/ocfs2/cluster/netdebug.c | 4
fs/ocfs2/cluster/tcp.c | 27
fs/ocfs2/cluster/tcp.h | 2
fs/ocfs2/dir.c | 4
fs/ocfs2/dlm/dlmcommon.h | 8
fs/ocfs2/dlm/dlmdebug.c | 100 -
fs/ocfs2/dlm/dlmmaster.c | 2
fs/ocfs2/dlm/dlmthread.c | 3
fs/ocfs2/dlmglue.c | 2
fs/ocfs2/journal.c | 2
fs/ocfs2/namei.c | 15
fs/ocfs2/ocfs2_fs.h | 18
fs/ocfs2/refcounttree.c | 2
fs/ocfs2/reservations.c | 3
fs/ocfs2/stackglue.c | 2
fs/ocfs2/suballoc.c | 5
fs/ocfs2/super.c | 46
fs/pipe.c | 2
fs/userfaultfd.c | 64 -
include/asm-generic/Kbuild | 52 +
include/linux/cgroup-defs.h | 5
include/linux/fs.h | 5
include/linux/gfp.h | 6
include/linux/huge_mm.h | 10
include/linux/hugetlb.h | 76 +
include/linux/hugetlb_cgroup.h | 175 +++
include/linux/kasan.h | 2
include/linux/kthread.h | 3
include/linux/memcontrol.h | 66 -
include/linux/mempolicy.h | 29
include/linux/mm.h | 243 +++-
include/linux/mm_types.h | 7
include/linux/mmzone.h | 6
include/linux/page_ref.h | 9
include/linux/pagemap.h | 29
include/linux/sched/signal.h | 18
include/linux/swap.h | 1
include/linux/topology.h | 17
include/trace/events/mmap.h | 48
include/uapi/linux/mman.h | 5
kernel/cgroup/cgroup.c | 17
kernel/fork.c | 9
kernel/sysctl.c | 31
lib/test_kasan.c | 19
mm/Makefile | 1
mm/compaction.c | 31
mm/debug.c | 54 -
mm/filemap.c | 77 -
mm/gup.c | 682 ++++++++++---
mm/gup_benchmark.c | 71 +
mm/huge_memory.c | 29
mm/hugetlb.c | 866 ++++++++++++-----
mm/hugetlb_cgroup.c | 347 +++++-
mm/internal.h | 32
mm/kasan/common.c | 26
mm/kasan/generic.c | 9
mm/kasan/generic_report.c | 11
mm/kasan/kasan.h | 2
mm/kasan/report.c | 5
mm/kasan/tags.c | 9
mm/kasan/tags_report.c | 11
mm/khugepaged.c | 4
mm/kmemleak.c | 2
mm/list_lru.c | 12
mm/mapping_dirty_helpers.c | 42
mm/memblock.c | 2
mm/memcontrol.c | 378 ++++---
mm/memory-failure.c | 29
mm/memory.c | 4
mm/mempolicy.c | 73 +
mm/migrate.c | 25
mm/mmap.c | 32
mm/mremap.c | 92 +
mm/page-writeback.c | 19
mm/page_alloc.c | 82 -
mm/page_counter.c | 29
mm/page_ext.c | 2
mm/rmap.c | 39
mm/shuffle.c | 2
mm/slab.h | 32
mm/slab_common.c | 2
mm/slub.c | 27
mm/sparse.c | 33
mm/swap.c | 5
mm/swap_slots.c | 12
mm/swap_state.c | 2
mm/swapfile.c | 10
mm/userfaultfd.c | 11
mm/vmpressure.c | 8
mm/vmscan.c | 111 --
mm/vmstat.c | 2
scripts/spelling.txt | 21
tools/accounting/getdelays.c | 2
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 2
tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 575 +++++++++++
tools/testing/selftests/vm/gup_benchmark.c | 15
tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 244 ++++
tools/testing/selftests/vm/map_hugetlb.c | 14
tools/testing/selftests/vm/mlock2-tests.c | 233 ----
tools/testing/selftests/vm/mremap_dontunmap.c | 313 ++++++
tools/testing/selftests/vm/run_vmtests | 37
tools/testing/selftests/vm/write_hugetlb_memory.sh | 23
tools/testing/selftests/vm/write_to_hugetlbfs.c | 242 ++++
165 files changed, 5020 insertions(+), 2376 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-04-07 3:02 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-04-07 3:02 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
- a lot more of MM, quite a bit more yet to come.
- various other subsystems
166 patches based on 7e63420847ae5f1036e4f7c42f0b3282e73efbc2.
Subsystems affected by this patch series:
mm/memcg
mm/pagemap
mm/vmalloc
mm/pagealloc
mm/migration
mm/thp
mm/ksm
mm/madvise
mm/virtio
mm/userfaultfd
mm/memory-hotplug
mm/shmem
mm/rmap
mm/zswap
mm/zsmalloc
mm/cleanups
procfs
misc
MAINTAINERS
bitops
lib
checkpatch
epoll
binfmt
kallsyms
reiserfs
kmod
gcov
kconfig
kcov
ubsan
fault-injection
ipc
Subsystem: mm/memcg
Chris Down <chris@chrisdown.name>:
mm, memcg: bypass high reclaim iteration for cgroup hierarchy root
Subsystem: mm/pagemap
Li Xinhai <lixinhai.lxh@gmail.com>:
Patch series "mm: Fix misuse of parent anon_vma in dup_mmap path":
mm: don't prepare anon_vma if vma has VM_WIPEONFORK
Revert "mm/rmap.c: reuse mergeable anon_vma as parent when fork"
mm: set vm_next and vm_prev to NULL in vm_area_dup()
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/vma: Use all available wrappers when possible", v2:
mm/vma: add missing VMA flag readable name for VM_SYNC
mm/vma: make vma_is_accessible() available for general use
mm/vma: replace all remaining open encodings with is_vm_hugetlb_page()
mm/vma: replace all remaining open encodings with vma_is_anonymous()
mm/vma: append unlikely() while testing VMA access permissions
Subsystem: mm/vmalloc
Qiujun Huang <hqjagain@gmail.com>:
mm/vmalloc: fix a typo in comment
Subsystem: mm/pagealloc
Michal Hocko <mhocko@suse.com>:
mm: make it clear that gfp reclaim modifiers are valid only for sleepable allocations
Subsystem: mm/migration
Wei Yang <richardw.yang@linux.intel.com>:
Patch series "cleanup on do_pages_move()", v5:
mm/migrate.c: no need to check for i > start in do_pages_move()
mm/migrate.c: wrap do_move_pages_to_node() and store_status()
mm/migrate.c: check pagelist in move_pages_and_store_status()
mm/migrate.c: unify "not queued for migration" handling in do_pages_move()
Yang Shi <yang.shi@linux.alibaba.com>:
mm/migrate.c: migrate PG_readahead flag
Subsystem: mm/thp
David Rientjes <rientjes@google.com>:
mm, shmem: add vmstat for hugepage fallback
mm, thp: track fallbacks due to failed memcg charges separately
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
include/linux/pagemap.h: optimise find_subpage for !THP
mm: remove CONFIG_TRANSPARENT_HUGE_PAGECACHE
Subsystem: mm/ksm
Li Chen <chenli@uniontech.com>:
mm/ksm.c: update get_user_pages() argument in comment
Subsystem: mm/madvise
Huang Ying <ying.huang@intel.com>:
mm: code cleanup for MADV_FREE
Subsystem: mm/virtio
Alexander Duyck <alexander.h.duyck@linux.intel.com>:
Patch series "mm / virtio: Provide support for free page reporting", v17:
mm: adjust shuffle code to allow for future coalescing
mm: use zone and order instead of free area in free_list manipulators
mm: add function __putback_isolated_page
mm: introduce Reported pages
virtio-balloon: pull page poisoning config out of free page hinting
virtio-balloon: add support for providing free page reports to host
mm/page_reporting: rotate reported pages to the tail of the list
mm/page_reporting: add budget limit on how many pages can be reported per pass
mm/page_reporting: add free page reporting documentation
David Hildenbrand <david@redhat.com>:
virtio-balloon: switch back to OOM handler for VIRTIO_BALLOON_F_DEFLATE_ON_OOM
Subsystem: mm/userfaultfd
Shaohua Li <shli@fb.com>:
Patch series "userfaultfd: write protection support", v6:
userfaultfd: wp: add helper for writeprotect check
Andrea Arcangeli <aarcange@redhat.com>:
userfaultfd: wp: hook userfault handler to write protection fault
userfaultfd: wp: add WP pagetable tracking to x86
userfaultfd: wp: userfaultfd_pte/huge_pmd_wp() helpers
userfaultfd: wp: add UFFDIO_COPY_MODE_WP
Peter Xu <peterx@redhat.com>:
mm: merge parameters for change_protection()
userfaultfd: wp: apply _PAGE_UFFD_WP bit
userfaultfd: wp: drop _PAGE_UFFD_WP properly when fork
userfaultfd: wp: add pmd_swp_*uffd_wp() helpers
userfaultfd: wp: support swap and page migration
khugepaged: skip collapse if uffd-wp detected
Shaohua Li <shli@fb.com>:
userfaultfd: wp: support write protection for userfault vma range
Andrea Arcangeli <aarcange@redhat.com>:
userfaultfd: wp: add the writeprotect API to userfaultfd ioctl
Shaohua Li <shli@fb.com>:
userfaultfd: wp: enabled write protection in userfaultfd API
Peter Xu <peterx@redhat.com>:
userfaultfd: wp: don't wake up when doing write protect
Martin Cracauer <cracauer@cons.org>:
userfaultfd: wp: UFFDIO_REGISTER_MODE_WP documentation update
Peter Xu <peterx@redhat.com>:
userfaultfd: wp: declare _UFFDIO_WRITEPROTECT conditionally
userfaultfd: selftests: refactor statistics
userfaultfd: selftests: add write-protect test
Subsystem: mm/memory-hotplug
David Hildenbrand <david@redhat.com>:
Patch series "mm: drop superfluous section checks when onlining/offlining":
drivers/base/memory.c: drop section_count
drivers/base/memory.c: drop pages_correctly_probed()
mm/page_ext.c: drop pfn_present() check when onlining
Baoquan He <bhe@redhat.com>:
mm/memory_hotplug.c: only respect mem= parameter during boot stage
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug.c: simplify calculation of number of pages in __remove_pages()
mm/memory_hotplug.c: cleanup __add_pages()
Baoquan He <bhe@redhat.com>:
Patch series "mm/hotplug: Only use subsection map for VMEMMAP", v4:
mm/sparse.c: introduce new function fill_subsection_map()
mm/sparse.c: introduce a new function clear_subsection_map()
mm/sparse.c: only use subsection map in VMEMMAP case
mm/sparse.c: add note about only VMEMMAP supporting sub-section hotplug
mm/sparse.c: move subsection_map related functions together
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: allow to specify a default online_type", v3:
drivers/base/memory: rename MMOP_ONLINE_KEEP to MMOP_ONLINE
drivers/base/memory: map MMOP_OFFLINE to 0
drivers/base/memory: store mapping between MMOP_* and string in an array
powernv/memtrace: always online added memory blocks
hv_balloon: don't check for memhp_auto_online manually
mm/memory_hotplug: unexport memhp_auto_online
mm/memory_hotplug: convert memhp_auto_online to store an online_type
mm/memory_hotplug: allow to specify a default online_type
chenqiwu <chenqiwu@xiaomi.com>:
mm/memory_hotplug.c: use __pfn_to_section() instead of open-coding
Subsystem: mm/shmem
Kees Cook <keescook@chromium.org>:
mm/shmem.c: distribute switch variables for initialization
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/shmem.c: clean code by removing unnecessary assignment
Hugh Dickins <hughd@google.com>:
mm: huge tmpfs: try to split_huge_page() when punching hole
Subsystem: mm/rmap
Palmer Dabbelt <palmerdabbelt@google.com>:
mm: prevent a warning when casting void* -> enum
Subsystem: mm/zswap
"Maciej S. Szmigiero" <mail@maciej.szmigiero.name>:
mm/zswap: allow setting default status, compressor and allocator in Kconfig
Subsystem: mm/zsmalloc
Subsystem: mm/cleanups
Jules Irenge <jbi.octave@gmail.com>:
mm/compaction: add missing annotation for compact_lock_irqsave
mm/hugetlb: add missing annotation for gather_surplus_pages()
mm/mempolicy: add missing annotation for queue_pages_pmd()
mm/slub: add missing annotation for get_map()
mm/slub: add missing annotation for put_map()
mm/zsmalloc: add missing annotation for migrate_read_lock()
mm/zsmalloc: add missing annotation for migrate_read_unlock()
mm/zsmalloc: add missing annotation for pin_tag()
mm/zsmalloc: add missing annotation for unpin_tag()
chenqiwu <chenqiwu@xiaomi.com>:
mm: fix ambiguous comments for better code readability
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/mm_init.c: clean code. Use BUILD_BUG_ON when comparing compile time constant
Joe Perches <joe@perches.com>:
mm: use fallthrough;
Steven Price <steven.price@arm.com>:
include/linux/swapops.h: correct guards for non_swap_entry()
Ira Weiny <ira.weiny@intel.com>:
include/linux/memremap.h: remove stale comments
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/dmapool.c: micro-optimisation remove unnecessary branch
Waiman Long <longman@redhat.com>:
mm: remove dummy struct bootmem_data/bootmem_data_t
Subsystem: procfs
Jules Irenge <jbi.octave@gmail.com>:
fs/proc/inode.c: annotate close_pdeo() for sparse
Alexey Dobriyan <adobriyan@gmail.com>:
proc: faster open/read/close with "permanent" files
proc: speed up /proc/*/statm
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
proc: inline vma_stop into m_stop
proc: remove m_cache_vma
proc: use ppos instead of m->version
seq_file: remove m->version
proc: inline m_next_vma into m_next
Subsystem: misc
Michal Simek <michal.simek@xilinx.com>:
asm-generic: fix unistd_32.h generation format
Nathan Chancellor <natechancellor@gmail.com>:
kernel/extable.c: use address-of operator on section symbols
Masahiro Yamada <masahiroy@kernel.org>:
sparc,x86: vdso: remove meaningless undefining CONFIG_OPTIMIZE_INLINING
compiler: remove CONFIG_OPTIMIZE_INLINING entirely
Vegard Nossum <vegard.nossum@oracle.com>:
compiler.h: fix error in BUILD_BUG_ON() reporting
Subsystem: MAINTAINERS
Joe Perches <joe@perches.com>:
MAINTAINERS: list the section entries in the preferred order
Subsystem: bitops
Josh Poimboeuf <jpoimboe@redhat.com>:
bitops: always inline sign extension helpers
Subsystem: lib
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
lib/test_lockup: test module to generate lockups
Colin Ian King <colin.king@canonical.com>:
lib/test_lockup.c: fix spelling mistake "iteraions" -> "iterations"
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
lib/test_lockup.c: add parameters for locking generic vfs locks
"Gustavo A. R. Silva" <gustavo@embeddedor.com>:
lib/bch.c: replace zero-length array with flexible-array member
lib/ts_bm.c: replace zero-length array with flexible-array member
lib/ts_fsm.c: replace zero-length array with flexible-array member
lib/ts_kmp.c: replace zero-length array with flexible-array member
Geert Uytterhoeven <geert+renesas@glider.be>:
lib/scatterlist: fix sg_copy_buffer() kerneldoc
Kees Cook <keescook@chromium.org>:
lib: test_stackinit.c: XFAIL switch variable init tests
Alexander Potapenko <glider@google.com>:
lib/stackdepot.c: check depot_index before accessing the stack slab
lib/stackdepot.c: fix a condition in stack_depot_fetch()
lib/stackdepot.c: build with -fno-builtin
kasan: stackdepot: move filter_irq_stacks() to stackdepot.c
Qian Cai <cai@lca.pw>:
percpu_counter: fix a data race at vm_committed_as
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
lib/test_bitmap.c: make use of EXP2_IN_BITS
chenqiwu <chenqiwu@xiaomi.com>:
lib/rbtree: fix coding style of assignments
Dan Carpenter <dan.carpenter@oracle.com>:
lib/test_kmod.c: remove a NULL test
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
linux/bits.h: add compile time sanity check of GENMASK inputs
Chris Wilson <chris@chris-wilson.co.uk>:
lib/list: prevent compiler reloads inside 'safe' list iteration
Nathan Chancellor <natechancellor@gmail.com>:
lib/dynamic_debug.c: use address-of operator on section symbols
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: remove email address comment from email address comparisons
Lubomir Rintel <lkundrak@v3.sk>:
checkpatch: check SPDX tags in YAML files
John Hubbard <jhubbard@nvidia.com>:
checkpatch: support "base-commit:" format
Joe Perches <joe@perches.com>:
checkpatch: prefer fallthrough; over fallthrough comments
Antonio Borneo <borneo.antonio@gmail.com>:
checkpatch: fix minor typo and mixed space+tab in indentation
checkpatch: fix multiple const * types
checkpatch: add command-line option for TAB size
Joe Perches <joe@perches.com>:
checkpatch: improve Gerrit Change-Id: test
Lubomir Rintel <lkundrak@v3.sk>:
checkpatch: check proper licensing of Devicetree bindings
Joe Perches <joe@perches.com>:
checkpatch: avoid warning about uninitialized_var()
Subsystem: epoll
Roman Penyaev <rpenyaev@suse.de>:
kselftest: introduce new epoll test case
Jason Baron <jbaron@akamai.com>:
fs/epoll: make nesting accounting safe for -rt kernel
Subsystem: binfmt
Alexey Dobriyan <adobriyan@gmail.com>:
fs/binfmt_elf.c: delete "loc" variable
fs/binfmt_elf.c: allocate less for static executable
fs/binfmt_elf.c: don't free interpreter's ELF pheaders on common path
Subsystem: kallsyms
Will Deacon <will@kernel.org>:
Patch series "Unexport kallsyms_lookup_name() and kallsyms_on_each_symbol()":
samples/hw_breakpoint: drop HW_BREAKPOINT_R when reporting writes
samples/hw_breakpoint: drop use of kallsyms_lookup_name()
kallsyms: unexport kallsyms_lookup_name() and kallsyms_on_each_symbol()
Subsystem: reiserfs
Colin Ian King <colin.king@canonical.com>:
reiserfs: clean up several indentation issues
Subsystem: kmod
Qiujun Huang <hqjagain@gmail.com>:
kernel/kmod.c: fix a typo "assuems" -> "assumes"
Subsystem: gcov
"Gustavo A. R. Silva" <gustavo@embeddedor.com>:
gcov: gcc_4_7: replace zero-length array with flexible-array member
gcov: gcc_3_4: replace zero-length array with flexible-array member
kernel/gcov/fs.c: replace zero-length array with flexible-array member
Subsystem: kconfig
Krzysztof Kozlowski <krzk@kernel.org>:
init/Kconfig: clean up ANON_INODES and old IO schedulers options
Subsystem: kcov
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kcov: collect coverage from usb soft interrupts", v4:
kcov: cleanup debug messages
kcov: fix potential use-after-free in kcov_remote_start
kcov: move t->kcov assignments into kcov_start/stop
kcov: move t->kcov_sequence assignment
kcov: use t->kcov_mode as enabled indicator
kcov: collect coverage from interrupts
usb: core: kcov: collect coverage from usb complete callback
Subsystem: ubsan
Kees Cook <keescook@chromium.org>:
Patch series "ubsan: Split out bounds checker", v5:
ubsan: add trap instrumentation option
ubsan: split "bounds" checker from other options
drivers/misc/lkdtm/bugs.c: add arithmetic overflow and array bounds checks
ubsan: check panic_on_warn
kasan: unset panic_on_warn before calling panic()
ubsan: include bug type in report header
Subsystem: fault-injection
Qiujun Huang <hqjagain@gmail.com>:
lib/Kconfig.debug: fix a typo "capabilitiy" -> "capability"
Subsystem: ipc
Somala Swaraj <somalaswaraj@gmail.com>:
ipc/mqueue.c: fix a brace coding style issue
Jason Yan <yanaijie@huawei.com>:
ipc/shm.c: make compat_ksys_shmctl() static
Documentation/admin-guide/kernel-parameters.txt | 13
Documentation/admin-guide/mm/transhuge.rst | 14
Documentation/admin-guide/mm/userfaultfd.rst | 51
Documentation/dev-tools/kcov.rst | 17
Documentation/vm/free_page_reporting.rst | 41
Documentation/vm/zswap.rst | 20
MAINTAINERS | 35
arch/alpha/include/asm/mmzone.h | 2
arch/alpha/kernel/syscalls/syscallhdr.sh | 2
arch/csky/mm/fault.c | 4
arch/ia64/kernel/syscalls/syscallhdr.sh | 2
arch/ia64/kernel/vmlinux.lds.S | 2
arch/m68k/mm/fault.c | 4
arch/microblaze/kernel/syscalls/syscallhdr.sh | 2
arch/mips/kernel/syscalls/syscallhdr.sh | 3
arch/mips/mm/fault.c | 4
arch/nds32/kernel/vmlinux.lds.S | 1
arch/parisc/kernel/syscalls/syscallhdr.sh | 2
arch/powerpc/kernel/syscalls/syscallhdr.sh | 3
arch/powerpc/kvm/e500_mmu_host.c | 2
arch/powerpc/mm/fault.c | 2
arch/powerpc/platforms/powernv/memtrace.c | 14
arch/sh/kernel/syscalls/syscallhdr.sh | 2
arch/sh/mm/fault.c | 2
arch/sparc/kernel/syscalls/syscallhdr.sh | 2
arch/sparc/vdso/vdso32/vclock_gettime.c | 4
arch/x86/Kconfig | 1
arch/x86/configs/i386_defconfig | 1
arch/x86/configs/x86_64_defconfig | 1
arch/x86/entry/vdso/vdso32/vclock_gettime.c | 4
arch/x86/include/asm/pgtable.h | 67 +
arch/x86/include/asm/pgtable_64.h | 8
arch/x86/include/asm/pgtable_types.h | 12
arch/x86/mm/fault.c | 2
arch/xtensa/kernel/syscalls/syscallhdr.sh | 2
drivers/base/memory.c | 138 --
drivers/hv/hv_balloon.c | 25
drivers/misc/lkdtm/bugs.c | 75 +
drivers/misc/lkdtm/core.c | 3
drivers/misc/lkdtm/lkdtm.h | 3
drivers/usb/core/hcd.c | 3
drivers/virtio/Kconfig | 1
drivers/virtio/virtio_balloon.c | 190 ++-
fs/binfmt_elf.c | 56
fs/eventpoll.c | 64 -
fs/proc/array.c | 39
fs/proc/cpuinfo.c | 1
fs/proc/generic.c | 31
fs/proc/inode.c | 188 ++-
fs/proc/internal.h | 6
fs/proc/kmsg.c | 1
fs/proc/stat.c | 1
fs/proc/task_mmu.c | 97 -
fs/reiserfs/do_balan.c | 2
fs/reiserfs/ioctl.c | 11
fs/reiserfs/namei.c | 10
fs/seq_file.c | 28
fs/userfaultfd.c | 116 +
include/asm-generic/pgtable.h | 1
include/asm-generic/pgtable_uffd.h | 66 +
include/asm-generic/tlb.h | 3
include/linux/bitops.h | 4
include/linux/bits.h | 22
include/linux/compiler.h | 2
include/linux/compiler_types.h | 11
include/linux/gfp.h | 2
include/linux/huge_mm.h | 2
include/linux/list.h | 50
include/linux/memory.h | 1
include/linux/memory_hotplug.h | 13
include/linux/memremap.h | 2
include/linux/mm.h | 25
include/linux/mm_inline.h | 15
include/linux/mm_types.h | 4
include/linux/mmzone.h | 47
include/linux/page-flags.h | 16
include/linux/page_reporting.h | 26
include/linux/pagemap.h | 4
include/linux/percpu_counter.h | 4
include/linux/proc_fs.h | 17
include/linux/sched.h | 3
include/linux/seq_file.h | 1
include/linux/shmem_fs.h | 10
include/linux/stackdepot.h | 2
include/linux/swapops.h | 5
include/linux/userfaultfd_k.h | 42
include/linux/vm_event_item.h | 5
include/trace/events/huge_memory.h | 1
include/trace/events/mmflags.h | 1
include/trace/events/vmscan.h | 2
include/uapi/linux/userfaultfd.h | 40
include/uapi/linux/virtio_balloon.h | 1
init/Kconfig | 8
ipc/mqueue.c | 5
ipc/shm.c | 2
ipc/util.c | 1
kernel/configs/tiny.config | 1
kernel/events/core.c | 3
kernel/extable.c | 3
kernel/fork.c | 10
kernel/gcov/fs.c | 2
kernel/gcov/gcc_3_4.c | 6
kernel/gcov/gcc_4_7.c | 2
kernel/kallsyms.c | 2
kernel/kcov.c | 282 +++-
kernel/kmod.c | 2
kernel/module.c | 1
kernel/sched/fair.c | 2
lib/Kconfig.debug | 35
lib/Kconfig.ubsan | 51
lib/Makefile | 8
lib/bch.c | 2
lib/dynamic_debug.c | 2
lib/rbtree.c | 4
lib/scatterlist.c | 2
lib/stackdepot.c | 39
lib/test_bitmap.c | 2
lib/test_kmod.c | 2
lib/test_lockup.c | 601 +++++++++-
lib/test_stackinit.c | 28
lib/ts_bm.c | 2
lib/ts_fsm.c | 2
lib/ts_kmp.c | 2
lib/ubsan.c | 47
mm/Kconfig | 135 ++
mm/Makefile | 1
mm/compaction.c | 3
mm/dmapool.c | 4
mm/filemap.c | 14
mm/gup.c | 9
mm/huge_memory.c | 36
mm/hugetlb.c | 1
mm/hugetlb_cgroup.c | 6
mm/internal.h | 2
mm/kasan/common.c | 23
mm/kasan/report.c | 10
mm/khugepaged.c | 39
mm/ksm.c | 5
mm/list_lru.c | 2
mm/memcontrol.c | 5
mm/memory-failure.c | 2
mm/memory.c | 42
mm/memory_hotplug.c | 53
mm/mempolicy.c | 11
mm/migrate.c | 122 +-
mm/mm_init.c | 2
mm/mmap.c | 10
mm/mprotect.c | 76 -
mm/page_alloc.c | 174 ++
mm/page_ext.c | 5
mm/page_isolation.c | 6
mm/page_reporting.c | 384 ++++++
mm/page_reporting.h | 54
mm/rmap.c | 23
mm/shmem.c | 168 +-
mm/shuffle.c | 12
mm/shuffle.h | 6
mm/slab_common.c | 1
mm/slub.c | 3
mm/sparse.c | 236 ++-
mm/swap.c | 20
mm/swapfile.c | 1
mm/userfaultfd.c | 98 +
mm/vmalloc.c | 2
mm/vmscan.c | 12
mm/vmstat.c | 3
mm/zsmalloc.c | 10
mm/zswap.c | 24
samples/hw_breakpoint/data_breakpoint.c | 11
scripts/Makefile.ubsan | 16
scripts/checkpatch.pl | 155 +-
tools/lib/rbtree.c | 4
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 67 +
tools/testing/selftests/vm/userfaultfd.c | 233 +++
174 files changed, 3990 insertions(+), 1399 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-04-10 21:30 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-04-10 21:30 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
Almost all of the rest of MM. Various other things.
35 patches, based on c0cc271173b2e1c2d8d0ceaef14e4dfa79eefc0d.
Subsystems affected by this patch series:
hfs
mm/memcg
mm/slab-generic
mm/slab
mm/pagealloc
mm/gup
ocfs2
mm/hugetlb
mm/pagemap
mm/memremap
kmod
misc
seqfile
Subsystem: hfs
Simon Gander <simon@tuxera.com>:
hfsplus: fix crash and filesystem corruption when deleting files
Subsystem: mm/memcg
Jakub Kicinski <kuba@kernel.org>:
mm, memcg: do not high throttle allocators based on wraparound
Subsystem: mm/slab-generic
Qiujun Huang <hqjagain@gmail.com>:
mm, slab_common: fix a typo in comment "eariler"->"earlier"
Subsystem: mm/slab
Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
docs: mm: slab.h: fix a broken cross-reference
Subsystem: mm/pagealloc
Randy Dunlap <rdunlap@infradead.org>:
mm/page_alloc.c: fix kernel-doc warning
Jason Yan <yanaijie@huawei.com>:
mm/page_alloc: make pcpu_drain_mutex and pcpu_drain static
Subsystem: mm/gup
Miles Chen <miles.chen@mediatek.com>:
mm/gup: fix null pointer dereference detected by coverity
Subsystem: ocfs2
Changwei Ge <chge@linux.alibaba.com>:
ocfs2: no need try to truncate file beyond i_size
Subsystem: mm/hugetlb
Aslan Bakirov <aslan@fb.com>:
mm: cma: NUMA node interface
Roman Gushchin <guro@fb.com>:
mm: hugetlb: optionally allocate gigantic hugepages using cma
Subsystem: mm/pagemap
Jaewon Kim <jaewon31.kim@samsung.com>:
mm/mmap.c: initialize align_offset explicitly for vm_unmapped_area
Arjun Roy <arjunroy@google.com>:
mm/memory.c: refactor insert_page to prepare for batched-lock insert
mm: bring sparc pte_index() semantics inline with other platforms
mm: define pte_index as macro for x86
mm/memory.c: add vm_insert_pages()
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/vma: define a default value for VM_DATA_DEFAULT_FLAGS
mm/vma: introduce VM_ACCESS_FLAGS
mm/special: create generic fallbacks for pte_special() and pte_mkspecial()
Subsystem: mm/memremap
Logan Gunthorpe <logang@deltatee.com>:
Patch series "Allow setting caching mode in arch_add_memory() for P2PDMA", v4:
mm/memory_hotplug: drop the flags field from struct mhp_restrictions
mm/memory_hotplug: rename mhp_restrictions to mhp_params
x86/mm: thread pgprot_t through init_memory_mapping()
x86/mm: introduce __set_memory_prot()
powerpc/mm: thread pgprot_t through create_section_mapping()
mm/memory_hotplug: add pgprot_t to mhp_params
mm/memremap: set caching mode for PCI P2PDMA memory to WC
Subsystem: kmod
Eric Biggers <ebiggers@google.com>:
Patch series "module autoloading fixes and cleanups", v5:
kmod: make request_module() return an error when autoloading is disabled
fs/filesystems.c: downgrade user-reachable WARN_ONCE() to pr_warn_once()
docs: admin-guide: document the kernel.modprobe sysctl
selftests: kmod: fix handling test numbers above 9
selftests: kmod: test disabling module autoloading
Subsystem: misc
Pali Rohár <pali@kernel.org>:
change email address for Pali Rohár
kbuild test robot <lkp@intel.com>:
drivers/dma/tegra20-apb-dma.c: fix platform_get_irq.cocci warnings
Subsystem: seqfile
Vasily Averin <vvs@virtuozzo.com>:
Patch series "seq_file .next functions should increase position index":
fs/seq_file.c: seq_read(): add info message about buggy .next functions
kernel/gcov/fs.c: gcov_seq_next() should increase position index
ipc/util.c: sysvipc_find_ipc() should increase position index
Documentation/ABI/testing/sysfs-platform-dell-laptop | 8
Documentation/admin-guide/kernel-parameters.txt | 8
Documentation/admin-guide/sysctl/kernel.rst | 21 ++
MAINTAINERS | 16 -
arch/alpha/include/asm/page.h | 3
arch/alpha/include/asm/pgtable.h | 2
arch/arc/include/asm/page.h | 2
arch/arm/include/asm/page.h | 4
arch/arm/include/asm/pgtable-2level.h | 2
arch/arm/include/asm/pgtable.h | 15 -
arch/arm/mach-omap2/omap-secure.c | 2
arch/arm/mach-omap2/omap-secure.h | 2
arch/arm/mach-omap2/omap-smc.S | 2
arch/arm/mm/fault.c | 2
arch/arm/mm/mmu.c | 14 +
arch/arm64/include/asm/page.h | 4
arch/arm64/mm/fault.c | 2
arch/arm64/mm/init.c | 6
arch/arm64/mm/mmu.c | 7
arch/c6x/include/asm/page.h | 5
arch/csky/include/asm/page.h | 3
arch/csky/include/asm/pgtable.h | 3
arch/h8300/include/asm/page.h | 2
arch/hexagon/include/asm/page.h | 3
arch/hexagon/include/asm/pgtable.h | 2
arch/ia64/include/asm/page.h | 5
arch/ia64/include/asm/pgtable.h | 2
arch/ia64/mm/init.c | 7
arch/m68k/include/asm/mcf_pgtable.h | 10 -
arch/m68k/include/asm/motorola_pgtable.h | 2
arch/m68k/include/asm/page.h | 3
arch/m68k/include/asm/sun3_pgtable.h | 2
arch/microblaze/include/asm/page.h | 2
arch/microblaze/include/asm/pgtable.h | 4
arch/mips/include/asm/page.h | 5
arch/mips/include/asm/pgtable.h | 44 +++-
arch/nds32/include/asm/page.h | 3
arch/nds32/include/asm/pgtable.h | 9 -
arch/nds32/mm/fault.c | 2
arch/nios2/include/asm/page.h | 3
arch/nios2/include/asm/pgtable.h | 3
arch/openrisc/include/asm/page.h | 5
arch/openrisc/include/asm/pgtable.h | 2
arch/parisc/include/asm/page.h | 3
arch/parisc/include/asm/pgtable.h | 2
arch/powerpc/include/asm/book3s/64/hash.h | 3
arch/powerpc/include/asm/book3s/64/radix.h | 3
arch/powerpc/include/asm/page.h | 9 -
arch/powerpc/include/asm/page_64.h | 7
arch/powerpc/include/asm/sparsemem.h | 3
arch/powerpc/mm/book3s64/hash_utils.c | 5
arch/powerpc/mm/book3s64/pgtable.c | 7
arch/powerpc/mm/book3s64/pkeys.c | 2
arch/powerpc/mm/book3s64/radix_pgtable.c | 18 +-
arch/powerpc/mm/mem.c | 12 -
arch/riscv/include/asm/page.h | 3
arch/s390/include/asm/page.h | 3
arch/s390/mm/fault.c | 2
arch/s390/mm/init.c | 9 -
arch/sh/include/asm/page.h | 3
arch/sh/mm/init.c | 7
arch/sparc/include/asm/page_32.h | 3
arch/sparc/include/asm/page_64.h | 3
arch/sparc/include/asm/pgtable_32.h | 7
arch/sparc/include/asm/pgtable_64.h | 10 -
arch/um/include/asm/pgtable.h | 10 -
arch/unicore32/include/asm/page.h | 3
arch/unicore32/include/asm/pgtable.h | 3
arch/unicore32/mm/fault.c | 2
arch/x86/include/asm/page_types.h | 7
arch/x86/include/asm/pgtable.h | 6
arch/x86/include/asm/set_memory.h | 1
arch/x86/kernel/amd_gart_64.c | 3
arch/x86/kernel/setup.c | 4
arch/x86/mm/init.c | 9 -
arch/x86/mm/init_32.c | 19 +-
arch/x86/mm/init_64.c | 42 ++--
arch/x86/mm/mm_internal.h | 3
arch/x86/mm/pat/set_memory.c | 13 +
arch/x86/mm/pkeys.c | 2
arch/x86/platform/uv/bios_uv.c | 3
arch/x86/um/asm/vm-flags.h | 10 -
arch/xtensa/include/asm/page.h | 3
arch/xtensa/include/asm/pgtable.h | 3
drivers/char/hw_random/omap3-rom-rng.c | 4
drivers/dma/tegra20-apb-dma.c | 1
drivers/hwmon/dell-smm-hwmon.c | 4
drivers/platform/x86/dell-laptop.c | 4
drivers/platform/x86/dell-rbtn.c | 4
drivers/platform/x86/dell-rbtn.h | 2
drivers/platform/x86/dell-smbios-base.c | 4
drivers/platform/x86/dell-smbios-smm.c | 2
drivers/platform/x86/dell-smbios.h | 2
drivers/platform/x86/dell-smo8800.c | 2
drivers/platform/x86/dell-wmi.c | 4
drivers/power/supply/bq2415x_charger.c | 4
drivers/power/supply/bq27xxx_battery.c | 2
drivers/power/supply/isp1704_charger.c | 2
drivers/power/supply/rx51_battery.c | 4
drivers/staging/gasket/gasket_core.c | 2
fs/filesystems.c | 4
fs/hfsplus/attributes.c | 4
fs/ocfs2/alloc.c | 4
fs/seq_file.c | 7
fs/udf/ecma_167.h | 2
fs/udf/osta_udf.h | 2
include/linux/cma.h | 14 +
include/linux/hugetlb.h | 12 +
include/linux/memblock.h | 3
include/linux/memory_hotplug.h | 21 +-
include/linux/mm.h | 34 +++
include/linux/power/bq2415x_charger.h | 2
include/linux/slab.h | 2
ipc/util.c | 2
kernel/gcov/fs.c | 2
kernel/kmod.c | 4
mm/cma.c | 16 +
mm/gup.c | 3
mm/hugetlb.c | 109 ++++++++++++
mm/memblock.c | 2
mm/memcontrol.c | 3
mm/memory.c | 168 +++++++++++++++++--
mm/memory_hotplug.c | 13 -
mm/memremap.c | 17 +
mm/mmap.c | 4
mm/mprotect.c | 4
mm/page_alloc.c | 5
mm/slab_common.c | 2
tools/laptop/freefall/freefall.c | 2
tools/testing/selftests/kmod/kmod.sh | 43 ++++
130 files changed, 710 insertions(+), 370 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-04-12 7:41 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-04-12 7:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
A straggler. This patch caused a lot of build errors on a lot of
architectures for a long time, but Anshuman believes it's all fixed up
now.
1 patch, based on GIT b032227c62939b5481bcd45442b36dfa263f4a7c.
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/debug: add tests validating architecture page table helpers
Documentation/features/debug/debug-vm-pgtable/arch-support.txt | 34
arch/arc/Kconfig | 1
arch/arm64/Kconfig | 1
arch/powerpc/Kconfig | 1
arch/s390/Kconfig | 1
arch/x86/Kconfig | 1
arch/x86/include/asm/pgtable_64.h | 6
include/linux/mmdebug.h | 5
init/main.c | 2
lib/Kconfig.debug | 26
mm/Makefile | 1
mm/debug_vm_pgtable.c | 392 ++++++++++
12 files changed, 471 insertions(+)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-04-21 1:13 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-04-21 1:13 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
15 fixes, based on ae83d0b416db002fe95601e7f97f64b59514d936:
Masahiro Yamada <masahiroy@kernel.org>:
sh: fix build error in mm/init.c
Kees Cook <keescook@chromium.org>:
slub: avoid redzone when choosing freepointer location
Peter Xu <peterx@redhat.com>:
mm/userfaultfd: disable userfaultfd-wp on x86_32
Bartosz Golaszewski <bgolaszewski@baylibre.com>:
MAINTAINERS: add an entry for kfifo
Longpeng <longpeng2@huawei.com>:
mm/hugetlb: fix a addressing exception caused by huge_pte_offset
Michal Hocko <mhocko@suse.com>:
mm, gup: return EINTR when gup is interrupted by fatal signals
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
checkpatch: fix a typo in the regex for $allocFunctions
George Burgess IV <gbiv@google.com>:
tools/build: tweak unused value workaround
Muchun Song <songmuchun@bytedance.com>:
mm/ksm: fix NULL pointer dereference when KSM zero page is enabled
Hugh Dickins <hughd@google.com>:
mm/shmem: fix build without THP
Jann Horn <jannh@google.com>:
vmalloc: fix remap_vmalloc_range() bounds checks
Hugh Dickins <hughd@google.com>:
shmem: fix possible deadlocks on shmlock_user_lock
Yang Shi <yang.shi@linux.alibaba.com>:
mm: shmem: disable interrupt when acquiring info->lock in userfaultfd_copy path
Sudip Mukherjee <sudipm.mukherjee@gmail.com>:
coredump: fix null pointer dereference on coredump
Lucas Stach <l.stach@pengutronix.de>:
tools/vm: fix cross-compile build
MAINTAINERS | 7 +++++++
arch/sh/mm/init.c | 2 +-
arch/x86/Kconfig | 2 +-
fs/coredump.c | 2 ++
fs/proc/vmcore.c | 5 +++--
include/linux/vmalloc.h | 2 +-
mm/gup.c | 2 +-
mm/hugetlb.c | 14 ++++++++------
mm/ksm.c | 12 ++++++++++--
mm/shmem.c | 13 ++++++++-----
mm/slub.c | 12 ++++++++++--
mm/vmalloc.c | 16 +++++++++++++---
samples/vfio-mdev/mdpy.c | 2 +-
scripts/checkpatch.pl | 2 +-
tools/build/feature/test-sync-compare-and-swap.c | 2 +-
tools/vm/Makefile | 2 ++
16 files changed, 70 insertions(+), 27 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-05-08 1:35 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-05-08 1:35 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
14 fixes and one selftest to verify the ipc fixes herein.
15 patches, based on a811c1fa0a02c062555b54651065899437bacdbe:
Oleg Nesterov <oleg@redhat.com>:
ipc/mqueue.c: change __do_notify() to bypass check_kill_permission()
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: fix error return value of mem_cgroup_css_alloc()
David Hildenbrand <david@redhat.com>:
mm/page_alloc: fix watchdog soft lockups during set_zone_contiguous()
Maciej Grochowski <maciej.grochowski@pm.me>:
kernel/kcov.c: fix typos in kcov_remote_start documentation
Ivan Delalande <colona@arista.com>:
scripts/decodecode: fix trapping instruction formatting
Janakarajan Natarajan <Janakarajan.Natarajan@amd.com>:
arch/x86/kvm/svm/sev.c: change flag passed to GUP fast in sev_pin_memory()
Khazhismel Kumykov <khazhy@google.com>:
eventpoll: fix missing wakeup for ovflist in ep_poll_callback
Aymeric Agon-Rambosson <aymeric.agon@yandex.com>:
scripts/gdb: repair rb_first() and rb_last()
Waiman Long <longman@redhat.com>:
mm/slub: fix incorrect interpretation of s->offset
Filipe Manana <fdmanana@suse.com>:
percpu: make pcpu_alloc() aware of current gfp context
Roman Penyaev <rpenyaev@suse.de>:
kselftests: introduce new epoll60 testcase for catching lost wakeups
epoll: atomically remove wait entry on wake up
Qiwu Chen <qiwuchen55@gmail.com>:
mm/vmscan: remove unnecessary argument description of isolate_lru_pages()
Kees Cook <keescook@chromium.org>:
ubsan: disable UBSAN_ALIGNMENT under COMPILE_TEST
Henry Willard <henry.willard@oracle.com>:
mm: limit boost_watermark on small zones
arch/x86/kvm/svm/sev.c | 2
fs/eventpoll.c | 61 ++--
ipc/mqueue.c | 34 +-
kernel/kcov.c | 4
lib/Kconfig.ubsan | 15 -
mm/memcontrol.c | 15 -
mm/page_alloc.c | 9
mm/percpu.c | 14
mm/slub.c | 45 ++-
mm/vmscan.c | 1
scripts/decodecode | 2
scripts/gdb/linux/rbtree.py | 4
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 146 ++++++++++
tools/testing/selftests/wireguard/qemu/debug.config | 1
14 files changed, 275 insertions(+), 78 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-05-14 0:50 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-05-14 0:50 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
7 fixes, based on 24085f70a6e1b0cb647ec92623284641d8270637:
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: fix inconsistent oom event behavior
Roman Penyaev <rpenyaev@suse.de>:
epoll: call final ep_events_available() check under the lock
Peter Xu <peterx@redhat.com>:
mm/gup: fix fixup_user_fault() on multiple retries
Brian Geffon <bgeffon@google.com>:
userfaultfd: fix remap event with MREMAP_DONTUNMAP
Vasily Averin <vvs@virtuozzo.com>:
ipc/util.c: sysvipc_find_ipc() incorrectly updates position index
Andrey Konovalov <andreyknvl@google.com>:
kasan: consistently disable debugging features
kasan: add missing functions declarations to kasan.h
fs/eventpoll.c | 48 ++++++++++++++++++++++++++-------------------
include/linux/memcontrol.h | 2 +
ipc/util.c | 12 +++++------
mm/gup.c | 12 ++++++-----
mm/kasan/Makefile | 15 +++++++++-----
mm/kasan/kasan.h | 34 ++++++++++++++++++++++++++++++-
mm/mremap.c | 2 -
7 files changed, 86 insertions(+), 39 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-05-23 5:22 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-05-23 5:22 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
11 fixes, based on 444565650a5fe9c63ddf153e6198e31705dedeb2:
David Hildenbrand <david@redhat.com>:
device-dax: don't leak kernel memory to user space after unloading kmem
Nick Desaulniers <ndesaulniers@google.com>:
x86: bitops: fix build regression
John Hubbard <jhubbard@nvidia.com>:
rapidio: fix an error in get_user_pages_fast() error handling
selftests/vm/.gitignore: add mremap_dontunmap
selftests/vm/write_to_hugetlbfs.c: fix unused variable warning
Marco Elver <elver@google.com>:
kasan: disable branch tracing for core runtime
Arnd Bergmann <arnd@arndb.de>:
sh: include linux/time_types.h for sockios
Naoya Horiguchi <n-horiguchi@ah.jp.nec.com>:
MAINTAINERS: update email address for Naoya Horiguchi
Mike Rapoport <rppt@linux.ibm.com>:
sparc32: use PUD rather than PGD to get PMD in srmmu_nocache_init()
Uladzislau Rezki <uladzislau.rezki@sony.com>:
z3fold: fix use-after-free when freeing handles
Baoquan He <bhe@redhat.com>:
MAINTAINERS: add files related to kdump
MAINTAINERS | 7 ++++++-
arch/sh/include/uapi/asm/sockios.h | 2 ++
arch/sparc/mm/srmmu.c | 2 +-
arch/x86/include/asm/bitops.h | 12 ++++++------
drivers/dax/kmem.c | 14 +++++++++++---
drivers/rapidio/devices/rio_mport_cdev.c | 5 +++++
mm/kasan/Makefile | 16 ++++++++--------
mm/kasan/generic.c | 1 -
mm/kasan/tags.c | 1 -
mm/z3fold.c | 11 ++++++-----
tools/testing/selftests/vm/.gitignore | 1 +
tools/testing/selftests/vm/write_to_hugetlbfs.c | 2 --
12 files changed, 46 insertions(+), 28 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-05-28 5:20 Andrew Morton
2020-05-28 20:10 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2020-05-28 5:20 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
5 fixes, based on 444fc5cde64330661bf59944c43844e7d4c2ccd8:
Qian Cai <cai@lca.pw>:
mm/z3fold: silence kmemleak false positives of slots
Hugh Dickins <hughd@google.com>:
mm,thp: stop leaking unreleased file pages
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
mm: remove VM_BUG_ON(PageSlab()) from page_mapcount()
Alexander Potapenko <glider@google.com>:
fs/binfmt_elf.c: allocate initialized memory in fill_thread_core_info()
Arnd Bergmann <arnd@arndb.de>:
include/asm-generic/topology.h: guard cpumask_of_node() macro argument
fs/binfmt_elf.c | 2 +-
include/asm-generic/topology.h | 2 +-
include/linux/mm.h | 19 +++++++++++++++----
mm/khugepaged.c | 1 +
mm/z3fold.c | 3 +++
5 files changed, 21 insertions(+), 6 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-05-28 5:20 incoming Andrew Morton
@ 2020-05-28 20:10 ` Linus Torvalds
2020-05-29 20:31 ` incoming Andrew Morton
0 siblings, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2020-05-28 20:10 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
Hmm..
On Wed, May 27, 2020 at 10:20 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> fs/binfmt_elf.c | 2 +-
> include/asm-generic/topology.h | 2 +-
> include/linux/mm.h | 19 +++++++++++++++----
> mm/khugepaged.c | 1 +
> mm/z3fold.c | 3 +++
> 5 files changed, 21 insertions(+), 6 deletions(-)
I wonder how you generate that diffstat.
The change to <linux/mm.h> simply doesn't match what you sent me. The
patch you sent me that changed mm.h had this:
include/linux/mm.h | 15 +++++++++++++--
1 file changed, 13 insertions(+), 2 deletions(-)
(note 15 lines changed: it's +13 and -2) but now suddenly in your
overall diffstat you have that
include/linux/mm.h | 19 +++++++++++++++----
with +15/-4.
So your diffstat simply doesn't match what you are sending. What's going on?
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-05-28 20:10 ` incoming Linus Torvalds
@ 2020-05-29 20:31 ` Andrew Morton
2020-05-29 20:38 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2020-05-29 20:31 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, Linux-MM
On Thu, 28 May 2020 13:10:18 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> Hmm..
>
> On Wed, May 27, 2020 at 10:20 PM Andrew Morton
> <akpm@linux-foundation.org> wrote:
> >
> > fs/binfmt_elf.c | 2 +-
> > include/asm-generic/topology.h | 2 +-
> > include/linux/mm.h | 19 +++++++++++++++----
> > mm/khugepaged.c | 1 +
> > mm/z3fold.c | 3 +++
> > 5 files changed, 21 insertions(+), 6 deletions(-)
>
> I wonder how you generate that diffstat.
>
> The change to <linux/mm.h> simply doesn't match what you sent me. The
> patch you sent me that changed mm.h had this:
>
> include/linux/mm.h | 15 +++++++++++++--
> 1 file changed, 13 insertions(+), 2 deletions(-)
>
> (note 15 lines changed: it's +13 and -2) but now suddenly in your
> overall diffstat you have that
>
> include/linux/mm.h | 19 +++++++++++++++----
>
> with +15/-4.
>
> So your diffstat simply doesn't match what you are sending. What's going on?
>
Bah. I got lazy (didn't want to interrupt an ongoing build) so I
generated the diffstat prior to folding two patches into a single one.
Evidently diffstat isn't as smart as I had assumed!
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-05-29 20:31 ` incoming Andrew Morton
@ 2020-05-29 20:38 ` Linus Torvalds
2020-05-29 21:12 ` incoming Andrew Morton
0 siblings, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2020-05-29 20:38 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Fri, May 29, 2020 at 1:31 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> Bah. I got lazy (didn't want to interrupt an ongoing build) so I
> generated the diffstat prior to folding two patches into a single one.
> Evidently diffstat isn't as smart as I had assumed!
Ahh. Yes - given two patches, diffstat just adds up the line number
counts for the individual diffs, it doesn't count some kind of
"combined diff result" line counts.
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-05-29 20:38 ` incoming Linus Torvalds
@ 2020-05-29 21:12 ` Andrew Morton
2020-05-29 21:20 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2020-05-29 21:12 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, Linux-MM
On Fri, 29 May 2020 13:38:35 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Fri, May 29, 2020 at 1:31 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > Bah. I got lazy (didn't want to interrupt an ongoing build) so I
> > generated the diffstat prior to folding two patches into a single one.
> > Evidently diffstat isn't as smart as I had assumed!
>
> Ahh. Yes - given two patches, diffstat just adds up the line number
> counts for the individual diffs, it doesn't count some kind of
> "combined diff result" line counts.
Stupid diffstat. Means that basically all my diffstats are very wrong.
Thanks for spotting it.
I can fix that...
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-05-29 21:12 ` incoming Andrew Morton
@ 2020-05-29 21:20 ` Linus Torvalds
0 siblings, 0 replies; 348+ messages in thread
From: Linus Torvalds @ 2020-05-29 21:20 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Fri, May 29, 2020 at 2:12 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> Stupid diffstat. Means that basically all my diffstats are very wrong.
I'm actually used to diffstats not matching 100%/
Usually it's not due to this issue - a "git diff --stat" *will* give
the stat from the actual combined diff result - but with git diffstats
the issue is that I might have gotten a patch from another source.
So the diffstat I see after-the-merge is possibly different from the
pre-merge diffstat simply due to merge issues.
So then I usually take a look at "ok, why did that diffstat differ"
and go "Ahh".
In your case, when I looked at the diffstat, I couldn't for the life
of me see how you would have gotten the diffstat you did, since I only
saw a single patch with no merge issues.
> Thanks for spotting it.
>
> I can fix that...
I can also just live with it, knowing what your workflow is. The
diffstat matching exactly just isn't that important - in fact,
different versions of "diff" can give slightly different output anyway
depending on diff algorithms even when they are looking at the exact
same before/after state. There's not necessarily always only one way
to generate a valid diff.
So to me, the diffstat is more of a guide than a hard thing, and I
want to see the rough outline,
In fact, one reason I want to see it in pull requests is actually just
that I want to get a feel for what changes even before I do the pull
or merge, so it's not just a "match against what I get" thing.
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-06-02 4:44 Andrew Morton
2020-06-02 20:08 ` incoming Andrew Morton
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2020-06-02 4:44 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
A few little subsystems and a start of a lot of MM patches.
128 patches, based on 9bf9511e3d9f328c03f6f79bfb741c3d18f2f2c0:
Subsystems affected by this patch series:
squashfs
ocfs2
parisc
vfs
mm/slab-generic
mm/slub
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/memory-failure
mm/vmalloc
mm/kasan
Subsystem: squashfs
Philippe Liard <pliard@google.com>:
squashfs: migrate from ll_rw_block usage to BIO
Subsystem: ocfs2
Jules Irenge <jbi.octave@gmail.com>:
ocfs2: add missing annotation for dlm_empty_lockres()
Gang He <ghe@suse.com>:
ocfs2: mount shared volume without ha stack
Subsystem: parisc
Andrew Morton <akpm@linux-foundation.org>:
arch/parisc/include/asm/pgtable.h: remove unused `old_pte'
Subsystem: vfs
Jeff Layton <jlayton@redhat.com>:
Patch series "vfs: have syncfs() return error when there are writeback:
vfs: track per-sb writeback errors and report them to syncfs
fs/buffer.c: record blockdev write errors in super_block that it backs
Subsystem: mm/slab-generic
Vlastimil Babka <vbabka@suse.cz>:
usercopy: mark dma-kmalloc caches as usercopy caches
Subsystem: mm/slub
Dongli Zhang <dongli.zhang@oracle.com>:
mm/slub.c: fix corrupted freechain in deactivate_slab()
Christoph Lameter <cl@linux.com>:
slub: Remove userspace notifier for cache add/remove
Christopher Lameter <cl@linux.com>:
slub: remove kmalloc under list_lock from list_slab_objects() V2
Qian Cai <cai@lca.pw>:
mm/slub: fix stack overruns with SLUB_STATS
Andrew Morton <akpm@linux-foundation.org>:
Documentation/vm/slub.rst: s/Toggle/Enable/
Subsystem: mm/debug
Vlastimil Babka <vbabka@suse.cz>:
mm, dump_page(): do not crash with invalid mapping pointer
Subsystem: mm/pagecache
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Change readahead API", v11:
mm: move readahead prototypes from mm.h
mm: return void from various readahead functions
mm: ignore return value of ->readpages
mm: move readahead nr_pages check into read_pages
mm: add new readahead_control API
mm: use readahead_control to pass arguments
mm: rename various 'offset' parameters to 'index'
mm: rename readahead loop variable to 'i'
mm: remove 'page_offset' from readahead loop
mm: put readahead pages in cache earlier
mm: add readahead address space operation
mm: move end_index check out of readahead loop
mm: add page_cache_readahead_unbounded
mm: document why we don't set PageReadahead
mm: use memalloc_nofs_save in readahead path
fs: convert mpage_readpages to mpage_readahead
btrfs: convert from readpages to readahead
erofs: convert uncompressed files from readpages to readahead
erofs: convert compressed files from readpages to readahead
ext4: convert from readpages to readahead
ext4: pass the inode to ext4_mpage_readpages
f2fs: convert from readpages to readahead
f2fs: pass the inode to f2fs_mpage_readpages
fuse: convert from readpages to readahead
iomap: convert from readpages to readahead
Guoqing Jiang <guoqing.jiang@cloud.ionos.com>:
Patch series "Introduce attach/detach_page_private to cleanup code":
include/linux/pagemap.h: introduce attach/detach_page_private
md: remove __clear_page_buffers and use attach/detach_page_private
btrfs: use attach/detach_page_private
fs/buffer.c: use attach/detach_page_private
f2fs: use attach/detach_page_private
iomap: use attach/detach_page_private
ntfs: replace attach_page_buffers with attach_page_private
orangefs: use attach/detach_page_private
buffer_head.h: remove attach_page_buffers
mm/migrate.c: call detach_page_private to cleanup code
mm_types.h: change set_page_private to inline function
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap.c: remove misleading comment
Chao Yu <yuchao0@huawei.com>:
mm/page-writeback.c: remove unused variable
NeilBrown <neilb@suse.de>:
mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE
mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead
Subsystem: mm/gup
Souptick Joarder <jrdr.linux@gmail.com>:
mm/gup.c: update the documentation
John Hubbard <jhubbard@nvidia.com>:
mm/gup: introduce pin_user_pages_unlocked
ivtv: convert get_user_pages() --> pin_user_pages()
Miles Chen <miles.chen@mediatek.com>:
mm/gup.c: further document vma_permits_fault()
Subsystem: mm/swap
chenqiwu <chenqiwu@xiaomi.com>:
mm/swapfile: use list_{prev,next}_entry() instead of open-coding
Qian Cai <cai@lca.pw>:
mm/swap_state: fix a data race in swapin_nr_pages
Andrea Righi <andrea.righi@canonical.com>:
mm: swap: properly update readahead statistics in unuse_pte_range()
Wei Yang <richard.weiyang@gmail.com>:
mm/swapfile.c: offset is only used when there is more slots
mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive
mm/swapfile.c: remove the unnecessary goto for SSD case
mm/swapfile.c: simplify the calculation of n_goal
mm/swapfile.c: remove the extra check in scan_swap_map_slots()
mm/swapfile.c: found_free could be represented by (tmp < max)
mm/swapfile.c: tmp is always smaller than max
mm/swapfile.c: omit a duplicate code by compare tmp and max first
Huang Ying <ying.huang@intel.com>:
swap: try to scan more free slots even when fragmented
Wei Yang <richard.weiyang@gmail.com>:
mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable
mm/swapfile.c: __swap_entry_free() always free 1 entry
Huang Ying <ying.huang@intel.com>:
mm/swapfile.c: use prandom_u32_max()
swap: reduce lock contention on swap cache from swap slots allocation
Randy Dunlap <rdunlap@infradead.org>:
mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment
Miaohe Lin <linmiaohe@huawei.com>:
include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration
Subsystem: mm/memcg
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: add workingset_restore in memory.stat
Kaixu Xia <kaixuxia@tencent.com>:
mm: memcontrol: simplify value comparison between count and limit
Shakeel Butt <shakeelb@google.com>:
memcg: expose root cgroup's memory.stat
Jakub Kicinski <kuba@kernel.org>:
Patch series "memcg: Slow down swap allocation as the available space gets:
mm/memcg: prepare for swap over-high accounting and penalty calculation
mm/memcg: move penalty delay clamping out of calculate_high_delay()
mm/memcg: move cgroup high memory limit setting into struct page_counter
mm/memcg: automatically penalize tasks with high swap use
Zefan Li <lizefan@huawei.com>:
memcg: fix memcg_kmem_bypass() for remote memcg charging
Subsystem: mm/pagemap
Steven Price <steven.price@arm.com>:
Patch series "Fix W+X debug feature on x86":
x86: mm: ptdump: calculate effective permissions correctly
mm: ptdump: expand type of 'val' in note_page()
Huang Ying <ying.huang@intel.com>:
/proc/PID/smaps: Add PMD migration entry parsing
chenqiwu <chenqiwu@xiaomi.com>:
mm/memory: remove unnecessary pte_devmap case in copy_one_pte()
Subsystem: mm/memory-failure
Wetp Zhang <wetp.zy@linux.alibaba.com>:
mm, memory_failure: don't send BUS_MCEERR_AO for action required error
Subsystem: mm/vmalloc
Christoph Hellwig <hch@lst.de>:
Patch series "decruft the vmalloc API", v2:
x86/hyperv: use vmalloc_exec for the hypercall page
x86: fix vmap arguments in map_irq_stack
staging: android: ion: use vmap instead of vm_map_ram
staging: media: ipu3: use vmap instead of reimplementing it
dma-mapping: use vmap insted of reimplementing it
powerpc: add an ioremap_phb helper
powerpc: remove __ioremap_at and __iounmap_at
mm: remove __get_vm_area
mm: unexport unmap_kernel_range_noflush
mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING
mm: only allow page table mappings for built-in zsmalloc
mm: pass addr as unsigned long to vb_free
mm: remove vmap_page_range_noflush and vunmap_page_range
mm: rename vmap_page_range to map_kernel_range
mm: don't return the number of pages from map_kernel_range{,_noflush}
mm: remove map_vm_range
mm: remove unmap_vmap_area
mm: remove the prot argument from vm_map_ram
mm: enforce that vmap can't map pages executable
gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc
mm: remove the pgprot argument to __vmalloc
mm: remove the prot argument to __vmalloc_node
mm: remove both instances of __vmalloc_node_flags
mm: remove __vmalloc_node_flags_caller
mm: switch the test_vmalloc module to use __vmalloc_node
mm: remove vmalloc_user_node_flags
arm64: use __vmalloc_node in arch_alloc_vmap_stack
powerpc: use __vmalloc_node in alloc_vm_stack
s390: use __vmalloc_node in stack_alloc
Joerg Roedel <jroedel@suse.de>:
Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3:
mm: add functions to track page directory modifications
mm/vmalloc: track which page-table levels were modified
mm/ioremap: track which page-table levels were modified
x86/mm/64: implement arch_sync_kernel_mappings()
x86/mm/32: implement arch_sync_kernel_mappings()
mm: remove vmalloc_sync_(un)mappings()
x86/mm: remove vmalloc faulting
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix clang compilation warning due to stack protector
Kees Cook <keescook@chromium.org>:
ubsan: entirely disable alignment checks under UBSAN_TRAP
Jing Xia <jing.xia@unisoc.com>:
mm/mm_init.c: report kasan-tag information stored in page->flags
Andrey Konovalov <andreyknvl@google.com>:
kasan: move kasan_report() into report.c
Documentation/admin-guide/cgroup-v2.rst | 24 +
Documentation/core-api/cachetlb.rst | 2
Documentation/filesystems/locking.rst | 6
Documentation/filesystems/proc.rst | 4
Documentation/filesystems/vfs.rst | 15
Documentation/vm/slub.rst | 2
arch/arm/configs/omap2plus_defconfig | 2
arch/arm64/include/asm/pgtable.h | 3
arch/arm64/include/asm/vmap_stack.h | 6
arch/arm64/mm/dump.c | 2
arch/parisc/include/asm/pgtable.h | 2
arch/powerpc/include/asm/io.h | 10
arch/powerpc/include/asm/pci-bridge.h | 2
arch/powerpc/kernel/irq.c | 5
arch/powerpc/kernel/isa-bridge.c | 28 +
arch/powerpc/kernel/pci_64.c | 56 +-
arch/powerpc/mm/ioremap_64.c | 50 --
arch/riscv/include/asm/pgtable.h | 4
arch/riscv/mm/ptdump.c | 2
arch/s390/kernel/setup.c | 9
arch/sh/kernel/cpu/sh4/sq.c | 3
arch/x86/hyperv/hv_init.c | 5
arch/x86/include/asm/kvm_host.h | 3
arch/x86/include/asm/pgtable-2level_types.h | 2
arch/x86/include/asm/pgtable-3level_types.h | 2
arch/x86/include/asm/pgtable_64_types.h | 2
arch/x86/include/asm/pgtable_types.h | 8
arch/x86/include/asm/switch_to.h | 23 -
arch/x86/kernel/irq_64.c | 2
arch/x86/kernel/setup_percpu.c | 6
arch/x86/kvm/svm/sev.c | 3
arch/x86/mm/dump_pagetables.c | 35 +
arch/x86/mm/fault.c | 196 ----------
arch/x86/mm/init_64.c | 5
arch/x86/mm/pti.c | 8
arch/x86/mm/tlb.c | 37 -
block/blk-core.c | 1
drivers/acpi/apei/ghes.c | 6
drivers/base/node.c | 2
drivers/block/drbd/drbd_bitmap.c | 4
drivers/block/loop.c | 2
drivers/dax/device.c | 1
drivers/gpu/drm/drm_scatter.c | 11
drivers/gpu/drm/etnaviv/etnaviv_dump.c | 4
drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c | 2
drivers/lightnvm/pblk-init.c | 5
drivers/md/dm-bufio.c | 4
drivers/md/md-bitmap.c | 12
drivers/media/common/videobuf2/videobuf2-dma-sg.c | 3
drivers/media/common/videobuf2/videobuf2-vmalloc.c | 3
drivers/media/pci/ivtv/ivtv-udma.c | 19 -
drivers/media/pci/ivtv/ivtv-yuv.c | 17
drivers/media/pci/ivtv/ivtvfb.c | 4
drivers/mtd/ubi/io.c | 4
drivers/pcmcia/electra_cf.c | 45 --
drivers/scsi/sd_zbc.c | 3
drivers/staging/android/ion/ion_heap.c | 4
drivers/staging/media/ipu3/ipu3-css-pool.h | 4
drivers/staging/media/ipu3/ipu3-dmamap.c | 30 -
fs/block_dev.c | 7
fs/btrfs/disk-io.c | 4
fs/btrfs/extent_io.c | 64 ---
fs/btrfs/extent_io.h | 3
fs/btrfs/inode.c | 39 --
fs/buffer.c | 23 -
fs/erofs/data.c | 41 --
fs/erofs/decompressor.c | 2
fs/erofs/zdata.c | 31 -
fs/exfat/inode.c | 7
fs/ext2/inode.c | 10
fs/ext4/ext4.h | 5
fs/ext4/inode.c | 25 -
fs/ext4/readpage.c | 25 -
fs/ext4/verity.c | 35 -
fs/f2fs/data.c | 56 +-
fs/f2fs/f2fs.h | 14
fs/f2fs/verity.c | 35 -
fs/fat/inode.c | 7
fs/file_table.c | 1
fs/fs-writeback.c | 1
fs/fuse/file.c | 100 +----
fs/gfs2/aops.c | 23 -
fs/gfs2/dir.c | 9
fs/gfs2/quota.c | 2
fs/hpfs/file.c | 7
fs/iomap/buffered-io.c | 113 +----
fs/iomap/trace.h | 2
fs/isofs/inode.c | 7
fs/jfs/inode.c | 7
fs/mpage.c | 38 --
fs/nfs/blocklayout/extent_tree.c | 2
fs/nfs/internal.h | 10
fs/nfs/write.c | 4
fs/nfsd/vfs.c | 9
fs/nilfs2/inode.c | 15
fs/ntfs/aops.c | 2
fs/ntfs/malloc.h | 2
fs/ntfs/mft.c | 2
fs/ocfs2/aops.c | 34 -
fs/ocfs2/dlm/dlmmaster.c | 1
fs/ocfs2/ocfs2.h | 4
fs/ocfs2/slot_map.c | 46 +-
fs/ocfs2/super.c | 21 +
fs/omfs/file.c | 7
fs/open.c | 3
fs/orangefs/inode.c | 32 -
fs/proc/meminfo.c | 3
fs/proc/task_mmu.c | 16
fs/qnx6/inode.c | 7
fs/reiserfs/inode.c | 8
fs/squashfs/block.c | 273 +++++++-------
fs/squashfs/decompressor.h | 5
fs/squashfs/decompressor_multi.c | 9
fs/squashfs/decompressor_multi_percpu.c | 17
fs/squashfs/decompressor_single.c | 9
fs/squashfs/lz4_wrapper.c | 17
fs/squashfs/lzo_wrapper.c | 17
fs/squashfs/squashfs.h | 4
fs/squashfs/xz_wrapper.c | 51 +-
fs/squashfs/zlib_wrapper.c | 63 +--
fs/squashfs/zstd_wrapper.c | 62 +--
fs/sync.c | 6
fs/ubifs/debug.c | 2
fs/ubifs/lprops.c | 2
fs/ubifs/lpt_commit.c | 4
fs/ubifs/orphan.c | 2
fs/udf/inode.c | 7
fs/xfs/kmem.c | 2
fs/xfs/xfs_aops.c | 13
fs/xfs/xfs_buf.c | 2
fs/zonefs/super.c | 7
include/asm-generic/5level-fixup.h | 5
include/asm-generic/pgtable.h | 27 +
include/linux/buffer_head.h | 8
include/linux/fs.h | 18
include/linux/iomap.h | 3
include/linux/memcontrol.h | 4
include/linux/mm.h | 67 ++-
include/linux/mm_types.h | 6
include/linux/mmzone.h | 1
include/linux/mpage.h | 4
include/linux/page_counter.h | 8
include/linux/pagemap.h | 193 ++++++++++
include/linux/ptdump.h | 3
include/linux/sched.h | 3
include/linux/swap.h | 17
include/linux/vmalloc.h | 49 +-
include/linux/zsmalloc.h | 2
include/trace/events/erofs.h | 6
include/trace/events/f2fs.h | 6
include/trace/events/writeback.h | 5
kernel/bpf/core.c | 6
kernel/bpf/syscall.c | 29 -
kernel/dma/remap.c | 48 --
kernel/groups.c | 2
kernel/module.c | 3
kernel/notifier.c | 1
kernel/sys.c | 2
kernel/trace/trace.c | 12
lib/Kconfig.ubsan | 2
lib/ioremap.c | 46 +-
lib/test_vmalloc.c | 26 -
mm/Kconfig | 4
mm/debug.c | 56 ++
mm/fadvise.c | 6
mm/filemap.c | 1
mm/gup.c | 77 +++-
mm/internal.h | 14
mm/kasan/Makefile | 21 -
mm/kasan/common.c | 19 -
mm/kasan/report.c | 22 +
mm/memcontrol.c | 198 +++++++---
mm/memory-failure.c | 15
mm/memory.c | 2
mm/migrate.c | 9
mm/mm_init.c | 16
mm/nommu.c | 52 +-
mm/page-writeback.c | 62 ++-
mm/page_alloc.c | 7
mm/percpu.c | 2
mm/ptdump.c | 17
mm/readahead.c | 349 ++++++++++--------
mm/slab_common.c | 3
mm/slub.c | 67 ++-
mm/swap_state.c | 5
mm/swapfile.c | 194 ++++++----
mm/util.c | 2
mm/vmalloc.c | 399 ++++++++-------------
mm/vmscan.c | 4
mm/vmstat.c | 11
mm/zsmalloc.c | 12
net/bridge/netfilter/ebtables.c | 6
net/ceph/ceph_common.c | 3
sound/core/memalloc.c | 2
sound/core/pcm_memory.c | 2
195 files changed, 2292 insertions(+), 2288 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-06-02 4:44 incoming Andrew Morton
@ 2020-06-02 20:08 ` Andrew Morton
2020-06-02 20:45 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2020-06-02 20:08 UTC (permalink / raw)
To: Linus Torvalds, mm-commits, linux-mm
The local_lock merge made rather a mess of all of this. I'm
cooking up a full resend of the same material.
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-06-02 20:09 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-06-02 20:09 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
A few little subsystems and a start of a lot of MM patches.
128 patches, based on f359287765c04711ff54fbd11645271d8e5ff763:
Subsystems affected by this patch series:
squashfs
ocfs2
parisc
vfs
mm/slab-generic
mm/slub
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/memory-failure
mm/vmalloc
mm/kasan
Subsystem: squashfs
Philippe Liard <pliard@google.com>:
squashfs: migrate from ll_rw_block usage to BIO
Subsystem: ocfs2
Jules Irenge <jbi.octave@gmail.com>:
ocfs2: add missing annotation for dlm_empty_lockres()
Gang He <ghe@suse.com>:
ocfs2: mount shared volume without ha stack
Subsystem: parisc
Andrew Morton <akpm@linux-foundation.org>:
arch/parisc/include/asm/pgtable.h: remove unused `old_pte'
Subsystem: vfs
Jeff Layton <jlayton@redhat.com>:
Patch series "vfs: have syncfs() return error when there are writeback:
vfs: track per-sb writeback errors and report them to syncfs
fs/buffer.c: record blockdev write errors in super_block that it backs
Subsystem: mm/slab-generic
Vlastimil Babka <vbabka@suse.cz>:
usercopy: mark dma-kmalloc caches as usercopy caches
Subsystem: mm/slub
Dongli Zhang <dongli.zhang@oracle.com>:
mm/slub.c: fix corrupted freechain in deactivate_slab()
Christoph Lameter <cl@linux.com>:
slub: Remove userspace notifier for cache add/remove
Christopher Lameter <cl@linux.com>:
slub: remove kmalloc under list_lock from list_slab_objects() V2
Qian Cai <cai@lca.pw>:
mm/slub: fix stack overruns with SLUB_STATS
Andrew Morton <akpm@linux-foundation.org>:
Documentation/vm/slub.rst: s/Toggle/Enable/
Subsystem: mm/debug
Vlastimil Babka <vbabka@suse.cz>:
mm, dump_page(): do not crash with invalid mapping pointer
Subsystem: mm/pagecache
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Change readahead API", v11:
mm: move readahead prototypes from mm.h
mm: return void from various readahead functions
mm: ignore return value of ->readpages
mm: move readahead nr_pages check into read_pages
mm: add new readahead_control API
mm: use readahead_control to pass arguments
mm: rename various 'offset' parameters to 'index'
mm: rename readahead loop variable to 'i'
mm: remove 'page_offset' from readahead loop
mm: put readahead pages in cache earlier
mm: add readahead address space operation
mm: move end_index check out of readahead loop
mm: add page_cache_readahead_unbounded
mm: document why we don't set PageReadahead
mm: use memalloc_nofs_save in readahead path
fs: convert mpage_readpages to mpage_readahead
btrfs: convert from readpages to readahead
erofs: convert uncompressed files from readpages to readahead
erofs: convert compressed files from readpages to readahead
ext4: convert from readpages to readahead
ext4: pass the inode to ext4_mpage_readpages
f2fs: convert from readpages to readahead
f2fs: pass the inode to f2fs_mpage_readpages
fuse: convert from readpages to readahead
iomap: convert from readpages to readahead
Guoqing Jiang <guoqing.jiang@cloud.ionos.com>:
Patch series "Introduce attach/detach_page_private to cleanup code":
include/linux/pagemap.h: introduce attach/detach_page_private
md: remove __clear_page_buffers and use attach/detach_page_private
btrfs: use attach/detach_page_private
fs/buffer.c: use attach/detach_page_private
f2fs: use attach/detach_page_private
iomap: use attach/detach_page_private
ntfs: replace attach_page_buffers with attach_page_private
orangefs: use attach/detach_page_private
buffer_head.h: remove attach_page_buffers
mm/migrate.c: call detach_page_private to cleanup code
mm_types.h: change set_page_private to inline function
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap.c: remove misleading comment
Chao Yu <yuchao0@huawei.com>:
mm/page-writeback.c: remove unused variable
NeilBrown <neilb@suse.de>:
mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE
mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead
Subsystem: mm/gup
Souptick Joarder <jrdr.linux@gmail.com>:
mm/gup.c: update the documentation
John Hubbard <jhubbard@nvidia.com>:
mm/gup: introduce pin_user_pages_unlocked
ivtv: convert get_user_pages() --> pin_user_pages()
Miles Chen <miles.chen@mediatek.com>:
mm/gup.c: further document vma_permits_fault()
Subsystem: mm/swap
chenqiwu <chenqiwu@xiaomi.com>:
mm/swapfile: use list_{prev,next}_entry() instead of open-coding
Qian Cai <cai@lca.pw>:
mm/swap_state: fix a data race in swapin_nr_pages
Andrea Righi <andrea.righi@canonical.com>:
mm: swap: properly update readahead statistics in unuse_pte_range()
Wei Yang <richard.weiyang@gmail.com>:
mm/swapfile.c: offset is only used when there is more slots
mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive
mm/swapfile.c: remove the unnecessary goto for SSD case
mm/swapfile.c: simplify the calculation of n_goal
mm/swapfile.c: remove the extra check in scan_swap_map_slots()
mm/swapfile.c: found_free could be represented by (tmp < max)
mm/swapfile.c: tmp is always smaller than max
mm/swapfile.c: omit a duplicate code by compare tmp and max first
Huang Ying <ying.huang@intel.com>:
swap: try to scan more free slots even when fragmented
Wei Yang <richard.weiyang@gmail.com>:
mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable
mm/swapfile.c: __swap_entry_free() always free 1 entry
Huang Ying <ying.huang@intel.com>:
mm/swapfile.c: use prandom_u32_max()
swap: reduce lock contention on swap cache from swap slots allocation
Randy Dunlap <rdunlap@infradead.org>:
mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment
Miaohe Lin <linmiaohe@huawei.com>:
include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration
Subsystem: mm/memcg
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: add workingset_restore in memory.stat
Kaixu Xia <kaixuxia@tencent.com>:
mm: memcontrol: simplify value comparison between count and limit
Shakeel Butt <shakeelb@google.com>:
memcg: expose root cgroup's memory.stat
Jakub Kicinski <kuba@kernel.org>:
Patch series "memcg: Slow down swap allocation as the available space gets:
mm/memcg: prepare for swap over-high accounting and penalty calculation
mm/memcg: move penalty delay clamping out of calculate_high_delay()
mm/memcg: move cgroup high memory limit setting into struct page_counter
mm/memcg: automatically penalize tasks with high swap use
Zefan Li <lizefan@huawei.com>:
memcg: fix memcg_kmem_bypass() for remote memcg charging
Subsystem: mm/pagemap
Steven Price <steven.price@arm.com>:
Patch series "Fix W+X debug feature on x86":
x86: mm: ptdump: calculate effective permissions correctly
mm: ptdump: expand type of 'val' in note_page()
Huang Ying <ying.huang@intel.com>:
/proc/PID/smaps: Add PMD migration entry parsing
chenqiwu <chenqiwu@xiaomi.com>:
mm/memory: remove unnecessary pte_devmap case in copy_one_pte()
Subsystem: mm/memory-failure
Wetp Zhang <wetp.zy@linux.alibaba.com>:
mm, memory_failure: don't send BUS_MCEERR_AO for action required error
Subsystem: mm/vmalloc
Christoph Hellwig <hch@lst.de>:
Patch series "decruft the vmalloc API", v2:
x86/hyperv: use vmalloc_exec for the hypercall page
x86: fix vmap arguments in map_irq_stack
staging: android: ion: use vmap instead of vm_map_ram
staging: media: ipu3: use vmap instead of reimplementing it
dma-mapping: use vmap insted of reimplementing it
powerpc: add an ioremap_phb helper
powerpc: remove __ioremap_at and __iounmap_at
mm: remove __get_vm_area
mm: unexport unmap_kernel_range_noflush
mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING
mm: only allow page table mappings for built-in zsmalloc
mm: pass addr as unsigned long to vb_free
mm: remove vmap_page_range_noflush and vunmap_page_range
mm: rename vmap_page_range to map_kernel_range
mm: don't return the number of pages from map_kernel_range{,_noflush}
mm: remove map_vm_range
mm: remove unmap_vmap_area
mm: remove the prot argument from vm_map_ram
mm: enforce that vmap can't map pages executable
gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc
mm: remove the pgprot argument to __vmalloc
mm: remove the prot argument to __vmalloc_node
mm: remove both instances of __vmalloc_node_flags
mm: remove __vmalloc_node_flags_caller
mm: switch the test_vmalloc module to use __vmalloc_node
mm: remove vmalloc_user_node_flags
arm64: use __vmalloc_node in arch_alloc_vmap_stack
powerpc: use __vmalloc_node in alloc_vm_stack
s390: use __vmalloc_node in stack_alloc
Joerg Roedel <jroedel@suse.de>:
Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3:
mm: add functions to track page directory modifications
mm/vmalloc: track which page-table levels were modified
mm/ioremap: track which page-table levels were modified
x86/mm/64: implement arch_sync_kernel_mappings()
x86/mm/32: implement arch_sync_kernel_mappings()
mm: remove vmalloc_sync_(un)mappings()
x86/mm: remove vmalloc faulting
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix clang compilation warning due to stack protector
Kees Cook <keescook@chromium.org>:
ubsan: entirely disable alignment checks under UBSAN_TRAP
Jing Xia <jing.xia@unisoc.com>:
mm/mm_init.c: report kasan-tag information stored in page->flags
Andrey Konovalov <andreyknvl@google.com>:
kasan: move kasan_report() into report.c
Documentation/admin-guide/cgroup-v2.rst | 24 +
Documentation/core-api/cachetlb.rst | 2
Documentation/filesystems/locking.rst | 6
Documentation/filesystems/proc.rst | 4
Documentation/filesystems/vfs.rst | 15
Documentation/vm/slub.rst | 2
arch/arm/configs/omap2plus_defconfig | 2
arch/arm64/include/asm/pgtable.h | 3
arch/arm64/include/asm/vmap_stack.h | 6
arch/arm64/mm/dump.c | 2
arch/parisc/include/asm/pgtable.h | 2
arch/powerpc/include/asm/io.h | 10
arch/powerpc/include/asm/pci-bridge.h | 2
arch/powerpc/kernel/irq.c | 5
arch/powerpc/kernel/isa-bridge.c | 28 +
arch/powerpc/kernel/pci_64.c | 56 +-
arch/powerpc/mm/ioremap_64.c | 50 --
arch/riscv/include/asm/pgtable.h | 4
arch/riscv/mm/ptdump.c | 2
arch/s390/kernel/setup.c | 9
arch/sh/kernel/cpu/sh4/sq.c | 3
arch/x86/hyperv/hv_init.c | 5
arch/x86/include/asm/kvm_host.h | 3
arch/x86/include/asm/pgtable-2level_types.h | 2
arch/x86/include/asm/pgtable-3level_types.h | 2
arch/x86/include/asm/pgtable_64_types.h | 2
arch/x86/include/asm/pgtable_types.h | 8
arch/x86/include/asm/switch_to.h | 23 -
arch/x86/kernel/irq_64.c | 2
arch/x86/kernel/setup_percpu.c | 6
arch/x86/kvm/svm/sev.c | 3
arch/x86/mm/dump_pagetables.c | 35 +
arch/x86/mm/fault.c | 196 ----------
arch/x86/mm/init_64.c | 5
arch/x86/mm/pti.c | 8
arch/x86/mm/tlb.c | 37 -
block/blk-core.c | 1
drivers/acpi/apei/ghes.c | 6
drivers/base/node.c | 2
drivers/block/drbd/drbd_bitmap.c | 4
drivers/block/loop.c | 2
drivers/dax/device.c | 1
drivers/gpu/drm/drm_scatter.c | 11
drivers/gpu/drm/etnaviv/etnaviv_dump.c | 4
drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c | 2
drivers/lightnvm/pblk-init.c | 5
drivers/md/dm-bufio.c | 4
drivers/md/md-bitmap.c | 12
drivers/media/common/videobuf2/videobuf2-dma-sg.c | 3
drivers/media/common/videobuf2/videobuf2-vmalloc.c | 3
drivers/media/pci/ivtv/ivtv-udma.c | 19 -
drivers/media/pci/ivtv/ivtv-yuv.c | 17
drivers/media/pci/ivtv/ivtvfb.c | 4
drivers/mtd/ubi/io.c | 4
drivers/pcmcia/electra_cf.c | 45 --
drivers/scsi/sd_zbc.c | 3
drivers/staging/android/ion/ion_heap.c | 4
drivers/staging/media/ipu3/ipu3-css-pool.h | 4
drivers/staging/media/ipu3/ipu3-dmamap.c | 30 -
fs/block_dev.c | 7
fs/btrfs/disk-io.c | 4
fs/btrfs/extent_io.c | 64 ---
fs/btrfs/extent_io.h | 3
fs/btrfs/inode.c | 39 --
fs/buffer.c | 23 -
fs/erofs/data.c | 41 --
fs/erofs/decompressor.c | 2
fs/erofs/zdata.c | 31 -
fs/exfat/inode.c | 7
fs/ext2/inode.c | 10
fs/ext4/ext4.h | 5
fs/ext4/inode.c | 25 -
fs/ext4/readpage.c | 25 -
fs/ext4/verity.c | 35 -
fs/f2fs/data.c | 56 +-
fs/f2fs/f2fs.h | 14
fs/f2fs/verity.c | 35 -
fs/fat/inode.c | 7
fs/file_table.c | 1
fs/fs-writeback.c | 1
fs/fuse/file.c | 100 +----
fs/gfs2/aops.c | 23 -
fs/gfs2/dir.c | 9
fs/gfs2/quota.c | 2
fs/hpfs/file.c | 7
fs/iomap/buffered-io.c | 113 +----
fs/iomap/trace.h | 2
fs/isofs/inode.c | 7
fs/jfs/inode.c | 7
fs/mpage.c | 38 --
fs/nfs/blocklayout/extent_tree.c | 2
fs/nfs/internal.h | 10
fs/nfs/write.c | 4
fs/nfsd/vfs.c | 9
fs/nilfs2/inode.c | 15
fs/ntfs/aops.c | 2
fs/ntfs/malloc.h | 2
fs/ntfs/mft.c | 2
fs/ocfs2/aops.c | 34 -
fs/ocfs2/dlm/dlmmaster.c | 1
fs/ocfs2/ocfs2.h | 4
fs/ocfs2/slot_map.c | 46 +-
fs/ocfs2/super.c | 21 +
fs/omfs/file.c | 7
fs/open.c | 3
fs/orangefs/inode.c | 32 -
fs/proc/meminfo.c | 3
fs/proc/task_mmu.c | 16
fs/qnx6/inode.c | 7
fs/reiserfs/inode.c | 8
fs/squashfs/block.c | 273 +++++++-------
fs/squashfs/decompressor.h | 5
fs/squashfs/decompressor_multi.c | 9
fs/squashfs/decompressor_multi_percpu.c | 17
fs/squashfs/decompressor_single.c | 9
fs/squashfs/lz4_wrapper.c | 17
fs/squashfs/lzo_wrapper.c | 17
fs/squashfs/squashfs.h | 4
fs/squashfs/xz_wrapper.c | 51 +-
fs/squashfs/zlib_wrapper.c | 63 +--
fs/squashfs/zstd_wrapper.c | 62 +--
fs/sync.c | 6
fs/ubifs/debug.c | 2
fs/ubifs/lprops.c | 2
fs/ubifs/lpt_commit.c | 4
fs/ubifs/orphan.c | 2
fs/udf/inode.c | 7
fs/xfs/kmem.c | 2
fs/xfs/xfs_aops.c | 13
fs/xfs/xfs_buf.c | 2
fs/zonefs/super.c | 7
include/asm-generic/5level-fixup.h | 5
include/asm-generic/pgtable.h | 27 +
include/linux/buffer_head.h | 8
include/linux/fs.h | 18
include/linux/iomap.h | 3
include/linux/memcontrol.h | 4
include/linux/mm.h | 67 ++-
include/linux/mm_types.h | 6
include/linux/mmzone.h | 1
include/linux/mpage.h | 4
include/linux/page_counter.h | 8
include/linux/pagemap.h | 193 ++++++++++
include/linux/ptdump.h | 3
include/linux/sched.h | 3
include/linux/swap.h | 17
include/linux/vmalloc.h | 49 +-
include/linux/zsmalloc.h | 2
include/trace/events/erofs.h | 6
include/trace/events/f2fs.h | 6
include/trace/events/writeback.h | 5
kernel/bpf/core.c | 6
kernel/bpf/syscall.c | 29 -
kernel/dma/remap.c | 48 --
kernel/groups.c | 2
kernel/module.c | 3
kernel/notifier.c | 1
kernel/sys.c | 2
kernel/trace/trace.c | 12
lib/Kconfig.ubsan | 2
lib/ioremap.c | 46 +-
lib/test_vmalloc.c | 26 -
mm/Kconfig | 4
mm/debug.c | 56 ++
mm/fadvise.c | 6
mm/filemap.c | 1
mm/gup.c | 77 +++-
mm/internal.h | 14
mm/kasan/Makefile | 21 -
mm/kasan/common.c | 19 -
mm/kasan/report.c | 22 +
mm/memcontrol.c | 198 +++++++---
mm/memory-failure.c | 15
mm/memory.c | 2
mm/migrate.c | 9
mm/mm_init.c | 16
mm/nommu.c | 52 +-
mm/page-writeback.c | 62 ++-
mm/page_alloc.c | 7
mm/percpu.c | 2
mm/ptdump.c | 17
mm/readahead.c | 349 ++++++++++--------
mm/slab_common.c | 3
mm/slub.c | 67 ++-
mm/swap_state.c | 5
mm/swapfile.c | 194 ++++++----
mm/util.c | 2
mm/vmalloc.c | 399 ++++++++-------------
mm/vmscan.c | 4
mm/vmstat.c | 11
mm/zsmalloc.c | 12
net/bridge/netfilter/ebtables.c | 6
net/ceph/ceph_common.c | 3
sound/core/memalloc.c | 2
sound/core/pcm_memory.c | 2
195 files changed, 2292 insertions(+), 2288 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-06-02 20:08 ` incoming Andrew Morton
@ 2020-06-02 20:45 ` Linus Torvalds
2020-06-02 21:38 ` incoming Andrew Morton
0 siblings, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2020-06-02 20:45 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Tue, Jun 2, 2020 at 1:08 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> The local_lock merge made rather a mess of all of this. I'm
> cooking up a full resend of the same material.
Hmm. I have no issues with conflicts, and already took your previous series.
I've pushed it out now - does my tree match what you expect?
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-06-02 20:45 ` incoming Linus Torvalds
@ 2020-06-02 21:38 ` Andrew Morton
2020-06-02 22:18 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2020-06-02 21:38 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, Linux-MM
On Tue, 2 Jun 2020 13:45:49 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Tue, Jun 2, 2020 at 1:08 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > The local_lock merge made rather a mess of all of this. I'm
> > cooking up a full resend of the same material.
>
> Hmm. I have no issues with conflicts, and already took your previous series.
Well that's odd.
> I've pushed it out now - does my tree match what you expect?
Yup, thanks.
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-06-02 21:38 ` incoming Andrew Morton
@ 2020-06-02 22:18 ` Linus Torvalds
0 siblings, 0 replies; 348+ messages in thread
From: Linus Torvalds @ 2020-06-02 22:18 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Tue, Jun 2, 2020 at 2:38 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> On Tue, 2 Jun 2020 13:45:49 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> >
> > Hmm. I have no issues with conflicts, and already took your previous series.
>
> Well that's odd.
I meant "I saw the conflicts and had no issue with them". Nothing odd.
And I actually much prefer seeing conflicts from your series (against
other pulls I've done) over having you delay your patch bombs because
of any fear for them.
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-06-03 22:55 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-06-03 22:55 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
More mm/ work, plenty more to come.
131 patches, based on d6f9469a03d832dcd17041ed67774ffb5f3e73b3.
Subsystems affected by this patch series:
mm/slub
mm/memcg
mm/gup
mm/kasan
mm/pagealloc
mm/hugetlb
mm/vmscan
mm/tools
mm/mempolicy
mm/memblock
mm/hugetlbfs
mm/thp
mm/mmap
mm/kconfig
Subsystem: mm/slub
Wang Hai <wanghai38@huawei.com>:
mm/slub: fix a memory leak in sysfs_slab_add()
Subsystem: mm/memcg
Shakeel Butt <shakeelb@google.com>:
mm/memcg: optimize memory.numa_stat like memory.stat
Subsystem: mm/gup
John Hubbard <jhubbard@nvidia.com>:
Patch series "mm/gup, drm/i915: refactor gup_fast, convert to pin_user_pages()", v2:
mm/gup: move __get_user_pages_fast() down a few lines in gup.c
mm/gup: refactor and de-duplicate gup_fast() code
mm/gup: introduce pin_user_pages_fast_only()
drm/i915: convert get_user_pages() --> pin_user_pages()
mm/gup: might_lock_read(mmap_sem) in get_user_pages_fast()
Subsystem: mm/kasan
Daniel Axtens <dja@axtens.net>:
Patch series "Fix some incompatibilites between KASAN and FORTIFY_SOURCE", v4:
kasan: stop tests being eliminated as dead code with FORTIFY_SOURCE
string.h: fix incompatibility between FORTIFY_SOURCE and KASAN
Subsystem: mm/pagealloc
Michal Hocko <mhocko@suse.com>:
mm: clarify __GFP_MEMALLOC usage
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: rework free_area_init*() funcitons":
mm: memblock: replace dereferences of memblock_region.nid with API calls
mm: make early_pfn_to_nid() and related defintions close to each other
mm: remove CONFIG_HAVE_MEMBLOCK_NODE_MAP option
mm: free_area_init: use maximal zone PFNs rather than zone sizes
mm: use free_area_init() instead of free_area_init_nodes()
alpha: simplify detection of memory zone boundaries
arm: simplify detection of memory zone boundaries
arm64: simplify detection of memory zone boundaries for UMA configs
csky: simplify detection of memory zone boundaries
m68k: mm: simplify detection of memory zone boundaries
parisc: simplify detection of memory zone boundaries
sparc32: simplify detection of memory zone boundaries
unicore32: simplify detection of memory zone boundaries
xtensa: simplify detection of memory zone boundaries
Baoquan He <bhe@redhat.com>:
mm: memmap_init: iterate over memblock regions rather that check each PFN
Mike Rapoport <rppt@linux.ibm.com>:
mm: remove early_pfn_in_nid() and CONFIG_NODES_SPAN_OTHER_NODES
mm: free_area_init: allow defining max_zone_pfn in descending order
mm: rename free_area_init_node() to free_area_init_memoryless_node()
mm: clean up free_area_init_node() and its helpers
mm: simplify find_min_pfn_with_active_regions()
docs/vm: update memory-models documentation
Wei Yang <richard.weiyang@gmail.com>:
Patch series "mm/page_alloc.c: cleanup on check page", v3:
mm/page_alloc.c: bad_[reason|flags] is not necessary when PageHWPoison
mm/page_alloc.c: bad_flags is not necessary for bad_page()
mm/page_alloc.c: rename free_pages_check_bad() to check_free_page_bad()
mm/page_alloc.c: rename free_pages_check() to check_free_page()
mm/page_alloc.c: extract check_[new|free]_page_bad() common part to page_bad_reason()
Roman Gushchin <guro@fb.com>:
mm,page_alloc,cma: conditionally prefer cma pageblocks for movable allocations
Baoquan He <bhe@redhat.com>:
mm/page_alloc.c: remove unused free_bootmem_with_active_regions
Patch series "improvements about lowmem_reserve and /proc/zoneinfo", v2:
mm/page_alloc.c: only tune sysctl_lowmem_reserve_ratio value once when changing it
mm/page_alloc.c: clear out zone->lowmem_reserve[] if the zone is empty
mm/vmstat.c: do not show lowmem reserve protection information of empty zone
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
Patch series "integrate classzone_idx and high_zoneidx", v5:
mm/page_alloc: use ac->high_zoneidx for classzone_idx
mm/page_alloc: integrate classzone_idx and high_zoneidx
Wei Yang <richard.weiyang@gmail.com>:
mm/page_alloc.c: use NODE_MASK_NONE in build_zonelists()
mm: rename gfpflags_to_migratetype to gfp_migratetype for same convention
Sandipan Das <sandipan@linux.ibm.com>:
mm/page_alloc.c: reset numa stats for boot pagesets
Charan Teja Reddy <charante@codeaurora.org>:
mm, page_alloc: reset the zone->watermark_boost early
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/page_alloc: restrict and formalize compound_page_dtors[]
Daniel Jordan <daniel.m.jordan@oracle.com>:
Patch series "initialize deferred pages with interrupts enabled", v4:
mm/pagealloc.c: call touch_nmi_watchdog() on max order boundaries in deferred init
Pavel Tatashin <pasha.tatashin@soleen.com>:
mm: initialize deferred pages with interrupts enabled
mm: call cond_resched() from deferred_init_memmap()
Daniel Jordan <daniel.m.jordan@oracle.com>:
Patch series "padata: parallelize deferred page init", v3:
padata: remove exit routine
padata: initialize earlier
padata: allocate work structures for parallel jobs from a pool
padata: add basic support for multithreaded jobs
mm: don't track number of pages during deferred initialization
mm: parallelize deferred_init_memmap()
mm: make deferred init's max threads arch-specific
padata: document multithreaded jobs
Chen Tao <chentao107@huawei.com>:
mm/page_alloc.c: add missing newline
Subsystem: mm/hugetlb
"Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
Patch series "thp/khugepaged improvements and CoW semantics", v4:
khugepaged: add self test
khugepaged: do not stop collapse if less than half PTEs are referenced
khugepaged: drain all LRU caches before scanning pages
khugepaged: drain LRU add pagevec after swapin
khugepaged: allow to collapse a page shared across fork
khugepaged: allow to collapse PTE-mapped compound pages
thp: change CoW semantics for anon-THP
khugepaged: introduce 'max_ptes_shared' tunable
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "Clean up hugetlb boot command line processing", v4:
hugetlbfs: add arch_hugetlb_valid_size
hugetlbfs: move hugepagesz= parsing to arch independent code
hugetlbfs: remove hugetlb_add_hstate() warning for existing hstate
hugetlbfs: clean up command line processing
hugetlbfs: fix changes to command line processing
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/hugetlb: avoid unnecessary check on pud and pmd entry in huge_pte_offset
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/hugetlb: Add some new generic fallbacks", v3:
arm64/mm: drop __HAVE_ARCH_HUGE_PTEP_GET
mm/hugetlb: define a generic fallback for is_hugepage_only_range()
mm/hugetlb: define a generic fallback for arch_clear_hugepage_flags()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: simplify calling a compound page destructor
Subsystem: mm/vmscan
Wei Yang <richard.weiyang@gmail.com>:
mm/vmscan.c: use update_lru_size() in update_lru_sizes()
Jaewon Kim <jaewon31.kim@samsung.com>:
mm/vmscan: count layzfree pages and fix nr_isolated_* mismatch
Maninder Singh <maninder1.s@samsung.com>:
mm/vmscan.c: change prototype for shrink_page_list
Qiwu Chen <qiwuchen55@gmail.com>:
mm/vmscan: update the comment of should_continue_reclaim()
Johannes Weiner <hannes@cmpxchg.org>:
Patch series "mm: memcontrol: charge swapin pages on instantiation", v2:
mm: fix NUMA node file count error in replace_page_cache()
mm: memcontrol: fix stat-corrupting race in charge moving
mm: memcontrol: drop @compound parameter from memcg charging API
mm: shmem: remove rare optimization when swapin races with hole punching
mm: memcontrol: move out cgroup swaprate throttling
mm: memcontrol: convert page cache to a new mem_cgroup_charge() API
mm: memcontrol: prepare uncharging for removal of private page type counters
mm: memcontrol: prepare move_account for removal of private page type counters
mm: memcontrol: prepare cgroup vmstat infrastructure for native anon counters
mm: memcontrol: switch to native NR_FILE_PAGES and NR_SHMEM counters
mm: memcontrol: switch to native NR_ANON_MAPPED counter
mm: memcontrol: switch to native NR_ANON_THPS counter
mm: memcontrol: convert anon and file-thp to new mem_cgroup_charge() API
mm: memcontrol: drop unused try/commit/cancel charge API
mm: memcontrol: prepare swap controller setup for integration
mm: memcontrol: make swap tracking an integral part of memory control
mm: memcontrol: charge swapin pages on instantiation
Alex Shi <alex.shi@linux.alibaba.com>:
mm: memcontrol: document the new swap control behavior
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: delete unused lrucare handling
mm: memcontrol: update page->mem_cgroup stability rules
mm: fix LRU balancing effect of new transparent huge pages
mm: keep separate anon and file statistics on page reclaim activity
mm: allow swappiness that prefers reclaiming anon over the file workingset
mm: fold and remove lru_cache_add_anon() and lru_cache_add_file()
mm: workingset: let cache workingset challenge anon
mm: remove use-once cache bias from LRU balancing
mm: vmscan: drop unnecessary div0 avoidance rounding in get_scan_count()
mm: base LRU balancing on an explicit cost model
mm: deactivations shouldn't bias the LRU balance
mm: only count actual rotations as LRU reclaim cost
mm: balance LRU lists based on relative thrashing
mm: vmscan: determine anon/file pressure balance at the reclaim root
mm: vmscan: reclaim writepage is IO cost
mm: vmscan: limit the range of LRU type balancing
Shakeel Butt <shakeelb@google.com>:
mm: swap: fix vmstats for huge pages
mm: swap: memcg: fix memcg stats for huge pages
Subsystem: mm/tools
Changhee Han <ch0.han@lge.com>:
tools/vm/page_owner_sort.c: filter out unneeded line
Subsystem: mm/mempolicy
Michal Hocko <mhocko@suse.com>:
mm, mempolicy: fix up gup usage in lookup_node
Subsystem: mm/memblock
chenqiwu <chenqiwu@xiaomi.com>:
include/linux/memblock.h: fix minor typo and unclear comment
Mike Rapoport <rppt@linux.ibm.com>:
sparc32: register memory occupied by kernel as memblock.memory
Subsystem: mm/hugetlbfs
Shijie Hu <hushijie3@huawei.com>:
hugetlbfs: get unmapped area below TASK_UNMAPPED_BASE for hugetlbfs
Subsystem: mm/thp
Yang Shi <yang.shi@linux.alibaba.com>:
mm: thp: don't need to drain lru cache when splitting and mlocking THP
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/thp: Rename pmd_mknotpresent() as pmd_mknotvalid()", v2:
powerpc/mm: drop platform defined pmd_mknotpresent()
mm/thp: rename pmd_mknotpresent() as pmd_mkinvalid()
Subsystem: mm/mmap
Scott Cheloha <cheloha@linux.vnet.ibm.com>:
drivers/base/memory.c: cache memory blocks in xarray to accelerate lookup
Subsystem: mm/kconfig
Zong Li <zong.li@sifive.com>:
Patch series "Extract DEBUG_WX to shared use":
mm: add DEBUG_WX support
riscv: support DEBUG_WX
x86: mm: use ARCH_HAS_DEBUG_WX instead of arch defined
arm64: mm: use ARCH_HAS_DEBUG_WX instead of arch defined
Documentation/admin-guide/cgroup-v1/memory.rst | 19
Documentation/admin-guide/kernel-parameters.txt | 40
Documentation/admin-guide/mm/hugetlbpage.rst | 35
Documentation/admin-guide/mm/transhuge.rst | 7
Documentation/admin-guide/sysctl/vm.rst | 23
Documentation/core-api/padata.rst | 41
Documentation/features/vm/numa-memblock/arch-support.txt | 34
Documentation/vm/memory-model.rst | 9
Documentation/vm/page_owner.rst | 3
arch/alpha/mm/init.c | 16
arch/alpha/mm/numa.c | 22
arch/arc/include/asm/hugepage.h | 2
arch/arc/mm/init.c | 41
arch/arm/include/asm/hugetlb.h | 7
arch/arm/include/asm/pgtable-3level.h | 2
arch/arm/mm/init.c | 66
arch/arm64/Kconfig | 2
arch/arm64/Kconfig.debug | 29
arch/arm64/include/asm/hugetlb.h | 13
arch/arm64/include/asm/pgtable.h | 2
arch/arm64/mm/hugetlbpage.c | 48
arch/arm64/mm/init.c | 56
arch/arm64/mm/numa.c | 9
arch/c6x/mm/init.c | 8
arch/csky/kernel/setup.c | 26
arch/h8300/mm/init.c | 6
arch/hexagon/mm/init.c | 6
arch/ia64/Kconfig | 1
arch/ia64/include/asm/hugetlb.h | 5
arch/ia64/mm/contig.c | 2
arch/ia64/mm/discontig.c | 2
arch/m68k/mm/init.c | 6
arch/m68k/mm/mcfmmu.c | 9
arch/m68k/mm/motorola.c | 15
arch/m68k/mm/sun3mmu.c | 10
arch/microblaze/Kconfig | 1
arch/microblaze/mm/init.c | 2
arch/mips/Kconfig | 1
arch/mips/include/asm/hugetlb.h | 11
arch/mips/include/asm/pgtable.h | 2
arch/mips/loongson64/numa.c | 2
arch/mips/mm/init.c | 2
arch/mips/sgi-ip27/ip27-memory.c | 2
arch/nds32/mm/init.c | 11
arch/nios2/mm/init.c | 8
arch/openrisc/mm/init.c | 9
arch/parisc/include/asm/hugetlb.h | 10
arch/parisc/mm/init.c | 22
arch/powerpc/Kconfig | 10
arch/powerpc/include/asm/book3s/64/pgtable.h | 4
arch/powerpc/include/asm/hugetlb.h | 5
arch/powerpc/mm/hugetlbpage.c | 38
arch/powerpc/mm/mem.c | 2
arch/riscv/Kconfig | 2
arch/riscv/include/asm/hugetlb.h | 10
arch/riscv/include/asm/ptdump.h | 11
arch/riscv/mm/hugetlbpage.c | 44
arch/riscv/mm/init.c | 5
arch/s390/Kconfig | 1
arch/s390/include/asm/hugetlb.h | 8
arch/s390/mm/hugetlbpage.c | 34
arch/s390/mm/init.c | 2
arch/sh/Kconfig | 1
arch/sh/include/asm/hugetlb.h | 7
arch/sh/mm/init.c | 2
arch/sparc/Kconfig | 10
arch/sparc/include/asm/hugetlb.h | 10
arch/sparc/mm/init_32.c | 1
arch/sparc/mm/init_64.c | 67
arch/sparc/mm/srmmu.c | 21
arch/um/kernel/mem.c | 12
arch/unicore32/include/asm/memory.h | 2
arch/unicore32/include/mach/memory.h | 6
arch/unicore32/kernel/pci.c | 14
arch/unicore32/mm/init.c | 43
arch/x86/Kconfig | 11
arch/x86/Kconfig.debug | 27
arch/x86/include/asm/hugetlb.h | 10
arch/x86/include/asm/pgtable.h | 2
arch/x86/mm/hugetlbpage.c | 35
arch/x86/mm/init.c | 2
arch/x86/mm/init_64.c | 12
arch/x86/mm/kmmio.c | 2
arch/x86/mm/numa.c | 11
arch/xtensa/mm/init.c | 8
drivers/base/memory.c | 44
drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 22
fs/cifs/file.c | 10
fs/fuse/dev.c | 2
fs/hugetlbfs/inode.c | 67
include/asm-generic/hugetlb.h | 2
include/linux/compaction.h | 9
include/linux/gfp.h | 7
include/linux/hugetlb.h | 16
include/linux/memblock.h | 15
include/linux/memcontrol.h | 102 -
include/linux/mm.h | 52
include/linux/mmzone.h | 46
include/linux/padata.h | 43
include/linux/string.h | 60
include/linux/swap.h | 17
include/linux/vm_event_item.h | 4
include/linux/vmstat.h | 2
include/trace/events/compaction.h | 22
include/trace/events/huge_memory.h | 3
include/trace/events/vmscan.h | 14
init/Kconfig | 17
init/main.c | 2
kernel/events/uprobes.c | 22
kernel/padata.c | 293 +++-
kernel/sysctl.c | 3
lib/test_kasan.c | 29
mm/Kconfig | 9
mm/Kconfig.debug | 32
mm/compaction.c | 70 -
mm/filemap.c | 55
mm/gup.c | 237 ++-
mm/huge_memory.c | 282 ----
mm/hugetlb.c | 260 ++-
mm/internal.h | 25
mm/khugepaged.c | 316 ++--
mm/memblock.c | 19
mm/memcontrol.c | 642 +++------
mm/memory.c | 103 -
mm/memory_hotplug.c | 10
mm/mempolicy.c | 5
mm/migrate.c | 30
mm/oom_kill.c | 4
mm/page_alloc.c | 735 ++++------
mm/page_owner.c | 7
mm/pgtable-generic.c | 2
mm/rmap.c | 53
mm/shmem.c | 156 --
mm/slab.c | 4
mm/slub.c | 8
mm/swap.c | 199 +-
mm/swap_cgroup.c | 10
mm/swap_state.c | 110 -
mm/swapfile.c | 39
mm/userfaultfd.c | 15
mm/vmscan.c | 344 ++--
mm/vmstat.c | 16
mm/workingset.c | 23
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 1
tools/testing/selftests/vm/khugepaged.c | 1035 +++++++++++++++
tools/vm/page_owner_sort.c | 5
147 files changed, 3876 insertions(+), 3108 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-06-04 23:45 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-06-04 23:45 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
- More MM work. 100ish more to go. Mike's "mm: remove
__ARCH_HAS_5LEVEL_HACK" series should fix the current ppc issue.
- Various other little subsystems
127 patches, based on 6929f71e46bdddbf1c4d67c2728648176c67c555.
Subsystems affected by this patch series:
kcov
mm/pagemap
mm/vmalloc
mm/kmap
mm/util
mm/memory-hotplug
mm/cleanups
mm/zram
procfs
core-kernel
get_maintainer
lib
bitops
checkpatch
binfmt
init
fat
seq_file
exec
rapidio
relay
selftests
ubsan
Subsystem: kcov
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kcov: collect coverage from usb soft interrupts", v4:
kcov: cleanup debug messages
kcov: fix potential use-after-free in kcov_remote_start
kcov: move t->kcov assignments into kcov_start/stop
kcov: move t->kcov_sequence assignment
kcov: use t->kcov_mode as enabled indicator
kcov: collect coverage from interrupts
usb: core: kcov: collect coverage from usb complete callback
Subsystem: mm/pagemap
Feng Tang <feng.tang@intel.com>:
mm/util.c: remove the VM_WARN_ONCE for vm_committed_as underflow check
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: remove __ARCH_HAS_5LEVEL_HACK", v4:
h8300: remove usage of __ARCH_USE_5LEVEL_HACK
arm: add support for folded p4d page tables
arm64: add support for folded p4d page tables
hexagon: remove __ARCH_USE_5LEVEL_HACK
ia64: add support for folded p4d page tables
nios2: add support for folded p4d page tables
openrisc: add support for folded p4d page tables
powerpc: add support for folded p4d page tables
Geert Uytterhoeven <geert+renesas@glider.be>:
sh: fault: modernize printing of kernel messages
Mike Rapoport <rppt@linux.ibm.com>:
sh: drop __pXd_offset() macros that duplicate pXd_index() ones
sh: add support for folded p4d page tables
unicore32: remove __ARCH_USE_5LEVEL_HACK
asm-generic: remove pgtable-nop4d-hack.h
mm: remove __ARCH_HAS_5LEVEL_HACK and include/asm-generic/5level-fixup.h
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/debug: Add tests validating architecture page table:
x86/mm: define mm_p4d_folded()
mm/debug: add tests validating architecture page table helpers
Subsystem: mm/vmalloc
Jeongtae Park <jtp.park@samsung.com>:
mm/vmalloc: fix a typo in comment
Subsystem: mm/kmap
Ira Weiny <ira.weiny@intel.com>:
Patch series "Remove duplicated kmap code", v3:
arch/kmap: remove BUG_ON()
arch/xtensa: move kmap build bug out of the way
arch/kmap: remove redundant arch specific kmaps
arch/kunmap: remove duplicate kunmap implementations
{x86,powerpc,microblaze}/kmap: move preempt disable
arch/kmap_atomic: consolidate duplicate code
arch/kunmap_atomic: consolidate duplicate code
arch/kmap: ensure kmap_prot visibility
arch/kmap: don't hard code kmap_prot values
arch/kmap: define kmap_atomic_prot() for all arch's
drm: remove drm specific kmap_atomic code
kmap: remove kmap_atomic_to_page()
parisc/kmap: remove duplicate kmap code
sparc: remove unnecessary includes
kmap: consolidate kmap_prot definitions
Subsystem: mm/util
Waiman Long <longman@redhat.com>:
mm: add kvfree_sensitive() for freeing sensitive data objects
Subsystem: mm/memory-hotplug
Vishal Verma <vishal.l.verma@intel.com>:
mm/memory_hotplug: refrain from adding memory into an impossible node
David Hildenbrand <david@redhat.com>:
powerpc/pseries/hotplug-memory: stop checking is_mem_section_removable()
mm/memory_hotplug: remove is_mem_section_removable()
Patch series "mm/memory_hotplug: handle memblocks only with:
mm/memory_hotplug: set node_start_pfn of hotadded pgdat to 0
mm/memory_hotplug: handle memblocks only with CONFIG_ARCH_KEEP_MEMBLOCK
Patch series "mm/memory_hotplug: Interface to add driver-managed system:
mm/memory_hotplug: introduce add_memory_driver_managed()
kexec_file: don't place kexec images on IORESOURCE_MEM_DRIVER_MANAGED
device-dax: add memory via add_memory_driver_managed()
Michal Hocko <mhocko@kernel.org>:
mm/memory_hotplug: disable the functionality for 32b
Subsystem: mm/cleanups
chenqiwu <chenqiwu@xiaomi.com>:
mm: replace zero-length array with flexible-array member
Ethon Paul <ethp@qq.com>:
mm/memory_hotplug: fix a typo in comment "recoreded"->"recorded"
mm: ksm: fix a typo in comment "alreaady"->"already"
mm: mmap: fix a typo in comment "compatbility"->"compatibility"
mm/hugetlb: fix a typos in comments
mm/vmsan: fix some typos in comment
mm/compaction: fix a typo in comment "pessemistic"->"pessimistic"
mm/memblock: fix a typo in comment "implict"->"implicit"
mm/list_lru: fix a typo in comment "numbesr"->"numbers"
mm/filemap: fix a typo in comment "unneccssary"->"unnecessary"
mm/frontswap: fix some typos in frontswap.c
mm, memcg: fix some typos in memcontrol.c
mm: fix a typo in comment "strucure"->"structure"
mm/slub: fix a typo in comment "disambiguiation"->"disambiguation"
mm/sparse: fix a typo in comment "convienence"->"convenience"
mm/page-writeback: fix a typo in comment "effictive"->"effective"
mm/memory: fix a typo in comment "attampt"->"attempt"
Zou Wei <zou_wei@huawei.com>:
mm: use false for bool variable
Jason Yan <yanaijie@huawei.com>:
include/linux/mm.h: return true in cpupid_pid_unset()
Subsystem: mm/zram
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
zcomp: Use ARRAY_SIZE() for backends list
Subsystem: procfs
Alexey Dobriyan <adobriyan@gmail.com>:
proc: rename "catch" function argument
Subsystem: core-kernel
Jason Yan <yanaijie@huawei.com>:
user.c: make uidhash_table static
Subsystem: get_maintainer
Joe Perches <joe@perches.com>:
get_maintainer: add email addresses from .yaml files
get_maintainer: fix unexpected behavior for path/to//file (double slashes)
Subsystem: lib
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
lib/math: avoid trailing newline hidden in pr_fmt()
KP Singh <kpsingh@chromium.org>:
lib: Add might_fault() to strncpy_from_user.
Jason Yan <yanaijie@huawei.com>:
lib/test_lockup.c: make test_inode static
Jann Horn <jannh@google.com>:
lib/zlib: remove outdated and incorrect pre-increment optimization
Joe Perches <joe@perches.com>:
lib/percpu-refcount.c: use a more common logging style
Tan Hu <tan.hu@zte.com.cn>:
lib/flex_proportions.c: cleanup __fprop_inc_percpu_max
Jesse Brandeburg <jesse.brandeburg@intel.com>:
lib: make a test module with set/clear bit
Subsystem: bitops
Arnd Bergmann <arnd@arndb.de>:
include/linux/bitops.h: avoid clang shift-count-overflow warnings
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: additional MAINTAINER section entry ordering checks
checkpatch: look for c99 comments in ctx_locate_comment
checkpatch: disallow --git and --file/--fix
Geert Uytterhoeven <geert+renesas@glider.be>:
checkpatch: use patch subject when reading from stdin
Subsystem: binfmt
Anthony Iliopoulos <ailiop@suse.com>:
fs/binfmt_elf: remove redundant elf_map ifndef
Nick Desaulniers <ndesaulniers@google.com>:
elfnote: mark all .note sections SHF_ALLOC
Subsystem: init
Chris Down <chris@chrisdown.name>:
init: allow distribution configuration of default init
Subsystem: fat
OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
fat: don't allow to mount if the FAT length == 0
fat: improve the readahead for FAT entries
Subsystem: seq_file
Joe Perches <joe@perches.com>:
fs/seq_file.c: seq_read: Update pr_info_ratelimited
Kefeng Wang <wangkefeng.wang@huawei.com>:
Patch series "seq_file: Introduce DEFINE_SEQ_ATTRIBUTE() helper macro":
include/linux/seq_file.h: introduce DEFINE_SEQ_ATTRIBUTE() helper macro
mm/vmstat.c: convert to use DEFINE_SEQ_ATTRIBUTE macro
kernel/kprobes.c: convert to use DEFINE_SEQ_ATTRIBUTE macro
Subsystem: exec
Christoph Hellwig <hch@lst.de>:
exec: simplify the copy_strings_kernel calling convention
exec: open code copy_string_kernel
Subsystem: rapidio
Madhuparna Bhowmik <madhuparnabhowmik10@gmail.com>:
rapidio: avoid data race between file operation callbacks and mport_cdev_add().
John Hubbard <jhubbard@nvidia.com>:
rapidio: convert get_user_pages() --> pin_user_pages()
Subsystem: relay
Daniel Axtens <dja@axtens.net>:
kernel/relay.c: handle alloc_percpu returning NULL in relay_open
Pengcheng Yang <yangpc@wangsu.com>:
kernel/relay.c: fix read_pos error when multiple readers
Subsystem: selftests
Ram Pai <linuxram@us.ibm.com>:
Patch series "selftests, powerpc, x86: Memory Protection Keys", v19:
selftests/x86/pkeys: move selftests to arch-neutral directory
selftests/vm/pkeys: rename all references to pkru to a generic name
selftests/vm/pkeys: move generic definitions to header file
Thiago Jung Bauermann <bauerman@linux.ibm.com>:
selftests/vm/pkeys: move some definitions to arch-specific header
selftests/vm/pkeys: make gcc check arguments of sigsafe_printf()
Sandipan Das <sandipan@linux.ibm.com>:
selftests: vm: pkeys: Use sane types for pkey register
selftests: vm: pkeys: add helpers for pkey bits
Ram Pai <linuxram@us.ibm.com>:
selftests/vm/pkeys: fix pkey_disable_clear()
selftests/vm/pkeys: fix assertion in pkey_disable_set/clear()
selftests/vm/pkeys: fix alloc_random_pkey() to make it really random
Sandipan Das <sandipan@linux.ibm.com>:
selftests: vm: pkeys: use the correct huge page size
Ram Pai <linuxram@us.ibm.com>:
selftests/vm/pkeys: introduce generic pkey abstractions
selftests/vm/pkeys: introduce powerpc support
"Desnes A. Nunes do Rosario" <desnesn@linux.vnet.ibm.com>:
selftests/vm/pkeys: fix number of reserved powerpc pkeys
Ram Pai <linuxram@us.ibm.com>:
selftests/vm/pkeys: fix assertion in test_pkey_alloc_exhaust()
selftests/vm/pkeys: improve checks to determine pkey support
selftests/vm/pkeys: associate key on a mapped page and detect access violation
selftests/vm/pkeys: associate key on a mapped page and detect write violation
selftests/vm/pkeys: detect write violation on a mapped access-denied-key page
selftests/vm/pkeys: introduce a sub-page allocator
selftests/vm/pkeys: test correct behaviour of pkey-0
selftests/vm/pkeys: override access right definitions on powerpc
Sandipan Das <sandipan@linux.ibm.com>:
selftests: vm: pkeys: use the correct page size on powerpc
selftests: vm: pkeys: fix multilib builds for x86
Jagadeesh Pagadala <jagdsh.linux@gmail.com>:
tools/testing/selftests/vm: remove duplicate headers
Subsystem: ubsan
Arnd Bergmann <arnd@arndb.de>:
lib/ubsan.c: fix gcc-10 warnings
Documentation/dev-tools/kcov.rst | 17
Documentation/features/debug/debug-vm-pgtable/arch-support.txt | 34
arch/arc/Kconfig | 1
arch/arc/include/asm/highmem.h | 20
arch/arc/mm/highmem.c | 34
arch/arm/include/asm/highmem.h | 9
arch/arm/include/asm/pgtable.h | 1
arch/arm/lib/uaccess_with_memcpy.c | 7
arch/arm/mach-sa1100/assabet.c | 2
arch/arm/mm/dump.c | 29
arch/arm/mm/fault-armv.c | 7
arch/arm/mm/fault.c | 22
arch/arm/mm/highmem.c | 41
arch/arm/mm/idmap.c | 3
arch/arm/mm/init.c | 2
arch/arm/mm/ioremap.c | 12
arch/arm/mm/mm.h | 2
arch/arm/mm/mmu.c | 35
arch/arm/mm/pgd.c | 40
arch/arm64/Kconfig | 1
arch/arm64/include/asm/kvm_mmu.h | 10
arch/arm64/include/asm/pgalloc.h | 10
arch/arm64/include/asm/pgtable-types.h | 5
arch/arm64/include/asm/pgtable.h | 37
arch/arm64/include/asm/stage2_pgtable.h | 48
arch/arm64/kernel/hibernate.c | 44
arch/arm64/kvm/mmu.c | 209
arch/arm64/mm/fault.c | 9
arch/arm64/mm/hugetlbpage.c | 15
arch/arm64/mm/kasan_init.c | 26
arch/arm64/mm/mmu.c | 52
arch/arm64/mm/pageattr.c | 7
arch/csky/include/asm/highmem.h | 12
arch/csky/mm/highmem.c | 64
arch/h8300/include/asm/pgtable.h | 1
arch/hexagon/include/asm/fixmap.h | 4
arch/hexagon/include/asm/pgtable.h | 1
arch/ia64/include/asm/pgalloc.h | 4
arch/ia64/include/asm/pgtable.h | 17
arch/ia64/mm/fault.c | 7
arch/ia64/mm/hugetlbpage.c | 18
arch/ia64/mm/init.c | 28
arch/microblaze/include/asm/highmem.h | 55
arch/microblaze/mm/highmem.c | 21
arch/microblaze/mm/init.c | 3
arch/mips/include/asm/highmem.h | 11
arch/mips/mm/cache.c | 6
arch/mips/mm/highmem.c | 62
arch/nds32/include/asm/highmem.h | 9
arch/nds32/mm/highmem.c | 49
arch/nios2/include/asm/pgtable.h | 3
arch/nios2/mm/fault.c | 9
arch/nios2/mm/ioremap.c | 6
arch/openrisc/include/asm/pgtable.h | 1
arch/openrisc/mm/fault.c | 10
arch/openrisc/mm/init.c | 4
arch/parisc/include/asm/cacheflush.h | 32
arch/powerpc/Kconfig | 1
arch/powerpc/include/asm/book3s/32/pgtable.h | 1
arch/powerpc/include/asm/book3s/64/hash.h | 4
arch/powerpc/include/asm/book3s/64/pgalloc.h | 4
arch/powerpc/include/asm/book3s/64/pgtable.h | 60
arch/powerpc/include/asm/book3s/64/radix.h | 6
arch/powerpc/include/asm/highmem.h | 56
arch/powerpc/include/asm/nohash/32/pgtable.h | 1
arch/powerpc/include/asm/nohash/64/pgalloc.h | 2
arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 32
arch/powerpc/include/asm/nohash/64/pgtable.h | 6
arch/powerpc/include/asm/pgtable.h | 10
arch/powerpc/kvm/book3s_64_mmu_radix.c | 32
arch/powerpc/lib/code-patching.c | 7
arch/powerpc/mm/book3s64/hash_pgtable.c | 4
arch/powerpc/mm/book3s64/radix_pgtable.c | 26
arch/powerpc/mm/book3s64/subpage_prot.c | 6
arch/powerpc/mm/highmem.c | 26
arch/powerpc/mm/hugetlbpage.c | 28
arch/powerpc/mm/kasan/kasan_init_32.c | 2
arch/powerpc/mm/mem.c | 3
arch/powerpc/mm/nohash/book3e_pgtable.c | 15
arch/powerpc/mm/pgtable.c | 30
arch/powerpc/mm/pgtable_64.c | 10
arch/powerpc/mm/ptdump/hashpagetable.c | 20
arch/powerpc/mm/ptdump/ptdump.c | 12
arch/powerpc/platforms/pseries/hotplug-memory.c | 26
arch/powerpc/xmon/xmon.c | 27
arch/s390/Kconfig | 1
arch/sh/include/asm/pgtable-2level.h | 1
arch/sh/include/asm/pgtable-3level.h | 1
arch/sh/include/asm/pgtable_32.h | 5
arch/sh/include/asm/pgtable_64.h | 5
arch/sh/kernel/io_trapped.c | 7
arch/sh/mm/cache-sh4.c | 4
arch/sh/mm/cache-sh5.c | 7
arch/sh/mm/fault.c | 64
arch/sh/mm/hugetlbpage.c | 28
arch/sh/mm/init.c | 15
arch/sh/mm/kmap.c | 2
arch/sh/mm/tlbex_32.c | 6
arch/sh/mm/tlbex_64.c | 7
arch/sparc/include/asm/highmem.h | 29
arch/sparc/mm/highmem.c | 31
arch/sparc/mm/io-unit.c | 1
arch/sparc/mm/iommu.c | 1
arch/unicore32/include/asm/pgtable.h | 1
arch/unicore32/kernel/hibernate.c | 4
arch/x86/Kconfig | 1
arch/x86/include/asm/fixmap.h | 1
arch/x86/include/asm/highmem.h | 37
arch/x86/include/asm/pgtable_64.h | 6
arch/x86/mm/highmem_32.c | 52
arch/xtensa/include/asm/highmem.h | 31
arch/xtensa/mm/highmem.c | 28
drivers/block/zram/zcomp.c | 7
drivers/dax/dax-private.h | 1
drivers/dax/kmem.c | 28
drivers/gpu/drm/ttm/ttm_bo_util.c | 56
drivers/gpu/drm/vmwgfx/vmwgfx_blit.c | 17
drivers/rapidio/devices/rio_mport_cdev.c | 27
drivers/usb/core/hcd.c | 3
fs/binfmt_elf.c | 4
fs/binfmt_em86.c | 6
fs/binfmt_misc.c | 4
fs/binfmt_script.c | 6
fs/exec.c | 58
fs/fat/fatent.c | 103
fs/fat/inode.c | 6
fs/proc/array.c | 8
fs/seq_file.c | 7
include/asm-generic/5level-fixup.h | 59
include/asm-generic/pgtable-nop4d-hack.h | 64
include/asm-generic/pgtable-nopud.h | 4
include/drm/ttm/ttm_bo_api.h | 4
include/linux/binfmts.h | 3
include/linux/bitops.h | 2
include/linux/elfnote.h | 2
include/linux/highmem.h | 89
include/linux/ioport.h | 1
include/linux/memory_hotplug.h | 9
include/linux/mm.h | 12
include/linux/sched.h | 3
include/linux/seq_file.h | 19
init/Kconfig | 10
init/main.c | 10
kernel/kcov.c | 282 -
kernel/kexec_file.c | 5
kernel/kprobes.c | 34
kernel/relay.c | 22
kernel/user.c | 2
lib/Kconfig.debug | 44
lib/Makefile | 2
lib/flex_proportions.c | 7
lib/math/prime_numbers.c | 10
lib/percpu-refcount.c | 6
lib/strncpy_from_user.c | 1
lib/test_bitops.c | 60
lib/test_lockup.c | 2
lib/ubsan.c | 33
lib/zlib_inflate/inffast.c | 91
mm/Kconfig | 4
mm/Makefile | 1
mm/compaction.c | 2
mm/debug_vm_pgtable.c | 382 +
mm/filemap.c | 2
mm/frontswap.c | 6
mm/huge_memory.c | 2
mm/hugetlb.c | 16
mm/internal.h | 2
mm/kasan/init.c | 11
mm/ksm.c | 10
mm/list_lru.c | 2
mm/memblock.c | 2
mm/memcontrol.c | 4
mm/memory.c | 10
mm/memory_hotplug.c | 179
mm/mmap.c | 2
mm/mremap.c | 2
mm/page-writeback.c | 2
mm/slub.c | 2
mm/sparse.c | 2
mm/util.c | 22
mm/vmalloc.c | 2
mm/vmscan.c | 6
mm/vmstat.c | 32
mm/zbud.c | 2
scripts/checkpatch.pl | 62
scripts/get_maintainer.pl | 46
security/keys/internal.h | 11
security/keys/keyctl.c | 16
tools/testing/selftests/lib/config | 1
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 75
tools/testing/selftests/vm/mremap_dontunmap.c | 1
tools/testing/selftests/vm/pkey-helpers.h | 557 +-
tools/testing/selftests/vm/pkey-powerpc.h | 153
tools/testing/selftests/vm/pkey-x86.h | 191
tools/testing/selftests/vm/protection_keys.c | 2370 ++++++++--
tools/testing/selftests/x86/.gitignore | 1
tools/testing/selftests/x86/Makefile | 2
tools/testing/selftests/x86/pkey-helpers.h | 219
tools/testing/selftests/x86/protection_keys.c | 1506 ------
200 files changed, 5182 insertions(+), 4033 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-06-08 4:35 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-06-08 4:35 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
Various trees. Mainly those parts of MM whose linux-next dependents
are now merged. I'm still sitting on ~160 patches which await merges
from -next.
54 patches, based on 9aa900c8094dba7a60dc805ecec1e9f720744ba1.
Subsystems affected by this patch series:
mm/proc
ipc
dynamic-debug
panic
lib
sysctl
mm/gup
mm/pagemap
Subsystem: mm/proc
SeongJae Park <sjpark@amazon.de>:
mm/page_idle.c: skip offline pages
Subsystem: ipc
Jules Irenge <jbi.octave@gmail.com>:
ipc/msg: add missing annotation for freeque()
Giuseppe Scrivano <gscrivan@redhat.com>:
ipc/namespace.c: use a work queue to free_ipc
Subsystem: dynamic-debug
Orson Zhai <orson.zhai@unisoc.com>:
dynamic_debug: add an option to enable dynamic debug for modules only
Subsystem: panic
Rafael Aquini <aquini@redhat.com>:
kernel: add panic_on_taint
Subsystem: lib
Manfred Spraul <manfred@colorfullife.com>:
xarray.h: correct return code documentation for xa_store_{bh,irq}()
Subsystem: sysctl
Vlastimil Babka <vbabka@suse.cz>:
Patch series "support setting sysctl parameters from kernel command line", v3:
kernel/sysctl: support setting sysctl parameters from kernel command line
kernel/sysctl: support handling command line aliases
kernel/hung_task convert hung_task_panic boot parameter to sysctl
tools/testing/selftests/sysctl/sysctl.sh: support CONFIG_TEST_SYSCTL=y
lib/test_sysctl: support testing of sysctl. boot parameter
"Guilherme G. Piccoli" <gpiccoli@canonical.com>:
kernel/watchdog.c: convert {soft/hard}lockup boot parameters to sysctl aliases
kernel/hung_task.c: introduce sysctl to print all traces when a hung task is detected
panic: add sysctl to dump all CPUs backtraces on oops event
Rafael Aquini <aquini@redhat.com>:
kernel/sysctl.c: ignore out-of-range taint bits introduced via kernel.tainted
Subsystem: mm/gup
Souptick Joarder <jrdr.linux@gmail.com>:
mm/gup.c: convert to use get_user_{page|pages}_fast_only()
John Hubbard <jhubbard@nvidia.com>:
mm/gup: update pin_user_pages.rst for "case 3" (mmu notifiers)
Patch series "mm/gup: introduce pin_user_pages_locked(), use it in frame_vector.c", v2:
mm/gup: introduce pin_user_pages_locked()
mm/gup: frame_vector: convert get_user_pages() --> pin_user_pages()
mm/gup: documentation fix for pin_user_pages*() APIs
Patch series "vhost, docs: convert to pin_user_pages(), new "case 5"":
docs: mm/gup: pin_user_pages.rst: add a "case 5"
vhost: convert get_user_pages() --> pin_user_pages()
Subsystem: mm/pagemap
Alexander Gordeev <agordeev@linux.ibm.com>:
mm/mmap.c: add more sanity checks to get_unmapped_area()
mm/mmap.c: do not allow mappings outside of allowed limits
Christoph Hellwig <hch@lst.de>:
Patch series "sort out the flush_icache_range mess", v2:
arm: fix the flush_icache_range arguments in set_fiq_handler
nds32: unexport flush_icache_page
powerpc: unexport flush_icache_user_range
unicore32: remove flush_cache_user_range
asm-generic: fix the inclusion guards for cacheflush.h
asm-generic: don't include <linux/mm.h> in cacheflush.h
asm-generic: improve the flush_dcache_page stub
alpha: use asm-generic/cacheflush.h
arm64: use asm-generic/cacheflush.h
c6x: use asm-generic/cacheflush.h
hexagon: use asm-generic/cacheflush.h
ia64: use asm-generic/cacheflush.h
microblaze: use asm-generic/cacheflush.h
m68knommu: use asm-generic/cacheflush.h
openrisc: use asm-generic/cacheflush.h
powerpc: use asm-generic/cacheflush.h
riscv: use asm-generic/cacheflush.h
arm,sparc,unicore32: remove flush_icache_user_range
mm: rename flush_icache_user_range to flush_icache_user_page
asm-generic: add a flush_icache_user_range stub
sh: implement flush_icache_user_range
xtensa: implement flush_icache_user_range
arm: rename flush_cache_user_range to flush_icache_user_range
m68k: implement flush_icache_user_range
exec: only build read_code when needed
exec: use flush_icache_user_range in read_code
binfmt_flat: use flush_icache_user_range
nommu: use flush_icache_user_range in brk and mmap
module: move the set_fs hack for flush_icache_range to m68k
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
doc: cgroup: update note about conditions when oom killer is invoked
Documentation/admin-guide/cgroup-v2.rst | 17 +-
Documentation/admin-guide/dynamic-debug-howto.rst | 5
Documentation/admin-guide/kdump/kdump.rst | 8 +
Documentation/admin-guide/kernel-parameters.txt | 34 +++-
Documentation/admin-guide/sysctl/kernel.rst | 37 ++++
Documentation/core-api/pin_user_pages.rst | 47 ++++--
arch/alpha/include/asm/cacheflush.h | 38 +----
arch/alpha/kernel/smp.c | 2
arch/arm/include/asm/cacheflush.h | 7
arch/arm/kernel/fiq.c | 4
arch/arm/kernel/traps.c | 2
arch/arm64/include/asm/cacheflush.h | 46 ------
arch/c6x/include/asm/cacheflush.h | 19 --
arch/hexagon/include/asm/cacheflush.h | 19 --
arch/ia64/include/asm/cacheflush.h | 30 ----
arch/m68k/include/asm/cacheflush_mm.h | 6
arch/m68k/include/asm/cacheflush_no.h | 19 --
arch/m68k/mm/cache.c | 13 +
arch/microblaze/include/asm/cacheflush.h | 29 ---
arch/nds32/include/asm/cacheflush.h | 4
arch/nds32/mm/cacheflush.c | 3
arch/openrisc/include/asm/cacheflush.h | 33 ----
arch/powerpc/include/asm/cacheflush.h | 46 +-----
arch/powerpc/kvm/book3s_64_mmu_hv.c | 2
arch/powerpc/kvm/book3s_64_mmu_radix.c | 2
arch/powerpc/mm/mem.c | 3
arch/powerpc/perf/callchain_64.c | 4
arch/riscv/include/asm/cacheflush.h | 65 --------
arch/sh/include/asm/cacheflush.h | 1
arch/sparc/include/asm/cacheflush_32.h | 2
arch/sparc/include/asm/cacheflush_64.h | 1
arch/um/include/asm/tlb.h | 2
arch/unicore32/include/asm/cacheflush.h | 11 -
arch/x86/include/asm/cacheflush.h | 2
arch/xtensa/include/asm/cacheflush.h | 2
drivers/media/platform/omap3isp/ispvideo.c | 2
drivers/nvdimm/pmem.c | 3
drivers/vhost/vhost.c | 5
fs/binfmt_flat.c | 2
fs/exec.c | 5
fs/proc/proc_sysctl.c | 163 ++++++++++++++++++++--
include/asm-generic/cacheflush.h | 25 +--
include/linux/dev_printk.h | 6
include/linux/dynamic_debug.h | 2
include/linux/ipc_namespace.h | 2
include/linux/kernel.h | 9 +
include/linux/mm.h | 12 +
include/linux/net.h | 3
include/linux/netdevice.h | 6
include/linux/printk.h | 9 -
include/linux/sched/sysctl.h | 7
include/linux/sysctl.h | 4
include/linux/xarray.h | 4
include/rdma/ib_verbs.h | 6
init/main.c | 2
ipc/msg.c | 2
ipc/namespace.c | 24 ++-
kernel/events/core.c | 4
kernel/events/uprobes.c | 2
kernel/hung_task.c | 30 ++--
kernel/module.c | 8 -
kernel/panic.c | 45 ++++++
kernel/sysctl.c | 38 ++++-
kernel/watchdog.c | 37 +---
lib/Kconfig.debug | 12 +
lib/Makefile | 2
lib/dynamic_debug.c | 9 -
lib/test_sysctl.c | 13 +
mm/frame_vector.c | 7
mm/gup.c | 74 +++++++--
mm/mmap.c | 28 ++-
mm/nommu.c | 4
mm/page_alloc.c | 9 -
mm/page_idle.c | 7
tools/testing/selftests/sysctl/sysctl.sh | 44 +++++
virt/kvm/kvm_main.c | 8 -
76 files changed, 732 insertions(+), 517 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-06-09 4:29 Andrew Morton
2020-06-09 16:58 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2020-06-09 4:29 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- a kernel-wide sweep of show_stack()
- pagetable cleanups
- abstract out accesses to mmap_sem - prep for mmap_sem scalability work
- hch's user acess work
93 patches, based on abfbb29297c27e3f101f348dc9e467b0fe70f919:
Subsystems affected by this patch series:
debug
mm/pagemap
mm/maccess
mm/documentation
Subsystem: debug
Dmitry Safonov <dima@arista.com>:
Patch series "Add log level to show_stack()", v3:
kallsyms/printk: add loglvl to print_ip_sym()
alpha: add show_stack_loglvl()
arc: add show_stack_loglvl()
arm/asm: add loglvl to c_backtrace()
arm: add loglvl to unwind_backtrace()
arm: add loglvl to dump_backtrace()
arm: wire up dump_backtrace_{entry,stm}
arm: add show_stack_loglvl()
arm64: add loglvl to dump_backtrace()
arm64: add show_stack_loglvl()
c6x: add show_stack_loglvl()
csky: add show_stack_loglvl()
h8300: add show_stack_loglvl()
hexagon: add show_stack_loglvl()
ia64: pass log level as arg into ia64_do_show_stack()
ia64: add show_stack_loglvl()
m68k: add show_stack_loglvl()
microblaze: add loglvl to microblaze_unwind_inner()
microblaze: add loglvl to microblaze_unwind()
microblaze: add show_stack_loglvl()
mips: add show_stack_loglvl()
nds32: add show_stack_loglvl()
nios2: add show_stack_loglvl()
openrisc: add show_stack_loglvl()
parisc: add show_stack_loglvl()
powerpc: add show_stack_loglvl()
riscv: add show_stack_loglvl()
s390: add show_stack_loglvl()
sh: add loglvl to dump_mem()
sh: remove needless printk()
sh: add loglvl to printk_address()
sh: add loglvl to show_trace()
sh: add show_stack_loglvl()
sparc: add show_stack_loglvl()
um/sysrq: remove needless variable sp
um: add show_stack_loglvl()
unicore32: remove unused pmode argument in c_backtrace()
unicore32: add loglvl to c_backtrace()
unicore32: add show_stack_loglvl()
x86: add missing const qualifiers for log_lvl
x86: add show_stack_loglvl()
xtensa: add loglvl to show_trace()
xtensa: add show_stack_loglvl()
sysrq: use show_stack_loglvl()
x86/amd_gart: print stacktrace for a leak with KERN_ERR
power: use show_stack_loglvl()
kdb: don't play with console_loglevel
sched: print stack trace with KERN_INFO
kernel: use show_stack_loglvl()
kernel: rename show_stack_loglvl() => show_stack()
Subsystem: mm/pagemap
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: consolidate definitions of page table accessors", v2:
mm: don't include asm/pgtable.h if linux/mm.h is already included
mm: introduce include/linux/pgtable.h
mm: reorder includes after introduction of linux/pgtable.h
csky: replace definitions of __pXd_offset() with pXd_index()
m68k/mm/motorola: move comment about page table allocation funcitons
m68k/mm: move {cache,nocahe}_page() definitions close to their user
x86/mm: simplify init_trampoline() and surrounding logic
mm: pgtable: add shortcuts for accessing kernel PMD and PTE
mm: consolidate pte_index() and pte_offset_*() definitions
Michel Lespinasse <walken@google.com>:
mmap locking API: initial implementation as rwsem wrappers
MMU notifier: use the new mmap locking API
DMA reservations: use the new mmap locking API
mmap locking API: use coccinelle to convert mmap_sem rwsem call sites
mmap locking API: convert mmap_sem call sites missed by coccinelle
mmap locking API: convert nested write lock sites
mmap locking API: add mmap_read_trylock_non_owner()
mmap locking API: add MMAP_LOCK_INITIALIZER
mmap locking API: add mmap_assert_locked() and mmap_assert_write_locked()
mmap locking API: rename mmap_sem to mmap_lock
mmap locking API: convert mmap_sem API comments
mmap locking API: convert mmap_sem comments
Subsystem: mm/maccess
Christoph Hellwig <hch@lst.de>:
Patch series "clean up and streamline probe_kernel_* and friends", v4:
maccess: unexport probe_kernel_write()
maccess: remove various unused weak aliases
maccess: remove duplicate kerneldoc comments
maccess: clarify kerneldoc comments
maccess: update the top of file comment
maccess: rename strncpy_from_unsafe_user to strncpy_from_user_nofault
maccess: rename strncpy_from_unsafe_strict to strncpy_from_kernel_nofault
maccess: rename strnlen_unsafe_user to strnlen_user_nofault
maccess: remove probe_read_common and probe_write_common
maccess: unify the probe kernel arch hooks
bpf: factor out a bpf_trace_copy_string helper
bpf: handle the compat string in bpf_trace_copy_string better
Andrew Morton <akpm@linux-foundation.org>:
bpf:bpf_seq_printf(): handle potentially unsafe format string better
Christoph Hellwig <hch@lst.de>:
bpf: rework the compat kernel probe handling
tracing/kprobes: handle mixed kernel/userspace probes better
maccess: remove strncpy_from_unsafe
maccess: always use strict semantics for probe_kernel_read
maccess: move user access routines together
maccess: allow architectures to provide kernel probing directly
x86: use non-set_fs based maccess routines
maccess: return -ERANGE when probe_kernel_read() fails
Subsystem: mm/documentation
Luis Chamberlain <mcgrof@kernel.org>:
include/linux/cache.h: expand documentation over __read_mostly
Documentation/admin-guide/mm/numa_memory_policy.rst | 10
Documentation/admin-guide/mm/userfaultfd.rst | 2
Documentation/filesystems/locking.rst | 2
Documentation/vm/hmm.rst | 6
Documentation/vm/transhuge.rst | 4
arch/alpha/boot/bootp.c | 1
arch/alpha/boot/bootpz.c | 1
arch/alpha/boot/main.c | 1
arch/alpha/include/asm/io.h | 1
arch/alpha/include/asm/pgtable.h | 16
arch/alpha/kernel/process.c | 1
arch/alpha/kernel/proto.h | 4
arch/alpha/kernel/ptrace.c | 1
arch/alpha/kernel/setup.c | 1
arch/alpha/kernel/smp.c | 1
arch/alpha/kernel/sys_alcor.c | 1
arch/alpha/kernel/sys_cabriolet.c | 1
arch/alpha/kernel/sys_dp264.c | 1
arch/alpha/kernel/sys_eb64p.c | 1
arch/alpha/kernel/sys_eiger.c | 1
arch/alpha/kernel/sys_jensen.c | 1
arch/alpha/kernel/sys_marvel.c | 1
arch/alpha/kernel/sys_miata.c | 1
arch/alpha/kernel/sys_mikasa.c | 1
arch/alpha/kernel/sys_nautilus.c | 1
arch/alpha/kernel/sys_noritake.c | 1
arch/alpha/kernel/sys_rawhide.c | 1
arch/alpha/kernel/sys_ruffian.c | 1
arch/alpha/kernel/sys_rx164.c | 1
arch/alpha/kernel/sys_sable.c | 1
arch/alpha/kernel/sys_sio.c | 1
arch/alpha/kernel/sys_sx164.c | 1
arch/alpha/kernel/sys_takara.c | 1
arch/alpha/kernel/sys_titan.c | 1
arch/alpha/kernel/sys_wildfire.c | 1
arch/alpha/kernel/traps.c | 40
arch/alpha/mm/fault.c | 12
arch/alpha/mm/init.c | 1
arch/arc/include/asm/bug.h | 3
arch/arc/include/asm/pgtable.h | 24
arch/arc/kernel/process.c | 4
arch/arc/kernel/stacktrace.c | 29
arch/arc/kernel/troubleshoot.c | 6
arch/arc/mm/fault.c | 6
arch/arc/mm/highmem.c | 14
arch/arc/mm/tlbex.S | 4
arch/arm/include/asm/bug.h | 3
arch/arm/include/asm/efi.h | 3
arch/arm/include/asm/fixmap.h | 4
arch/arm/include/asm/idmap.h | 2
arch/arm/include/asm/pgtable-2level.h | 1
arch/arm/include/asm/pgtable-3level.h | 7
arch/arm/include/asm/pgtable-nommu.h | 3
arch/arm/include/asm/pgtable.h | 25
arch/arm/include/asm/traps.h | 3
arch/arm/include/asm/unwind.h | 3
arch/arm/kernel/head.S | 4
arch/arm/kernel/machine_kexec.c | 1
arch/arm/kernel/module.c | 1
arch/arm/kernel/process.c | 4
arch/arm/kernel/ptrace.c | 1
arch/arm/kernel/smp.c | 1
arch/arm/kernel/suspend.c | 4
arch/arm/kernel/swp_emulate.c | 4
arch/arm/kernel/traps.c | 61
arch/arm/kernel/unwind.c | 7
arch/arm/kernel/vdso.c | 2
arch/arm/kernel/vmlinux.lds.S | 4
arch/arm/lib/backtrace-clang.S | 9
arch/arm/lib/backtrace.S | 14
arch/arm/lib/uaccess_with_memcpy.c | 16
arch/arm/mach-ebsa110/core.c | 1
arch/arm/mach-footbridge/common.c | 1
arch/arm/mach-imx/mm-imx21.c | 1
arch/arm/mach-imx/mm-imx27.c | 1
arch/arm/mach-imx/mm-imx3.c | 1
arch/arm/mach-integrator/core.c | 4
arch/arm/mach-iop32x/i2c.c | 1
arch/arm/mach-iop32x/iq31244.c | 1
arch/arm/mach-iop32x/iq80321.c | 1
arch/arm/mach-iop32x/n2100.c | 1
arch/arm/mach-ixp4xx/common.c | 1
arch/arm/mach-keystone/platsmp.c | 4
arch/arm/mach-sa1100/assabet.c | 3
arch/arm/mach-sa1100/hackkit.c | 4
arch/arm/mach-tegra/iomap.h | 2
arch/arm/mach-zynq/common.c | 4
arch/arm/mm/copypage-v4mc.c | 1
arch/arm/mm/copypage-v6.c | 1
arch/arm/mm/copypage-xscale.c | 1
arch/arm/mm/dump.c | 1
arch/arm/mm/fault-armv.c | 1
arch/arm/mm/fault.c | 9
arch/arm/mm/highmem.c | 4
arch/arm/mm/idmap.c | 4
arch/arm/mm/ioremap.c | 31
arch/arm/mm/mm.h | 8
arch/arm/mm/mmu.c | 7
arch/arm/mm/pageattr.c | 1
arch/arm/mm/proc-arm1020.S | 4
arch/arm/mm/proc-arm1020e.S | 4
arch/arm/mm/proc-arm1022.S | 4
arch/arm/mm/proc-arm1026.S | 4
arch/arm/mm/proc-arm720.S | 4
arch/arm/mm/proc-arm740.S | 4
arch/arm/mm/proc-arm7tdmi.S | 4
arch/arm/mm/proc-arm920.S | 4
arch/arm/mm/proc-arm922.S | 4
arch/arm/mm/proc-arm925.S | 4
arch/arm/mm/proc-arm926.S | 4
arch/arm/mm/proc-arm940.S | 4
arch/arm/mm/proc-arm946.S | 4
arch/arm/mm/proc-arm9tdmi.S | 4
arch/arm/mm/proc-fa526.S | 4
arch/arm/mm/proc-feroceon.S | 4
arch/arm/mm/proc-mohawk.S | 4
arch/arm/mm/proc-sa110.S | 4
arch/arm/mm/proc-sa1100.S | 4
arch/arm/mm/proc-v6.S | 4
arch/arm/mm/proc-v7.S | 4
arch/arm/mm/proc-xsc3.S | 4
arch/arm/mm/proc-xscale.S | 4
arch/arm/mm/pv-fixup-asm.S | 4
arch/arm64/include/asm/io.h | 4
arch/arm64/include/asm/kernel-pgtable.h | 2
arch/arm64/include/asm/kvm_mmu.h | 4
arch/arm64/include/asm/mmu_context.h | 4
arch/arm64/include/asm/pgtable.h | 40
arch/arm64/include/asm/stacktrace.h | 3
arch/arm64/include/asm/stage2_pgtable.h | 2
arch/arm64/include/asm/vmap_stack.h | 4
arch/arm64/kernel/acpi.c | 4
arch/arm64/kernel/head.S | 4
arch/arm64/kernel/hibernate.c | 5
arch/arm64/kernel/kaslr.c | 4
arch/arm64/kernel/process.c | 2
arch/arm64/kernel/ptrace.c | 1
arch/arm64/kernel/smp.c | 1
arch/arm64/kernel/suspend.c | 4
arch/arm64/kernel/traps.c | 37
arch/arm64/kernel/vdso.c | 8
arch/arm64/kernel/vmlinux.lds.S | 3
arch/arm64/kvm/mmu.c | 14
arch/arm64/mm/dump.c | 1
arch/arm64/mm/fault.c | 9
arch/arm64/mm/kasan_init.c | 3
arch/arm64/mm/mmu.c | 8
arch/arm64/mm/pageattr.c | 1
arch/arm64/mm/proc.S | 4
arch/c6x/include/asm/pgtable.h | 3
arch/c6x/kernel/traps.c | 28
arch/csky/include/asm/io.h | 2
arch/csky/include/asm/pgtable.h | 37
arch/csky/kernel/module.c | 1
arch/csky/kernel/ptrace.c | 5
arch/csky/kernel/stacktrace.c | 20
arch/csky/kernel/vdso.c | 4
arch/csky/mm/fault.c | 10
arch/csky/mm/highmem.c | 2
arch/csky/mm/init.c | 7
arch/csky/mm/tlb.c | 1
arch/h8300/include/asm/pgtable.h | 1
arch/h8300/kernel/process.c | 1
arch/h8300/kernel/setup.c | 1
arch/h8300/kernel/signal.c | 1
arch/h8300/kernel/traps.c | 26
arch/h8300/mm/fault.c | 1
arch/h8300/mm/init.c | 1
arch/h8300/mm/memory.c | 1
arch/hexagon/include/asm/fixmap.h | 4
arch/hexagon/include/asm/pgtable.h | 55
arch/hexagon/kernel/traps.c | 39
arch/hexagon/kernel/vdso.c | 4
arch/hexagon/mm/uaccess.c | 2
arch/hexagon/mm/vm_fault.c | 9
arch/ia64/include/asm/pgtable.h | 34
arch/ia64/include/asm/ptrace.h | 1
arch/ia64/include/asm/uaccess.h | 2
arch/ia64/kernel/efi.c | 1
arch/ia64/kernel/entry.S | 4
arch/ia64/kernel/head.S | 5
arch/ia64/kernel/irq_ia64.c | 4
arch/ia64/kernel/ivt.S | 4
arch/ia64/kernel/kprobes.c | 4
arch/ia64/kernel/mca.c | 2
arch/ia64/kernel/mca_asm.S | 4
arch/ia64/kernel/perfmon.c | 8
arch/ia64/kernel/process.c | 37
arch/ia64/kernel/ptrace.c | 1
arch/ia64/kernel/relocate_kernel.S | 6
arch/ia64/kernel/setup.c | 4
arch/ia64/kernel/smp.c | 1
arch/ia64/kernel/smpboot.c | 1
arch/ia64/kernel/uncached.c | 4
arch/ia64/kernel/vmlinux.lds.S | 4
arch/ia64/mm/contig.c | 1
arch/ia64/mm/fault.c | 17
arch/ia64/mm/init.c | 12
arch/m68k/68000/m68EZ328.c | 2
arch/m68k/68000/m68VZ328.c | 4
arch/m68k/68000/timers.c | 1
arch/m68k/amiga/config.c | 1
arch/m68k/apollo/config.c | 1
arch/m68k/atari/atasound.c | 1
arch/m68k/atari/stram.c | 1
arch/m68k/bvme6000/config.c | 1
arch/m68k/include/asm/mcf_pgtable.h | 63
arch/m68k/include/asm/motorola_pgalloc.h | 8
arch/m68k/include/asm/motorola_pgtable.h | 84 -
arch/m68k/include/asm/pgtable_mm.h | 1
arch/m68k/include/asm/pgtable_no.h | 2
arch/m68k/include/asm/sun3_pgtable.h | 24
arch/m68k/include/asm/sun3xflop.h | 4
arch/m68k/kernel/head.S | 4
arch/m68k/kernel/process.c | 1
arch/m68k/kernel/ptrace.c | 1
arch/m68k/kernel/setup_no.c | 1
arch/m68k/kernel/signal.c | 1
arch/m68k/kernel/sys_m68k.c | 14
arch/m68k/kernel/traps.c | 27
arch/m68k/kernel/uboot.c | 1
arch/m68k/mac/config.c | 1
arch/m68k/mm/fault.c | 10
arch/m68k/mm/init.c | 2
arch/m68k/mm/mcfmmu.c | 1
arch/m68k/mm/motorola.c | 65
arch/m68k/mm/sun3kmap.c | 1
arch/m68k/mm/sun3mmu.c | 1
arch/m68k/mvme147/config.c | 1
arch/m68k/mvme16x/config.c | 1
arch/m68k/q40/config.c | 1
arch/m68k/sun3/config.c | 1
arch/m68k/sun3/dvma.c | 1
arch/m68k/sun3/mmu_emu.c | 1
arch/m68k/sun3/sun3dvma.c | 1
arch/m68k/sun3x/dvma.c | 1
arch/m68k/sun3x/prom.c | 1
arch/microblaze/include/asm/pgalloc.h | 4
arch/microblaze/include/asm/pgtable.h | 23
arch/microblaze/include/asm/uaccess.h | 2
arch/microblaze/include/asm/unwind.h | 3
arch/microblaze/kernel/hw_exception_handler.S | 4
arch/microblaze/kernel/module.c | 4
arch/microblaze/kernel/setup.c | 4
arch/microblaze/kernel/signal.c | 9
arch/microblaze/kernel/stacktrace.c | 4
arch/microblaze/kernel/traps.c | 28
arch/microblaze/kernel/unwind.c | 46
arch/microblaze/mm/fault.c | 17
arch/microblaze/mm/init.c | 9
arch/microblaze/mm/pgtable.c | 4
arch/mips/fw/arc/memory.c | 1
arch/mips/include/asm/fixmap.h | 3
arch/mips/include/asm/mach-generic/floppy.h | 1
arch/mips/include/asm/mach-jazz/floppy.h | 1
arch/mips/include/asm/pgtable-32.h | 22
arch/mips/include/asm/pgtable-64.h | 32
arch/mips/include/asm/pgtable.h | 2
arch/mips/jazz/irq.c | 4
arch/mips/jazz/jazzdma.c | 1
arch/mips/jazz/setup.c | 4
arch/mips/kernel/module.c | 1
arch/mips/kernel/process.c | 1
arch/mips/kernel/ptrace.c | 1
arch/mips/kernel/ptrace32.c | 1
arch/mips/kernel/smp-bmips.c | 1
arch/mips/kernel/traps.c | 58
arch/mips/kernel/vdso.c | 4
arch/mips/kvm/mips.c | 4
arch/mips/kvm/mmu.c | 20
arch/mips/kvm/tlb.c | 1
arch/mips/kvm/trap_emul.c | 2
arch/mips/lib/dump_tlb.c | 1
arch/mips/lib/r3k_dump_tlb.c | 1
arch/mips/mm/c-octeon.c | 1
arch/mips/mm/c-r3k.c | 11
arch/mips/mm/c-r4k.c | 11
arch/mips/mm/c-tx39.c | 11
arch/mips/mm/fault.c | 12
arch/mips/mm/highmem.c | 2
arch/mips/mm/init.c | 1
arch/mips/mm/page.c | 1
arch/mips/mm/pgtable-32.c | 1
arch/mips/mm/pgtable-64.c | 1
arch/mips/mm/sc-ip22.c | 1
arch/mips/mm/sc-mips.c | 1
arch/mips/mm/sc-r5k.c | 1
arch/mips/mm/tlb-r3k.c | 1
arch/mips/mm/tlb-r4k.c | 1
arch/mips/mm/tlbex.c | 4
arch/mips/sgi-ip27/ip27-init.c | 1
arch/mips/sgi-ip27/ip27-timer.c | 1
arch/mips/sgi-ip32/ip32-memory.c | 1
arch/nds32/include/asm/highmem.h | 3
arch/nds32/include/asm/pgtable.h | 22
arch/nds32/kernel/head.S | 4
arch/nds32/kernel/module.c | 2
arch/nds32/kernel/traps.c | 33
arch/nds32/kernel/vdso.c | 6
arch/nds32/mm/fault.c | 17
arch/nds32/mm/init.c | 13
arch/nds32/mm/proc.c | 7
arch/nios2/include/asm/pgtable.h | 24
arch/nios2/kernel/module.c | 1
arch/nios2/kernel/nios2_ksyms.c | 4
arch/nios2/kernel/traps.c | 35
arch/nios2/mm/fault.c | 14
arch/nios2/mm/init.c | 5
arch/nios2/mm/pgtable.c | 1
arch/nios2/mm/tlb.c | 1
arch/openrisc/include/asm/io.h | 3
arch/openrisc/include/asm/pgtable.h | 33
arch/openrisc/include/asm/tlbflush.h | 1
arch/openrisc/kernel/asm-offsets.c | 1
arch/openrisc/kernel/entry.S | 4
arch/openrisc/kernel/head.S | 4
arch/openrisc/kernel/or32_ksyms.c | 4
arch/openrisc/kernel/process.c | 1
arch/openrisc/kernel/ptrace.c | 1
arch/openrisc/kernel/setup.c | 1
arch/openrisc/kernel/traps.c | 27
arch/openrisc/mm/fault.c | 12
arch/openrisc/mm/init.c | 1
arch/openrisc/mm/ioremap.c | 4
arch/openrisc/mm/tlb.c | 1
arch/parisc/include/asm/io.h | 2
arch/parisc/include/asm/mmu_context.h | 1
arch/parisc/include/asm/pgtable.h | 33
arch/parisc/kernel/asm-offsets.c | 4
arch/parisc/kernel/entry.S | 4
arch/parisc/kernel/head.S | 4
arch/parisc/kernel/module.c | 1
arch/parisc/kernel/pacache.S | 4
arch/parisc/kernel/pci-dma.c | 2
arch/parisc/kernel/pdt.c | 4
arch/parisc/kernel/ptrace.c | 1
arch/parisc/kernel/smp.c | 1
arch/parisc/kernel/traps.c | 42
arch/parisc/lib/memcpy.c | 14
arch/parisc/mm/fault.c | 10
arch/parisc/mm/fixmap.c | 6
arch/parisc/mm/init.c | 1
arch/powerpc/include/asm/book3s/32/pgtable.h | 20
arch/powerpc/include/asm/book3s/64/pgtable.h | 43
arch/powerpc/include/asm/fixmap.h | 4
arch/powerpc/include/asm/io.h | 1
arch/powerpc/include/asm/kup.h | 2
arch/powerpc/include/asm/nohash/32/pgtable.h | 17
arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 4
arch/powerpc/include/asm/nohash/64/pgtable.h | 22
arch/powerpc/include/asm/nohash/pgtable.h | 2
arch/powerpc/include/asm/pgtable.h | 28
arch/powerpc/include/asm/pkeys.h | 2
arch/powerpc/include/asm/tlb.h | 2
arch/powerpc/kernel/asm-offsets.c | 1
arch/powerpc/kernel/btext.c | 4
arch/powerpc/kernel/fpu.S | 3
arch/powerpc/kernel/head_32.S | 4
arch/powerpc/kernel/head_40x.S | 4
arch/powerpc/kernel/head_44x.S | 4
arch/powerpc/kernel/head_8xx.S | 4
arch/powerpc/kernel/head_fsl_booke.S | 4
arch/powerpc/kernel/io-workarounds.c | 4
arch/powerpc/kernel/irq.c | 4
arch/powerpc/kernel/mce_power.c | 4
arch/powerpc/kernel/paca.c | 4
arch/powerpc/kernel/process.c | 30
arch/powerpc/kernel/prom.c | 4
arch/powerpc/kernel/prom_init.c | 4
arch/powerpc/kernel/rtas_pci.c | 4
arch/powerpc/kernel/setup-common.c | 4
arch/powerpc/kernel/setup_32.c | 4
arch/powerpc/kernel/setup_64.c | 4
arch/powerpc/kernel/signal_32.c | 1
arch/powerpc/kernel/signal_64.c | 1
arch/powerpc/kernel/smp.c | 4
arch/powerpc/kernel/stacktrace.c | 2
arch/powerpc/kernel/traps.c | 1
arch/powerpc/kernel/vdso.c | 7
arch/powerpc/kvm/book3s_64_mmu_radix.c | 4
arch/powerpc/kvm/book3s_hv.c | 6
arch/powerpc/kvm/book3s_hv_nested.c | 4
arch/powerpc/kvm/book3s_hv_rm_xics.c | 4
arch/powerpc/kvm/book3s_hv_rm_xive.c | 4
arch/powerpc/kvm/book3s_hv_uvmem.c | 18
arch/powerpc/kvm/e500_mmu_host.c | 4
arch/powerpc/kvm/fpu.S | 4
arch/powerpc/lib/code-patching.c | 1
arch/powerpc/mm/book3s32/hash_low.S | 4
arch/powerpc/mm/book3s32/mmu.c | 2
arch/powerpc/mm/book3s32/tlb.c | 6
arch/powerpc/mm/book3s64/hash_hugetlbpage.c | 1
arch/powerpc/mm/book3s64/hash_native.c | 4
arch/powerpc/mm/book3s64/hash_pgtable.c | 5
arch/powerpc/mm/book3s64/hash_utils.c | 4
arch/powerpc/mm/book3s64/iommu_api.c | 4
arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 1
arch/powerpc/mm/book3s64/radix_pgtable.c | 1
arch/powerpc/mm/book3s64/slb.c | 4
arch/powerpc/mm/book3s64/subpage_prot.c | 16
arch/powerpc/mm/copro_fault.c | 4
arch/powerpc/mm/fault.c | 23
arch/powerpc/mm/hugetlbpage.c | 1
arch/powerpc/mm/init-common.c | 4
arch/powerpc/mm/init_32.c | 1
arch/powerpc/mm/init_64.c | 1
arch/powerpc/mm/kasan/8xx.c | 4
arch/powerpc/mm/kasan/book3s_32.c | 2
arch/powerpc/mm/kasan/kasan_init_32.c | 8
arch/powerpc/mm/mem.c | 1
arch/powerpc/mm/nohash/40x.c | 5
arch/powerpc/mm/nohash/8xx.c | 2
arch/powerpc/mm/nohash/fsl_booke.c | 1
arch/powerpc/mm/nohash/tlb_low_64e.S | 4
arch/powerpc/mm/pgtable.c | 2
arch/powerpc/mm/pgtable_32.c | 5
arch/powerpc/mm/pgtable_64.c | 1
arch/powerpc/mm/ptdump/8xx.c | 2
arch/powerpc/mm/ptdump/bats.c | 4
arch/powerpc/mm/ptdump/book3s64.c | 2
arch/powerpc/mm/ptdump/hashpagetable.c | 1
arch/powerpc/mm/ptdump/ptdump.c | 1
arch/powerpc/mm/ptdump/shared.c | 2
arch/powerpc/oprofile/cell/spu_task_sync.c | 6
arch/powerpc/perf/callchain.c | 1
arch/powerpc/perf/callchain_32.c | 1
arch/powerpc/perf/callchain_64.c | 1
arch/powerpc/platforms/85xx/corenet_generic.c | 4
arch/powerpc/platforms/85xx/mpc85xx_cds.c | 4
arch/powerpc/platforms/85xx/qemu_e500.c | 4
arch/powerpc/platforms/85xx/sbc8548.c | 4
arch/powerpc/platforms/85xx/smp.c | 4
arch/powerpc/platforms/86xx/mpc86xx_smp.c | 4
arch/powerpc/platforms/8xx/cpm1.c | 1
arch/powerpc/platforms/8xx/micropatch.c | 1
arch/powerpc/platforms/cell/cbe_regs.c | 4
arch/powerpc/platforms/cell/interrupt.c | 4
arch/powerpc/platforms/cell/pervasive.c | 4
arch/powerpc/platforms/cell/setup.c | 1
arch/powerpc/platforms/cell/smp.c | 4
arch/powerpc/platforms/cell/spider-pic.c | 4
arch/powerpc/platforms/cell/spufs/file.c | 10
arch/powerpc/platforms/chrp/pci.c | 4
arch/powerpc/platforms/chrp/setup.c | 1
arch/powerpc/platforms/chrp/smp.c | 4
arch/powerpc/platforms/maple/setup.c | 1
arch/powerpc/platforms/maple/time.c | 1
arch/powerpc/platforms/powermac/setup.c | 1
arch/powerpc/platforms/powermac/smp.c | 4
arch/powerpc/platforms/powermac/time.c | 1
arch/powerpc/platforms/pseries/lpar.c | 4
arch/powerpc/platforms/pseries/setup.c | 1
arch/powerpc/platforms/pseries/smp.c | 4
arch/powerpc/sysdev/cpm2.c | 1
arch/powerpc/sysdev/fsl_85xx_cache_sram.c | 2
arch/powerpc/sysdev/mpic.c | 4
arch/powerpc/xmon/xmon.c | 1
arch/riscv/include/asm/fixmap.h | 4
arch/riscv/include/asm/io.h | 4
arch/riscv/include/asm/kasan.h | 4
arch/riscv/include/asm/pgtable-64.h | 7
arch/riscv/include/asm/pgtable.h | 22
arch/riscv/kernel/module.c | 2
arch/riscv/kernel/setup.c | 1
arch/riscv/kernel/soc.c | 2
arch/riscv/kernel/stacktrace.c | 23
arch/riscv/kernel/vdso.c | 4
arch/riscv/mm/cacheflush.c | 3
arch/riscv/mm/fault.c | 14
arch/riscv/mm/init.c | 31
arch/riscv/mm/kasan_init.c | 4
arch/riscv/mm/pageattr.c | 6
arch/riscv/mm/ptdump.c | 2
arch/s390/boot/ipl_parm.c | 4
arch/s390/boot/kaslr.c | 4
arch/s390/include/asm/hugetlb.h | 4
arch/s390/include/asm/kasan.h | 4
arch/s390/include/asm/pgtable.h | 15
arch/s390/include/asm/tlbflush.h | 1
arch/s390/kernel/asm-offsets.c | 4
arch/s390/kernel/dumpstack.c | 25
arch/s390/kernel/machine_kexec.c | 1
arch/s390/kernel/ptrace.c | 1
arch/s390/kernel/uv.c | 4
arch/s390/kernel/vdso.c | 5
arch/s390/kvm/gaccess.c | 8
arch/s390/kvm/interrupt.c | 4
arch/s390/kvm/kvm-s390.c | 32
arch/s390/kvm/priv.c | 38
arch/s390/mm/dump_pagetables.c | 1
arch/s390/mm/extmem.c | 4
arch/s390/mm/fault.c | 17
arch/s390/mm/gmap.c | 80
arch/s390/mm/init.c | 1
arch/s390/mm/kasan_init.c | 4
arch/s390/mm/pageattr.c | 13
arch/s390/mm/pgalloc.c | 2
arch/s390/mm/pgtable.c | 1
arch/s390/mm/vmem.c | 1
arch/s390/pci/pci_mmio.c | 4
arch/sh/include/asm/io.h | 2
arch/sh/include/asm/kdebug.h | 6
arch/sh/include/asm/pgtable-3level.h | 7
arch/sh/include/asm/pgtable.h | 2
arch/sh/include/asm/pgtable_32.h | 25
arch/sh/include/asm/processor_32.h | 2
arch/sh/kernel/dumpstack.c | 54
arch/sh/kernel/machine_kexec.c | 1
arch/sh/kernel/process_32.c | 2
arch/sh/kernel/ptrace_32.c | 1
arch/sh/kernel/signal_32.c | 1
arch/sh/kernel/sys_sh.c | 6
arch/sh/kernel/traps.c | 4
arch/sh/kernel/vsyscall/vsyscall.c | 4
arch/sh/mm/cache-sh3.c | 1
arch/sh/mm/cache-sh4.c | 11
arch/sh/mm/cache-sh7705.c | 1
arch/sh/mm/fault.c | 16
arch/sh/mm/kmap.c | 5
arch/sh/mm/nommu.c | 1
arch/sh/mm/pmb.c | 4
arch/sparc/include/asm/floppy_32.h | 4
arch/sparc/include/asm/highmem.h | 4
arch/sparc/include/asm/ide.h | 2
arch/sparc/include/asm/io-unit.h | 4
arch/sparc/include/asm/pgalloc_32.h | 4
arch/sparc/include/asm/pgalloc_64.h | 2
arch/sparc/include/asm/pgtable_32.h | 34
arch/sparc/include/asm/pgtable_64.h | 32
arch/sparc/kernel/cpu.c | 4
arch/sparc/kernel/entry.S | 4
arch/sparc/kernel/head_64.S | 4
arch/sparc/kernel/ktlb.S | 4
arch/sparc/kernel/leon_smp.c | 1
arch/sparc/kernel/pci.c | 4
arch/sparc/kernel/process_32.c | 29
arch/sparc/kernel/process_64.c | 3
arch/sparc/kernel/ptrace_32.c | 1
arch/sparc/kernel/ptrace_64.c | 1
arch/sparc/kernel/setup_32.c | 1
arch/sparc/kernel/setup_64.c | 1
arch/sparc/kernel/signal32.c | 1
arch/sparc/kernel/signal_32.c | 1
arch/sparc/kernel/signal_64.c | 1
arch/sparc/kernel/smp_32.c | 1
arch/sparc/kernel/smp_64.c | 1
arch/sparc/kernel/sun4m_irq.c | 4
arch/sparc/kernel/trampoline_64.S | 4
arch/sparc/kernel/traps_32.c | 4
arch/sparc/kernel/traps_64.c | 24
arch/sparc/lib/clear_page.S | 4
arch/sparc/lib/copy_page.S | 2
arch/sparc/mm/fault_32.c | 21
arch/sparc/mm/fault_64.c | 17
arch/sparc/mm/highmem.c | 12
arch/sparc/mm/hugetlbpage.c | 1
arch/sparc/mm/init_32.c | 1
arch/sparc/mm/init_64.c | 7
arch/sparc/mm/io-unit.c | 11
arch/sparc/mm/iommu.c | 9
arch/sparc/mm/tlb.c | 1
arch/sparc/mm/tsb.c | 4
arch/sparc/mm/ultra.S | 4
arch/sparc/vdso/vma.c | 4
arch/um/drivers/mconsole_kern.c | 2
arch/um/include/asm/mmu_context.h | 5
arch/um/include/asm/pgtable-3level.h | 4
arch/um/include/asm/pgtable.h | 69
arch/um/kernel/maccess.c | 12
arch/um/kernel/mem.c | 10
arch/um/kernel/process.c | 1
arch/um/kernel/skas/mmu.c | 3
arch/um/kernel/skas/uaccess.c | 1
arch/um/kernel/sysrq.c | 35
arch/um/kernel/tlb.c | 5
arch/um/kernel/trap.c | 15
arch/um/kernel/um_arch.c | 1
arch/unicore32/include/asm/pgtable.h | 19
arch/unicore32/kernel/hibernate.c | 4
arch/unicore32/kernel/hibernate_asm.S | 4
arch/unicore32/kernel/module.c | 1
arch/unicore32/kernel/setup.h | 4
arch/unicore32/kernel/traps.c | 50
arch/unicore32/lib/backtrace.S | 24
arch/unicore32/mm/alignment.c | 4
arch/unicore32/mm/fault.c | 9
arch/unicore32/mm/mm.h | 10
arch/unicore32/mm/proc-ucv2.S | 4
arch/x86/boot/compressed/kaslr_64.c | 4
arch/x86/entry/vdso/vma.c | 14
arch/x86/events/core.c | 4
arch/x86/include/asm/agp.h | 2
arch/x86/include/asm/asm-prototypes.h | 4
arch/x86/include/asm/efi.h | 4
arch/x86/include/asm/iomap.h | 1
arch/x86/include/asm/kaslr.h | 2
arch/x86/include/asm/mmu.h | 2
arch/x86/include/asm/pgtable-3level.h | 8
arch/x86/include/asm/pgtable.h | 89 -
arch/x86/include/asm/pgtable_32.h | 11
arch/x86/include/asm/pgtable_64.h | 4
arch/x86/include/asm/setup.h | 12
arch/x86/include/asm/stacktrace.h | 2
arch/x86/include/asm/uaccess.h | 16
arch/x86/include/asm/xen/hypercall.h | 4
arch/x86/include/asm/xen/page.h | 1
arch/x86/kernel/acpi/boot.c | 4
arch/x86/kernel/acpi/sleep.c | 4
arch/x86/kernel/alternative.c | 1
arch/x86/kernel/amd_gart_64.c | 5
arch/x86/kernel/apic/apic_numachip.c | 4
arch/x86/kernel/cpu/bugs.c | 4
arch/x86/kernel/cpu/common.c | 4
arch/x86/kernel/cpu/intel.c | 4
arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 6
arch/x86/kernel/cpu/resctrl/rdtgroup.c | 6
arch/x86/kernel/crash_core_32.c | 4
arch/x86/kernel/crash_core_64.c | 4
arch/x86/kernel/doublefault_32.c | 1
arch/x86/kernel/dumpstack.c | 21
arch/x86/kernel/early_printk.c | 4
arch/x86/kernel/espfix_64.c | 2
arch/x86/kernel/head64.c | 4
arch/x86/kernel/head_64.S | 4
arch/x86/kernel/i8259.c | 4
arch/x86/kernel/irqinit.c | 4
arch/x86/kernel/kprobes/core.c | 4
arch/x86/kernel/kprobes/opt.c | 4
arch/x86/kernel/ldt.c | 2
arch/x86/kernel/machine_kexec_32.c | 1
arch/x86/kernel/machine_kexec_64.c | 1
arch/x86/kernel/module.c | 1
arch/x86/kernel/paravirt.c | 4
arch/x86/kernel/process_32.c | 1
arch/x86/kernel/process_64.c | 1
arch/x86/kernel/ptrace.c | 1
arch/x86/kernel/reboot.c | 4
arch/x86/kernel/smpboot.c | 4
arch/x86/kernel/tboot.c | 3
arch/x86/kernel/vm86_32.c | 4
arch/x86/kvm/mmu/paging_tmpl.h | 8
arch/x86/mm/cpu_entry_area.c | 4
arch/x86/mm/debug_pagetables.c | 2
arch/x86/mm/dump_pagetables.c | 1
arch/x86/mm/fault.c | 22
arch/x86/mm/init.c | 22
arch/x86/mm/init_32.c | 27
arch/x86/mm/init_64.c | 1
arch/x86/mm/ioremap.c | 4
arch/x86/mm/kasan_init_64.c | 1
arch/x86/mm/kaslr.c | 37
arch/x86/mm/maccess.c | 44
arch/x86/mm/mem_encrypt_boot.S | 2
arch/x86/mm/mmio-mod.c | 4
arch/x86/mm/pat/cpa-test.c | 1
arch/x86/mm/pat/memtype.c | 1
arch/x86/mm/pat/memtype_interval.c | 4
arch/x86/mm/pgtable.c | 1
arch/x86/mm/pgtable_32.c | 1
arch/x86/mm/pti.c | 1
arch/x86/mm/setup_nx.c | 4
arch/x86/platform/efi/efi_32.c | 4
arch/x86/platform/efi/efi_64.c | 1
arch/x86/platform/olpc/olpc_ofw.c | 4
arch/x86/power/cpu.c | 4
arch/x86/power/hibernate.c | 4
arch/x86/power/hibernate_32.c | 4
arch/x86/power/hibernate_64.c | 4
arch/x86/realmode/init.c | 4
arch/x86/um/vdso/vma.c | 4
arch/x86/xen/enlighten_pv.c | 1
arch/x86/xen/grant-table.c | 1
arch/x86/xen/mmu_pv.c | 4
arch/x86/xen/smp_pv.c | 2
arch/xtensa/include/asm/fixmap.h | 12
arch/xtensa/include/asm/highmem.h | 4
arch/xtensa/include/asm/initialize_mmu.h | 2
arch/xtensa/include/asm/mmu_context.h | 4
arch/xtensa/include/asm/pgtable.h | 20
arch/xtensa/kernel/entry.S | 4
arch/xtensa/kernel/process.c | 1
arch/xtensa/kernel/ptrace.c | 1
arch/xtensa/kernel/setup.c | 1
arch/xtensa/kernel/traps.c | 42
arch/xtensa/kernel/vectors.S | 4
arch/xtensa/mm/cache.c | 4
arch/xtensa/mm/fault.c | 12
arch/xtensa/mm/highmem.c | 2
arch/xtensa/mm/ioremap.c | 4
arch/xtensa/mm/kasan_init.c | 10
arch/xtensa/mm/misc.S | 4
arch/xtensa/mm/mmu.c | 5
drivers/acpi/scan.c | 3
drivers/android/binder_alloc.c | 14
drivers/atm/fore200e.c | 4
drivers/base/power/main.c | 4
drivers/block/z2ram.c | 4
drivers/char/agp/frontend.c | 1
drivers/char/agp/generic.c | 1
drivers/char/bsr.c | 1
drivers/char/mspec.c | 3
drivers/dma-buf/dma-resv.c | 5
drivers/firmware/efi/arm-runtime.c | 4
drivers/firmware/efi/efi.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gpuvm.c | 4
drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c | 10
drivers/gpu/drm/amd/amdkfd/kfd_events.c | 4
drivers/gpu/drm/drm_vm.c | 4
drivers/gpu/drm/etnaviv/etnaviv_gem.c | 2
drivers/gpu/drm/i915/gem/i915_gem_mman.c | 4
drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 14
drivers/gpu/drm/i915/i915_mm.c | 1
drivers/gpu/drm/i915/i915_perf.c | 2
drivers/gpu/drm/nouveau/nouveau_svm.c | 22
drivers/gpu/drm/radeon/radeon_cs.c | 4
drivers/gpu/drm/radeon/radeon_gem.c | 6
drivers/gpu/drm/ttm/ttm_bo_vm.c | 10
drivers/infiniband/core/umem_odp.c | 4
drivers/infiniband/core/uverbs_main.c | 6
drivers/infiniband/hw/hfi1/mmu_rb.c | 2
drivers/infiniband/hw/mlx4/mr.c | 4
drivers/infiniband/hw/qib/qib_file_ops.c | 4
drivers/infiniband/hw/qib/qib_user_pages.c | 6
drivers/infiniband/hw/usnic/usnic_uiom.c | 4
drivers/infiniband/sw/rdmavt/mmap.c | 1
drivers/infiniband/sw/rxe/rxe_mmap.c | 1
drivers/infiniband/sw/siw/siw_mem.c | 4
drivers/iommu/amd_iommu_v2.c | 4
drivers/iommu/intel-svm.c | 4
drivers/macintosh/macio-adb.c | 4
drivers/macintosh/mediabay.c | 4
drivers/macintosh/via-pmu.c | 4
drivers/media/pci/bt8xx/bt878.c | 4
drivers/media/pci/bt8xx/btcx-risc.c | 4
drivers/media/pci/bt8xx/bttv-risc.c | 4
drivers/media/platform/davinci/vpbe_display.c | 1
drivers/media/v4l2-core/v4l2-common.c | 1
drivers/media/v4l2-core/videobuf-core.c | 4
drivers/media/v4l2-core/videobuf-dma-contig.c | 4
drivers/media/v4l2-core/videobuf-dma-sg.c | 10
drivers/media/v4l2-core/videobuf-vmalloc.c | 4
drivers/misc/cxl/cxllib.c | 9
drivers/misc/cxl/fault.c | 4
drivers/misc/genwqe/card_utils.c | 2
drivers/misc/sgi-gru/grufault.c | 25
drivers/misc/sgi-gru/grufile.c | 4
drivers/mtd/ubi/ubi.h | 2
drivers/net/ethernet/amd/7990.c | 4
drivers/net/ethernet/amd/hplance.c | 4
drivers/net/ethernet/amd/mvme147.c | 4
drivers/net/ethernet/amd/sun3lance.c | 4
drivers/net/ethernet/amd/sunlance.c | 4
drivers/net/ethernet/apple/bmac.c | 4
drivers/net/ethernet/apple/mace.c | 4
drivers/net/ethernet/freescale/fs_enet/fs_enet-main.c | 4
drivers/net/ethernet/freescale/fs_enet/mac-fcc.c | 4
drivers/net/ethernet/freescale/fs_enet/mii-fec.c | 4
drivers/net/ethernet/i825xx/82596.c | 4
drivers/net/ethernet/korina.c | 4
drivers/net/ethernet/marvell/pxa168_eth.c | 4
drivers/net/ethernet/natsemi/jazzsonic.c | 4
drivers/net/ethernet/natsemi/macsonic.c | 4
drivers/net/ethernet/natsemi/xtsonic.c | 4
drivers/net/ethernet/sun/sunbmac.c | 4
drivers/net/ethernet/sun/sunhme.c | 1
drivers/net/ethernet/sun/sunqe.c | 4
drivers/oprofile/buffer_sync.c | 12
drivers/sbus/char/flash.c | 1
drivers/sbus/char/uctrl.c | 1
drivers/scsi/53c700.c | 4
drivers/scsi/a2091.c | 1
drivers/scsi/a3000.c | 1
drivers/scsi/arm/cumana_2.c | 4
drivers/scsi/arm/eesox.c | 4
drivers/scsi/arm/powertec.c | 4
drivers/scsi/dpt_i2o.c | 4
drivers/scsi/gvp11.c | 1
drivers/scsi/lasi700.c | 1
drivers/scsi/mac53c94.c | 4
drivers/scsi/mesh.c | 4
drivers/scsi/mvme147.c | 1
drivers/scsi/qlogicpti.c | 4
drivers/scsi/sni_53c710.c | 1
drivers/scsi/zorro_esp.c | 4
drivers/staging/android/ashmem.c | 4
drivers/staging/comedi/comedi_fops.c | 2
drivers/staging/kpc2000/kpc_dma/fileops.c | 4
drivers/staging/media/atomisp/pci/hmm/hmm_bo.c | 4
drivers/tee/optee/call.c | 4
drivers/tty/sysrq.c | 4
drivers/tty/vt/consolemap.c | 2
drivers/vfio/pci/vfio_pci.c | 22
drivers/vfio/vfio_iommu_type1.c | 8
drivers/vhost/vdpa.c | 4
drivers/video/console/newport_con.c | 1
drivers/video/fbdev/acornfb.c | 1
drivers/video/fbdev/atafb.c | 1
drivers/video/fbdev/cirrusfb.c | 1
drivers/video/fbdev/cyber2000fb.c | 1
drivers/video/fbdev/fb-puv3.c | 1
drivers/video/fbdev/hitfb.c | 1
drivers/video/fbdev/neofb.c | 1
drivers/video/fbdev/q40fb.c | 1
drivers/video/fbdev/savage/savagefb_driver.c | 1
drivers/xen/balloon.c | 1
drivers/xen/gntdev.c | 6
drivers/xen/grant-table.c | 1
drivers/xen/privcmd.c | 15
drivers/xen/xenbus/xenbus_probe.c | 1
drivers/xen/xenbus/xenbus_probe_backend.c | 1
drivers/xen/xenbus/xenbus_probe_frontend.c | 1
fs/aio.c | 4
fs/coredump.c | 8
fs/exec.c | 18
fs/ext2/file.c | 2
fs/ext4/super.c | 6
fs/hugetlbfs/inode.c | 2
fs/io_uring.c | 4
fs/kernfs/file.c | 4
fs/proc/array.c | 1
fs/proc/base.c | 24
fs/proc/meminfo.c | 1
fs/proc/nommu.c | 1
fs/proc/task_mmu.c | 34
fs/proc/task_nommu.c | 18
fs/proc/vmcore.c | 1
fs/userfaultfd.c | 46
fs/xfs/xfs_file.c | 2
fs/xfs/xfs_inode.c | 14
fs/xfs/xfs_iops.c | 4
include/asm-generic/io.h | 2
include/asm-generic/pgtable-nopmd.h | 1
include/asm-generic/pgtable-nopud.h | 1
include/asm-generic/pgtable.h | 1322 ----------------
include/linux/cache.h | 10
include/linux/crash_dump.h | 3
include/linux/dax.h | 1
include/linux/dma-noncoherent.h | 2
include/linux/fs.h | 4
include/linux/hmm.h | 2
include/linux/huge_mm.h | 2
include/linux/hugetlb.h | 2
include/linux/io-mapping.h | 4
include/linux/kallsyms.h | 4
include/linux/kasan.h | 4
include/linux/mempolicy.h | 2
include/linux/mm.h | 15
include/linux/mm_types.h | 4
include/linux/mmap_lock.h | 128 +
include/linux/mmu_notifier.h | 13
include/linux/pagemap.h | 2
include/linux/pgtable.h | 1444 +++++++++++++++++-
include/linux/rmap.h | 2
include/linux/sched/debug.h | 7
include/linux/sched/mm.h | 10
include/linux/uaccess.h | 62
include/xen/arm/page.h | 4
init/init_task.c | 1
ipc/shm.c | 8
kernel/acct.c | 6
kernel/bpf/stackmap.c | 21
kernel/bpf/syscall.c | 2
kernel/cgroup/cpuset.c | 4
kernel/debug/kdb/kdb_bt.c | 17
kernel/events/core.c | 10
kernel/events/uprobes.c | 20
kernel/exit.c | 11
kernel/fork.c | 15
kernel/futex.c | 4
kernel/locking/lockdep.c | 4
kernel/locking/rtmutex-debug.c | 4
kernel/power/snapshot.c | 1
kernel/relay.c | 2
kernel/sched/core.c | 10
kernel/sched/fair.c | 4
kernel/sys.c | 22
kernel/trace/bpf_trace.c | 176 +-
kernel/trace/ftrace.c | 8
kernel/trace/trace_kprobe.c | 80
kernel/trace/trace_output.c | 4
lib/dump_stack.c | 4
lib/ioremap.c | 1
lib/test_hmm.c | 14
lib/test_lockup.c | 16
mm/debug.c | 10
mm/debug_vm_pgtable.c | 1
mm/filemap.c | 46
mm/frame_vector.c | 6
mm/gup.c | 73
mm/hmm.c | 2
mm/huge_memory.c | 8
mm/hugetlb.c | 3
mm/init-mm.c | 6
mm/internal.h | 6
mm/khugepaged.c | 72
mm/ksm.c | 48
mm/maccess.c | 496 +++---
mm/madvise.c | 40
mm/memcontrol.c | 10
mm/memory.c | 61
mm/mempolicy.c | 36
mm/migrate.c | 16
mm/mincore.c | 8
mm/mlock.c | 22
mm/mmap.c | 74
mm/mmu_gather.c | 2
mm/mmu_notifier.c | 22
mm/mprotect.c | 22
mm/mremap.c | 14
mm/msync.c | 8
mm/nommu.c | 22
mm/oom_kill.c | 14
mm/page_io.c | 1
mm/page_reporting.h | 2
mm/pagewalk.c | 12
mm/pgtable-generic.c | 6
mm/process_vm_access.c | 4
mm/ptdump.c | 4
mm/rmap.c | 12
mm/shmem.c | 5
mm/sparse-vmemmap.c | 1
mm/sparse.c | 1
mm/swap_state.c | 5
mm/swapfile.c | 5
mm/userfaultfd.c | 26
mm/util.c | 12
mm/vmacache.c | 1
mm/zsmalloc.c | 4
net/ipv4/tcp.c | 8
net/xdp/xdp_umem.c | 4
security/keys/keyctl.c | 2
sound/core/oss/pcm_oss.c | 2
sound/core/sgbuf.c | 1
sound/pci/hda/hda_intel.c | 4
sound/soc/intel/common/sst-firmware.c | 4
sound/soc/intel/haswell/sst-haswell-pcm.c | 4
tools/include/linux/kallsyms.h | 2
virt/kvm/async_pf.c | 4
virt/kvm/kvm_main.c | 9
942 files changed, 4580 insertions(+), 5662 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-06-09 4:29 incoming Andrew Morton
@ 2020-06-09 16:58 ` Linus Torvalds
0 siblings, 0 replies; 348+ messages in thread
From: Linus Torvalds @ 2020-06-09 16:58 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Mon, Jun 8, 2020 at 9:29 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 942 files changed, 4580 insertions(+), 5662 deletions(-)
If you use proper tools, add a "-M" to your diff script, so that you see
941 files changed, 2614 insertions(+), 3696 deletions(-)
because a big portion of the lines were due to a rename:
rename include/{asm-generic => linux}/pgtable.h (91%)
but at some earlier point you mentioned "diffstat", so I guess "proper
tools" isn't an option ;(
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-06-11 1:40 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-06-11 1:40 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- various hotfixes and minor things
- hch's use_mm/unuse_mm clearnups
- new syscall process_madvise(): perform madvise() on a process other
than self
25 patches, based on 6f630784cc0d92fb58ea326e2bc01aa056279ecb.
Subsystems affected by this patch series:
mm/hugetlb
scripts
kcov
lib
nilfs
checkpatch
lib
mm/debug
ocfs2
lib
misc
mm/madvise
Subsystem: mm/hugetlb
Dan Carpenter <dan.carpenter@oracle.com>:
khugepaged: selftests: fix timeout condition in wait_for_scan()
Subsystem: scripts
SeongJae Park <sjpark@amazon.de>:
scripts/spelling: add a few more typos
Subsystem: kcov
Andrey Konovalov <andreyknvl@google.com>:
kcov: check kcov_softirq in kcov_remote_stop()
Subsystem: lib
Joe Perches <joe@perches.com>:
lib/lz4/lz4_decompress.c: document deliberate use of `&'
Subsystem: nilfs
Ryusuke Konishi <konishi.ryusuke@gmail.com>:
nilfs2: fix null pointer dereference at nilfs_segctor_do_construct()
Subsystem: checkpatch
Tim Froidcoeur <tim.froidcoeur@tessares.net>:
checkpatch: correct check for kernel parameters doc
Subsystem: lib
Alexander Gordeev <agordeev@linux.ibm.com>:
lib: fix bitmap_parse() on 64-bit big endian archs
Subsystem: mm/debug
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/debug_vm_pgtable: fix kernel crash by checking for THP support
Subsystem: ocfs2
Keyur Patel <iamkeyur96@gmail.com>:
ocfs2: fix spelling mistake and grammar
Ben Widawsky <ben.widawsky@intel.com>:
mm: add comments on pglist_data zones
Subsystem: lib
Wei Yang <richard.weiyang@gmail.com>:
lib: test get_count_order/long in test_bitops.c
Subsystem: misc
Walter Wu <walter-zh.wu@mediatek.com>:
stacktrace: cleanup inconsistent variable type
Christoph Hellwig <hch@lst.de>:
Patch series "improve use_mm / unuse_mm", v2:
kernel: move use_mm/unuse_mm to kthread.c
kernel: move use_mm/unuse_mm to kthread.c
kernel: better document the use_mm/unuse_mm API contract
kernel: set USER_DS in kthread_use_mm
Subsystem: mm/madvise
Minchan Kim <minchan@kernel.org>:
Patch series "introduce memory hinting API for external process", v7:
mm/madvise: pass task and mm to do_madvise
mm/madvise: introduce process_madvise() syscall: an external memory hinting API
mm/madvise: check fatal signal pending of target process
pid: move pidfd_get_pid() to pid.c
mm/madvise: support both pid and pidfd for process_madvise
Oleksandr Natalenko <oleksandr@redhat.com>:
mm/madvise: allow KSM hints for remote API
Minchan Kim <minchan@kernel.org>:
mm: support vector address ranges for process_madvise
mm: use only pidfd for process_madvise syscall
YueHaibing <yuehaibing@huawei.com>:
mm/madvise.c: remove duplicated include
arch/alpha/kernel/syscalls/syscall.tbl | 1
arch/arm/tools/syscall.tbl | 1
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 4
arch/ia64/kernel/syscalls/syscall.tbl | 1
arch/m68k/kernel/syscalls/syscall.tbl | 1
arch/microblaze/kernel/syscalls/syscall.tbl | 1
arch/mips/kernel/syscalls/syscall_n32.tbl | 3
arch/mips/kernel/syscalls/syscall_n64.tbl | 1
arch/mips/kernel/syscalls/syscall_o32.tbl | 3
arch/parisc/kernel/syscalls/syscall.tbl | 3
arch/powerpc/kernel/syscalls/syscall.tbl | 3
arch/powerpc/platforms/powernv/vas-fault.c | 4
arch/s390/kernel/syscalls/syscall.tbl | 3
arch/sh/kernel/syscalls/syscall.tbl | 1
arch/sparc/kernel/syscalls/syscall.tbl | 3
arch/x86/entry/syscalls/syscall_32.tbl | 3
arch/x86/entry/syscalls/syscall_64.tbl | 5
arch/xtensa/kernel/syscalls/syscall.tbl | 1
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 5
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_arcturus.c | 1
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v10.c | 1
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v9.c | 2
drivers/gpu/drm/i915/gvt/kvmgt.c | 2
drivers/usb/gadget/function/f_fs.c | 10
drivers/usb/gadget/legacy/inode.c | 6
drivers/vfio/vfio_iommu_type1.c | 6
drivers/vhost/vhost.c | 8
fs/aio.c | 1
fs/io-wq.c | 15 -
fs/io_uring.c | 11
fs/nilfs2/segment.c | 2
fs/ocfs2/mmap.c | 2
include/linux/compat.h | 10
include/linux/kthread.h | 9
include/linux/mm.h | 3
include/linux/mmu_context.h | 5
include/linux/mmzone.h | 14
include/linux/pid.h | 1
include/linux/stacktrace.h | 2
include/linux/syscalls.h | 16 -
include/uapi/asm-generic/unistd.h | 7
kernel/exit.c | 17 -
kernel/kcov.c | 26 +
kernel/kthread.c | 95 +++++-
kernel/pid.c | 17 +
kernel/sys_ni.c | 2
lib/Kconfig.debug | 10
lib/bitmap.c | 9
lib/lz4/lz4_decompress.c | 3
lib/test_bitops.c | 53 +++
mm/Makefile | 2
mm/debug_vm_pgtable.c | 6
mm/madvise.c | 295 ++++++++++++++------
mm/mmu_context.c | 64 ----
mm/oom_kill.c | 6
mm/vmacache.c | 4
scripts/checkpatch.pl | 4
scripts/spelling.txt | 9
tools/testing/selftests/vm/khugepaged.c | 2
62 files changed, 526 insertions(+), 285 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-06-12 0:30 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-06-12 0:30 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
A few fixes and stragglers.
5 patches, based on 623f6dc593eaf98b91916836785278eddddaacf8.
Subsystems affected by this patch series:
mm/memory-failure
ocfs2
lib/lzo
misc
Subsystem: mm/memory-failure
Naoya Horiguchi <nao.horiguchi@gmail.com>:
Patch series "hwpoison: fixes signaling on memory error":
mm/memory-failure: prioritize prctl(PR_MCE_KILL) over vm.memory_failure_early_kill
mm/memory-failure: send SIGBUS(BUS_MCEERR_AR) only to current thread
Subsystem: ocfs2
Tom Seewald <tseewald@gmail.com>:
ocfs2: fix build failure when TCP/IP is disabled
Subsystem: lib/lzo
Dave Rodgman <dave.rodgman@arm.com>:
lib/lzo: fix ambiguous encoding bug in lzo-rle
Subsystem: misc
Christoph Hellwig <hch@lst.de>:
amdgpu: a NULL ->mm does not mean a thread is a kthread
Documentation/lzo.txt | 8 ++++-
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 2 -
fs/ocfs2/Kconfig | 2 -
lib/lzo/lzo1x_compress.c | 13 ++++++++
mm/memory-failure.c | 43 +++++++++++++++++------------
5 files changed, 47 insertions(+), 21 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-06-26 3:28 Andrew Morton
2020-06-26 6:51 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2020-06-26 3:28 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a.
Subsystems affected by this patch series:
hotfixes
mm/pagealloc
kexec
ocfs2
lib
misc
mm/slab
mm/slab
mm/slub
mm/swap
mm/pagemap
mm/vmalloc
mm/memcg
mm/gup
mm/thp
mm/vmscan
x86
mm/memory-hotplug
MAINTAINERS
Subsystem: hotfixes
Stafford Horne <shorne@gmail.com>:
openrisc: fix boot oops when DEBUG_VM is enabled
Michal Hocko <mhocko@suse.com>:
mm: do_swap_page(): fix up the error code
Subsystem: mm/pagealloc
Vlastimil Babka <vbabka@suse.cz>:
mm, compaction: make capture control handling safe wrt interrupts
Subsystem: kexec
Lianbo Jiang <lijiang@redhat.com>:
kexec: do not verify the signature without the lockdown or mandatory signature
Subsystem: ocfs2
Junxiao Bi <junxiao.bi@oracle.com>:
Patch series "ocfs2: fix nfsd over ocfs2 issues", v2:
ocfs2: avoid inode removal while nfsd is accessing it
ocfs2: load global_inode_alloc
ocfs2: fix panic on nfs server over ocfs2
ocfs2: fix value of OCFS2_INVALID_SLOT
Subsystem: lib
Randy Dunlap <rdunlap@infradead.org>:
lib: fix test_hmm.c reference after free
Subsystem: misc
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
linux/bits.h: fix unsigned less than zero warnings
Subsystem: mm/slab
Waiman Long <longman@redhat.com>:
mm, slab: fix sign conversion problem in memcg_uncharge_slab()
Subsystem: mm/slab
Waiman Long <longman@redhat.com>:
mm/slab: use memzero_explicit() in kzfree()
Subsystem: mm/slub
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
slub: cure list_slab_objects() from double fix
Subsystem: mm/swap
Hugh Dickins <hughd@google.com>:
mm: fix swap cache node allocation mask
Subsystem: mm/pagemap
Arjun Roy <arjunroy@google.com>:
mm/memory.c: properly pte_offset_map_lock/unlock in vm_insert_pages()
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm/debug_vm_pgtable: fix build failure with powerpc 8xx
Stephen Rothwell <sfr@canb.auug.org.au>:
make asm-generic/cacheflush.h more standalone
Nathan Chancellor <natechancellor@gmail.com>:
media: omap3isp: remove cacheflush.h
Subsystem: mm/vmalloc
Masanari Iida <standby24x7@gmail.com>:
mm/vmalloc.c: fix a warning while make xmldocs
Subsystem: mm/memcg
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: handle div0 crash race condition in memory.low
Muchun Song <songmuchun@bytedance.com>:
mm/memcontrol.c: add missed css_put()
Chris Down <chris@chrisdown.name>:
mm/memcontrol.c: prevent missed memory.low load tears
Subsystem: mm/gup
Souptick Joarder <jrdr.linux@gmail.com>:
docs: mm/gup: minor documentation update
Subsystem: mm/thp
Yang Shi <yang.shi@linux.alibaba.com>:
doc: THP CoW fault no longer allocate THP
Subsystem: mm/vmscan
Johannes Weiner <hannes@cmpxchg.org>:
Patch series "fix for "mm: balance LRU lists based on relative thrashing" patchset":
mm: workingset: age nonresident information alongside anonymous pages
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
mm/swap: fix for "mm: workingset: age nonresident information alongside anonymous pages"
mm/memory: fix IO cost for anonymous page
Subsystem: x86
Christoph Hellwig <hch@lst.de>:
Patch series "fix a hyperv W^X violation and remove vmalloc_exec":
x86/hyperv: allocate the hypercall page with only read and execute bits
arm64: use PAGE_KERNEL_ROX directly in alloc_insn_page
mm: remove vmalloc_exec
Subsystem: mm/memory-hotplug
Ben Widawsky <ben.widawsky@intel.com>:
mm/memory_hotplug.c: fix false softlockup during pfn range removal
Subsystem: MAINTAINERS
Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
MAINTAINERS: update info for sparse
Documentation/admin-guide/cgroup-v2.rst | 4 +-
Documentation/admin-guide/mm/transhuge.rst | 3 -
Documentation/core-api/pin_user_pages.rst | 2 -
MAINTAINERS | 4 +-
arch/arm64/kernel/probes/kprobes.c | 12 +------
arch/openrisc/kernel/dma.c | 5 +++
arch/x86/hyperv/hv_init.c | 4 +-
arch/x86/include/asm/pgtable_types.h | 2 +
drivers/media/platform/omap3isp/isp.c | 2 -
drivers/media/platform/omap3isp/ispvideo.c | 1
fs/ocfs2/dlmglue.c | 17 ++++++++++
fs/ocfs2/ocfs2.h | 1
fs/ocfs2/ocfs2_fs.h | 4 +-
fs/ocfs2/suballoc.c | 9 +++--
include/asm-generic/cacheflush.h | 5 +++
include/linux/bits.h | 3 +
include/linux/mmzone.h | 4 +-
include/linux/swap.h | 1
include/linux/vmalloc.h | 1
kernel/kexec_file.c | 36 ++++------------------
kernel/module.c | 4 +-
lib/test_hmm.c | 3 -
mm/compaction.c | 17 ++++++++--
mm/debug_vm_pgtable.c | 4 +-
mm/memcontrol.c | 18 ++++++++---
mm/memory.c | 33 +++++++++++++-------
mm/memory_hotplug.c | 13 ++++++--
mm/nommu.c | 17 ----------
mm/slab.h | 4 +-
mm/slab_common.c | 2 -
mm/slub.c | 19 ++---------
mm/swap.c | 3 -
mm/swap_state.c | 4 +-
mm/vmalloc.c | 21 -------------
mm/vmscan.c | 3 +
mm/workingset.c | 46 +++++++++++++++++------------
36 files changed, 168 insertions(+), 163 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-06-26 3:28 incoming Andrew Morton
@ 2020-06-26 6:51 ` Linus Torvalds
2020-06-26 7:31 ` incoming Linus Torvalds
2020-06-26 17:39 ` incoming Konstantin Ryabitsev
0 siblings, 2 replies; 348+ messages in thread
From: Linus Torvalds @ 2020-06-26 6:51 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits
On Thu, Jun 25, 2020 at 8:28 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a.
You didn't cc lkml, so now none of the nice 'b4' automation seems to
work for this series..
Yes, this cover-letter went to linux-mm (which is on lore), but the
individual patches didn't.
Konstantin, maybe mm-commits could be on lore too and then they'd have
been caught that way?
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-06-26 6:51 ` incoming Linus Torvalds
@ 2020-06-26 7:31 ` Linus Torvalds
2020-06-26 17:39 ` incoming Konstantin Ryabitsev
1 sibling, 0 replies; 348+ messages in thread
From: Linus Torvalds @ 2020-06-26 7:31 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits
On Thu, Jun 25, 2020 at 11:51 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> You didn't cc lkml, so now none of the nice 'b4' automation seems to
> work for this series..
Note that I've picked them up the old-fashioned way, so don't re-send them.
So more of a note for "please, next time..."
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-06-26 6:51 ` incoming Linus Torvalds
2020-06-26 7:31 ` incoming Linus Torvalds
@ 2020-06-26 17:39 ` Konstantin Ryabitsev
2020-06-26 17:40 ` incoming Konstantin Ryabitsev
1 sibling, 1 reply; 348+ messages in thread
From: Konstantin Ryabitsev @ 2020-06-26 17:39 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits
On Thu, Jun 25, 2020 at 11:51:06PM -0700, Linus Torvalds wrote:
> On Thu, Jun 25, 2020 at 8:28 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a.
>
> You didn't cc lkml, so now none of the nice 'b4' automation seems to
> work for this series..
>
> Yes, this cover-letter went to linux-mm (which is on lore), but the
> individual patches didn't.
>
> Konstantin, maybe mm-commits could be on lore too and then they'd have
> been caught that way?
Yes, I already have a request from Kees for linux-mm addition, so that
should show up in archives before long.
-K
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-06-26 17:39 ` incoming Konstantin Ryabitsev
@ 2020-06-26 17:40 ` Konstantin Ryabitsev
0 siblings, 0 replies; 348+ messages in thread
From: Konstantin Ryabitsev @ 2020-06-26 17:40 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits
On Fri, 26 Jun 2020 at 13:39, Konstantin Ryabitsev
<konstantin@linuxfoundation.org> wrote:
> > Konstantin, maybe mm-commits could be on lore too and then they'd have
> > been caught that way?
>
> Yes, I already have a request from Kees for linux-mm addition, so that
> should show up in archives before long.
correction: mm-commits, that is
-K
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-07-03 22:14 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-07-03 22:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
5 patches, based on cdd3bb54332f82295ed90cd0c09c78cd0c0ee822.
Subsystems affected by this patch series:
mm/hugetlb
samples
mm/cma
mm/vmalloc
mm/pagealloc
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
mm/hugetlb.c: fix pages per hugetlb calculation
Subsystem: samples
Kees Cook <keescook@chromium.org>:
samples/vfs: avoid warning in statx override
Subsystem: mm/cma
Barry Song <song.bao.hua@hisilicon.com>:
mm/cma.c: use exact_nid true to fix possible per-numa cma leak
Subsystem: mm/vmalloc
Christoph Hellwig <hch@lst.de>:
vmalloc: fix the owner argument for the new __vmalloc_node_range callers
Subsystem: mm/pagealloc
Joel Savitz <jsavitz@redhat.com>:
mm/page_alloc: fix documentation error
arch/arm64/kernel/probes/kprobes.c | 2 +-
arch/x86/hyperv/hv_init.c | 3 ++-
kernel/module.c | 2 +-
mm/cma.c | 4 ++--
mm/hugetlb.c | 2 +-
mm/page_alloc.c | 2 +-
samples/vfs/test-statx.c | 2 ++
7 files changed, 10 insertions(+), 7 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-07-24 4:14 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-07-24 4:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
15 patches, based on f37e99aca03f63aa3f2bd13ceaf769455d12c4b0.
Subsystems affected by this patch series:
mm/pagemap
mm/shmem
mm/hotfixes
mm/memcg
mm/hugetlb
mailmap
squashfs
scripts
io-mapping
MAINTAINERS
gdb
Subsystem: mm/pagemap
Yang Shi <yang.shi@linux.alibaba.com>:
mm/memory.c: avoid access flag update TLB flush for retried page fault
"Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
mm/mmap.c: close race between munmap() and expand_upwards()/downwards()
Subsystem: mm/shmem
Chengguang Xu <cgxu519@mykernel.net>:
vfs/xattr: mm/shmem: kernfs: release simple xattr entry in a right way
Subsystem: mm/hotfixes
Tom Rix <trix@redhat.com>:
mm: initialize return of vm_insert_pages
Bhupesh Sharma <bhsharma@redhat.com>:
mm/memcontrol: fix OOPS inside mem_cgroup_get_nr_swap_pages()
Subsystem: mm/memcg
Hugh Dickins <hughd@google.com>:
mm/memcg: fix refcount error while moving and swapping
Muchun Song <songmuchun@bytedance.com>:
mm: memcg/slab: fix memory leak at non-root kmem_cache destroy
Subsystem: mm/hugetlb
Barry Song <song.bao.hua@hisilicon.com>:
mm/hugetlb: avoid hardcoding while checking if cma is enabled
"Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
khugepaged: fix null-pointer dereference due to race
Subsystem: mailmap
Mike Rapoport <rppt@linux.ibm.com>:
mailmap: add entry for Mike Rapoport
Subsystem: squashfs
Phillip Lougher <phillip@squashfs.org.uk>:
squashfs: fix length field overlap check in metadata reading
Subsystem: scripts
Pi-Hsun Shih <pihsun@chromium.org>:
scripts/decode_stacktrace: strip basepath from all paths
Subsystem: io-mapping
"Michael J. Ruhl" <michael.j.ruhl@intel.com>:
io-mapping: indicate mapping failure
Subsystem: MAINTAINERS
Andrey Konovalov <andreyknvl@google.com>:
MAINTAINERS: add KCOV section
Subsystem: gdb
Stefano Garzarella <sgarzare@redhat.com>:
scripts/gdb: fix lx-symbols 'gdb.error' while loading modules
.mailmap | 3 +++
MAINTAINERS | 11 +++++++++++
fs/squashfs/block.c | 2 +-
include/linux/io-mapping.h | 5 ++++-
include/linux/xattr.h | 3 ++-
mm/hugetlb.c | 15 ++++++++++-----
mm/khugepaged.c | 3 +++
mm/memcontrol.c | 13 ++++++++++---
mm/memory.c | 9 +++++++--
mm/mmap.c | 16 ++++++++++++++--
mm/shmem.c | 2 +-
mm/slab_common.c | 35 ++++++++++++++++++++++++++++-------
scripts/decode_stacktrace.sh | 4 ++--
scripts/gdb/linux/symbols.py | 2 +-
14 files changed, 97 insertions(+), 26 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-08-07 6:16 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-08-07 6:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- A few MM hotfixes
- kthread, tools, scripts, ntfs and ocfs2
- Some of MM
163 patches, based on d6efb3ac3e6c19ab722b28bdb9252bae0b9676b6.
Subsystems affected by this patch series:
mm/pagemap
mm/hofixes
mm/pagealloc
kthread
tools
scripts
ntfs
ocfs2
mm/slab-generic
mm/slab
mm/slub
mm/kcsan
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/shmem
mm/memcg
mm/pagemap
mm/mremap
mm/mincore
mm/sparsemem
mm/vmalloc
mm/kasan
mm/pagealloc
mm/hugetlb
mm/vmscan
Subsystem: mm/pagemap
Yang Shi <yang.shi@linux.alibaba.com>:
mm/memory.c: avoid access flag update TLB flush for retried page fault
Subsystem: mm/hofixes
Ralph Campbell <rcampbell@nvidia.com>:
mm/migrate: fix migrate_pgmap_owner w/o CONFIG_MMU_NOTIFIER
Subsystem: mm/pagealloc
David Hildenbrand <david@redhat.com>:
mm/shuffle: don't move pages between zones and don't read garbage memmaps
Subsystem: kthread
Peter Zijlstra <peterz@infradead.org>:
mm: fix kthread_use_mm() vs TLB invalidate
Ilias Stamatis <stamatis.iliass@gmail.com>:
kthread: remove incorrect comment in kthread_create_on_cpu()
Subsystem: tools
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
tools/: replace HTTP links with HTTPS ones
Gaurav Singh <gaurav1086@gmail.com>:
tools/testing/selftests/cgroup/cgroup_util.c: cg_read_strcmp: fix null pointer dereference
Subsystem: scripts
Jialu Xu <xujialu@vimux.org>:
scripts/tags.sh: collect compiled source precisely
Nikolay Borisov <nborisov@suse.com>:
scripts/bloat-o-meter: Support comparing library archives
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
scripts/decode_stacktrace.sh: skip missing symbols
scripts/decode_stacktrace.sh: guess basepath if not specified
scripts/decode_stacktrace.sh: guess path to modules
scripts/decode_stacktrace.sh: guess path to vmlinux by release name
Joe Perches <joe@perches.com>:
const_structs.checkpatch: add regulator_ops
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ntfs
Luca Stefani <luca.stefani.ge1@gmail.com>:
ntfs: fix ntfs_test_inode and ntfs_init_locked_inode function type
Subsystem: ocfs2
Gang He <ghe@suse.com>:
ocfs2: fix remounting needed after setfacl command
Randy Dunlap <rdunlap@infradead.org>:
ocfs2: suballoc.h: delete a duplicated word
Junxiao Bi <junxiao.bi@oracle.com>:
ocfs2: change slot number type s16 to u16
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
ocfs2: replace HTTP links with HTTPS ones
Pavel Machek <pavel@ucw.cz>:
ocfs2: fix unbalanced locking
Subsystem: mm/slab-generic
Waiman Long <longman@redhat.com>:
mm, treewide: rename kzfree() to kfree_sensitive()
William Kucharski <william.kucharski@oracle.com>:
mm: ksize() should silently accept a NULL pointer
Subsystem: mm/slab
Kees Cook <keescook@chromium.org>:
Patch series "mm: Expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB":
mm/slab: expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB
mm/slab: add naive detection of double free
Long Li <lonuxli.64@gmail.com>:
mm, slab: check GFP_SLAB_BUG_MASK before alloc_pages in kmalloc_order
Xiao Yang <yangx.jy@cn.fujitsu.com>:
mm/slab.c: update outdated kmem_list3 in a comment
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
Patch series "slub_debug fixes and improvements":
mm, slub: extend slub_debug syntax for multiple blocks
mm, slub: make some slub_debug related attributes read-only
mm, slub: remove runtime allocation order changes
mm, slub: make remaining slub_debug related attributes read-only
mm, slub: make reclaim_account attribute read-only
mm, slub: introduce static key for slub_debug()
mm, slub: introduce kmem_cache_debug_flags()
mm, slub: extend checks guarded by slub_debug static key
mm, slab/slub: move and improve cache_from_obj()
mm, slab/slub: improve error reporting and overhead of cache_from_obj()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/slub.c: drop lockdep_assert_held() from put_map()
Subsystem: mm/kcsan
Marco Elver <elver@google.com>:
mm, kcsan: instrument SLAB/SLUB free with "ASSERT_EXCLUSIVE_ACCESS"
Subsystem: mm/debug
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/debug_vm_pgtable: Add some more tests", v5:
mm/debug_vm_pgtable: add tests validating arch helpers for core MM features
mm/debug_vm_pgtable: add tests validating advanced arch page table helpers
mm/debug_vm_pgtable: add debug prints for individual tests
Documentation/mm: add descriptions for arch page table helpers
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Improvements for dump_page()", v2:
mm/debug: handle page->mapping better in dump_page
mm/debug: dump compound page information on a second line
mm/debug: print head flags in dump_page
mm/debug: switch dump_page to get_kernel_nofault
mm/debug: print the inode number in dump_page
mm/debug: print hashed address of struct page
John Hubbard <jhubbard@nvidia.com>:
mm, dump_page: do not crash with bad compound_mapcount()
Subsystem: mm/pagecache
Yang Shi <yang.shi@linux.alibaba.com>:
mm: filemap: clear idle flag for writes
mm: filemap: add missing FGP_ flags in kerneldoc comment for pagecache_get_page
Subsystem: mm/gup
Tang Yizhou <tangyizhou@huawei.com>:
mm/gup.c: fix the comment of return value for populate_vma_page_range()
Subsystem: mm/swap
Zhen Lei <thunder.leizhen@huawei.com>:
Patch series "clean up some functions in mm/swap_slots.c":
mm/swap_slots.c: simplify alloc_swap_slot_cache()
mm/swap_slots.c: simplify enable_swap_slots_cache()
mm/swap_slots.c: remove redundant check for swap_slot_cache_initialized
Krzysztof Kozlowski <krzk@kernel.org>:
mm: swap: fix kerneldoc of swap_vma_readahead()
Xianting Tian <xianting_tian@126.com>:
mm/page_io.c: use blk_io_schedule() for avoiding task hung in sync io
Subsystem: mm/shmem
Chris Down <chris@chrisdown.name>:
Patch series "tmpfs: inode: Reduce risk of inum overflow", v7:
tmpfs: per-superblock i_ino support
tmpfs: support 64-bit inums per-sb
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: kmem: make memcg_kmem_enabled() irreversible
Patch series "The new cgroup slab memory controller", v7:
mm: memcg: factor out memcg- and lruvec-level changes out of __mod_lruvec_state()
mm: memcg: prepare for byte-sized vmstat items
mm: memcg: convert vmstat slab counters to bytes
mm: slub: implement SLUB version of obj_to_index()
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: decouple reference counting from page accounting
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: obj_cgroup API
mm: memcg/slab: allocate obj_cgroups for non-root slab pages
mm: memcg/slab: save obj_cgroup for non-root slab objects
mm: memcg/slab: charge individual slab objects instead of pages
mm: memcg/slab: deprecate memory.kmem.slabinfo
mm: memcg/slab: move memcg_kmem_bypass() to memcontrol.h
mm: memcg/slab: use a single set of kmem_caches for all accounted allocations
mm: memcg/slab: simplify memcg cache creation
mm: memcg/slab: remove memcg_kmem_get_cache()
mm: memcg/slab: deprecate slab_root_caches
mm: memcg/slab: remove redundant check in memcg_accumulate_slabinfo()
mm: memcg/slab: use a single set of kmem_caches for all allocations
kselftests: cgroup: add kernel memory accounting tests
tools/cgroup: add memcg_slabinfo.py tool
Shakeel Butt <shakeelb@google.com>:
mm: memcontrol: account kernel stack per node
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: remove unused argument by charge_slab_page()
mm: slab: rename (un)charge_slab_page() to (un)account_slab_page()
mm: kmem: switch to static_branch_likely() in memcg_kmem_enabled()
mm: memcontrol: avoid workload stalls when lowering memory.high
Chris Down <chris@chrisdown.name>:
Patch series "mm, memcg: reclaim harder before high throttling", v2:
mm, memcg: reclaim more aggressively before high allocator throttling
mm, memcg: unify reclaim retry limits with page allocator
Yafang Shao <laoar.shao@gmail.com>:
Patch series "mm, memcg: memory.{low,min} reclaim fix & cleanup", v4:
mm, memcg: avoid stale protection values when cgroup is above protection
Chris Down <chris@chrisdown.name>:
mm, memcg: decouple e{low,min} state mutations from protection checks
Yafang Shao <laoar.shao@gmail.com>:
memcg, oom: check memcg margin for parallel oom
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: restore proper dirty throttling when memory.high changes
mm: memcontrol: don't count limit-setting reclaim as memory pressure
Michal Koutný <mkoutny@suse.com>:
mm/page_counter.c: fix protection usage propagation
Subsystem: mm/pagemap
Ralph Campbell <rcampbell@nvidia.com>:
mm: remove redundant check non_swap_entry()
Alex Zhang <zhangalex@google.com>:
mm/memory.c: make remap_pfn_range() reject unaligned addr
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: cleanup usage of <asm/pgalloc.h>":
mm: remove unneeded includes of <asm/pgalloc.h>
opeinrisc: switch to generic version of pte allocation
xtensa: switch to generic version of pte allocation
asm-generic: pgalloc: provide generic pmd_alloc_one() and pmd_free_one()
asm-generic: pgalloc: provide generic pud_alloc_one() and pud_free_one()
asm-generic: pgalloc: provide generic pgd_free()
mm: move lib/ioremap.c to mm/
Joerg Roedel <jroedel@suse.de>:
mm: move p?d_alloc_track to separate header file
Zhen Lei <thunder.leizhen@huawei.com>:
mm/mmap: optimize a branch judgment in ksys_mmap_pgoff()
Feng Tang <feng.tang@intel.com>:
Patch series "make vm_committed_as_batch aware of vm overcommit policy", v6:
proc/meminfo: avoid open coded reading of vm_committed_as
mm/util.c: make vm_memory_committed() more accurate
percpu_counter: add percpu_counter_sync()
mm: adjust vm_committed_as_batch according to vm overcommit policy
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "arm64: Enable vmemmap mapping from device memory", v4:
mm/sparsemem: enable vmem_altmap support in vmemmap_populate_basepages()
mm/sparsemem: enable vmem_altmap support in vmemmap_alloc_block_buf()
arm64/mm: enable vmem_altmap support for vmemmap mappings
Miaohe Lin <linmiaohe@huawei.com>:
mm: mmap: merge vma after call_mmap() if possible
Peter Collingbourne <pcc@google.com>:
mm: remove unnecessary wrapper function do_mmap_pgoff()
Subsystem: mm/mremap
Wei Yang <richard.weiyang@linux.alibaba.com>:
Patch series "mm/mremap: cleanup move_page_tables() a little", v5:
mm/mremap: it is sure to have enough space when extent meets requirement
mm/mremap: calculate extent in one place
mm/mremap: start addresses are properly aligned
Subsystem: mm/mincore
Ricardo Cañuelo <ricardo.canuelo@collabora.com>:
selftests: add mincore() tests
Subsystem: mm/sparsemem
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/sparse: never partially remove memmap for early section
mm/sparse: only sub-section aligned range would be populated
Mike Rapoport <rppt@linux.ibm.com>:
mm/sparse: cleanup the code surrounding memory_present()
Subsystem: mm/vmalloc
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
vmalloc: convert to XArray
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: simplify merge_or_add_vmap_area()
mm/vmalloc: simplify augment_tree_propagate_check()
mm/vmalloc: switch to "propagate()" callback
mm/vmalloc: update the header about KVA rework
Mike Rapoport <rppt@linux.ibm.com>:
mm: vmalloc: remove redundant assignment in unmap_kernel_range_noflush()
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc.c: remove BUG() from the find_va_links()
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
kasan: improve and simplify Kconfig.kasan
kasan: update required compiler versions in documentation
Walter Wu <walter-zh.wu@mediatek.com>:
Patch series "kasan: memorize and print call_rcu stack", v8:
rcu: kasan: record and print call_rcu() call stack
kasan: record and print the free track
kasan: add tests for call_rcu stack recording
kasan: update documentation for generic kasan
Vincenzo Frascino <vincenzo.frascino@arm.com>:
kasan: remove kasan_unpoison_stack_above_sp_to()
Walter Wu <walter-zh.wu@mediatek.com>:
lib/test_kasan.c: fix KASAN unit tests for tag-based KASAN
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: support stack instrumentation for tag-based mode", v2:
kasan: don't tag stacks allocated with pagealloc
efi: provide empty efi_enter_virtual_mode implementation
kasan, arm64: don't instrument functions that enable kasan
kasan: allow enabling stack tagging for tag-based mode
kasan: adjust kasan_stack_oob for tag-based mode
Subsystem: mm/pagealloc
Vlastimil Babka <vbabka@suse.cz>:
mm, page_alloc: use unlikely() in task_capc()
Jaewon Kim <jaewon31.kim@samsung.com>:
page_alloc: consider highatomic reserve in watermark fast
Charan Teja Reddy <charante@codeaurora.org>:
mm, page_alloc: skip ->waternark_boost for atomic order-0 allocations
David Hildenbrand <david@redhat.com>:
mm: remove vm_total_pages
mm/page_alloc: remove nr_free_pagecache_pages()
mm/memory_hotplug: document why shuffle_zone() is relevant
mm/shuffle: remove dynamic reconfiguration
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/page_alloc.c: replace the definition of NR_MIGRATETYPE_BITS with PB_migratetype_bits
mm/page_alloc.c: extract the common part in pfn_to_bitidx()
mm/page_alloc.c: simplify pageblock bitmap access
mm/page_alloc.c: remove unnecessary end_bitidx for [set|get]_pfnblock_flags_mask()
Qian Cai <cai@lca.pw>:
mm/page_alloc: silence a KASAN false positive
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/page_alloc: fallbacks at most has 3 elements
Muchun Song <songmuchun@bytedance.com>:
mm/page_alloc.c: skip setting nodemask when we are in interrupt
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
mm/page_alloc: fix memalloc_nocma_{save/restore} APIs
Subsystem: mm/hugetlb
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
mm: thp: replace HTTP links with HTTPS ones
Peter Xu <peterx@redhat.com>:
mm/hugetlb: fix calculation of adjust_range_if_pmd_sharing_possible
Hugh Dickins <hughd@google.com>:
khugepaged: collapse_pte_mapped_thp() flush the right range
khugepaged: collapse_pte_mapped_thp() protect the pmd lock
khugepaged: retract_page_tables() remember to test exit
khugepaged: khugepaged_test_exit() check mmget_still_valid()
Subsystem: mm/vmscan
dylan-meiners <spacct.spacct@gmail.com>:
mm/vmscan.c: fix typo
Shakeel Butt <shakeelb@google.com>:
mm: vmscan: consistent update to pgrefill
Documentation/admin-guide/kernel-parameters.txt | 2
Documentation/dev-tools/kasan.rst | 10
Documentation/filesystems/dlmfs.rst | 2
Documentation/filesystems/ocfs2.rst | 2
Documentation/filesystems/tmpfs.rst | 18
Documentation/vm/arch_pgtable_helpers.rst | 258 +++++
Documentation/vm/memory-model.rst | 9
Documentation/vm/slub.rst | 51 -
arch/alpha/include/asm/pgalloc.h | 21
arch/alpha/include/asm/tlbflush.h | 1
arch/alpha/kernel/core_irongate.c | 1
arch/alpha/kernel/core_marvel.c | 1
arch/alpha/kernel/core_titan.c | 1
arch/alpha/kernel/machvec_impl.h | 2
arch/alpha/kernel/smp.c | 1
arch/alpha/mm/numa.c | 1
arch/arc/mm/fault.c | 1
arch/arc/mm/init.c | 1
arch/arm/include/asm/pgalloc.h | 12
arch/arm/include/asm/tlb.h | 1
arch/arm/kernel/machine_kexec.c | 1
arch/arm/kernel/smp.c | 1
arch/arm/kernel/suspend.c | 1
arch/arm/mach-omap2/omap-mpuss-lowpower.c | 1
arch/arm/mm/hugetlbpage.c | 1
arch/arm/mm/init.c | 9
arch/arm/mm/mmu.c | 1
arch/arm64/include/asm/pgalloc.h | 39
arch/arm64/kernel/setup.c | 2
arch/arm64/kernel/smp.c | 1
arch/arm64/mm/hugetlbpage.c | 1
arch/arm64/mm/init.c | 6
arch/arm64/mm/ioremap.c | 1
arch/arm64/mm/mmu.c | 63 -
arch/csky/include/asm/pgalloc.h | 7
arch/csky/kernel/smp.c | 1
arch/hexagon/include/asm/pgalloc.h | 7
arch/ia64/include/asm/pgalloc.h | 24
arch/ia64/include/asm/tlb.h | 1
arch/ia64/kernel/process.c | 1
arch/ia64/kernel/smp.c | 1
arch/ia64/kernel/smpboot.c | 1
arch/ia64/mm/contig.c | 1
arch/ia64/mm/discontig.c | 4
arch/ia64/mm/hugetlbpage.c | 1
arch/ia64/mm/tlb.c | 1
arch/m68k/include/asm/mmu_context.h | 2
arch/m68k/include/asm/sun3_pgalloc.h | 7
arch/m68k/kernel/dma.c | 2
arch/m68k/kernel/traps.c | 3
arch/m68k/mm/cache.c | 2
arch/m68k/mm/fault.c | 1
arch/m68k/mm/kmap.c | 2
arch/m68k/mm/mcfmmu.c | 1
arch/m68k/mm/memory.c | 1
arch/m68k/sun3x/dvma.c | 2
arch/microblaze/include/asm/pgalloc.h | 6
arch/microblaze/include/asm/tlbflush.h | 1
arch/microblaze/kernel/process.c | 1
arch/microblaze/kernel/signal.c | 1
arch/microblaze/mm/init.c | 3
arch/mips/include/asm/pgalloc.h | 19
arch/mips/kernel/setup.c | 8
arch/mips/loongson64/numa.c | 1
arch/mips/sgi-ip27/ip27-memory.c | 2
arch/mips/sgi-ip32/ip32-memory.c | 1
arch/nds32/mm/mm-nds32.c | 2
arch/nios2/include/asm/pgalloc.h | 7
arch/openrisc/include/asm/pgalloc.h | 33
arch/openrisc/include/asm/tlbflush.h | 1
arch/openrisc/kernel/or32_ksyms.c | 1
arch/parisc/include/asm/mmu_context.h | 1
arch/parisc/include/asm/pgalloc.h | 12
arch/parisc/kernel/cache.c | 1
arch/parisc/kernel/pci-dma.c | 1
arch/parisc/kernel/process.c | 1
arch/parisc/kernel/signal.c | 1
arch/parisc/kernel/smp.c | 1
arch/parisc/mm/hugetlbpage.c | 1
arch/parisc/mm/init.c | 5
arch/parisc/mm/ioremap.c | 2
arch/powerpc/include/asm/tlb.h | 1
arch/powerpc/mm/book3s64/hash_hugetlbpage.c | 1
arch/powerpc/mm/book3s64/hash_pgtable.c | 1
arch/powerpc/mm/book3s64/hash_tlb.c | 1
arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 1
arch/powerpc/mm/init_32.c | 1
arch/powerpc/mm/init_64.c | 4
arch/powerpc/mm/kasan/8xx.c | 1
arch/powerpc/mm/kasan/book3s_32.c | 1
arch/powerpc/mm/mem.c | 3
arch/powerpc/mm/nohash/40x.c | 1
arch/powerpc/mm/nohash/8xx.c | 1
arch/powerpc/mm/nohash/fsl_booke.c | 1
arch/powerpc/mm/nohash/kaslr_booke.c | 1
arch/powerpc/mm/nohash/tlb.c | 1
arch/powerpc/mm/numa.c | 1
arch/powerpc/mm/pgtable.c | 1
arch/powerpc/mm/pgtable_64.c | 1
arch/powerpc/mm/ptdump/hashpagetable.c | 2
arch/powerpc/mm/ptdump/ptdump.c | 1
arch/powerpc/platforms/pseries/cmm.c | 1
arch/riscv/include/asm/pgalloc.h | 18
arch/riscv/mm/fault.c | 1
arch/riscv/mm/init.c | 3
arch/s390/crypto/prng.c | 4
arch/s390/include/asm/tlb.h | 1
arch/s390/include/asm/tlbflush.h | 1
arch/s390/kernel/machine_kexec.c | 1
arch/s390/kernel/ptrace.c | 1
arch/s390/kvm/diag.c | 1
arch/s390/kvm/priv.c | 1
arch/s390/kvm/pv.c | 1
arch/s390/mm/cmm.c | 1
arch/s390/mm/init.c | 1
arch/s390/mm/mmap.c | 1
arch/s390/mm/pgtable.c | 1
arch/sh/include/asm/pgalloc.h | 4
arch/sh/kernel/idle.c | 1
arch/sh/kernel/machine_kexec.c | 1
arch/sh/mm/cache-sh3.c | 1
arch/sh/mm/cache-sh7705.c | 1
arch/sh/mm/hugetlbpage.c | 1
arch/sh/mm/init.c | 7
arch/sh/mm/ioremap_fixed.c | 1
arch/sh/mm/numa.c | 3
arch/sh/mm/tlb-sh3.c | 1
arch/sparc/include/asm/ide.h | 1
arch/sparc/include/asm/tlb_64.h | 1
arch/sparc/kernel/leon_smp.c | 1
arch/sparc/kernel/process_32.c | 1
arch/sparc/kernel/signal_32.c | 1
arch/sparc/kernel/smp_32.c | 1
arch/sparc/kernel/smp_64.c | 1
arch/sparc/kernel/sun4m_irq.c | 1
arch/sparc/mm/highmem.c | 1
arch/sparc/mm/init_64.c | 1
arch/sparc/mm/io-unit.c | 1
arch/sparc/mm/iommu.c | 1
arch/sparc/mm/tlb.c | 1
arch/um/include/asm/pgalloc.h | 9
arch/um/include/asm/pgtable-3level.h | 3
arch/um/kernel/mem.c | 17
arch/x86/ia32/ia32_aout.c | 1
arch/x86/include/asm/mmu_context.h | 1
arch/x86/include/asm/pgalloc.h | 42
arch/x86/kernel/alternative.c | 1
arch/x86/kernel/apic/apic.c | 1
arch/x86/kernel/mpparse.c | 1
arch/x86/kernel/traps.c | 1
arch/x86/mm/fault.c | 1
arch/x86/mm/hugetlbpage.c | 1
arch/x86/mm/init_32.c | 2
arch/x86/mm/init_64.c | 12
arch/x86/mm/kaslr.c | 1
arch/x86/mm/pgtable_32.c | 1
arch/x86/mm/pti.c | 1
arch/x86/platform/uv/bios_uv.c | 1
arch/x86/power/hibernate.c | 2
arch/xtensa/include/asm/pgalloc.h | 46
arch/xtensa/kernel/xtensa_ksyms.c | 1
arch/xtensa/mm/cache.c | 1
arch/xtensa/mm/fault.c | 1
crypto/adiantum.c | 2
crypto/ahash.c | 4
crypto/api.c | 2
crypto/asymmetric_keys/verify_pefile.c | 4
crypto/deflate.c | 2
crypto/drbg.c | 10
crypto/ecc.c | 8
crypto/ecdh.c | 2
crypto/gcm.c | 2
crypto/gf128mul.c | 4
crypto/jitterentropy-kcapi.c | 2
crypto/rng.c | 2
crypto/rsa-pkcs1pad.c | 6
crypto/seqiv.c | 2
crypto/shash.c | 2
crypto/skcipher.c | 2
crypto/testmgr.c | 6
crypto/zstd.c | 2
drivers/base/node.c | 10
drivers/block/xen-blkback/common.h | 1
drivers/crypto/allwinner/sun8i-ce/sun8i-ce-cipher.c | 2
drivers/crypto/allwinner/sun8i-ss/sun8i-ss-cipher.c | 2
drivers/crypto/amlogic/amlogic-gxl-cipher.c | 4
drivers/crypto/atmel-ecc.c | 2
drivers/crypto/caam/caampkc.c | 28
drivers/crypto/cavium/cpt/cptvf_main.c | 6
drivers/crypto/cavium/cpt/cptvf_reqmanager.c | 12
drivers/crypto/cavium/nitrox/nitrox_lib.c | 4
drivers/crypto/cavium/zip/zip_crypto.c | 6
drivers/crypto/ccp/ccp-crypto-rsa.c | 6
drivers/crypto/ccree/cc_aead.c | 4
drivers/crypto/ccree/cc_buffer_mgr.c | 4
drivers/crypto/ccree/cc_cipher.c | 6
drivers/crypto/ccree/cc_hash.c | 8
drivers/crypto/ccree/cc_request_mgr.c | 2
drivers/crypto/marvell/cesa/hash.c | 2
drivers/crypto/marvell/octeontx/otx_cptvf_main.c | 6
drivers/crypto/marvell/octeontx/otx_cptvf_reqmgr.h | 2
drivers/crypto/nx/nx.c | 4
drivers/crypto/virtio/virtio_crypto_algs.c | 12
drivers/crypto/virtio/virtio_crypto_core.c | 2
drivers/iommu/ipmmu-vmsa.c | 1
drivers/md/dm-crypt.c | 32
drivers/md/dm-integrity.c | 6
drivers/misc/ibmvmc.c | 6
drivers/net/ethernet/hisilicon/hns3/hns3pf/hclge_mbx.c | 2
drivers/net/ethernet/intel/ixgbe/ixgbe_ipsec.c | 6
drivers/net/ppp/ppp_mppe.c | 6
drivers/net/wireguard/noise.c | 4
drivers/net/wireguard/peer.c | 2
drivers/net/wireless/intel/iwlwifi/pcie/rx.c | 2
drivers/net/wireless/intel/iwlwifi/pcie/tx-gen2.c | 6
drivers/net/wireless/intel/iwlwifi/pcie/tx.c | 6
drivers/net/wireless/intersil/orinoco/wext.c | 4
drivers/s390/crypto/ap_bus.h | 4
drivers/staging/ks7010/ks_hostif.c | 2
drivers/staging/rtl8723bs/core/rtw_security.c | 2
drivers/staging/wlan-ng/p80211netdev.c | 2
drivers/target/iscsi/iscsi_target_auth.c | 2
drivers/xen/balloon.c | 1
drivers/xen/privcmd.c | 1
fs/Kconfig | 21
fs/aio.c | 6
fs/binfmt_elf_fdpic.c | 1
fs/cifs/cifsencrypt.c | 2
fs/cifs/connect.c | 10
fs/cifs/dfs_cache.c | 2
fs/cifs/misc.c | 8
fs/crypto/inline_crypt.c | 5
fs/crypto/keyring.c | 6
fs/crypto/keysetup_v1.c | 4
fs/ecryptfs/keystore.c | 4
fs/ecryptfs/messaging.c | 2
fs/hugetlbfs/inode.c | 2
fs/ntfs/dir.c | 2
fs/ntfs/inode.c | 27
fs/ntfs/inode.h | 4
fs/ntfs/mft.c | 4
fs/ocfs2/Kconfig | 6
fs/ocfs2/acl.c | 2
fs/ocfs2/blockcheck.c | 2
fs/ocfs2/dlmglue.c | 8
fs/ocfs2/ocfs2.h | 4
fs/ocfs2/suballoc.c | 4
fs/ocfs2/suballoc.h | 2
fs/ocfs2/super.c | 4
fs/proc/meminfo.c | 10
include/asm-generic/pgalloc.h | 80 +
include/asm-generic/tlb.h | 1
include/crypto/aead.h | 2
include/crypto/akcipher.h | 2
include/crypto/gf128mul.h | 2
include/crypto/hash.h | 2
include/crypto/internal/acompress.h | 2
include/crypto/kpp.h | 2
include/crypto/skcipher.h | 2
include/linux/efi.h | 4
include/linux/fs.h | 17
include/linux/huge_mm.h | 2
include/linux/kasan.h | 4
include/linux/memcontrol.h | 209 +++-
include/linux/mm.h | 86 -
include/linux/mm_types.h | 5
include/linux/mman.h | 4
include/linux/mmu_notifier.h | 13
include/linux/mmzone.h | 54 -
include/linux/pageblock-flags.h | 30
include/linux/percpu_counter.h | 4
include/linux/sched/mm.h | 8
include/linux/shmem_fs.h | 3
include/linux/slab.h | 11
include/linux/slab_def.h | 9
include/linux/slub_def.h | 31
include/linux/swap.h | 2
include/linux/vmstat.h | 14
init/Kconfig | 9
init/main.c | 2
ipc/shm.c | 2
kernel/fork.c | 54 -
kernel/kthread.c | 8
kernel/power/snapshot.c | 2
kernel/rcu/tree.c | 2
kernel/scs.c | 2
kernel/sysctl.c | 2
lib/Kconfig.kasan | 39
lib/Makefile | 1
lib/ioremap.c | 287 -----
lib/mpi/mpiutil.c | 6
lib/percpu_counter.c | 19
lib/test_kasan.c | 87 +
mm/Kconfig | 6
mm/Makefile | 2
mm/debug.c | 103 +-
mm/debug_vm_pgtable.c | 666 +++++++++++++
mm/filemap.c | 9
mm/gup.c | 3
mm/huge_memory.c | 14
mm/hugetlb.c | 25
mm/ioremap.c | 289 +++++
mm/kasan/common.c | 41
mm/kasan/generic.c | 43
mm/kasan/generic_report.c | 1
mm/kasan/kasan.h | 25
mm/kasan/quarantine.c | 1
mm/kasan/report.c | 54 -
mm/kasan/tags.c | 37
mm/khugepaged.c | 75 -
mm/memcontrol.c | 832 ++++++++++-------
mm/memory.c | 15
mm/memory_hotplug.c | 11
mm/migrate.c | 6
mm/mm_init.c | 20
mm/mmap.c | 45
mm/mremap.c | 19
mm/nommu.c | 6
mm/oom_kill.c | 2
mm/page-writeback.c | 6
mm/page_alloc.c | 226 ++--
mm/page_counter.c | 6
mm/page_io.c | 2
mm/pgalloc-track.h | 51 +
mm/shmem.c | 133 ++
mm/shuffle.c | 46
mm/shuffle.h | 17
mm/slab.c | 129 +-
mm/slab.h | 755 ++++++---------
mm/slab_common.c | 829 ++--------------
mm/slob.c | 12
mm/slub.c | 680 ++++---------
mm/sparse-vmemmap.c | 62 -
mm/sparse.c | 31
mm/swap_slots.c | 45
mm/swap_state.c | 2
mm/util.c | 52 +
mm/vmalloc.c | 176 +--
mm/vmscan.c | 39
mm/vmstat.c | 38
mm/workingset.c | 6
net/atm/mpoa_caches.c | 4
net/bluetooth/ecdh_helper.c | 6
net/bluetooth/smp.c | 24
net/core/sock.c | 2
net/ipv4/tcp_fastopen.c | 2
net/mac80211/aead_api.c | 4
net/mac80211/aes_gmac.c | 2
net/mac80211/key.c | 2
net/mac802154/llsec.c | 20
net/sctp/auth.c | 2
net/sunrpc/auth_gss/gss_krb5_crypto.c | 4
net/sunrpc/auth_gss/gss_krb5_keys.c | 6
net/sunrpc/auth_gss/gss_krb5_mech.c | 2
net/tipc/crypto.c | 10
net/wireless/core.c | 2
net/wireless/ibss.c | 4
net/wireless/lib80211_crypt_tkip.c | 2
net/wireless/lib80211_crypt_wep.c | 2
net/wireless/nl80211.c | 24
net/wireless/sme.c | 6
net/wireless/util.c | 2
net/wireless/wext-sme.c | 2
scripts/Makefile.kasan | 3
scripts/bloat-o-meter | 2
scripts/coccinelle/free/devm_free.cocci | 4
scripts/coccinelle/free/ifnullfree.cocci | 4
scripts/coccinelle/free/kfree.cocci | 6
scripts/coccinelle/free/kfreeaddr.cocci | 2
scripts/const_structs.checkpatch | 1
scripts/decode_stacktrace.sh | 85 +
scripts/spelling.txt | 19
scripts/tags.sh | 18
security/apparmor/domain.c | 4
security/apparmor/include/file.h | 2
security/apparmor/policy.c | 24
security/apparmor/policy_ns.c | 6
security/apparmor/policy_unpack.c | 14
security/keys/big_key.c | 6
security/keys/dh.c | 14
security/keys/encrypted-keys/encrypted.c | 14
security/keys/trusted-keys/trusted_tpm1.c | 34
security/keys/user_defined.c | 6
tools/cgroup/memcg_slabinfo.py | 226 ++++
tools/include/linux/jhash.h | 2
tools/lib/rbtree.c | 2
tools/lib/traceevent/event-parse.h | 2
tools/testing/ktest/examples/README | 2
tools/testing/ktest/examples/crosstests.conf | 2
tools/testing/selftests/Makefile | 1
tools/testing/selftests/cgroup/.gitignore | 1
tools/testing/selftests/cgroup/Makefile | 2
tools/testing/selftests/cgroup/cgroup_util.c | 2
tools/testing/selftests/cgroup/test_kmem.c | 382 +++++++
tools/testing/selftests/mincore/.gitignore | 2
tools/testing/selftests/mincore/Makefile | 6
tools/testing/selftests/mincore/mincore_selftest.c | 361 +++++++
397 files changed, 5547 insertions(+), 4072 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-08-12 1:29 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-08-12 1:29 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- Most of the rest of MM
- various other subsystems
165 patches, based on 00e4db51259a5f936fec1424b884f029479d3981.
Subsystems affected by this patch series:
mm/memcg
mm/hugetlb
mm/vmscan
mm/proc
mm/compaction
mm/mempolicy
mm/oom-kill
mm/hugetlbfs
mm/migration
mm/thp
mm/cma
mm/util
mm/memory-hotplug
mm/cleanups
mm/uaccess
alpha
misc
sparse
bitmap
lib
lz4
bitops
checkpatch
autofs
minix
nilfs
ufs
fat
signals
kmod
coredump
exec
kdump
rapidio
panic
kcov
kgdb
ipc
mm/migration
mm/gup
mm/pagemap
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
Patch series "mm: memcg accounting of percpu memory", v3:
percpu: return number of released bytes from pcpu_free_area()
mm: memcg/percpu: account percpu memory to memory cgroups
mm: memcg/percpu: per-memcg percpu memory statistics
mm: memcg: charge memcg percpu memory to the parent cgroup
kselftests: cgroup: add perpcu memory accounting test
Subsystem: mm/hugetlb
Muchun Song <songmuchun@bytedance.com>:
mm/hugetlb: add mempolicy check in the reservation routine
Subsystem: mm/vmscan
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
Patch series "workingset protection/detection on the anonymous LRU list", v7:
mm/vmscan: make active/inactive ratio as 1:1 for anon lru
mm/vmscan: protect the workingset on anonymous LRU
mm/workingset: prepare the workingset detection infrastructure for anon LRU
mm/swapcache: support to handle the shadow entries
mm/swap: implement workingset detection for anonymous LRU
mm/vmscan: restore active/inactive ratio for anonymous LRU
Subsystem: mm/proc
Michal Koutný <mkoutny@suse.com>:
/proc/PID/smaps: consistent whitespace output format
Subsystem: mm/compaction
Nitin Gupta <nigupta@nvidia.com>:
mm: proactive compaction
mm: fix compile error due to COMPACTION_HPAGE_ORDER
mm: use unsigned types for fragmentation score
Alex Shi <alex.shi@linux.alibaba.com>:
mm/compaction: correct the comments of compact_defer_shift
Subsystem: mm/mempolicy
Krzysztof Kozlowski <krzk@kernel.org>:
mm: mempolicy: fix kerneldoc of numa_map_to_online_node()
Wenchao Hao <haowenchao22@gmail.com>:
mm/mempolicy.c: check parameters first in kernel_get_mempolicy
Yanfei Xu <yanfei.xu@windriver.com>:
include/linux/mempolicy.h: fix typo
Subsystem: mm/oom-kill
Yafang Shao <laoar.shao@gmail.com>:
mm, oom: make the calculation of oom badness more accurate
Michal Hocko <mhocko@suse.com>:
doc, mm: sync up oom_score_adj documentation
doc, mm: clarify /proc/<pid>/oom_score value range
Yafang Shao <laoar.shao@gmail.com>:
mm, oom: show process exiting information in __oom_kill_process()
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlbfs: prevent filesystem stacking of hugetlbfs
hugetlbfs: remove call to huge_pte_alloc without i_mmap_rwsem
Subsystem: mm/migration
Ralph Campbell <rcampbell@nvidia.com>:
Patch series "mm/migrate: optimize migrate_vma_setup() for holes":
mm/migrate: optimize migrate_vma_setup() for holes
mm/migrate: add migrate-shared test for migrate_vma_*()
Subsystem: mm/thp
Yang Shi <yang.shi@linux.alibaba.com>:
mm: thp: remove debug_cow switch
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/vmstat: add events for THP migration without split
Subsystem: mm/cma
Jianqun Xu <jay.xu@rock-chips.com>:
mm/cma.c: fix NULL pointer dereference when cma could not be activated
Barry Song <song.bao.hua@hisilicon.com>:
Patch series "mm: fix the names of general cma and hugetlb cma", v2:
mm: cma: fix the name of CMA areas
mm: hugetlb: fix the name of hugetlb CMA
Mike Kravetz <mike.kravetz@oracle.com>:
cma: don't quit at first error when activating reserved areas
Subsystem: mm/util
Waiman Long <longman@redhat.com>:
include/linux/sched/mm.h: optimize current_gfp_context()
Krzysztof Kozlowski <krzk@kernel.org>:
mm: mmu_notifier: fix and extend kerneldoc
Subsystem: mm/memory-hotplug
Daniel Jordan <daniel.m.jordan@oracle.com>:
x86/mm: use max memory block size on bare metal
Jia He <justin.he@arm.com>:
mm/memory_hotplug: introduce default dummy memory_add_physaddr_to_nid()
mm/memory_hotplug: fix unpaired mem_hotplug_begin/done
Charan Teja Reddy <charante@codeaurora.org>:
mm, memory_hotplug: update pcp lists everytime onlining a memory block
Subsystem: mm/cleanups
Randy Dunlap <rdunlap@infradead.org>:
mm: drop duplicated words in <linux/pgtable.h>
mm: drop duplicated words in <linux/mm.h>
include/linux/highmem.h: fix duplicated words in a comment
include/linux/frontswap.h: drop duplicated word in a comment
include/linux/memcontrol.h: drop duplicate word and fix spello
Arvind Sankar <nivedita@alum.mit.edu>:
sh/mm: drop unused MAX_PHYSADDR_BITS
sparc: drop unused MAX_PHYSADDR_BITS
Randy Dunlap <rdunlap@infradead.org>:
mm/compaction.c: delete duplicated word
mm/filemap.c: delete duplicated word
mm/hmm.c: delete duplicated word
mm/hugetlb.c: delete duplicated words
mm/memcontrol.c: delete duplicated words
mm/memory.c: delete duplicated words
mm/migrate.c: delete duplicated word
mm/nommu.c: delete duplicated words
mm/page_alloc.c: delete or fix duplicated words
mm/shmem.c: delete duplicated word
mm/slab_common.c: delete duplicated word
mm/usercopy.c: delete duplicated word
mm/vmscan.c: delete or fix duplicated words
mm/zpool.c: delete duplicated word and fix grammar
mm/zsmalloc.c: fix duplicated words
Subsystem: mm/uaccess
Christoph Hellwig <hch@lst.de>:
Patch series "clean up address limit helpers", v2:
syscalls: use uaccess_kernel in addr_limit_user_check
nds32: use uaccess_kernel in show_regs
riscv: include <asm/pgtable.h> in <asm/uaccess.h>
uaccess: remove segment_eq
uaccess: add force_uaccess_{begin,end} helpers
exec: use force_uaccess_begin during exec and exit
Subsystem: alpha
Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
alpha: fix annotation of io{read,write}{16,32}be()
Subsystem: misc
Randy Dunlap <rdunlap@infradead.org>:
include/linux/compiler-clang.h: drop duplicated word in a comment
include/linux/exportfs.h: drop duplicated word in a comment
include/linux/async_tx.h: drop duplicated word in a comment
include/linux/xz.h: drop duplicated word
Christoph Hellwig <hch@lst.de>:
kernel: add a kernel_wait helper
Feng Tang <feng.tang@intel.com>:
./Makefile: add debug option to enable function aligned on 32 bytes
Arvind Sankar <nivedita@alum.mit.edu>:
kernel.h: remove duplicate include of asm/div64.h
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
include/: replace HTTP links with HTTPS ones
Matthew Wilcox <willy@infradead.org>:
include/linux/poison.h: remove obsolete comment
Subsystem: sparse
Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
sparse: group the defines by functionality
Subsystem: bitmap
Stefano Brivio <sbrivio@redhat.com>:
Patch series "lib: Fix bitmap_cut() for overlaps, add test":
lib/bitmap.c: fix bitmap_cut() for partial overlapping case
lib/test_bitmap.c: add test for bitmap_cut()
Subsystem: lib
Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
lib/generic-radix-tree.c: remove unneeded __rcu
Geert Uytterhoeven <geert@linux-m68k.org>:
lib/test_bitops: do the full test during module init
Wei Yongjun <weiyongjun1@huawei.com>:
lib/test_lockup.c: make symbol 'test_works' static
Tiezhu Yang <yangtiezhu@loongson.cn>:
lib/Kconfig.debug: make TEST_LOCKUP depend on module
lib/test_lockup.c: fix return value of test_lockup_init()
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
lib/: replace HTTP links with HTTPS ones
"Kars Mulder" <kerneldev@karsmulder.nl>:
kstrto*: correct documentation references to simple_strto*()
kstrto*: do not describe simple_strto*() as obsolete/replaced
Subsystem: lz4
Nick Terrell <terrelln@fb.com>:
lz4: fix kernel decompression speed
Subsystem: bitops
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
lib/test_bits.c: add tests of GENMASK
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: add test for possible misuse of IS_ENABLED() without CONFIG_
checkpatch: add --fix option for ASSIGN_IN_IF
Quentin Monnet <quentin@isovalent.com>:
checkpatch: fix CONST_STRUCT when const_structs.checkpatch is missing
Joe Perches <joe@perches.com>:
checkpatch: add test for repeated words
checkpatch: remove missing switch/case break test
Subsystem: autofs
Randy Dunlap <rdunlap@infradead.org>:
autofs: fix doubled word
Subsystem: minix
Eric Biggers <ebiggers@google.com>:
Patch series "fs/minix: fix syzbot bugs and set s_maxbytes":
fs/minix: check return value of sb_getblk()
fs/minix: don't allow getting deleted inodes
fs/minix: reject too-large maximum file size
fs/minix: set s_maxbytes correctly
fs/minix: fix block limit check for V1 filesystems
fs/minix: remove expected error message in block_to_path()
Subsystem: nilfs
Eric Biggers <ebiggers@google.com>:
Patch series "nilfs2 updates":
nilfs2: only call unlock_new_inode() if I_NEW
Joe Perches <joe@perches.com>:
nilfs2: convert __nilfs_msg to integrate the level and format
nilfs2: use a more common logging style
Subsystem: ufs
Colin Ian King <colin.king@canonical.com>:
fs/ufs: avoid potential u32 multiplication overflow
Subsystem: fat
Yubo Feng <fengyubo3@huawei.com>:
fatfs: switch write_lock to read_lock in fat_ioctl_get_attributes
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
VFAT/FAT/MSDOS FILESYSTEM: replace HTTP links with HTTPS ones
OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
fat: fix fat_ra_init() for data clusters == 0
Subsystem: signals
Helge Deller <deller@gmx.de>:
fs/signalfd.c: fix inconsistent return codes for signalfd4
Subsystem: kmod
Tiezhu Yang <yangtiezhu@loongson.cn>:
Patch series "kmod/umh: a few fixes":
selftests: kmod: use variable NAME in kmod_test_0001()
kmod: remove redundant "be an" in the comment
test_kmod: avoid potential double free in trigger_config_run_type()
Subsystem: coredump
Lepton Wu <ytht.net@gmail.com>:
coredump: add %f for executable filename
Subsystem: exec
Kees Cook <keescook@chromium.org>:
Patch series "Relocate execve() sanity checks", v2:
exec: change uselib(2) IS_SREG() failure to EACCES
exec: move S_ISREG() check earlier
exec: move path_noexec() check earlier
Subsystem: kdump
Vijay Balakrishna <vijayb@linux.microsoft.com>:
kdump: append kernel build-id string to VMCOREINFO
Subsystem: rapidio
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
drivers/rapidio/devices/rio_mport_cdev.c: use struct_size() helper
drivers/rapidio/rio-scan.c: use struct_size() helper
rapidio/rio_mport_cdev: use array_size() helper in copy_{from,to}_user()
Subsystem: panic
Tiezhu Yang <yangtiezhu@loongson.cn>:
kernel/panic.c: make oops_may_print() return bool
lib/Kconfig.debug: fix typo in the help text of CONFIG_PANIC_TIMEOUT
Yue Hu <huyue2@yulong.com>:
panic: make print_oops_end_marker() static
Subsystem: kcov
Marco Elver <elver@google.com>:
kcov: unconditionally add -fno-stack-protector to compiler options
Wei Yongjun <weiyongjun1@huawei.com>:
kcov: make some symbols static
Subsystem: kgdb
Nick Desaulniers <ndesaulniers@google.com>:
scripts/gdb: fix python 3.8 SyntaxWarning
Subsystem: ipc
Alexey Dobriyan <adobriyan@gmail.com>:
ipc: uninline functions
Liao Pingfang <liao.pingfang@zte.com.cn>:
ipc/shm.c: remove the superfluous break
Subsystem: mm/migration
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
Patch series "clean-up the migration target allocation functions", v5:
mm/page_isolation: prefer the node of the source page
mm/migrate: move migration helper from .h to .c
mm/hugetlb: unify migration callbacks
mm/migrate: clear __GFP_RECLAIM to make the migration callback consistent with regular THP allocations
mm/migrate: introduce a standard migration target allocation function
mm/mempolicy: use a standard migration target allocation callback
mm/page_alloc: remove a wrapper for alloc_migration_target()
Subsystem: mm/gup
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
mm/gup: restrict CMA region by using allocation scope API
mm/hugetlb: make hugetlb migration callback CMA aware
mm/gup: use a standard migration target allocation callback
Subsystem: mm/pagemap
Peter Xu <peterx@redhat.com>:
Patch series "mm: Page fault accounting cleanups", v5:
mm: do page fault accounting in handle_mm_fault
mm/alpha: use general page fault accounting
mm/arc: use general page fault accounting
mm/arm: use general page fault accounting
mm/arm64: use general page fault accounting
mm/csky: use general page fault accounting
mm/hexagon: use general page fault accounting
mm/ia64: use general page fault accounting
mm/m68k: use general page fault accounting
mm/microblaze: use general page fault accounting
mm/mips: use general page fault accounting
mm/nds32: use general page fault accounting
mm/nios2: use general page fault accounting
mm/openrisc: use general page fault accounting
mm/parisc: use general page fault accounting
mm/powerpc: use general page fault accounting
mm/riscv: use general page fault accounting
mm/s390: use general page fault accounting
mm/sh: use general page fault accounting
mm/sparc32: use general page fault accounting
mm/sparc64: use general page fault accounting
mm/x86: use general page fault accounting
mm/xtensa: use general page fault accounting
mm: clean up the last pieces of page fault accountings
mm/gup: remove task_struct pointer for all gup code
Documentation/admin-guide/cgroup-v2.rst | 4
Documentation/admin-guide/sysctl/kernel.rst | 3
Documentation/admin-guide/sysctl/vm.rst | 15 +
Documentation/filesystems/proc.rst | 11 -
Documentation/vm/page_migration.rst | 27 +++
Makefile | 4
arch/alpha/include/asm/io.h | 8
arch/alpha/include/asm/uaccess.h | 2
arch/alpha/mm/fault.c | 10 -
arch/arc/include/asm/segment.h | 3
arch/arc/kernel/process.c | 2
arch/arc/mm/fault.c | 20 --
arch/arm/include/asm/uaccess.h | 4
arch/arm/kernel/signal.c | 2
arch/arm/mm/fault.c | 27 ---
arch/arm64/include/asm/uaccess.h | 2
arch/arm64/kernel/sdei.c | 2
arch/arm64/mm/fault.c | 31 ---
arch/arm64/mm/numa.c | 10 -
arch/csky/include/asm/segment.h | 2
arch/csky/mm/fault.c | 15 -
arch/h8300/include/asm/segment.h | 2
arch/hexagon/mm/vm_fault.c | 11 -
arch/ia64/include/asm/uaccess.h | 2
arch/ia64/mm/fault.c | 11 -
arch/ia64/mm/numa.c | 2
arch/m68k/include/asm/segment.h | 2
arch/m68k/include/asm/tlbflush.h | 6
arch/m68k/mm/fault.c | 16 -
arch/microblaze/include/asm/uaccess.h | 2
arch/microblaze/mm/fault.c | 11 -
arch/mips/include/asm/uaccess.h | 2
arch/mips/kernel/unaligned.c | 27 +--
arch/mips/mm/fault.c | 16 -
arch/nds32/include/asm/uaccess.h | 2
arch/nds32/kernel/process.c | 2
arch/nds32/mm/alignment.c | 7
arch/nds32/mm/fault.c | 21 --
arch/nios2/include/asm/uaccess.h | 2
arch/nios2/mm/fault.c | 16 -
arch/openrisc/include/asm/uaccess.h | 2
arch/openrisc/mm/fault.c | 11 -
arch/parisc/include/asm/uaccess.h | 2
arch/parisc/mm/fault.c | 10 -
arch/powerpc/include/asm/uaccess.h | 3
arch/powerpc/mm/copro_fault.c | 7
arch/powerpc/mm/fault.c | 13 -
arch/riscv/include/asm/uaccess.h | 6
arch/riscv/mm/fault.c | 18 --
arch/s390/include/asm/uaccess.h | 2
arch/s390/kvm/interrupt.c | 2
arch/s390/kvm/kvm-s390.c | 2
arch/s390/kvm/priv.c | 8
arch/s390/mm/fault.c | 18 --
arch/s390/mm/gmap.c | 4
arch/sh/include/asm/segment.h | 3
arch/sh/include/asm/sparsemem.h | 4
arch/sh/kernel/traps_32.c | 12 -
arch/sh/mm/fault.c | 13 -
arch/sh/mm/init.c | 9 -
arch/sparc/include/asm/sparsemem.h | 1
arch/sparc/include/asm/uaccess_32.h | 2
arch/sparc/include/asm/uaccess_64.h | 2
arch/sparc/mm/fault_32.c | 15 -
arch/sparc/mm/fault_64.c | 13 -
arch/um/kernel/trap.c | 6
arch/x86/include/asm/uaccess.h | 2
arch/x86/mm/fault.c | 19 --
arch/x86/mm/init_64.c | 9 +
arch/x86/mm/numa.c | 1
arch/xtensa/include/asm/uaccess.h | 2
arch/xtensa/mm/fault.c | 17 -
drivers/firmware/arm_sdei.c | 5
drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 2
drivers/infiniband/core/umem_odp.c | 2
drivers/iommu/amd/iommu_v2.c | 2
drivers/iommu/intel/svm.c | 3
drivers/rapidio/devices/rio_mport_cdev.c | 7
drivers/rapidio/rio-scan.c | 8
drivers/vfio/vfio_iommu_type1.c | 4
fs/coredump.c | 17 +
fs/exec.c | 38 ++--
fs/fat/Kconfig | 2
fs/fat/fatent.c | 3
fs/fat/file.c | 4
fs/hugetlbfs/inode.c | 6
fs/minix/inode.c | 48 ++++-
fs/minix/itree_common.c | 8
fs/minix/itree_v1.c | 16 -
fs/minix/itree_v2.c | 15 -
fs/minix/minix.h | 1
fs/namei.c | 10 -
fs/nilfs2/alloc.c | 38 ++--
fs/nilfs2/btree.c | 42 ++--
fs/nilfs2/cpfile.c | 10 -
fs/nilfs2/dat.c | 14 -
fs/nilfs2/direct.c | 14 -
fs/nilfs2/gcinode.c | 2
fs/nilfs2/ifile.c | 4
fs/nilfs2/inode.c | 32 +--
fs/nilfs2/ioctl.c | 37 ++--
fs/nilfs2/mdt.c | 2
fs/nilfs2/namei.c | 6
fs/nilfs2/nilfs.h | 18 +-
fs/nilfs2/page.c | 11 -
fs/nilfs2/recovery.c | 32 +--
fs/nilfs2/segbuf.c | 2
fs/nilfs2/segment.c | 38 ++--
fs/nilfs2/sufile.c | 29 +--
fs/nilfs2/super.c | 73 ++++----
fs/nilfs2/sysfs.c | 29 +--
fs/nilfs2/the_nilfs.c | 85 ++++-----
fs/open.c | 6
fs/proc/base.c | 11 +
fs/proc/task_mmu.c | 4
fs/signalfd.c | 10 -
fs/ufs/super.c | 2
include/asm-generic/uaccess.h | 4
include/clocksource/timer-ti-dm.h | 2
include/linux/async_tx.h | 2
include/linux/btree.h | 2
include/linux/compaction.h | 6
include/linux/compiler-clang.h | 2
include/linux/compiler_types.h | 44 ++---
include/linux/crash_core.h | 6
include/linux/delay.h | 2
include/linux/dma/k3-psil.h | 2
include/linux/dma/k3-udma-glue.h | 2
include/linux/dma/ti-cppi5.h | 2
include/linux/exportfs.h | 2
include/linux/frontswap.h | 2
include/linux/fs.h | 10 +
include/linux/generic-radix-tree.h | 2
include/linux/highmem.h | 2
include/linux/huge_mm.h | 7
include/linux/hugetlb.h | 53 ++++--
include/linux/irqchip/irq-omap-intc.h | 2
include/linux/jhash.h | 2
include/linux/kernel.h | 12 -
include/linux/leds-ti-lmu-common.h | 2
include/linux/memcontrol.h | 12 +
include/linux/mempolicy.h | 18 +-
include/linux/migrate.h | 42 +---
include/linux/mm.h | 20 +-
include/linux/mmzone.h | 17 +
include/linux/oom.h | 4
include/linux/pgtable.h | 12 -
include/linux/platform_data/davinci-cpufreq.h | 2
include/linux/platform_data/davinci_asp.h | 2
include/linux/platform_data/elm.h | 2
include/linux/platform_data/gpio-davinci.h | 2
include/linux/platform_data/gpmc-omap.h | 2
include/linux/platform_data/mtd-davinci-aemif.h | 2
include/linux/platform_data/omap-twl4030.h | 2
include/linux/platform_data/uio_pruss.h | 2
include/linux/platform_data/usb-omap.h | 2
include/linux/poison.h | 4
include/linux/sched/mm.h | 8
include/linux/sched/task.h | 1
include/linux/soc/ti/k3-ringacc.h | 2
include/linux/soc/ti/knav_qmss.h | 2
include/linux/soc/ti/ti-msgmgr.h | 2
include/linux/swap.h | 25 ++
include/linux/syscalls.h | 2
include/linux/uaccess.h | 20 ++
include/linux/vm_event_item.h | 3
include/linux/wkup_m3_ipc.h | 2
include/linux/xxhash.h | 2
include/linux/xz.h | 4
include/linux/zlib.h | 2
include/soc/arc/aux.h | 2
include/trace/events/migrate.h | 17 +
include/uapi/linux/auto_dev-ioctl.h | 2
include/uapi/linux/elf.h | 2
include/uapi/linux/map_to_7segment.h | 2
include/uapi/linux/types.h | 2
include/uapi/linux/usb/ch9.h | 2
ipc/sem.c | 3
ipc/shm.c | 4
kernel/Makefile | 2
kernel/crash_core.c | 50 +++++
kernel/events/callchain.c | 5
kernel/events/core.c | 5
kernel/events/uprobes.c | 8
kernel/exit.c | 18 +-
kernel/futex.c | 2
kernel/kcov.c | 6
kernel/kmod.c | 5
kernel/kthread.c | 5
kernel/panic.c | 4
kernel/stacktrace.c | 5
kernel/sysctl.c | 11 +
kernel/umh.c | 29 ---
lib/Kconfig.debug | 27 ++-
lib/Makefile | 1
lib/bitmap.c | 4
lib/crc64.c | 2
lib/decompress_bunzip2.c | 2
lib/decompress_unlzma.c | 6
lib/kstrtox.c | 20 --
lib/lz4/lz4_compress.c | 4
lib/lz4/lz4_decompress.c | 18 +-
lib/lz4/lz4defs.h | 10 +
lib/lz4/lz4hc_compress.c | 2
lib/math/rational.c | 2
lib/rbtree.c | 2
lib/test_bitmap.c | 58 ++++++
lib/test_bitops.c | 18 +-
lib/test_bits.c | 75 ++++++++
lib/test_kmod.c | 2
lib/test_lockup.c | 6
lib/ts_bm.c | 2
lib/xxhash.c | 2
lib/xz/xz_crc32.c | 2
lib/xz/xz_dec_bcj.c | 2
lib/xz/xz_dec_lzma2.c | 2
lib/xz/xz_lzma2.h | 2
lib/xz/xz_stream.h | 2
mm/cma.c | 40 +---
mm/cma.h | 4
mm/compaction.c | 207 +++++++++++++++++++++--
mm/filemap.c | 2
mm/gup.c | 195 ++++++----------------
mm/hmm.c | 5
mm/huge_memory.c | 23 --
mm/hugetlb.c | 93 ++++------
mm/internal.h | 9 -
mm/khugepaged.c | 2
mm/ksm.c | 3
mm/maccess.c | 22 +-
mm/memcontrol.c | 42 +++-
mm/memory-failure.c | 7
mm/memory.c | 107 +++++++++---
mm/memory_hotplug.c | 30 ++-
mm/mempolicy.c | 49 +----
mm/migrate.c | 151 ++++++++++++++---
mm/mmu_notifier.c | 9 -
mm/nommu.c | 4
mm/oom_kill.c | 24 +-
mm/page_alloc.c | 14 +
mm/page_isolation.c | 21 --
mm/percpu-internal.h | 55 ++++++
mm/percpu-km.c | 5
mm/percpu-stats.c | 36 ++--
mm/percpu-vm.c | 5
mm/percpu.c | 208 +++++++++++++++++++++---
mm/process_vm_access.c | 2
mm/rmap.c | 2
mm/shmem.c | 5
mm/slab_common.c | 2
mm/swap.c | 13 -
mm/swap_state.c | 80 +++++++--
mm/swapfile.c | 4
mm/usercopy.c | 2
mm/userfaultfd.c | 2
mm/vmscan.c | 36 ++--
mm/vmstat.c | 32 +++
mm/workingset.c | 23 +-
mm/zpool.c | 8
mm/zsmalloc.c | 2
scripts/checkpatch.pl | 116 +++++++++----
scripts/gdb/linux/rbtree.py | 4
security/tomoyo/domain.c | 2
tools/testing/selftests/cgroup/test_kmem.c | 70 +++++++-
tools/testing/selftests/kmod/kmod.sh | 4
tools/testing/selftests/vm/hmm-tests.c | 35 ++++
virt/kvm/async_pf.c | 2
virt/kvm/kvm_main.c | 2
268 files changed, 2481 insertions(+), 1551 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-08-15 0:29 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-08-15 0:29 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
39 patches, based on b923f1247b72fc100b87792fd2129d026bb10e66.
Subsystems affected by this patch series:
mm/hotfixes
lz4
exec
mailmap
mm/thp
autofs
mm/madvise
sysctl
mm/kmemleak
mm/misc
lib
Subsystem: mm/hotfixes
Mike Rapoport <rppt@linux.ibm.com>:
asm-generic: pgalloc.h: use correct #ifdef to enable pud_alloc_one()
Baoquan He <bhe@redhat.com>:
Revert "mm/vmstat.c: do not show lowmem reserve protection information of empty zone"
Subsystem: lz4
Nick Terrell <terrelln@fb.com>:
lz4: fix kernel decompression speed
Subsystem: exec
Kees Cook <keescook@chromium.org>:
Patch series "Fix S_ISDIR execve() errno":
exec: restore EACCES of S_ISDIR execve()
selftests/exec: add file type errno tests
Subsystem: mailmap
Greg Kurz <groug@kaod.org>:
mailmap: add entry for Greg Kurz
Subsystem: mm/thp
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "THP prep patches":
mm: store compound_nr as well as compound_order
mm: move page-flags include to top of file
mm: add thp_order
mm: add thp_size
mm: replace hpage_nr_pages with thp_nr_pages
mm: add thp_head
mm: introduce offset_in_thp
Subsystem: autofs
Randy Dunlap <rdunlap@infradead.org>:
fs: autofs: delete repeated words in comments
Subsystem: mm/madvise
Minchan Kim <minchan@kernel.org>:
Patch series "introduce memory hinting API for external process", v8:
mm/madvise: pass task and mm to do_madvise
pid: move pidfd_get_pid() to pid.c
mm/madvise: introduce process_madvise() syscall: an external memory hinting API
mm/madvise: check fatal signal pending of target process
Subsystem: sysctl
Xiaoming Ni <nixiaoming@huawei.com>:
all arch: remove system call sys_sysctl
Subsystem: mm/kmemleak
Qian Cai <cai@lca.pw>:
mm/kmemleak: silence KCSAN splats in checksum
Subsystem: mm/misc
Qian Cai <cai@lca.pw>:
mm/frontswap: mark various intentional data races
mm/page_io: mark various intentional data races
mm/swap_state: mark various intentional data races
Kirill A. Shutemov <kirill@shutemov.name>:
mm/filemap.c: fix a data race in filemap_fault()
Qian Cai <cai@lca.pw>:
mm/swapfile: fix and annotate various data races
mm/page_counter: fix various data races at memsw
mm/memcontrol: fix a data race in scan count
mm/list_lru: fix a data race in list_lru_count_one
mm/mempool: fix a data race in mempool_free()
mm/rmap: annotate a data race at tlb_flush_batched
mm/swap.c: annotate data races for lru_rotate_pvecs
mm: annotate a data race in page_zonenum()
Romain Naour <romain.naour@gmail.com>:
include/asm-generic/vmlinux.lds.h: align ro_after_init
Kuninori Morimoto <kuninori.morimoto.gx@renesas.com>:
sh: clkfwk: remove r8/r16/r32
sh: use generic strncpy()
Subsystem: lib
Krzysztof Kozlowski <krzk@kernel.org>:
Patch series "iomap: Constify ioreadX() iomem argument", v3:
iomap: constify ioreadX() iomem argument (as in generic implementation)
rtl818x: constify ioreadX() iomem argument (as in generic implementation)
ntb: intel: constify ioreadX() iomem argument (as in generic implementation)
virtio: pci: constify ioreadX() iomem argument (as in generic implementation)
.mailmap | 1
arch/alpha/include/asm/core_apecs.h | 6
arch/alpha/include/asm/core_cia.h | 6
arch/alpha/include/asm/core_lca.h | 6
arch/alpha/include/asm/core_marvel.h | 4
arch/alpha/include/asm/core_mcpcia.h | 6
arch/alpha/include/asm/core_t2.h | 2
arch/alpha/include/asm/io.h | 12 -
arch/alpha/include/asm/io_trivial.h | 16 -
arch/alpha/include/asm/jensen.h | 2
arch/alpha/include/asm/machvec.h | 6
arch/alpha/kernel/core_marvel.c | 2
arch/alpha/kernel/io.c | 12 -
arch/alpha/kernel/syscalls/syscall.tbl | 3
arch/arm/configs/am200epdkit_defconfig | 1
arch/arm/tools/syscall.tbl | 3
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 6
arch/ia64/kernel/syscalls/syscall.tbl | 3
arch/m68k/kernel/syscalls/syscall.tbl | 3
arch/microblaze/kernel/syscalls/syscall.tbl | 3
arch/mips/configs/cu1000-neo_defconfig | 1
arch/mips/kernel/syscalls/syscall_n32.tbl | 3
arch/mips/kernel/syscalls/syscall_n64.tbl | 3
arch/mips/kernel/syscalls/syscall_o32.tbl | 3
arch/parisc/include/asm/io.h | 4
arch/parisc/kernel/syscalls/syscall.tbl | 3
arch/parisc/lib/iomap.c | 72 +++---
arch/powerpc/kernel/iomap.c | 28 +-
arch/powerpc/kernel/syscalls/syscall.tbl | 3
arch/s390/kernel/syscalls/syscall.tbl | 3
arch/sh/configs/dreamcast_defconfig | 1
arch/sh/configs/espt_defconfig | 1
arch/sh/configs/hp6xx_defconfig | 1
arch/sh/configs/landisk_defconfig | 1
arch/sh/configs/lboxre2_defconfig | 1
arch/sh/configs/microdev_defconfig | 1
arch/sh/configs/migor_defconfig | 1
arch/sh/configs/r7780mp_defconfig | 1
arch/sh/configs/r7785rp_defconfig | 1
arch/sh/configs/rts7751r2d1_defconfig | 1
arch/sh/configs/rts7751r2dplus_defconfig | 1
arch/sh/configs/se7206_defconfig | 1
arch/sh/configs/se7343_defconfig | 1
arch/sh/configs/se7619_defconfig | 1
arch/sh/configs/se7705_defconfig | 1
arch/sh/configs/se7750_defconfig | 1
arch/sh/configs/se7751_defconfig | 1
arch/sh/configs/secureedge5410_defconfig | 1
arch/sh/configs/sh03_defconfig | 1
arch/sh/configs/sh7710voipgw_defconfig | 1
arch/sh/configs/sh7757lcr_defconfig | 1
arch/sh/configs/sh7763rdp_defconfig | 1
arch/sh/configs/shmin_defconfig | 1
arch/sh/configs/titan_defconfig | 1
arch/sh/include/asm/string_32.h | 26 --
arch/sh/kernel/iomap.c | 22 -
arch/sh/kernel/syscalls/syscall.tbl | 3
arch/sparc/kernel/syscalls/syscall.tbl | 3
arch/x86/entry/syscalls/syscall_32.tbl | 3
arch/x86/entry/syscalls/syscall_64.tbl | 4
arch/xtensa/kernel/syscalls/syscall.tbl | 3
drivers/mailbox/bcm-pdc-mailbox.c | 2
drivers/net/wireless/realtek/rtl818x/rtl8180/rtl8180.h | 6
drivers/ntb/hw/intel/ntb_hw_gen1.c | 2
drivers/ntb/hw/intel/ntb_hw_gen3.h | 2
drivers/ntb/hw/intel/ntb_hw_intel.h | 2
drivers/nvdimm/btt.c | 4
drivers/nvdimm/pmem.c | 6
drivers/sh/clk/cpg.c | 25 --
drivers/virtio/virtio_pci_modern.c | 6
fs/autofs/dev-ioctl.c | 4
fs/io_uring.c | 2
fs/namei.c | 4
include/asm-generic/iomap.h | 28 +-
include/asm-generic/pgalloc.h | 2
include/asm-generic/vmlinux.lds.h | 1
include/linux/compat.h | 5
include/linux/huge_mm.h | 58 ++++-
include/linux/io-64-nonatomic-hi-lo.h | 4
include/linux/io-64-nonatomic-lo-hi.h | 4
include/linux/memcontrol.h | 2
include/linux/mm.h | 16 -
include/linux/mm_inline.h | 6
include/linux/mm_types.h | 1
include/linux/pagemap.h | 6
include/linux/pid.h | 1
include/linux/syscalls.h | 4
include/linux/sysctl.h | 6
include/uapi/asm-generic/unistd.h | 4
kernel/Makefile | 2
kernel/exit.c | 17 -
kernel/pid.c | 17 +
kernel/sys_ni.c | 3
kernel/sysctl_binary.c | 171 --------------
lib/iomap.c | 30 +-
lib/lz4/lz4_compress.c | 4
lib/lz4/lz4_decompress.c | 18 -
lib/lz4/lz4defs.h | 10
lib/lz4/lz4hc_compress.c | 2
mm/compaction.c | 2
mm/filemap.c | 22 +
mm/frontswap.c | 8
mm/gup.c | 2
mm/internal.h | 4
mm/kmemleak.c | 2
mm/list_lru.c | 2
mm/madvise.c | 190 ++++++++++++++--
mm/memcontrol.c | 10
mm/memory.c | 4
mm/memory_hotplug.c | 7
mm/mempolicy.c | 2
mm/mempool.c | 2
mm/migrate.c | 18 -
mm/mlock.c | 9
mm/page_alloc.c | 5
mm/page_counter.c | 13 -
mm/page_io.c | 12 -
mm/page_vma_mapped.c | 6
mm/rmap.c | 10
mm/swap.c | 21 -
mm/swap_state.c | 10
mm/swapfile.c | 33 +-
mm/vmscan.c | 6
mm/vmstat.c | 12 -
mm/workingset.c | 6
tools/perf/arch/powerpc/entry/syscalls/syscall.tbl | 2
tools/perf/arch/s390/entry/syscalls/syscall.tbl | 2
tools/perf/arch/x86/entry/syscalls/syscall_64.tbl | 2
tools/testing/selftests/exec/.gitignore | 1
tools/testing/selftests/exec/Makefile | 5
tools/testing/selftests/exec/non-regular.c | 196 +++++++++++++++++
132 files changed, 815 insertions(+), 614 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-08-21 0:41 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-08-21 0:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
11 patches, based on 7eac66d0456fe12a462e5c14c68e97c7460989da.
Subsystems affected by this patch series:
misc
mm/hugetlb
mm/vmalloc
mm/misc
romfs
relay
uprobes
squashfs
mm/cma
mm/pagealloc
Subsystem: misc
Nick Desaulniers <ndesaulniers@google.com>:
mailmap: add Andi Kleen
Subsystem: mm/hugetlb
Xu Wang <vulab@iscas.ac.cn>:
hugetlb_cgroup: convert comma to semicolon
Hugh Dickins <hughd@google.com>:
khugepaged: adjust VM_BUG_ON_MM() in __khugepaged_enter()
Subsystem: mm/vmalloc
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/vunmap: add cond_resched() in vunmap_pmd_range
Subsystem: mm/misc
Leon Romanovsky <leonro@nvidia.com>:
mm/rodata_test.c: fix missing function declaration
Subsystem: romfs
Jann Horn <jannh@google.com>:
romfs: fix uninitialized memory leak in romfs_dev_read()
Subsystem: relay
Wei Yongjun <weiyongjun1@huawei.com>:
kernel/relay.c: fix memleak on destroy relay channel
Subsystem: uprobes
Hugh Dickins <hughd@google.com>:
uprobes: __replace_page() avoid BUG in munlock_vma_page()
Subsystem: squashfs
Phillip Lougher <phillip@squashfs.org.uk>:
squashfs: avoid bio_alloc() failure with 1Mbyte blocks
Subsystem: mm/cma
Doug Berger <opendmb@gmail.com>:
mm: include CMA pages in lowmem_reserve at boot
Subsystem: mm/pagealloc
Charan Teja Reddy <charante@codeaurora.org>:
mm, page_alloc: fix core hung in free_pcppages_bulk()
.mailmap | 1 +
fs/romfs/storage.c | 4 +---
fs/squashfs/block.c | 6 +++++-
kernel/events/uprobes.c | 2 +-
kernel/relay.c | 1 +
mm/hugetlb_cgroup.c | 4 ++--
mm/khugepaged.c | 2 +-
mm/page_alloc.c | 7 ++++++-
mm/rodata_test.c | 1 +
mm/vmalloc.c | 2 ++
10 files changed, 21 insertions(+), 9 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-09-04 23:34 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-09-04 23:34 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
19 patches, based on 59126901f200f5fc907153468b03c64e0081b6e6.
Subsystems affected by this patch series:
mm/memcg
mm/slub
MAINTAINERS
mm/pagemap
ipc
fork
checkpatch
mm/madvise
mm/migration
mm/hugetlb
lib
Subsystem: mm/memcg
Michal Hocko <mhocko@suse.com>:
memcg: fix use-after-free in uncharge_batch
Xunlei Pang <xlpang@linux.alibaba.com>:
mm: memcg: fix memcg reclaim soft lockup
Subsystem: mm/slub
Eugeniu Rosca <erosca@de.adit-jv.com>:
mm: slub: fix conversion of freelist_corrupted()
Subsystem: MAINTAINERS
Robert Richter <rric@kernel.org>:
MAINTAINERS: update Cavium/Marvell entries
Nick Desaulniers <ndesaulniers@google.com>:
MAINTAINERS: add LLVM maintainers
Randy Dunlap <rdunlap@infradead.org>:
MAINTAINERS: IA64: mark Status as Odd Fixes only
Subsystem: mm/pagemap
Joerg Roedel <jroedel@suse.de>:
mm: track page table modifications in __apply_to_page_range()
Subsystem: ipc
Tobias Klauser <tklauser@distanz.ch>:
ipc: adjust proc_ipc_sem_dointvec definition to match prototype
Subsystem: fork
Tobias Klauser <tklauser@distanz.ch>:
fork: adjust sysctl_max_threads definition to match prototype
Subsystem: checkpatch
Mrinal Pandey <mrinalmni@gmail.com>:
checkpatch: fix the usage of capture group ( ... )
Subsystem: mm/madvise
Yang Shi <shy828301@gmail.com>:
mm: madvise: fix vma user-after-free
Subsystem: mm/migration
Alistair Popple <alistair@popple.id.au>:
mm/migrate: fixup setting UFFD_WP flag
mm/rmap: fixup copying of soft dirty and uffd ptes
Ralph Campbell <rcampbell@nvidia.com>:
Patch series "mm/migrate: preserve soft dirty in remove_migration_pte()":
mm/migrate: remove unnecessary is_zone_device_page() check
mm/migrate: preserve soft dirty in remove_migration_pte()
Subsystem: mm/hugetlb
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/hugetlb: try preferred node first when alloc gigantic page from cma
Muchun Song <songmuchun@bytedance.com>:
mm/hugetlb: fix a race between hugetlb sysctl handlers
David Howells <dhowells@redhat.com>:
mm/khugepaged.c: fix khugepaged's request size in collapse_file
Subsystem: lib
Jason Gunthorpe <jgg@nvidia.com>:
include/linux/log2.h: add missing () around n in roundup_pow_of_two()
MAINTAINERS | 32 ++++++++++++++++----------------
include/linux/log2.h | 2 +-
ipc/ipc_sysctl.c | 2 +-
kernel/fork.c | 2 +-
mm/hugetlb.c | 49 +++++++++++++++++++++++++++++++++++++------------
mm/khugepaged.c | 2 +-
mm/madvise.c | 2 +-
mm/memcontrol.c | 6 ++++++
mm/memory.c | 37 ++++++++++++++++++++++++-------------
mm/migrate.c | 31 +++++++++++++++++++------------
mm/rmap.c | 9 +++++++--
mm/slub.c | 12 ++++++------
mm/vmscan.c | 8 ++++++++
scripts/checkpatch.pl | 4 ++--
14 files changed, 130 insertions(+), 68 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-09-19 4:19 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-09-19 4:19 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
15 patches, based on 92ab97adeefccf375de7ebaad9d5b75d4125fe8b.
Subsystems affected by this patch series:
mailmap
mm/hotfixes
mm/thp
mm/memory-hotplug
misc
kcsan
Subsystem: mailmap
Kees Cook <keescook@chromium.org>:
mailmap: add older email addresses for Kees Cook
Subsystem: mm/hotfixes
Hugh Dickins <hughd@google.com>:
Patch series "mm: fixes to past from future testing":
ksm: reinstate memcg charge on copied pages
mm: migration of hugetlbfs page skip memcg
shmem: shmem_writepage() split unlikely i915 THP
mm: fix check_move_unevictable_pages() on THP
mlock: fix unevictable_pgs event counts on THP
Byron Stanoszek <gandalf@winds.org>:
tmpfs: restore functionality of nr_inodes=0
Muchun Song <songmuchun@bytedance.com>:
kprobes: fix kill kprobe which has been marked as gone
Subsystem: mm/thp
Ralph Campbell <rcampbell@nvidia.com>:
mm/thp: fix __split_huge_pmd_locked() for migration PMD
Christophe Leroy <christophe.leroy@csgroup.eu>:
selftests/vm: fix display of page size in map_hugetlb
Subsystem: mm/memory-hotplug
Pavel Tatashin <pasha.tatashin@soleen.com>:
mm/memory_hotplug: drain per-cpu pages again during memory offline
Subsystem: misc
Tobias Klauser <tklauser@distanz.ch>:
ftrace: let ftrace_enable_sysctl take a kernel pointer buffer
stackleak: let stack_erasing_sysctl take a kernel pointer buffer
fs/fs-writeback.c: adjust dirtytime_interval_handler definition to match prototype
Subsystem: kcsan
Changbin Du <changbin.du@gmail.com>:
kcsan: kconfig: move to menu 'Generic Kernel Debugging Instruments'
.mailmap | 4 ++
fs/fs-writeback.c | 2 -
include/linux/ftrace.h | 3 --
include/linux/stackleak.h | 2 -
kernel/kprobes.c | 9 +++++-
kernel/stackleak.c | 2 -
kernel/trace/ftrace.c | 3 --
lib/Kconfig.debug | 4 --
mm/huge_memory.c | 42 ++++++++++++++++---------------
mm/ksm.c | 4 ++
mm/memory_hotplug.c | 14 ++++++++++
mm/migrate.c | 3 +-
mm/mlock.c | 24 +++++++++++------
mm/page_isolation.c | 8 +++++
mm/shmem.c | 20 +++++++++++---
mm/swap.c | 6 ++--
mm/vmscan.c | 10 +++++--
tools/testing/selftests/vm/map_hugetlb.c | 2 -
18 files changed, 111 insertions(+), 51 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-09-26 4:17 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-09-26 4:17 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
9 patches, based on 7c7ec3226f5f33f9c050d85ec20f18419c622ad6.
Subsystems affected by this patch series:
mm/thp
mm/memcg
mm/gup
mm/migration
lib
x86
mm/memory-hotplug
Subsystem: mm/thp
Gao Xiang <hsiangkao@redhat.com>:
mm, THP, swap: fix allocating cluster for swapfile by mistake
Subsystem: mm/memcg
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: fix missing suffix of workingset_restore
Subsystem: mm/gup
Vasily Gorbik <gor@linux.ibm.com>:
mm/gup: fix gup_fast with dynamic page table folding
Subsystem: mm/migration
Zi Yan <ziy@nvidia.com>:
mm/migrate: correct thp migration stats
Subsystem: lib
Nick Desaulniers <ndesaulniers@google.com>:
lib/string.c: implement stpcpy
Jason Yan <yanaijie@huawei.com>:
lib/memregion.c: include memregion.h
Subsystem: x86
Mikulas Patocka <mpatocka@redhat.com>:
arch/x86/lib/usercopy_64.c: fix __copy_user_flushcache() cache writeback
Subsystem: mm/memory-hotplug
Laurent Dufour <ldufour@linux.ibm.com>:
Patch series "mm: fix memory to node bad links in sysfs", v3:
mm: replace memmap_context by meminit_context
mm: don't rely on system state to detect hot-plug operations
Documentation/admin-guide/cgroup-v2.rst | 25 ++++++---
arch/ia64/mm/init.c | 6 +-
arch/s390/include/asm/pgtable.h | 42 +++++++++++----
arch/x86/lib/usercopy_64.c | 2
drivers/base/node.c | 85 ++++++++++++++++++++------------
include/linux/mm.h | 2
include/linux/mmzone.h | 11 +++-
include/linux/node.h | 11 ++--
include/linux/pgtable.h | 10 +++
lib/memregion.c | 1
lib/string.c | 24 +++++++++
mm/gup.c | 18 +++---
mm/memcontrol.c | 4 -
mm/memory_hotplug.c | 5 +
mm/migrate.c | 7 +-
mm/page_alloc.c | 10 +--
mm/swapfile.c | 2
17 files changed, 181 insertions(+), 84 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-10-03 5:20 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-10-03 5:20 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
3 patches, based on d3d45f8220d60a0b2aaaacf8fb2be4e6ffd9008e.
Subsystems affected by this patch series:
mm/slub
mm/cma
scripts
Subsystem: mm/slub
Eric Farman <farman@linux.ibm.com>:
mm, slub: restore initial kmem_cache flags
Subsystem: mm/cma
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
mm/page_alloc: handle a missing case for memalloc_nocma_{save/restore} APIs
Subsystem: scripts
Eric Biggers <ebiggers@google.com>:
scripts/spelling.txt: fix malformed entry
mm/page_alloc.c | 19 ++++++++++++++++---
mm/slub.c | 6 +-----
scripts/spelling.txt | 2 +-
3 files changed, 18 insertions(+), 9 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-10-11 6:15 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-10-11 6:15 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
5 patches, based on da690031a5d6d50a361e3f19f3eeabd086a6f20d.
Subsystems affected by this patch series:
MAINTAINERS
mm/pagemap
mm/swap
mm/hugetlb
Subsystem: MAINTAINERS
Kees Cook <keescook@chromium.org>:
MAINTAINERS: change hardening mailing list
Antoine Tenart <atenart@kernel.org>:
MAINTAINERS: Antoine Tenart's email address
Subsystem: mm/pagemap
Miaohe Lin <linmiaohe@huawei.com>:
mm: mmap: Fix general protection fault in unlink_file_vma()
Subsystem: mm/swap
Minchan Kim <minchan@kernel.org>:
mm: validate inode in mapping_set_error()
Subsystem: mm/hugetlb
Vijay Balakrishna <vijayb@linux.microsoft.com>:
mm: khugepaged: recalculate min_free_kbytes after memory hotplug as expected by khugepaged
.mailmap | 4 +++-
MAINTAINERS | 8 ++++----
include/linux/khugepaged.h | 5 +++++
include/linux/pagemap.h | 3 ++-
mm/khugepaged.c | 13 +++++++++++--
mm/mmap.c | 6 +++++-
mm/page_alloc.c | 3 +++
7 files changed, 33 insertions(+), 9 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-10-13 23:46 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-10-13 23:46 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
181 patches, based on 029f56db6ac248769f2c260bfaf3c3c0e23e904c.
Subsystems affected by this patch series:
kbuild
scripts
ntfs
ocfs2
vfs
mm/slab
mm/slub
mm/kmemleak
mm/dax
mm/debug
mm/pagecache
mm/fadvise
mm/gup
mm/swap
mm/memremap
mm/memcg
mm/selftests
mm/pagemap
mm/mincore
mm/hmm
mm/dma
mm/memory-failure
mm/vmalloc
mm/documentation
mm/kasan
mm/pagealloc
mm/hugetlb
mm/vmscan
mm/z3fold
mm/zbud
mm/compaction
mm/mempolicy
mm/mempool
mm/memblock
mm/oom-kill
mm/migration
Subsystem: kbuild
Nick Desaulniers <ndesaulniers@google.com>:
Patch series "set clang minimum version to 10.0.1", v3:
compiler-clang: add build check for clang 10.0.1
Revert "kbuild: disable clang's default use of -fmerge-all-constants"
Revert "arm64: bti: Require clang >= 10.0.1 for in-kernel BTI support"
Revert "arm64: vdso: Fix compilation with clang older than 8"
Partially revert "ARM: 8905/1: Emit __gnu_mcount_nc when using Clang 10.0.0 or newer"
Marco Elver <elver@google.com>:
kasan: remove mentions of unsupported Clang versions
Nick Desaulniers <ndesaulniers@google.com>:
compiler-gcc: improve version error
compiler.h: avoid escaped section names
export.h: fix section name for CONFIG_TRIM_UNUSED_KSYMS for Clang
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
kbuild: doc: describe proper script invocation
Subsystem: scripts
Wang Qing <wangqing@vivo.com>:
scripts/spelling.txt: increase error-prone spell checking
Naoki Hayama <naoki.hayama@lineo.co.jp>:
scripts/spelling.txt: add "arbitrary" typo
Borislav Petkov <bp@suse.de>:
scripts/decodecode: add the capability to supply the program counter
Subsystem: ntfs
Rustam Kovhaev <rkovhaev@gmail.com>:
ntfs: add check for mft record size in superblock
Subsystem: ocfs2
Randy Dunlap <rdunlap@infradead.org>:
ocfs2: delete repeated words in comments
Gang He <ghe@suse.com>:
ocfs2: fix potential soft lockup during fstrim
Subsystem: vfs
Randy Dunlap <rdunlap@infradead.org>:
fs/xattr.c: fix kernel-doc warnings for setxattr & removexattr
Luo Jiaxing <luojiaxing@huawei.com>:
fs_parse: mark fs_param_bad_value() as static
Subsystem: mm/slab
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/slab.c: clean code by removing redundant if condition
tangjianqiang <wyqt1985@gmail.com>:
include/linux/slab.h: fix a typo error in comment
Subsystem: mm/slub
Abel Wu <wuyun.wu@huawei.com>:
mm/slub.c: branch optimization in free slowpath
mm/slub: fix missing ALLOC_SLOWPATH stat when bulk alloc
mm/slub: make add_full() condition more explicit
Subsystem: mm/kmemleak
Davidlohr Bueso <dave@stgolabs.net>:
mm/kmemleak: rely on rcu for task stack scanning
Hui Su <sh_def@163.com>:
mm,kmemleak-test.c: move kmemleak-test.c to samples dir
Subsystem: mm/dax
Dan Williams <dan.j.williams@intel.com>:
Patch series "device-dax: Support sub-dividing soft-reserved ranges", v5:
x86/numa: cleanup configuration dependent command-line options
x86/numa: add 'nohmat' option
efi/fake_mem: arrange for a resource entry per efi_fake_mem instance
ACPI: HMAT: refactor hmat_register_target_device to hmem_register_device
resource: report parent to walk_iomem_res_desc() callback
mm/memory_hotplug: introduce default phys_to_target_node() implementation
ACPI: HMAT: attach a device for each soft-reserved range
device-dax: drop the dax_region.pfn_flags attribute
device-dax: move instance creation parameters to 'struct dev_dax_data'
device-dax: make pgmap optional for instance creation
device-dax/kmem: introduce dax_kmem_range()
device-dax/kmem: move resource name tracking to drvdata
device-dax/kmem: replace release_resource() with release_mem_region()
device-dax: add an allocation interface for device-dax instances
device-dax: introduce 'struct dev_dax' typed-driver operations
device-dax: introduce 'seed' devices
drivers/base: make device_find_child_by_name() compatible with sysfs inputs
device-dax: add resize support
mm/memremap_pages: convert to 'struct range'
mm/memremap_pages: support multiple ranges per invocation
device-dax: add dis-contiguous resource support
device-dax: introduce 'mapping' devices
Joao Martins <joao.m.martins@oracle.com>:
device-dax: make align a per-device property
Dan Williams <dan.j.williams@intel.com>:
device-dax: add an 'align' attribute
Joao Martins <joao.m.martins@oracle.com>:
dax/hmem: introduce dax_hmem.region_idle parameter
device-dax: add a range mapping allocation attribute
Subsystem: mm/debug
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/debug.c: do not dereference i_ino blindly
John Hubbard <jhubbard@nvidia.com>:
mm, dump_page: rename head_mapcount() --> head_compound_mapcount()
Subsystem: mm/pagecache
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Return head pages from find_*_entry", v2:
mm: factor find_get_incore_page out of mincore_page
mm: use find_get_incore_page in memcontrol
mm: optimise madvise WILLNEED
proc: optimise smaps for shmem entries
i915: use find_lock_page instead of find_lock_entry
mm: convert find_get_entry to return the head page
mm/shmem: return head page from find_lock_entry
mm: add find_lock_head
mm/filemap: fix filemap_map_pages for THP
Subsystem: mm/fadvise
Yafang Shao <laoar.shao@gmail.com>:
mm, fadvise: improve the expensive remote LRU cache draining after FADV_DONTNEED
Subsystem: mm/gup
Barry Song <song.bao.hua@hisilicon.com>:
mm/gup_benchmark: update the documentation in Kconfig
mm/gup_benchmark: use pin_user_pages for FOLL_LONGTERM flag
mm/gup: don't permit users to call get_user_pages with FOLL_LONGTERM
John Hubbard <jhubbard@nvidia.com>:
mm/gup: protect unpin_user_pages() against npages==-ERRNO
Subsystem: mm/swap
Gao Xiang <hsiangkao@redhat.com>:
swap: rename SWP_FS to SWAP_FS_OPS to avoid ambiguity
Yu Zhao <yuzhao@google.com>:
mm: remove activate_page() from unuse_pte()
mm: remove superfluous __ClearPageActive()
Miaohe Lin <linmiaohe@huawei.com>:
mm/swap.c: fix confusing comment in release_pages()
mm/swap_slots.c: remove always zero and unused return value of enable_swap_slots_cache()
mm/page_io.c: remove useless out label in __swap_writepage()
mm/swap.c: fix incomplete comment in lru_cache_add_inactive_or_unevictable()
mm/swapfile.c: remove unnecessary goto out in _swap_info_get()
mm/swapfile.c: fix potential memory leak in sys_swapon
Subsystem: mm/memremap
Ira Weiny <ira.weiny@intel.com>:
mm/memremap.c: convert devmap static branch to {inc,dec}
Subsystem: mm/memcg
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
mm: memcontrol: use flex_array_size() helper in memcpy()
mm: memcontrol: use the preferred form for passing the size of a structure type
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: fix racy access to page->mem_cgroup in mem_cgroup_from_obj()
Miaohe Lin <linmiaohe@huawei.com>:
mm: memcontrol: correct the comment of mem_cgroup_iter()
Waiman Long <longman@redhat.com>:
Patch series "mm/memcg: Miscellaneous cleanups and streamlining", v2:
mm/memcg: clean up obsolete enum charge_type
mm/memcg: simplify mem_cgroup_get_max()
mm/memcg: unify swap and memsw page counters
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: add the missing numa_stat interface for cgroup v2
Miaohe Lin <linmiaohe@huawei.com>:
mm/page_counter: correct the obsolete func name in the comment of page_counter_try_charge()
mm: memcontrol: reword obsolete comment of mem_cgroup_unmark_under_oom()
Bharata B Rao <bharata@linux.ibm.com>:
mm: memcg/slab: uncharge during kmem_cache_free_bulk()
Ralph Campbell <rcampbell@nvidia.com>:
mm/memcg: fix device private memcg accounting
Subsystem: mm/selftests
John Hubbard <jhubbard@nvidia.com>:
Patch series "selftests/vm: fix some minor aggravating factors in the Makefile":
selftests/vm: fix false build success on the second and later attempts
selftests/vm: fix incorrect gcc invocation in some cases
Subsystem: mm/pagemap
Matthew Wilcox <willy@infradead.org>:
mm: account PMD tables like PTE tables
Yanfei Xu <yanfei.xu@windriver.com>:
mm/memory.c: fix typo in __do_fault() comment
mm/memory.c: replace vmf->vma with variable vma
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/mmap: rename __vma_unlink_common() to __vma_unlink()
mm/mmap: leverage vma_rb_erase_ignore() to implement vma_rb_erase()
Chinwen Chang <chinwen.chang@mediatek.com>:
Patch series "Try to release mmap_lock temporarily in smaps_rollup", v4:
mmap locking API: add mmap_lock_is_contended()
mm: smaps*: extend smap_gather_stats to support specified beginning
mm: proc: smaps_rollup: do not stall write attempts on mmap_lock
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Fix PageDoubleMap":
mm: move PageDoubleMap bit
mm: simplify PageDoubleMap with PF_SECOND policy
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/mmap: leave adjust_next as virtual address instead of page frame number
Randy Dunlap <rdunlap@infradead.org>:
mm/memory.c: fix spello of "function"
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/mmap: not necessary to check mapping separately
mm/mmap: check on file instead of the rb_root_cached of its address_space
Miaohe Lin <linmiaohe@huawei.com>:
mm: use helper function mapping_allow_writable()
mm/mmap.c: use helper function allow_write_access() in __remove_shared_vm_struct()
Liao Pingfang <liao.pingfang@zte.com.cn>:
mm/mmap.c: replace do_brk with do_brk_flags in comment of insert_vm_struct()
Peter Xu <peterx@redhat.com>:
mm: remove src/dst mm parameter in copy_page_range()
Subsystem: mm/mincore
yuleixzhang <yulei.kernel@gmail.com>:
include/linux/huge_mm.h: remove mincore_huge_pmd declaration
Subsystem: mm/hmm
Ralph Campbell <rcampbell@nvidia.com>:
tools/testing/selftests/vm/hmm-tests.c: use the new SKIP() macro
lib/test_hmm.c: remove unused dmirror_zero_page
Subsystem: mm/dma
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
mm/dmapool.c: replace open-coded list_for_each_entry_safe()
mm/dmapool.c: replace hard coded function name with __func__
Subsystem: mm/memory-failure
Xianting Tian <tian.xianting@h3c.com>:
mm/memory-failure: do pgoff calculation before for_each_process()
Alex Shi <alex.shi@linux.alibaba.com>:
mm/memory-failure.c: remove unused macro `writeback'
Subsystem: mm/vmalloc
Hui Su <sh_def@163.com>:
mm/vmalloc.c: update the comment in __vmalloc_area_node()
mm/vmalloc.c: fix the comment of find_vm_area
Subsystem: mm/documentation
Alexander Gordeev <agordeev@linux.ibm.com>:
docs/vm: fix 'mm_count' vs 'mm_users' counter confusion
Subsystem: mm/kasan
Patricia Alfonso <trishalfonso@google.com>:
Patch series "KASAN-KUnit Integration", v14:
kasan/kunit: add KUnit Struct to Current Task
KUnit: KASAN Integration
KASAN: port KASAN Tests to KUnit
KASAN: Testing Documentation
David Gow <davidgow@google.com>:
mm: kasan: do not panic if both panic_on_warn and kasan_multishot set
Subsystem: mm/pagealloc
David Hildenbrand <david@redhat.com>:
Patch series "mm / virtio-mem: support ZONE_MOVABLE", v5:
mm/page_alloc: tweak comments in has_unmovable_pages()
mm/page_isolation: exit early when pageblock is isolated in set_migratetype_isolate()
mm/page_isolation: drop WARN_ON_ONCE() in set_migratetype_isolate()
mm/page_isolation: cleanup set_migratetype_isolate()
virtio-mem: don't special-case ZONE_MOVABLE
mm: document semantics of ZONE_MOVABLE
Li Xinhai <lixinhai.lxh@gmail.com>:
mm, isolation: avoid checking unmovable pages across pageblock boundary
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/page_alloc.c: clean code by removing unnecessary initialization
mm/page_alloc.c: micro-optimization remove unnecessary branch
mm/page_alloc.c: fix early params garbage value accesses
mm/page_alloc.c: clean code by merging two functions
Yanfei Xu <yanfei.xu@windriver.com>:
mm/page_alloc.c: __perform_reclaim should return 'unsigned long'
Mateusz Nosek <mateusznosek0@gmail.com>:
mmzone: clean code by removing unused macro parameter
Ralph Campbell <rcampbell@nvidia.com>:
mm: move call to compound_head() in release_pages()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/page_alloc.c: fix freeing non-compound pages
Michal Hocko <mhocko@suse.com>:
include/linux/gfp.h: clarify usage of GFP_ATOMIC in !preemptible contexts
Subsystem: mm/hugetlb
Baoquan He <bhe@redhat.com>:
Patch series "mm/hugetlb: Small cleanup and improvement", v2:
mm/hugetlb.c: make is_hugetlb_entry_hwpoisoned return bool
mm/hugetlb.c: remove the unnecessary non_swap_entry()
doc/vm: fix typo in the hugetlb admin documentation
Wei Yang <richard.weiyang@linux.alibaba.com>:
Patch series "mm/hugetlb: code refine and simplification", v4:
mm/hugetlb: not necessary to coalesce regions recursively
mm/hugetlb: remove VM_BUG_ON(!nrg) in get_file_region_entry_from_cache()
mm/hugetlb: use list_splice to merge two list at once
mm/hugetlb: count file_region to be added when regions_needed != NULL
mm/hugetlb: a page from buddy is not on any list
mm/hugetlb: narrow the hugetlb_lock protection area during preparing huge page
mm/hugetlb: take the free hpage during the iteration directly
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: add lockdep check for i_mmap_rwsem held in huge_pmd_share
Subsystem: mm/vmscan
Chunxin Zang <zangchunxin@bytedance.com>:
mm/vmscan: fix infinite loop in drop_slab_node
Hui Su <sh_def@163.com>:
mm/vmscan: fix comments for isolate_lru_page()
Subsystem: mm/z3fold
Hui Su <sh_def@163.com>:
mm/z3fold.c: use xx_zalloc instead xx_alloc and memset
Subsystem: mm/zbud
Xiang Chen <chenxiang66@hisilicon.com>:
mm/zbud: remove redundant initialization
Subsystem: mm/compaction
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/compaction.c: micro-optimization remove unnecessary branch
include/linux/compaction.h: clean code by removing unused enum value
John Hubbard <jhubbard@nvidia.com>:
selftests/vm: 8x compaction_test speedup
Subsystem: mm/mempolicy
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/mempolicy: remove or narrow the lock on current
mm: remove unused alloc_page_vma_node()
Subsystem: mm/mempool
Miaohe Lin <linmiaohe@huawei.com>:
mm/mempool: add 'else' to split mutually exclusive case
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "memblock: seasonal cleaning^w cleanup", v3:
KVM: PPC: Book3S HV: simplify kvm_cma_reserve()
dma-contiguous: simplify cma_early_percent_memory()
arm, xtensa: simplify initialization of high memory pages
arm64: numa: simplify dummy_numa_init()
h8300, nds32, openrisc: simplify detection of memory extents
riscv: drop unneeded node initialization
mircoblaze: drop unneeded NUMA and sparsemem initializations
memblock: make for_each_memblock_type() iterator private
memblock: make memblock_debug and related functionality private
memblock: reduce number of parameters in for_each_mem_range()
arch, mm: replace for_each_memblock() with for_each_mem_pfn_range()
arch, drivers: replace for_each_membock() with for_each_mem_range()
x86/setup: simplify initrd relocation and reservation
x86/setup: simplify reserve_crashkernel()
memblock: remove unused memblock_mem_size()
memblock: implement for_each_reserved_mem_region() using __next_mem_region()
memblock: use separate iterators for memory and reserved regions
Subsystem: mm/oom-kill
Suren Baghdasaryan <surenb@google.com>:
mm, oom_adj: don't loop through tasks in __set_oom_adj when not necessary
Subsystem: mm/migration
Ralph Campbell <rcampbell@nvidia.com>:
mm/migrate: remove cpages-- in migrate_vma_finalize()
mm/migrate: remove obsolete comment about device public
.clang-format | 7
Documentation/admin-guide/cgroup-v2.rst | 69 +
Documentation/admin-guide/mm/hugetlbpage.rst | 2
Documentation/dev-tools/kasan.rst | 74 +
Documentation/dev-tools/kmemleak.rst | 2
Documentation/kbuild/makefiles.rst | 20
Documentation/vm/active_mm.rst | 2
Documentation/x86/x86_64/boot-options.rst | 4
MAINTAINERS | 2
Makefile | 9
arch/arm/Kconfig | 2
arch/arm/include/asm/tlb.h | 1
arch/arm/kernel/setup.c | 18
arch/arm/mm/init.c | 59 -
arch/arm/mm/mmu.c | 39
arch/arm/mm/pmsa-v7.c | 23
arch/arm/mm/pmsa-v8.c | 17
arch/arm/xen/mm.c | 7
arch/arm64/Kconfig | 2
arch/arm64/kernel/machine_kexec_file.c | 6
arch/arm64/kernel/setup.c | 4
arch/arm64/kernel/vdso/Makefile | 7
arch/arm64/mm/init.c | 11
arch/arm64/mm/kasan_init.c | 10
arch/arm64/mm/mmu.c | 11
arch/arm64/mm/numa.c | 15
arch/c6x/kernel/setup.c | 9
arch/h8300/kernel/setup.c | 8
arch/microblaze/mm/init.c | 23
arch/mips/cavium-octeon/dma-octeon.c | 14
arch/mips/kernel/setup.c | 31
arch/mips/netlogic/xlp/setup.c | 2
arch/nds32/kernel/setup.c | 8
arch/openrisc/kernel/setup.c | 9
arch/openrisc/mm/init.c | 8
arch/powerpc/kernel/fadump.c | 61 -
arch/powerpc/kexec/file_load_64.c | 16
arch/powerpc/kvm/book3s_hv_builtin.c | 12
arch/powerpc/kvm/book3s_hv_uvmem.c | 14
arch/powerpc/mm/book3s64/hash_utils.c | 16
arch/powerpc/mm/book3s64/radix_pgtable.c | 10
arch/powerpc/mm/kasan/kasan_init_32.c | 8
arch/powerpc/mm/mem.c | 31
arch/powerpc/mm/numa.c | 7
arch/powerpc/mm/pgtable_32.c | 8
arch/riscv/mm/init.c | 36
arch/riscv/mm/kasan_init.c | 10
arch/s390/kernel/setup.c | 27
arch/s390/mm/page-states.c | 6
arch/s390/mm/vmem.c | 7
arch/sh/mm/init.c | 9
arch/sparc/mm/init_64.c | 12
arch/x86/include/asm/numa.h | 8
arch/x86/kernel/e820.c | 16
arch/x86/kernel/setup.c | 56 -
arch/x86/mm/numa.c | 13
arch/x86/mm/numa_emulation.c | 3
arch/x86/xen/enlighten_pv.c | 2
arch/xtensa/mm/init.c | 55 -
drivers/acpi/numa/hmat.c | 76 -
drivers/acpi/numa/srat.c | 9
drivers/base/core.c | 2
drivers/bus/mvebu-mbus.c | 12
drivers/dax/Kconfig | 6
drivers/dax/Makefile | 3
drivers/dax/bus.c | 1237 +++++++++++++++++++++++----
drivers/dax/bus.h | 34
drivers/dax/dax-private.h | 74 +
drivers/dax/device.c | 164 +--
drivers/dax/hmem.c | 56 -
drivers/dax/hmem/Makefile | 8
drivers/dax/hmem/device.c | 100 ++
drivers/dax/hmem/hmem.c | 93 +-
drivers/dax/kmem.c | 236 ++---
drivers/dax/pmem/compat.c | 2
drivers/dax/pmem/core.c | 36
drivers/firmware/efi/x86_fake_mem.c | 12
drivers/gpu/drm/i915/gem/i915_gem_shmem.c | 4
drivers/gpu/drm/nouveau/nouveau_dmem.c | 15
drivers/irqchip/irq-gic-v3-its.c | 2
drivers/nvdimm/badrange.c | 26
drivers/nvdimm/claim.c | 13
drivers/nvdimm/nd.h | 3
drivers/nvdimm/pfn_devs.c | 13
drivers/nvdimm/pmem.c | 27
drivers/nvdimm/region.c | 21
drivers/pci/p2pdma.c | 12
drivers/virtio/virtio_mem.c | 47 -
drivers/xen/unpopulated-alloc.c | 45
fs/fs_parser.c | 2
fs/ntfs/inode.c | 6
fs/ocfs2/alloc.c | 6
fs/ocfs2/localalloc.c | 2
fs/proc/base.c | 3
fs/proc/task_mmu.c | 104 +-
fs/xattr.c | 22
include/acpi/acpi_numa.h | 14
include/kunit/test.h | 5
include/linux/acpi.h | 2
include/linux/compaction.h | 3
include/linux/compiler-clang.h | 8
include/linux/compiler-gcc.h | 2
include/linux/compiler.h | 2
include/linux/dax.h | 8
include/linux/export.h | 2
include/linux/fs.h | 4
include/linux/gfp.h | 6
include/linux/huge_mm.h | 3
include/linux/kasan.h | 6
include/linux/memblock.h | 90 +
include/linux/memcontrol.h | 13
include/linux/memory_hotplug.h | 23
include/linux/memremap.h | 15
include/linux/mm.h | 36
include/linux/mmap_lock.h | 5
include/linux/mmzone.h | 37
include/linux/numa.h | 11
include/linux/oom.h | 1
include/linux/page-flags.h | 42
include/linux/pagemap.h | 43
include/linux/range.h | 6
include/linux/sched.h | 4
include/linux/sched/coredump.h | 1
include/linux/slab.h | 2
include/linux/swap.h | 10
include/linux/swap_slots.h | 2
kernel/dma/contiguous.c | 11
kernel/fork.c | 25
kernel/resource.c | 11
lib/Kconfig.debug | 9
lib/Kconfig.kasan | 31
lib/Makefile | 5
lib/kunit/test.c | 13
lib/test_free_pages.c | 42
lib/test_hmm.c | 65 -
lib/test_kasan.c | 732 ++++++---------
lib/test_kasan_module.c | 111 ++
mm/Kconfig | 4
mm/Makefile | 1
mm/compaction.c | 5
mm/debug.c | 18
mm/dmapool.c | 46 -
mm/fadvise.c | 9
mm/filemap.c | 78 -
mm/gup.c | 44
mm/gup_benchmark.c | 23
mm/huge_memory.c | 4
mm/hugetlb.c | 100 +-
mm/internal.h | 3
mm/kasan/report.c | 34
mm/kmemleak-test.c | 99 --
mm/kmemleak.c | 8
mm/madvise.c | 21
mm/memblock.c | 102 --
mm/memcontrol.c | 262 +++--
mm/memory-failure.c | 5
mm/memory.c | 147 +--
mm/memory_hotplug.c | 10
mm/mempolicy.c | 8
mm/mempool.c | 18
mm/memremap.c | 344 ++++---
mm/migrate.c | 3
mm/mincore.c | 28
mm/mmap.c | 45
mm/oom_kill.c | 2
mm/page_alloc.c | 82 -
mm/page_counter.c | 2
mm/page_io.c | 14
mm/page_isolation.c | 41
mm/shmem.c | 19
mm/slab.c | 4
mm/slab.h | 50 -
mm/slub.c | 33
mm/sparse.c | 10
mm/swap.c | 14
mm/swap_slots.c | 3
mm/swap_state.c | 38
mm/swapfile.c | 12
mm/truncate.c | 58 -
mm/vmalloc.c | 6
mm/vmscan.c | 5
mm/z3fold.c | 3
mm/zbud.c | 1
samples/Makefile | 1
samples/kmemleak/Makefile | 3
samples/kmemleak/kmemleak-test.c | 99 ++
scripts/decodecode | 29
scripts/spelling.txt | 4
tools/testing/nvdimm/dax-dev.c | 28
tools/testing/nvdimm/test/iomap.c | 2
tools/testing/selftests/vm/Makefile | 17
tools/testing/selftests/vm/compaction_test.c | 11
tools/testing/selftests/vm/gup_benchmark.c | 14
tools/testing/selftests/vm/hmm-tests.c | 4
194 files changed, 4273 insertions(+), 2777 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-10-16 2:40 Andrew Morton
2020-10-16 3:03 ` incoming Andrew Morton
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2020-10-16 2:40 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- most of the rest of mm/
- various other subsystems
156 patches, based on 578a7155c5a1894a789d4ece181abf9d25dc6b0d.
Subsystems affected by this patch series:
mm/dax
mm/debug
mm/thp
mm/readahead
mm/page-poison
mm/util
mm/memory-hotplug
mm/zram
mm/cleanups
misc
core-kernel
get_maintainer
MAINTAINERS
lib
bitops
checkpatch
binfmt
ramfs
autofs
nilfs
rapidio
panic
relay
kgdb
ubsan
romfs
fault-injection
Subsystem: mm/dax
Dan Williams <dan.j.williams@intel.com>:
device-dax/kmem: fix resource release
Subsystem: mm/debug
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "mm/debug_vm_pgtable fixes", v4:
powerpc/mm: add DEBUG_VM WARN for pmd_clear
powerpc/mm: move setting pte specific flags to pfn_pte
mm/debug_vm_pgtable/ppc64: avoid setting top bits in radom value
mm/debug_vm_pgtables/hugevmap: use the arch helper to identify huge vmap support.
mm/debug_vm_pgtable/savedwrite: enable savedwrite test with CONFIG_NUMA_BALANCING
mm/debug_vm_pgtable/THP: mark the pte entry huge before using set_pmd/pud_at
mm/debug_vm_pgtable/set_pte/pmd/pud: don't use set_*_at to update an existing pte entry
mm/debug_vm_pgtable/locks: move non page table modifying test together
mm/debug_vm_pgtable/locks: take correct page table lock
mm/debug_vm_pgtable/thp: use page table depost/withdraw with THP
mm/debug_vm_pgtable/pmd_clear: don't use pmd/pud_clear on pte entries
mm/debug_vm_pgtable/hugetlb: disable hugetlb test on ppc64
mm/debug_vm_pgtable: avoid none pte in pte_clear_test
mm/debug_vm_pgtable: avoid doing memory allocation with pgtable_t mapped.
Subsystem: mm/thp
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Fix read-only THP for non-tmpfs filesystems":
XArray: add xa_get_order
XArray: add xas_split
mm/filemap: fix storing to a THP shadow entry
Patch series "Remove assumptions of THP size":
mm/filemap: fix page cache removal for arbitrary sized THPs
mm/memory: remove page fault assumption of compound page size
mm/page_owner: change split_page_owner to take a count
"Kirill A. Shutemov" <kirill@shutemov.name>:
mm/huge_memory: fix total_mapcount assumption of page size
mm/huge_memory: fix split assumption of page size
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/huge_memory: fix page_trans_huge_mapcount assumption of THP size
mm/huge_memory: fix can_split_huge_page assumption of THP size
mm/rmap: fix assumptions of THP size
mm/truncate: fix truncation for pages of arbitrary size
mm/page-writeback: support tail pages in wait_for_stable_page
mm/vmscan: allow arbitrary sized pages to be paged out
fs: add a filesystem flag for THPs
fs: do not update nr_thps for mappings which support THPs
Huang Ying <ying.huang@intel.com>:
mm: fix a race during THP splitting
Subsystem: mm/readahead
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Readahead patches for 5.9/5.10":
mm/readahead: add DEFINE_READAHEAD
mm/readahead: make page_cache_ra_unbounded take a readahead_control
mm/readahead: make do_page_cache_ra take a readahead_control
David Howells <dhowells@redhat.com>:
mm/readahead: make ondemand_readahead take a readahead_control
mm/readahead: pass readahead_control to force_page_cache_ra
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/readahead: add page_cache_sync_ra and page_cache_async_ra
David Howells <dhowells@redhat.com>:
mm/filemap: fold ra_submit into do_sync_mmap_readahead
mm/readahead: pass a file_ra_state into force_page_cache_ra
Subsystem: mm/page-poison
Naoya Horiguchi <naoya.horiguchi@nec.com>:
Patch series "HWPOISON: soft offline rework", v7:
mm,hwpoison: cleanup unused PageHuge() check
mm, hwpoison: remove recalculating hpage
mm,hwpoison-inject: don't pin for hwpoison_filter
Oscar Salvador <osalvador@suse.de>:
mm,hwpoison: unexport get_hwpoison_page and make it static
mm,hwpoison: refactor madvise_inject_error
mm,hwpoison: kill put_hwpoison_page
mm,hwpoison: unify THP handling for hard and soft offline
mm,hwpoison: rework soft offline for free pages
mm,hwpoison: rework soft offline for in-use pages
mm,hwpoison: refactor soft_offline_huge_page and __soft_offline_page
mm,hwpoison: return 0 if the page is already poisoned in soft-offline
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm,hwpoison: introduce MF_MSG_UNSPLIT_THP
mm,hwpoison: double-check page count in __get_any_page()
Oscar Salvador <osalvador@suse.de>:
mm,hwpoison: try to narrow window race for free pages
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/page_poison.c: replace bool variable with static key
Miaohe Lin <linmiaohe@huawei.com>:
mm/vmstat.c: use helper macro abs()
Subsystem: mm/util
Bartosz Golaszewski <bgolaszewski@baylibre.com>:
mm/util.c: update the kerneldoc for kstrdup_const()
Jann Horn <jannh@google.com>:
mm/mmu_notifier: fix mmget() assert in __mmu_interval_notifier_insert
Subsystem: mm/memory-hotplug
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: online_pages()/offline_pages() cleanups", v2:
mm/memory_hotplug: inline __offline_pages() into offline_pages()
mm/memory_hotplug: enforce section granularity when onlining/offlining
mm/memory_hotplug: simplify page offlining
mm/page_alloc: simplify __offline_isolated_pages()
mm/memory_hotplug: drop nr_isolate_pageblock in offline_pages()
mm/page_isolation: simplify return value of start_isolate_page_range()
mm/memory_hotplug: simplify page onlining
mm/page_alloc: drop stale pageblock comment in memmap_init_zone*()
mm: pass migratetype into memmap_init_zone() and move_pfn_range_to_zone()
mm/memory_hotplug: mark pageblocks MIGRATE_ISOLATE while onlining memory
Patch series "selective merging of system ram resources", v4:
kernel/resource: make release_mem_region_adjustable() never fail
kernel/resource: move and rename IORESOURCE_MEM_DRIVER_MANAGED
mm/memory_hotplug: guard more declarations by CONFIG_MEMORY_HOTPLUG
mm/memory_hotplug: prepare passing flags to add_memory() and friends
mm/memory_hotplug: MEMHP_MERGE_RESOURCE to specify merging of System RAM resources
virtio-mem: try to merge system ram resources
xen/balloon: try to merge system ram resources
hv_balloon: try to merge system ram resources
kernel/resource: make iomem_resource implicit in release_mem_region_adjustable()
Laurent Dufour <ldufour@linux.ibm.com>:
mm: don't panic when links can't be created in sysfs
David Hildenbrand <david@redhat.com>:
Patch series "mm: place pages to the freelist tail when onlining and undoing isolation", v2:
mm/page_alloc: convert "report" flag of __free_one_page() to a proper flag
mm/page_alloc: place pages to tail in __putback_isolated_page()
mm/page_alloc: move pages to tail in move_to_free_list()
mm/page_alloc: place pages to tail in __free_pages_core()
mm/memory_hotplug: update comment regarding zone shuffling
Subsystem: mm/zram
Douglas Anderson <dianders@chromium.org>:
zram: failing to decompress is WARN_ON worthy
Subsystem: mm/cleanups
YueHaibing <yuehaibing@huawei.com>:
mm/slab.h: remove duplicate include
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/page_reporting.c: drop stale list head check in page_reporting_cycle
Ira Weiny <ira.weiny@intel.com>:
mm/highmem.c: clean up endif comments
Yu Zhao <yuzhao@google.com>:
mm: use self-explanatory macros rather than "2"
Miaohe Lin <linmiaohe@huawei.com>:
mm: fix some broken comments
Chen Tao <chentao3@hotmail.com>:
mm: fix some comments formatting
Xiaofei Tan <tanxiaofei@huawei.com>:
mm/workingset.c: fix some doc warnings
Miaohe Lin <linmiaohe@huawei.com>:
mm: use helper function put_write_access()
Mike Rapoport <rppt@linux.ibm.com>:
include/linux/mmzone.h: remove unused early_pfn_valid()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: rename page_order() to buddy_order()
Subsystem: misc
Randy Dunlap <rdunlap@infradead.org>:
fs: configfs: delete repeated words in comments
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: split out min()/max() et al. helpers
Subsystem: core-kernel
Liao Pingfang <liao.pingfang@zte.com.cn>:
kernel/sys.c: replace do_brk with do_brk_flags in comment of prctl_set_mm_map()
Randy Dunlap <rdunlap@infradead.org>:
kernel/: fix repeated words in comments
kernel: acct.c: fix some kernel-doc nits
Subsystem: get_maintainer
Joe Perches <joe@perches.com>:
get_maintainer: add test for file in VCS
Subsystem: MAINTAINERS
Joe Perches <joe@perches.com>:
get_maintainer: exclude MAINTAINERS file(s) from --git-fallback
Jarkko Sakkinen <jarkko.sakkinen@linux.intel.com>:
MAINTAINERS: jarkko.sakkinen@linux.intel.com -> jarkko@kernel.org
Subsystem: lib
Randy Dunlap <rdunlap@infradead.org>:
lib: bitmap: delete duplicated words
lib: libcrc32c: delete duplicated words
lib: decompress_bunzip2: delete duplicated words
lib: dynamic_queue_limits: delete duplicated words + fix typo
lib: earlycpio: delete duplicated words
lib: radix-tree: delete duplicated words
lib: syscall: delete duplicated words
lib: test_sysctl: delete duplicated words
lib/mpi/mpi-bit.c: fix spello of "functions"
Stephen Boyd <swboyd@chromium.org>:
lib/idr.c: document calling context for IDA APIs mustn't use locks
lib/idr.c: document that ida_simple_{get,remove}() are deprecated
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
lib/scatterlist.c: avoid a double memset
Miaohe Lin <linmiaohe@huawei.com>:
lib/percpu_counter.c: use helper macro abs()
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
include/linux/list.h: add a macro to test if entry is pointing to the head
Dan Carpenter <dan.carpenter@oracle.com>:
lib/test_hmm.c: fix an error code in dmirror_allocate_chunk()
Tobias Jordan <kernel@cdqe.de>:
lib/crc32.c: fix trivial typo in preprocessor condition
Subsystem: bitops
Wei Yang <richard.weiyang@linux.alibaba.com>:
bitops: simplify get_count_order_long()
bitops: use the same mechanism for get_count_order[_long]
Subsystem: checkpatch
Jerome Forissier <jerome@forissier.org>:
checkpatch: add --kconfig-prefix
Joe Perches <joe@perches.com>:
checkpatch: move repeated word test
checkpatch: add test for comma use that should be semicolon
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
const_structs.checkpatch: add phy_ops
Nicolas Boichat <drinkcat@chromium.org>:
checkpatch: warn if trace_printk and friends are called
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
const_structs.checkpatch: add pinctrl_ops and pinmux_ops
Joe Perches <joe@perches.com>:
checkpatch: warn on self-assignments
checkpatch: allow not using -f with files that are in git
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: extend author Signed-off-by check for split From: header
Joe Perches <joe@perches.com>:
checkpatch: emit a warning on embedded filenames
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: fix multi-statement macro checks for while blocks.
Łukasz Stelmach <l.stelmach@samsung.com>:
checkpatch: fix false positive on empty block comment lines
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: add new warnings to author signoff checks.
Subsystem: binfmt
Chris Kennelly <ckennelly@google.com>:
Patch series "Selecting Load Addresses According to p_align", v3:
fs/binfmt_elf: use PT_LOAD p_align values for suitable start address
tools/testing/selftests: add self-test for verifying load alignment
Jann Horn <jannh@google.com>:
Patch series "Fix ELF / FDPIC ELF core dumping, and use mmap_lock properly in there", v5:
binfmt_elf_fdpic: stop using dump_emit() on user pointers on !MMU
coredump: let dump_emit() bail out on short writes
coredump: refactor page range dumping into common helper
coredump: rework elf/elf_fdpic vma_dump_size() into common helper
binfmt_elf, binfmt_elf_fdpic: use a VMA list snapshot
mm/gup: take mmap_lock in get_dump_page()
mm: remove the now-unnecessary mmget_still_valid() hack
Subsystem: ramfs
Matthew Wilcox (Oracle) <willy@infradead.org>:
ramfs: fix nommu mmap with gaps in the page cache
Subsystem: autofs
Matthew Wilcox <willy@infradead.org>:
autofs: harden ioctl table
Subsystem: nilfs
Wang Hai <wanghai38@huawei.com>:
nilfs2: fix some kernel-doc warnings for nilfs2
Subsystem: rapidio
Souptick Joarder <jrdr.linux@gmail.com>:
rapidio: fix error handling path
Jing Xiangfeng <jingxiangfeng@huawei.com>:
rapidio: fix the missed put_device() for rio_mport_add_riodev
Subsystem: panic
Alexey Kardashevskiy <aik@ozlabs.ru>:
panic: dump registers on panic_on_warn
Subsystem: relay
Sudip Mukherjee <sudipm.mukherjee@gmail.com>:
kernel/relay.c: drop unneeded initialization
Subsystem: kgdb
Ritesh Harjani <riteshh@linux.ibm.com>:
scripts/gdb/proc: add struct mount & struct super_block addr in lx-mounts command
scripts/gdb/tasks: add headers and improve spacing format
Subsystem: ubsan
Elena Petrova <lenaptr@google.com>:
sched.h: drop in_ubsan field when UBSAN is in trap mode
George Popescu <georgepope@android.com>:
ubsan: introduce CONFIG_UBSAN_LOCAL_BOUNDS for Clang
Subsystem: romfs
Libing Zhou <libing.zhou@nokia-sbell.com>:
ROMFS: support inode blocks calculation
Subsystem: fault-injection
Albert van der Linde <alinde@google.com>:
Patch series "add fault injection to user memory access", v3:
lib, include/linux: add usercopy failure capability
lib, uaccess: add failure injection to usercopy functions
.mailmap | 1
Documentation/admin-guide/kernel-parameters.txt | 1
Documentation/core-api/xarray.rst | 14
Documentation/fault-injection/fault-injection.rst | 7
MAINTAINERS | 6
arch/ia64/mm/init.c | 4
arch/powerpc/include/asm/book3s/64/pgtable.h | 29 +
arch/powerpc/include/asm/nohash/pgtable.h | 5
arch/powerpc/mm/pgtable.c | 5
arch/powerpc/platforms/powernv/memtrace.c | 2
arch/powerpc/platforms/pseries/hotplug-memory.c | 2
drivers/acpi/acpi_memhotplug.c | 3
drivers/base/memory.c | 3
drivers/base/node.c | 33 +-
drivers/block/zram/zram_drv.c | 2
drivers/dax/kmem.c | 50 ++-
drivers/hv/hv_balloon.c | 4
drivers/infiniband/core/uverbs_main.c | 3
drivers/rapidio/devices/rio_mport_cdev.c | 18 -
drivers/s390/char/sclp_cmd.c | 2
drivers/vfio/pci/vfio_pci.c | 38 +-
drivers/virtio/virtio_mem.c | 5
drivers/xen/balloon.c | 4
fs/autofs/dev-ioctl.c | 8
fs/binfmt_elf.c | 267 +++-------------
fs/binfmt_elf_fdpic.c | 176 ++--------
fs/configfs/dir.c | 2
fs/configfs/file.c | 2
fs/coredump.c | 238 +++++++++++++-
fs/ext4/verity.c | 4
fs/f2fs/verity.c | 4
fs/inode.c | 2
fs/nilfs2/bmap.c | 2
fs/nilfs2/cpfile.c | 6
fs/nilfs2/page.c | 1
fs/nilfs2/sufile.c | 4
fs/proc/task_mmu.c | 18 -
fs/ramfs/file-nommu.c | 2
fs/romfs/super.c | 1
fs/userfaultfd.c | 28 -
include/linux/bitops.h | 13
include/linux/blkdev.h | 1
include/linux/bvec.h | 6
include/linux/coredump.h | 13
include/linux/fault-inject-usercopy.h | 22 +
include/linux/fs.h | 28 -
include/linux/idr.h | 13
include/linux/ioport.h | 15
include/linux/jiffies.h | 3
include/linux/kernel.h | 150 ---------
include/linux/list.h | 29 +
include/linux/memory_hotplug.h | 42 +-
include/linux/minmax.h | 153 +++++++++
include/linux/mm.h | 5
include/linux/mmzone.h | 17 -
include/linux/node.h | 16
include/linux/nodemask.h | 2
include/linux/page-flags.h | 6
include/linux/page_owner.h | 6
include/linux/pagemap.h | 111 ++++++
include/linux/sched.h | 2
include/linux/sched/mm.h | 25 -
include/linux/uaccess.h | 12
include/linux/vmstat.h | 2
include/linux/xarray.h | 22 +
include/ras/ras_event.h | 3
kernel/acct.c | 10
kernel/cgroup/cpuset.c | 2
kernel/dma/direct.c | 2
kernel/fork.c | 4
kernel/futex.c | 2
kernel/irq/timings.c | 2
kernel/jump_label.c | 2
kernel/kcsan/encoding.h | 2
kernel/kexec_core.c | 2
kernel/kexec_file.c | 2
kernel/kthread.c | 2
kernel/livepatch/state.c | 2
kernel/panic.c | 12
kernel/pid_namespace.c | 2
kernel/power/snapshot.c | 2
kernel/range.c | 3
kernel/relay.c | 2
kernel/resource.c | 114 +++++--
kernel/smp.c | 2
kernel/sys.c | 2
kernel/user_namespace.c | 2
lib/Kconfig.debug | 7
lib/Kconfig.ubsan | 14
lib/Makefile | 1
lib/bitmap.c | 2
lib/crc32.c | 2
lib/decompress_bunzip2.c | 2
lib/dynamic_queue_limits.c | 4
lib/earlycpio.c | 2
lib/fault-inject-usercopy.c | 39 ++
lib/find_bit.c | 1
lib/hexdump.c | 1
lib/idr.c | 9
lib/iov_iter.c | 5
lib/libcrc32c.c | 2
lib/math/rational.c | 2
lib/math/reciprocal_div.c | 1
lib/mpi/mpi-bit.c | 2
lib/percpu_counter.c | 2
lib/radix-tree.c | 2
lib/scatterlist.c | 2
lib/strncpy_from_user.c | 3
lib/syscall.c | 2
lib/test_hmm.c | 2
lib/test_sysctl.c | 2
lib/test_xarray.c | 65 ++++
lib/usercopy.c | 5
lib/xarray.c | 208 ++++++++++++
mm/Kconfig | 2
mm/compaction.c | 6
mm/debug_vm_pgtable.c | 267 ++++++++--------
mm/filemap.c | 58 ++-
mm/gup.c | 73 ++--
mm/highmem.c | 4
mm/huge_memory.c | 47 +-
mm/hwpoison-inject.c | 18 -
mm/internal.h | 47 +-
mm/khugepaged.c | 2
mm/madvise.c | 52 ---
mm/memory-failure.c | 357 ++++++++++------------
mm/memory.c | 7
mm/memory_hotplug.c | 223 +++++--------
mm/memremap.c | 3
mm/migrate.c | 11
mm/mmap.c | 7
mm/mmu_notifier.c | 2
mm/page-writeback.c | 1
mm/page_alloc.c | 289 +++++++++++------
mm/page_isolation.c | 16
mm/page_owner.c | 10
mm/page_poison.c | 20 -
mm/page_reporting.c | 4
mm/readahead.c | 174 ++++------
mm/rmap.c | 10
mm/shmem.c | 2
mm/shuffle.c | 2
mm/slab.c | 2
mm/slab.h | 1
mm/slub.c | 2
mm/sparse.c | 2
mm/swap_state.c | 2
mm/truncate.c | 6
mm/util.c | 3
mm/vmscan.c | 5
mm/vmstat.c | 8
mm/workingset.c | 2
scripts/Makefile.ubsan | 10
scripts/checkpatch.pl | 238 ++++++++++----
scripts/const_structs.checkpatch | 3
scripts/gdb/linux/proc.py | 15
scripts/gdb/linux/tasks.py | 9
scripts/get_maintainer.pl | 9
tools/testing/selftests/exec/.gitignore | 1
tools/testing/selftests/exec/Makefile | 9
tools/testing/selftests/exec/load_address.c | 68 ++++
161 files changed, 2532 insertions(+), 1864 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-10-16 2:40 incoming Andrew Morton
@ 2020-10-16 3:03 ` Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-10-16 3:03 UTC (permalink / raw)
To: Linus Torvalds, mm-commits, linux-mm
And... I forgot to set in-reply-to :(
Shall resend, omitting linux-mm.
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-10-17 23:13 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-10-17 23:13 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
40 patches, based on 9d9af1007bc08971953ae915d88dc9bb21344b53.
Subsystems affected by this patch series:
ia64
mm/memcg
mm/migration
mm/pagemap
mm/gup
mm/madvise
mm/vmalloc
misc
Subsystem: ia64
Krzysztof Kozlowski <krzk@kernel.org>:
ia64: fix build error with !COREDUMP
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm, memcg: rework remote charging API to support nesting
Patch series "mm: kmem: kernel memory accounting in an interrupt context":
mm: kmem: move memcg_kmem_bypass() calls to get_mem/obj_cgroup_from_current()
mm: kmem: remove redundant checks from get_obj_cgroup_from_current()
mm: kmem: prepare remote memcg charging infra for interrupt contexts
mm: kmem: enable kernel memcg accounting from interrupt contexts
Subsystem: mm/migration
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
mm/memory-failure: remove a wrapper for alloc_migration_target()
mm/memory_hotplug: remove a wrapper for alloc_migration_target()
Miaohe Lin <linmiaohe@huawei.com>:
mm/migrate: avoid possible unnecessary process right check in kernel_move_pages()
Subsystem: mm/pagemap
"Liam R. Howlett" <Liam.Howlett@Oracle.com>:
mm/mmap: add inline vma_next() for readability of mmap code
mm/mmap: add inline munmap_vma_range() for code readability
Subsystem: mm/gup
Jann Horn <jannh@google.com>:
mm/gup_benchmark: take the mmap lock around GUP
binfmt_elf: take the mmap lock around find_extend_vma()
mm/gup: assert that the mmap lock is held in __get_user_pages()
John Hubbard <jhubbard@nvidia.com>:
Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v2:
mm/gup_benchmark: rename to mm/gup_test
selftests/vm: use a common gup_test.h
selftests/vm: rename run_vmtests --> run_vmtests.sh
selftests/vm: minor cleanup: Makefile and gup_test.c
selftests/vm: only some gup_test items are really benchmarks
selftests/vm: gup_test: introduce the dump_pages() sub-test
selftests/vm: run_vmtests.sh: update and clean up gup_test invocation
selftests/vm: hmm-tests: remove the libhugetlbfs dependency
selftests/vm: 10x speedup for hmm-tests
Subsystem: mm/madvise
Minchan Kim <minchan@kernel.org>:
Patch series "introduce memory hinting API for external process", v9:
mm/madvise: pass mm to do_madvise
pid: move pidfd_get_pid() to pid.c
mm/madvise: introduce process_madvise() syscall: an external memory hinting API
Subsystem: mm/vmalloc
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "remove alloc_vm_area", v4:
mm: update the documentation for vfree
Christoph Hellwig <hch@lst.de>:
mm: add a VM_MAP_PUT_PAGES flag for vmap
mm: add a vmap_pfn function
mm: allow a NULL fn callback in apply_to_page_range
zsmalloc: switch from alloc_vm_area to get_vm_area
drm/i915: use vmap in shmem_pin_map
drm/i915: stop using kmap in i915_gem_object_map
drm/i915: use vmap in i915_gem_object_map
xen/xenbus: use apply_to_page_range directly in xenbus_map_ring_pv
x86/xen: open code alloc_vm_area in arch_gnttab_valloc
mm: remove alloc_vm_area
Patch series "two small vmalloc cleanups":
mm: cleanup the gfp_mask handling in __vmalloc_area_node
mm: remove the filename in the top of file comment in vmalloc.c
Subsystem: misc
Tian Tao <tiantao6@hisilicon.com>:
mm: remove duplicate include statement in mmu.c
Documentation/core-api/pin_user_pages.rst | 8
arch/alpha/kernel/syscalls/syscall.tbl | 1
arch/arm/mm/mmu.c | 1
arch/arm/tools/syscall.tbl | 1
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 2
arch/ia64/kernel/Makefile | 2
arch/ia64/kernel/syscalls/syscall.tbl | 1
arch/m68k/kernel/syscalls/syscall.tbl | 1
arch/microblaze/kernel/syscalls/syscall.tbl | 1
arch/mips/kernel/syscalls/syscall_n32.tbl | 1
arch/mips/kernel/syscalls/syscall_n64.tbl | 1
arch/mips/kernel/syscalls/syscall_o32.tbl | 1
arch/parisc/kernel/syscalls/syscall.tbl | 1
arch/powerpc/kernel/syscalls/syscall.tbl | 1
arch/s390/configs/debug_defconfig | 2
arch/s390/configs/defconfig | 2
arch/s390/kernel/syscalls/syscall.tbl | 1
arch/sh/kernel/syscalls/syscall.tbl | 1
arch/sparc/kernel/syscalls/syscall.tbl | 1
arch/x86/entry/syscalls/syscall_32.tbl | 1
arch/x86/entry/syscalls/syscall_64.tbl | 1
arch/x86/xen/grant-table.c | 27 +-
arch/xtensa/kernel/syscalls/syscall.tbl | 1
drivers/gpu/drm/i915/Kconfig | 1
drivers/gpu/drm/i915/gem/i915_gem_pages.c | 136 ++++------
drivers/gpu/drm/i915/gt/shmem_utils.c | 78 +-----
drivers/xen/xenbus/xenbus_client.c | 30 +-
fs/binfmt_elf.c | 3
fs/buffer.c | 6
fs/io_uring.c | 2
fs/notify/fanotify/fanotify.c | 5
fs/notify/inotify/inotify_fsnotify.c | 5
include/linux/memcontrol.h | 12
include/linux/mm.h | 2
include/linux/pid.h | 1
include/linux/sched/mm.h | 43 +--
include/linux/syscalls.h | 2
include/linux/vmalloc.h | 7
include/uapi/asm-generic/unistd.h | 4
kernel/exit.c | 19 -
kernel/pid.c | 19 +
kernel/sys_ni.c | 1
mm/Kconfig | 24 +
mm/Makefile | 2
mm/gup.c | 2
mm/gup_benchmark.c | 225 ------------------
mm/gup_test.c | 295 +++++++++++++++++++++--
mm/gup_test.h | 40 ++-
mm/madvise.c | 125 ++++++++--
mm/memcontrol.c | 83 ++++--
mm/memory-failure.c | 18 -
mm/memory.c | 16 -
mm/memory_hotplug.c | 46 +--
mm/migrate.c | 71 +++--
mm/mmap.c | 74 ++++-
mm/nommu.c | 7
mm/percpu.c | 3
mm/slab.h | 3
mm/vmalloc.c | 147 +++++------
mm/zsmalloc.c | 10
tools/testing/selftests/vm/.gitignore | 3
tools/testing/selftests/vm/Makefile | 40 ++-
tools/testing/selftests/vm/check_config.sh | 31 ++
tools/testing/selftests/vm/config | 2
tools/testing/selftests/vm/gup_benchmark.c | 143 -----------
tools/testing/selftests/vm/gup_test.c | 260 ++++++++++++++++++--
tools/testing/selftests/vm/hmm-tests.c | 12
tools/testing/selftests/vm/run_vmtests | 334 --------------------------
tools/testing/selftests/vm/run_vmtests.sh | 350 +++++++++++++++++++++++++++-
70 files changed, 1580 insertions(+), 1224 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-11-02 1:06 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-11-02 1:06 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
15 patches, based on 3cea11cd5e3b00d91caf0b4730194039b45c5891.
Subsystems affected by this patch series:
mm/memremap
mm/memcg
mm/slab-generic
mm/kasan
mm/mempolicy
signals
lib
mm/pagecache
kthread
mm/oom-kill
mm/pagemap
epoll
core-kernel
Subsystem: mm/memremap
Ralph Campbell <rcampbell@nvidia.com>:
mm/mremap_pages: fix static key devmap_managed_key updates
Subsystem: mm/memcg
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb_cgroup: fix reservation accounting
zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>:
mm: memcontrol: correct the NR_ANON_THPS counter of hierarchical memcg
Roman Gushchin <guro@fb.com>:
mm: memcg: link page counters to root if use_hierarchy is false
Subsystem: mm/slab-generic
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: adopt KUNIT tests to SW_TAGS mode
Subsystem: mm/mempolicy
Shijie Luo <luoshijie1@huawei.com>:
mm: mempolicy: fix potential pte_unmap_unlock pte error
Subsystem: signals
Oleg Nesterov <oleg@redhat.com>:
ptrace: fix task_join_group_stop() for the case when current is traced
Subsystem: lib
Vasily Gorbik <gor@linux.ibm.com>:
lib/crc32test: remove extra local_irq_disable/enable
Subsystem: mm/pagecache
Jason Yan <yanaijie@huawei.com>:
mm/truncate.c: make __invalidate_mapping_pages() static
Subsystem: kthread
Zqiang <qiang.zhang@windriver.com>:
kthread_worker: prevent queuing delayed work from timer_fn when it is being canceled
Subsystem: mm/oom-kill
Charles Haithcock <chaithco@redhat.com>:
mm, oom: keep oom_adj under or at upper limit when printing
Subsystem: mm/pagemap
Jason Gunthorpe <jgg@nvidia.com>:
mm: always have io_remap_pfn_range() set pgprot_decrypted()
Subsystem: epoll
Soheil Hassas Yeganeh <soheil@google.com>:
epoll: check ep_events_available() upon timeout
epoll: add a selftest for epoll timeout race
Subsystem: core-kernel
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
kernel/hung_task.c: make type annotations consistent
fs/eventpoll.c | 16 +
fs/proc/base.c | 2
include/linux/mm.h | 9
include/linux/pgtable.h | 4
kernel/hung_task.c | 3
kernel/kthread.c | 3
kernel/signal.c | 19 -
lib/crc32test.c | 4
lib/test_kasan.c | 149 +++++++---
mm/hugetlb.c | 20 -
mm/memcontrol.c | 25 +
mm/mempolicy.c | 6
mm/memremap.c | 39 +-
mm/truncate.c | 2
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 95 ++++++
15 files changed, 290 insertions(+), 106 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-11-14 6:51 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-11-14 6:51 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
14 patches, based on 9e6a39eae450b81c8b2c8cbbfbdf8218e9b40c81.
Subsystems affected by this patch series:
mm/migration
mm/vmscan
mailmap
mm/slub
mm/gup
kbuild
reboot
kernel/watchdog
mm/memcg
mm/hugetlbfs
panic
ocfs2
Subsystem: mm/migration
Zi Yan <ziy@nvidia.com>:
mm/compaction: count pages and stop correctly during page isolation
mm/compaction: stop isolation if too many pages are isolated and we have pages to migrate
Subsystem: mm/vmscan
Nicholas Piggin <npiggin@gmail.com>:
mm/vmscan: fix NR_ISOLATED_FILE corruption on 64-bit
Subsystem: mailmap
Dmitry Baryshkov <dbaryshkov@gmail.com>:
mailmap: fix entry for Dmitry Baryshkov/Eremin-Solenikov
Subsystem: mm/slub
Laurent Dufour <ldufour@linux.ibm.com>:
mm/slub: fix panic in slab_alloc_node()
Subsystem: mm/gup
Jason Gunthorpe <jgg@nvidia.com>:
mm/gup: use unpin_user_pages() in __gup_longterm_locked()
Subsystem: kbuild
Arvind Sankar <nivedita@alum.mit.edu>:
compiler.h: fix barrier_data() on clang
Subsystem: reboot
Matteo Croce <mcroce@microsoft.com>:
Patch series "fix parsing of reboot= cmdline", v3:
Revert "kernel/reboot.c: convert simple_strtoul to kstrtoint"
reboot: fix overflow parsing reboot cpu number
Subsystem: kernel/watchdog
Santosh Sivaraj <santosh@fossix.org>:
kernel/watchdog: fix watchdog_allowed_mask not used warning
Subsystem: mm/memcg
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: fix missing wakeup polling thread
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlbfs: fix anon huge page migration race
Subsystem: panic
Christophe Leroy <christophe.leroy@csgroup.eu>:
panic: don't dump stack twice on warn
Subsystem: ocfs2
Wengang Wang <wen.gang.wang@oracle.com>:
ocfs2: initialize ip_next_orphan
.mailmap | 5 +-
fs/ocfs2/super.c | 1
include/asm-generic/barrier.h | 1
include/linux/compiler-clang.h | 6 --
include/linux/compiler-gcc.h | 19 --------
include/linux/compiler.h | 18 +++++++-
include/linux/memcontrol.h | 11 ++++-
kernel/panic.c | 3 -
kernel/reboot.c | 28 ++++++------
kernel/watchdog.c | 4 -
mm/compaction.c | 12 +++--
mm/gup.c | 14 ++++--
mm/hugetlb.c | 90 ++---------------------------------------
mm/memory-failure.c | 36 +++++++---------
mm/migrate.c | 46 +++++++++++---------
mm/rmap.c | 5 --
mm/slub.c | 2
mm/vmscan.c | 5 +-
18 files changed, 119 insertions(+), 187 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-11-22 6:16 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-11-22 6:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
8 patches, based on a349e4c659609fd20e4beea89e5c4a4038e33a95.
Subsystems affected by this patch series:
mm/madvise
kbuild
mm/pagemap
mm/readahead
mm/memcg
mm/userfaultfd
vfs-akpm
mm/madvise
Subsystem: mm/madvise
Eric Dumazet <edumazet@google.com>:
mm/madvise: fix memory leak from process_madvise
Subsystem: kbuild
Nick Desaulniers <ndesaulniers@google.com>:
compiler-clang: remove version check for BPF Tracing
Subsystem: mm/pagemap
Dan Williams <dan.j.williams@intel.com>:
mm: fix phys_to_target_node() and memory_add_physaddr_to_nid() exports
Subsystem: mm/readahead
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: fix readahead_page_batch for retry entries
Subsystem: mm/memcg
Muchun Song <songmuchun@bytedance.com>:
mm: memcg/slab: fix root memcg vmstats
Subsystem: mm/userfaultfd
Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
mm/userfaultfd: do not access vma->vm_mm after calling handle_userfault()
Subsystem: vfs-akpm
Yicong Yang <yangyicong@hisilicon.com>:
libfs: fix error cast of negative value in simple_attr_write()
Subsystem: mm/madvise
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: fix madvise WILLNEED performance problem
arch/ia64/include/asm/sparsemem.h | 6 ++++++
arch/powerpc/include/asm/mmzone.h | 5 +++++
arch/powerpc/include/asm/sparsemem.h | 5 ++---
arch/powerpc/mm/mem.c | 1 +
arch/x86/include/asm/sparsemem.h | 10 ++++++++++
arch/x86/mm/numa.c | 2 ++
drivers/dax/Kconfig | 1 -
fs/libfs.c | 6 ++++--
include/linux/compiler-clang.h | 2 ++
include/linux/memory_hotplug.h | 14 --------------
include/linux/numa.h | 30 +++++++++++++++++++++++++++++-
include/linux/pagemap.h | 2 ++
mm/huge_memory.c | 9 ++++-----
mm/madvise.c | 4 +---
mm/memcontrol.c | 9 +++++++--
mm/memory_hotplug.c | 18 ------------------
16 files changed, 75 insertions(+), 49 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-12-06 6:14 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-12-06 6:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
12 patches, based on 33256ce194110874d4bc90078b577c59f9076c59.
Subsystems affected by this patch series:
lib
coredump
mm/memcg
mm/zsmalloc
mm/swap
mailmap
mm/selftests
mm/pagecache
mm/hugetlb
mm/pagemap
Subsystem: lib
Randy Dunlap <rdunlap@infradead.org>:
zlib: export S390 symbols for zlib modules
Subsystem: coredump
Menglong Dong <dong.menglong@zte.com.cn>:
coredump: fix core_pattern parse error
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: fix obj_cgroup_charge() return value handling
Yang Shi <shy828301@gmail.com>:
mm: list_lru: set shrinker map bit when child nr_items is not zero
Subsystem: mm/zsmalloc
Minchan Kim <minchan@kernel.org>:
mm/zsmalloc.c: drop ZSMALLOC_PGTABLE_MAPPING
Subsystem: mm/swap
Qian Cai <qcai@redhat.com>:
mm/swapfile: do not sleep with a spin lock held
Subsystem: mailmap
Uwe Kleine-König <u.kleine-koenig@pengutronix.de>:
mailmap: add two more addresses of Uwe Kleine-König
Subsystem: mm/selftests
Xingxing Su <suxingxing@loongson.cn>:
tools/testing/selftests/vm: fix build error
Axel Rasmussen <axelrasmussen@google.com>:
userfaultfd: selftests: fix SIGSEGV if huge mmap fails
Subsystem: mm/pagecache
Alex Shi <alex.shi@linux.alibaba.com>:
mm/filemap: add static for function __add_to_page_cache_locked
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb_cgroup: fix offline of hugetlb cgroup with reservations
Subsystem: mm/pagemap
Liu Zixian <liuzixian4@huawei.com>:
mm/mmap.c: fix mmap return value when vma is merged after call_mmap()
.mailmap | 2 +
arch/arm/configs/omap2plus_defconfig | 1
fs/coredump.c | 3 +
include/linux/zsmalloc.h | 1
lib/zlib_dfltcc/dfltcc_inflate.c | 3 +
mm/Kconfig | 13 -------
mm/filemap.c | 2 -
mm/hugetlb_cgroup.c | 8 +---
mm/list_lru.c | 10 ++---
mm/mmap.c | 26 ++++++--------
mm/slab.h | 40 +++++++++++++---------
mm/swapfile.c | 4 +-
mm/zsmalloc.c | 54 -------------------------------
tools/testing/selftests/vm/Makefile | 4 ++
tools/testing/selftests/vm/userfaultfd.c | 25 +++++++++-----
15 files changed, 75 insertions(+), 121 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-12-11 21:35 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-12-11 21:35 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
8 patches, based on 33dc9614dc208291d0c4bcdeb5d30d481dcd2c4c.
Subsystems affected by this patch series:
mm/pagecache
proc
selftests
kbuild
mm/kasan
mm/hugetlb
Subsystem: mm/pagecache
Andrew Morton <akpm@linux-foundation.org>:
revert "mm/filemap: add static for function __add_to_page_cache_locked"
Subsystem: proc
Miles Chen <miles.chen@mediatek.com>:
proc: use untagged_addr() for pagemap_read addresses
Subsystem: selftests
Arnd Bergmann <arnd@arndb.de>:
selftest/fpu: avoid clang warning
Subsystem: kbuild
Arnd Bergmann <arnd@arndb.de>:
kbuild: avoid static_assert for genksyms
initramfs: fix clang build failure
elfcore: fix building with clang
Subsystem: mm/kasan
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
kasan: fix object remaining in offline per-cpu quarantine
Subsystem: mm/hugetlb
Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
mm/hugetlb: clear compound_nr before freeing gigantic pages
fs/proc/task_mmu.c | 8 ++++++--
include/linux/build_bug.h | 5 +++++
include/linux/elfcore.h | 22 ++++++++++++++++++++++
init/initramfs.c | 2 +-
kernel/Makefile | 1 -
kernel/elfcore.c | 26 --------------------------
lib/Makefile | 3 ++-
mm/filemap.c | 2 +-
mm/hugetlb.c | 1 +
mm/kasan/quarantine.c | 39 +++++++++++++++++++++++++++++++++++++++
10 files changed, 77 insertions(+), 32 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-12-15 3:02 Andrew Morton
2020-12-15 3:25 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2020-12-15 3:02 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- a few random little subsystems
- almost all of the MM patches which are staged ahead of linux-next
material. I'll trickle to post-linux-next work in as the dependents
get merged up.
200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442.
Subsystems affected by this patch series:
kthread
kbuild
ide
ntfs
ocfs2
arch
mm/slab-generic
mm/slab
mm/slub
mm/dax
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/shmem
mm/memcg
mm/pagemap
mm/mremap
mm/hmm
mm/vmalloc
mm/documentation
mm/kasan
mm/pagealloc
mm/memory-failure
mm/hugetlb
mm/vmscan
mm/z3fold
mm/compaction
mm/oom-kill
mm/migration
mm/cma
mm/page-poison
mm/userfaultfd
mm/zswap
mm/zsmalloc
mm/uaccess
mm/zram
mm/cleanups
Subsystem: kthread
Rob Clark <robdclark@chromium.org>:
kthread: add kthread_work tracepoints
Petr Mladek <pmladek@suse.com>:
kthread_worker: document CPU hotplug handling
Subsystem: kbuild
Petr Vorel <petr.vorel@gmail.com>:
uapi: move constants from <linux/kernel.h> to <linux/const.h>
Subsystem: ide
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
ide/falcon: remove in_interrupt() usage
ide: remove BUG_ON(in_interrupt() || irqs_disabled()) from ide_unregister()
Subsystem: ntfs
Alex Shi <alex.shi@linux.alibaba.com>:
fs/ntfs: remove unused varibles
fs/ntfs: remove unused variable attr_len
Subsystem: ocfs2
Tom Rix <trix@redhat.com>:
fs/ocfs2/cluster/tcp.c: remove unneeded break
Mauricio Faria de Oliveira <mfo@canonical.com>:
ocfs2: ratelimit the 'max lookup times reached' notice
Subsystem: arch
Colin Ian King <colin.king@canonical.com>:
arch/Kconfig: fix spelling mistakes
Subsystem: mm/slab-generic
Hui Su <sh_def@163.com>:
mm/slab_common.c: use list_for_each_entry in dump_unreclaimable_slab()
Bartosz Golaszewski <bgolaszewski@baylibre.com>:
Patch series "slab: provide and use krealloc_array()", v3:
mm: slab: clarify krealloc()'s behavior with __GFP_ZERO
mm: slab: provide krealloc_array()
ALSA: pcm: use krealloc_array()
vhost: vringh: use krealloc_array()
pinctrl: use krealloc_array()
edac: ghes: use krealloc_array()
drm: atomic: use krealloc_array()
hwtracing: intel: use krealloc_array()
dma-buf: use krealloc_array()
Vlastimil Babka <vbabka@suse.cz>:
mm, slab, slub: clear the slab_cache field when freeing page
Subsystem: mm/slab
Alexander Popov <alex.popov@linux.com>:
mm/slab: rerform init_on_free earlier
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: use kmem_cache_debug_flags() in deactivate_slab()
Bharata B Rao <bharata@linux.ibm.com>:
mm/slub: let number of online CPUs determine the slub page order
Subsystem: mm/dax
Dan Williams <dan.j.williams@intel.com>:
device-dax/kmem: use struct_size()
Subsystem: mm/debug
Zhenhua Huang <zhenhuah@codeaurora.org>:
mm: fix page_owner initializing issue for arm32
Liam Mark <lmark@codeaurora.org>:
mm/page_owner: record timestamp and pid
Subsystem: mm/pagecache
Kent Overstreet <kent.overstreet@gmail.com>:
Patch series "generic_file_buffered_read() improvements", v2:
mm/filemap/c: break generic_file_buffered_read up into multiple functions
mm/filemap.c: generic_file_buffered_read() now uses find_get_pages_contig
Alex Shi <alex.shi@linux.alibaba.com>:
mm/truncate: add parameter explanation for invalidate_mapping_pagevec
Hailong Liu <carver4lio@163.com>:
mm/filemap.c: remove else after a return
Subsystem: mm/gup
John Hubbard <jhubbard@nvidia.com>:
Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v3:
mm/gup_benchmark: rename to mm/gup_test
selftests/vm: use a common gup_test.h
selftests/vm: rename run_vmtests --> run_vmtests.sh
selftests/vm: minor cleanup: Makefile and gup_test.c
selftests/vm: only some gup_test items are really benchmarks
selftests/vm: gup_test: introduce the dump_pages() sub-test
selftests/vm: run_vmtests.sh: update and clean up gup_test invocation
selftests/vm: hmm-tests: remove the libhugetlbfs dependency
selftests/vm: 2x speedup for run_vmtests.sh
Barry Song <song.bao.hua@hisilicon.com>:
mm/gup_test.c: mark gup_test_init as __init function
mm/gup_test: GUP_TEST depends on DEBUG_FS
Jason Gunthorpe <jgg@nvidia.com>:
Patch series "Add a seqcount between gup_fast and copy_page_range()", v4:
mm/gup: reorganize internal_get_user_pages_fast()
mm/gup: prevent gup_fast from racing with COW during fork
mm/gup: remove the vma allocation from gup_longterm_locked()
mm/gup: combine put_compound_head() and unpin_user_page()
Subsystem: mm/swap
Ralph Campbell <rcampbell@nvidia.com>:
mm: handle zone device pages in release_pages()
Miaohe Lin <linmiaohe@huawei.com>:
mm/swapfile.c: use helper function swap_count() in add_swap_count_continuation()
mm/swap_state: skip meaningless swap cache readahead when ra_info.win == 0
mm/swapfile.c: remove unnecessary out label in __swap_duplicate()
mm/swapfile.c: use memset to fill the swap_map with SWAP_HAS_CACHE
Jeff Layton <jlayton@kernel.org>:
mm: remove pagevec_lookup_range_nr_tag()
Subsystem: mm/shmem
Hui Su <sh_def@163.com>:
mm/shmem.c: make shmem_mapping() inline
Randy Dunlap <rdunlap@infradead.org>:
tmpfs: fix Documentation nits
Subsystem: mm/memcg
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: add file_thp, shmem_thp to memory.stat
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: remove unused mod_memcg_obj_state()
Miaohe Lin <linmiaohe@huawei.com>:
mm: memcontrol: eliminate redundant check in __mem_cgroup_insert_exceeded()
Muchun Song <songmuchun@bytedance.com>:
mm: memcg/slab: fix return of child memcg objcg for root memcg
mm: memcg/slab: fix use after free in obj_cgroup_charge
Shakeel Butt <shakeelb@google.com>:
mm/rmap: always do TTU_IGNORE_ACCESS
Alex Shi <alex.shi@linux.alibaba.com>:
mm/memcg: update page struct member in comments
Roman Gushchin <guro@fb.com>:
mm: memcg: fix obsolete code comments
Patch series "mm: memcg: deprecate cgroup v1 non-hierarchical mode", v1:
mm: memcg: deprecate the non-hierarchical mode
docs: cgroup-v1: reflect the deprecation of the non-hierarchical mode
cgroup: remove obsoleted broken_hierarchy and warned_broken_hierarchy
Hui Su <sh_def@163.com>:
mm/page_counter: use page_counter_read in page_counter_set_max
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
mm: memcg: remove obsolete memcg_has_children()
Muchun Song <songmuchun@bytedance.com>:
mm: memcg/slab: rename *_lruvec_slab_state to *_lruvec_kmem_state
Kaixu Xia <kaixuxia@tencent.com>:
mm: memcontrol: sssign boolean values to a bool variable
Alex Shi <alex.shi@linux.alibaba.com>:
mm/memcg: remove incorrect comment
Shakeel Butt <shakeelb@google.com>:
Patch series "memcg: add pagetable comsumption to memory.stat", v2:
mm: move lruvec stats update functions to vmstat.h
mm: memcontrol: account pagetables per node
Subsystem: mm/pagemap
Dan Williams <dan.j.williams@intel.com>:
xen/unpopulated-alloc: consolidate pgmap manipulation
Kalesh Singh <kaleshsingh@google.com>:
Patch series "Speed up mremap on large regions", v4:
kselftests: vm: add mremap tests
mm: speedup mremap on 1GB or larger regions
arm64: mremap speedup - enable HAVE_MOVE_PUD
x86: mremap speedup - Enable HAVE_MOVE_PUD
John Hubbard <jhubbard@nvidia.com>:
mm: cleanup: remove unused tsk arg from __access_remote_vm
Alex Shi <alex.shi@linux.alibaba.com>:
mm/mapping_dirty_helpers: enhance the kernel-doc markups
mm/page_vma_mapped.c: add colon to fix kernel-doc markups error for check_pte
Axel Rasmussen <axelrasmussen@google.com>:
mm: mmap_lock: add tracepoints around lock acquisition
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
sparc: fix handling of page table constructor failure
mm: move free_unref_page to mm/internal.h
Subsystem: mm/mremap
Dmitry Safonov <dima@arista.com>:
Patch series "mremap: move_vma() fixes":
mm/mremap: account memory on do_munmap() failure
mm/mremap: for MREMAP_DONTUNMAP check security_vm_enough_memory_mm()
mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio
vm_ops: rename .split() callback to .may_split()
mremap: check if it's possible to split original vma
mm: forbid splitting special mappings
Subsystem: mm/hmm
Daniel Vetter <daniel.vetter@ffwll.ch>:
mm: track mmu notifiers in fs_reclaim_acquire/release
mm: extract might_alloc() debug check
locking/selftests: add testcases for fs_reclaim
Subsystem: mm/vmalloc
Andrew Morton <akpm@linux-foundation.org>:
mm/vmalloc.c:__vmalloc_area_node(): avoid 32-bit overflow
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: use free_vm_area() if an allocation fails
mm/vmalloc: rework the drain logic
Alex Shi <alex.shi@linux.alibaba.com>:
mm/vmalloc: add 'align' parameter explanation for pvm_determine_end_from_reverse
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm/vmalloc.c: remove unnecessary return statement
Waiman Long <longman@redhat.com>:
mm/vmalloc: Fix unlock order in s_stop()
Subsystem: mm/documentation
Alex Shi <alex.shi@linux.alibaba.com>:
docs/vm: remove unused 3 items explanation for /proc/vmstat
Subsystem: mm/kasan
Vincenzo Frascino <vincenzo.frascino@arm.com>:
mm/vmalloc.c: fix kasan shadow poisoning size
Walter Wu <walter-zh.wu@mediatek.com>:
Patch series "kasan: add workqueue stack for generic KASAN", v5:
workqueue: kasan: record workqueue stack
kasan: print workqueue stack
lib/test_kasan.c: add workqueue test case
kasan: update documentation for generic kasan
Marco Elver <elver@google.com>:
lkdtm: disable KASAN for rodata.o
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "arch, mm: deprecate DISCONTIGMEM", v2:
alpha: switch from DISCONTIGMEM to SPARSEMEM
ia64: remove custom __early_pfn_to_nid()
ia64: remove 'ifdef CONFIG_ZONE_DMA32' statements
ia64: discontig: paging_init(): remove local max_pfn calculation
ia64: split virtual map initialization out of paging_init()
ia64: forbid using VIRTUAL_MEM_MAP with FLATMEM
ia64: make SPARSEMEM default and disable DISCONTIGMEM
arm: remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL
arm, arm64: move free_unused_memmap() to generic mm
arc: use FLATMEM with freeing of unused memory map instead of DISCONTIGMEM
m68k/mm: make node data and node setup depend on CONFIG_DISCONTIGMEM
m68k/mm: enable use of generic memory_model.h for !DISCONTIGMEM
m68k: deprecate DISCONTIGMEM
Patch series "arch, mm: improve robustness of direct map manipulation", v7:
mm: introduce debug_pagealloc_{map,unmap}_pages() helpers
PM: hibernate: make direct map manipulations more explicit
arch, mm: restore dependency of __kernel_map_pages() on DEBUG_PAGEALLOC
arch, mm: make kernel_page_present() always available
Vlastimil Babka <vbabka@suse.cz>:
Patch series "disable pcplists during memory offline", v3:
mm, page_alloc: clean up pageset high and batch update
mm, page_alloc: calculate pageset high and batch once per zone
mm, page_alloc: remove setup_pageset()
mm, page_alloc: simplify pageset_update()
mm, page_alloc: cache pageset high and batch in struct zone
mm, page_alloc: move draining pcplists to page isolation users
mm, page_alloc: disable pcplists during memory offline
Miaohe Lin <linmiaohe@huawei.com>:
include/linux/page-flags.h: remove unused __[Set|Clear]PagePrivate
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/page-flags: fix comment
mm/page_alloc: add __free_pages() documentation
Zou Wei <zou_wei@huawei.com>:
mm/page_alloc: mark some symbols with static keyword
David Hildenbrand <david@redhat.com>:
mm/page_alloc: clear all pages in post_alloc_hook() with init_on_alloc=1
Lin Feng <linf@wangsu.com>:
init/main: fix broken buffer_init when DEFERRED_STRUCT_PAGE_INIT set
Lorenzo Stoakes <lstoakes@gmail.com>:
mm: page_alloc: refactor setup_per_zone_lowmem_reserve()
Muchun Song <songmuchun@bytedance.com>:
mm/page_alloc: speed up the iteration of max_order
Subsystem: mm/memory-failure
Oscar Salvador <osalvador@suse.de>:
Patch series "HWpoison: further fixes and cleanups", v5:
mm,hwpoison: drain pcplists before bailing out for non-buddy zero-refcount page
mm,hwpoison: take free pages off the buddy freelists
mm,hwpoison: drop unneeded pcplist draining
Patch series "HWPoison: Refactor get page interface", v2:
mm,hwpoison: refactor get_any_page
mm,hwpoison: disable pcplists before grabbing a refcount
mm,hwpoison: remove drain_all_pages from shake_page
mm,memory_failure: always pin the page in madvise_inject_error
mm,hwpoison: return -EBUSY when migration fails
Subsystem: mm/hugetlb
Hui Su <sh_def@163.com>:
mm/hugetlb.c: just use put_page_testzero() instead of page_count()
Ralph Campbell <rcampbell@nvidia.com>:
include/linux/huge_mm.h: remove extern keyword
Alex Shi <alex.shi@linux.alibaba.com>:
khugepaged: add parameter explanations for kernel-doc markup
Liu Xiang <liu.xiang@zlingsmart.com>:
mm: hugetlb: fix type of delta parameter and related local variables in gather_surplus_pages()
Oscar Salvador <osalvador@suse.de>:
mm,hugetlb: remove unneeded initialization
Dan Carpenter <dan.carpenter@oracle.com>:
hugetlb: fix an error code in hugetlb_reserve_pages()
Subsystem: mm/vmscan
Johannes Weiner <hannes@cmpxchg.org>:
mm: don't wake kswapd prematurely when watermark boosting is disabled
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
mm/vmscan: drop unneeded assignment in kswapd()
"logic.yu" <hymmsx.yu@gmail.com>:
mm/vmscan.c: remove the filename in the top of file comment
Muchun Song <songmuchun@bytedance.com>:
mm/page_isolation: do not isolate the max order page
Subsystem: mm/z3fold
Vitaly Wool <vitaly.wool@konsulko.com>:
Patch series "z3fold: stability / rt fixes":
z3fold: simplify freeing slots
z3fold: stricter locking and more careful reclaim
z3fold: remove preempt disabled sections for RT
Subsystem: mm/compaction
Yanfei Xu <yanfei.xu@windriver.com>:
mm/compaction: rename 'start_pfn' to 'iteration_start_pfn' in compact_zone()
Hui Su <sh_def@163.com>:
mm/compaction: move compaction_suitable's comment to right place
mm/compaction: make defer_compaction and compaction_deferred static
Subsystem: mm/oom-kill
Hui Su <sh_def@163.com>:
mm/oom_kill: change comment and rename is_dump_unreclaim_slabs()
Subsystem: mm/migration
Long Li <lonuxli.64@gmail.com>:
mm/migrate.c: fix comment spelling
Ralph Campbell <rcampbell@nvidia.com>:
mm/migrate.c: optimize migrate_vma_pages() mmu notifier
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: support THPs in zero_user_segments
Yang Shi <shy828301@gmail.com>:
Patch series "mm: misc migrate cleanup and improvement", v3:
mm: truncate_complete_page() does not exist any more
mm: migrate: simplify the logic for handling permanent failure
mm: migrate: skip shared exec THP for NUMA balancing
mm: migrate: clean up migrate_prep{_local}
mm: migrate: return -ENOSYS if THP migration is unsupported
Stephen Zhang <starzhangzsd@gmail.com>:
mm: migrate: remove unused parameter in migrate_vma_insert_page()
Subsystem: mm/cma
Lecopzer Chen <lecopzer.chen@mediatek.com>:
mm/cma.c: remove redundant cma_mutex lock
Charan Teja Reddy <charante@codeaurora.org>:
mm: cma: improve pr_debug log in cma_release()
Subsystem: mm/page-poison
Vlastimil Babka <vbabka@suse.cz>:
Patch series "cleanup page poisoning", v3:
mm, page_alloc: do not rely on the order of page_poison and init_on_alloc/free parameters
mm, page_poison: use static key more efficiently
kernel/power: allow hibernation with page_poison sanity checking
mm, page_poison: remove CONFIG_PAGE_POISONING_NO_SANITY
mm, page_poison: remove CONFIG_PAGE_POISONING_ZERO
Subsystem: mm/userfaultfd
Lokesh Gidra <lokeshgidra@google.com>:
Patch series "Control over userfaultfd kernel-fault handling", v6:
userfaultfd: add UFFD_USER_MODE_ONLY
userfaultfd: add user-mode only option to unprivileged_userfaultfd sysctl knob
Axel Rasmussen <axelrasmussen@google.com>:
userfaultfd: selftests: make __{s,u}64 format specifiers portable
Peter Xu <peterx@redhat.com>:
Patch series "userfaultfd: selftests: Small fixes":
userfaultfd/selftests: always dump something in modes
userfaultfd/selftests: fix retval check for userfaultfd_open()
userfaultfd/selftests: hint the test runner on required privilege
Subsystem: mm/zswap
Joe Perches <joe@perches.com>:
mm/zswap: make struct kernel_param_ops definitions const
YueHaibing <yuehaibing@huawei.com>:
mm/zswap: fix passing zero to 'PTR_ERR' warning
Barry Song <song.bao.hua@hisilicon.com>:
mm/zswap: move to use crypto_acomp API for hardware acceleration
Subsystem: mm/zsmalloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/zsmalloc.c: rework the list_add code in insert_zspage()
Subsystem: mm/uaccess
Colin Ian King <colin.king@canonical.com>:
mm/process_vm_access: remove redundant initialization of iov_r
Subsystem: mm/zram
Minchan Kim <minchan@kernel.org>:
zram: support page writeback
zram: add stat to gather incompressible pages since zram set up
Rui Salvaterra <rsalvaterra@gmail.com>:
zram: break the strict dependency from lzo
Subsystem: mm/cleanups
Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
mm: fix kernel-doc markups
Joe Perches <joe@perches.com>:
Patch series "mm: Convert sysfs sprintf family to sysfs_emit", v2:
mm: use sysfs_emit for struct kobject * uses
mm: huge_memory: convert remaining use of sprintf to sysfs_emit and neatening
mm:backing-dev: use sysfs_emit in macro defining functions
mm: shmem: convert shmem_enabled_show to use sysfs_emit_at
mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
mm: fix fall-through warnings for Clang
Alexey Dobriyan <adobriyan@gmail.com>:
mm: cleanup kstrto*() usage
/mmap_lock.h | 107 ++
a/Documentation/admin-guide/blockdev/zram.rst | 6
a/Documentation/admin-guide/cgroup-v1/memcg_test.rst | 8
a/Documentation/admin-guide/cgroup-v1/memory.rst | 42
a/Documentation/admin-guide/cgroup-v2.rst | 11
a/Documentation/admin-guide/mm/transhuge.rst | 15
a/Documentation/admin-guide/sysctl/vm.rst | 15
a/Documentation/core-api/memory-allocation.rst | 4
a/Documentation/core-api/pin_user_pages.rst | 8
a/Documentation/dev-tools/kasan.rst | 5
a/Documentation/filesystems/tmpfs.rst | 8
a/Documentation/vm/memory-model.rst | 3
a/Documentation/vm/page_owner.rst | 12
a/arch/Kconfig | 21
a/arch/alpha/Kconfig | 8
a/arch/alpha/include/asm/mmzone.h | 14
a/arch/alpha/include/asm/page.h | 7
a/arch/alpha/include/asm/pgtable.h | 12
a/arch/alpha/include/asm/sparsemem.h | 18
a/arch/alpha/kernel/setup.c | 1
a/arch/arc/Kconfig | 3
a/arch/arc/include/asm/page.h | 20
a/arch/arc/mm/init.c | 29
a/arch/arm/Kconfig | 12
a/arch/arm/kernel/vdso.c | 9
a/arch/arm/mach-bcm/Kconfig | 1
a/arch/arm/mach-davinci/Kconfig | 1
a/arch/arm/mach-exynos/Kconfig | 1
a/arch/arm/mach-highbank/Kconfig | 1
a/arch/arm/mach-omap2/Kconfig | 1
a/arch/arm/mach-s5pv210/Kconfig | 1
a/arch/arm/mach-tango/Kconfig | 1
a/arch/arm/mm/init.c | 78 -
a/arch/arm64/Kconfig | 9
a/arch/arm64/include/asm/cacheflush.h | 1
a/arch/arm64/include/asm/pgtable.h | 1
a/arch/arm64/kernel/vdso.c | 41
a/arch/arm64/mm/init.c | 68 -
a/arch/arm64/mm/pageattr.c | 12
a/arch/ia64/Kconfig | 11
a/arch/ia64/include/asm/meminit.h | 2
a/arch/ia64/mm/contig.c | 88 --
a/arch/ia64/mm/discontig.c | 44 -
a/arch/ia64/mm/init.c | 14
a/arch/ia64/mm/numa.c | 30
a/arch/m68k/Kconfig.cpu | 31
a/arch/m68k/include/asm/page.h | 2
a/arch/m68k/include/asm/page_mm.h | 7
a/arch/m68k/include/asm/virtconvert.h | 7
a/arch/m68k/mm/init.c | 10
a/arch/mips/vdso/genvdso.c | 4
a/arch/nds32/mm/mm-nds32.c | 6
a/arch/powerpc/Kconfig | 5
a/arch/riscv/Kconfig | 4
a/arch/riscv/include/asm/pgtable.h | 2
a/arch/riscv/include/asm/set_memory.h | 1
a/arch/riscv/mm/pageattr.c | 31
a/arch/s390/Kconfig | 4
a/arch/s390/configs/debug_defconfig | 2
a/arch/s390/configs/defconfig | 2
a/arch/s390/kernel/vdso.c | 11
a/arch/sparc/Kconfig | 4
a/arch/sparc/mm/init_64.c | 2
a/arch/x86/Kconfig | 5
a/arch/x86/entry/vdso/vma.c | 17
a/arch/x86/include/asm/set_memory.h | 1
a/arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 2
a/arch/x86/kernel/tboot.c | 1
a/arch/x86/mm/pat/set_memory.c | 6
a/drivers/base/node.c | 2
a/drivers/block/zram/Kconfig | 42
a/drivers/block/zram/zcomp.c | 2
a/drivers/block/zram/zram_drv.c | 29
a/drivers/block/zram/zram_drv.h | 1
a/drivers/dax/device.c | 4
a/drivers/dax/kmem.c | 2
a/drivers/dma-buf/sync_file.c | 3
a/drivers/edac/ghes_edac.c | 4
a/drivers/firmware/efi/efi.c | 1
a/drivers/gpu/drm/drm_atomic.c | 3
a/drivers/hwtracing/intel_th/msu.c | 2
a/drivers/ide/falconide.c | 2
a/drivers/ide/ide-probe.c | 3
a/drivers/misc/lkdtm/Makefile | 1
a/drivers/pinctrl/pinctrl-utils.c | 2
a/drivers/vhost/vringh.c | 3
a/drivers/virtio/virtio_balloon.c | 6
a/drivers/xen/unpopulated-alloc.c | 14
a/fs/aio.c | 5
a/fs/ntfs/file.c | 5
a/fs/ntfs/inode.c | 2
a/fs/ntfs/logfile.c | 3
a/fs/ocfs2/cluster/tcp.c | 1
a/fs/ocfs2/namei.c | 4
a/fs/proc/kcore.c | 2
a/fs/proc/meminfo.c | 2
a/fs/userfaultfd.c | 20
a/include/linux/cgroup-defs.h | 15
a/include/linux/compaction.h | 12
a/include/linux/fs.h | 2
a/include/linux/gfp.h | 2
a/include/linux/highmem.h | 19
a/include/linux/huge_mm.h | 93 --
a/include/linux/memcontrol.h | 148 ---
a/include/linux/migrate.h | 4
a/include/linux/mm.h | 118 +-
a/include/linux/mm_types.h | 8
a/include/linux/mmap_lock.h | 94 ++
a/include/linux/mmzone.h | 50 -
a/include/linux/page-flags.h | 6
a/include/linux/page_ext.h | 8
a/include/linux/pagevec.h | 3
a/include/linux/poison.h | 4
a/include/linux/rmap.h | 1
a/include/linux/sched/mm.h | 16
a/include/linux/set_memory.h | 5
a/include/linux/shmem_fs.h | 6
a/include/linux/slab.h | 18
a/include/linux/vmalloc.h | 8
a/include/linux/vmstat.h | 104 ++
a/include/trace/events/sched.h | 84 +
a/include/uapi/linux/const.h | 5
a/include/uapi/linux/ethtool.h | 2
a/include/uapi/linux/kernel.h | 9
a/include/uapi/linux/lightnvm.h | 2
a/include/uapi/linux/mroute6.h | 2
a/include/uapi/linux/netfilter/x_tables.h | 2
a/include/uapi/linux/netlink.h | 2
a/include/uapi/linux/sysctl.h | 2
a/include/uapi/linux/userfaultfd.h | 9
a/init/main.c | 6
a/ipc/shm.c | 8
a/kernel/cgroup/cgroup.c | 12
a/kernel/fork.c | 3
a/kernel/kthread.c | 29
a/kernel/power/hibernate.c | 2
a/kernel/power/power.h | 2
a/kernel/power/snapshot.c | 52 +
a/kernel/ptrace.c | 2
a/kernel/workqueue.c | 3
a/lib/locking-selftest.c | 47 +
a/lib/test_kasan_module.c | 29
a/mm/Kconfig | 25
a/mm/Kconfig.debug | 28
a/mm/Makefile | 4
a/mm/backing-dev.c | 8
a/mm/cma.c | 6
a/mm/compaction.c | 29
a/mm/filemap.c | 823 ++++++++++---------
a/mm/gup.c | 329 ++-----
a/mm/gup_benchmark.c | 210 ----
a/mm/gup_test.c | 299 ++++++
a/mm/gup_test.h | 40
a/mm/highmem.c | 52 +
a/mm/huge_memory.c | 86 +
a/mm/hugetlb.c | 28
a/mm/init-mm.c | 1
a/mm/internal.h | 5
a/mm/kasan/generic.c | 3
a/mm/kasan/report.c | 4
a/mm/khugepaged.c | 58 -
a/mm/ksm.c | 50 -
a/mm/madvise.c | 14
a/mm/mapping_dirty_helpers.c | 6
a/mm/memblock.c | 80 +
a/mm/memcontrol.c | 170 +--
a/mm/memory-failure.c | 322 +++----
a/mm/memory.c | 24
a/mm/memory_hotplug.c | 44 -
a/mm/mempolicy.c | 8
a/mm/migrate.c | 183 ++--
a/mm/mm_init.c | 1
a/mm/mmap.c | 22
a/mm/mmap_lock.c | 230 +++++
a/mm/mmu_notifier.c | 7
a/mm/mmzone.c | 14
a/mm/mremap.c | 282 ++++--
a/mm/nommu.c | 8
a/mm/oom_kill.c | 14
a/mm/page_alloc.c | 517 ++++++-----
a/mm/page_counter.c | 4
a/mm/page_ext.c | 10
a/mm/page_isolation.c | 18
a/mm/page_owner.c | 17
a/mm/page_poison.c | 56 -
a/mm/page_vma_mapped.c | 9
a/mm/process_vm_access.c | 2
a/mm/rmap.c | 9
a/mm/shmem.c | 39
a/mm/slab.c | 10
a/mm/slab.h | 9
a/mm/slab_common.c | 10
a/mm/slob.c | 6
a/mm/slub.c | 156 +--
a/mm/swap.c | 12
a/mm/swap_state.c | 7
a/mm/swapfile.c | 14
a/mm/truncate.c | 18
a/mm/vmalloc.c | 105 +-
a/mm/vmscan.c | 21
a/mm/vmstat.c | 6
a/mm/workingset.c | 8
a/mm/z3fold.c | 215 ++--
a/mm/zsmalloc.c | 11
a/mm/zswap.c | 193 +++-
a/sound/core/pcm_lib.c | 4
a/tools/include/linux/poison.h | 6
a/tools/testing/selftests/vm/.gitignore | 4
a/tools/testing/selftests/vm/Makefile | 41
a/tools/testing/selftests/vm/check_config.sh | 31
a/tools/testing/selftests/vm/config | 2
a/tools/testing/selftests/vm/gup_benchmark.c | 143 ---
a/tools/testing/selftests/vm/gup_test.c | 258 +++++
a/tools/testing/selftests/vm/hmm-tests.c | 10
a/tools/testing/selftests/vm/mremap_test.c | 344 +++++++
a/tools/testing/selftests/vm/run_vmtests | 51 -
a/tools/testing/selftests/vm/userfaultfd.c | 94 --
217 files changed, 4817 insertions(+), 3369 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-12-15 3:02 incoming Andrew Morton
@ 2020-12-15 3:25 ` Linus Torvalds
2020-12-15 3:30 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2020-12-15 3:25 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM
On Mon, Dec 14, 2020 at 7:02 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442.
I haven't actually processed the patches yet, but I have a question
for Konstantin wrt b4.
All the patches except for _one_ get a nice little green check-mark
next to them when I use 'git am' on this series.
The one that did not was [patch 192/200].
I have no idea why - and it doesn't matter a lot to me, it just stood
out as being different. I'm assuming Andrew has started doing patch
attestation, and that patch failed. But if so, maybe Konstantin wants
to know what went wrong.
Konstantin?
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-12-15 3:25 ` incoming Linus Torvalds
@ 2020-12-15 3:30 ` Linus Torvalds
2020-12-15 14:04 ` incoming Konstantin Ryabitsev
0 siblings, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2020-12-15 3:30 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM
On Mon, Dec 14, 2020 at 7:25 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> All the patches except for _one_ get a nice little green check-mark
> next to them when I use 'git am' on this series.
>
> The one that did not was [patch 192/200].
>
> I have no idea why
Hmm. It looks like that patch is the only one in the series with the
">From" marker in the commit message, from the silly "clarify that
this isn't the first line in a new message in mbox format".
And "b4 am" has turned the single ">" into two, making the stupid
marker worse, and actually corrupting the end result.
Coincidence? Or cause?
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-12-15 3:30 ` incoming Linus Torvalds
@ 2020-12-15 14:04 ` Konstantin Ryabitsev
0 siblings, 0 replies; 348+ messages in thread
From: Konstantin Ryabitsev @ 2020-12-15 14:04 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Andrew Morton, mm-commits, Linux-MM
On Mon, Dec 14, 2020 at 07:30:54PM -0800, Linus Torvalds wrote:
> > All the patches except for _one_ get a nice little green check-mark
> > next to them when I use 'git am' on this series.
> >
> > The one that did not was [patch 192/200].
> >
> > I have no idea why
>
> Hmm. It looks like that patch is the only one in the series with the
> ">From" marker in the commit message, from the silly "clarify that
> this isn't the first line in a new message in mbox format".
>
> And "b4 am" has turned the single ">" into two, making the stupid
> marker worse, and actually corrupting the end result.
It's a bug in b4 that I overlooked. Public-inbox emits mboxrd-formatted
.mbox files, while Python's mailbox.mbox consumes mboxo only. The main
distinction between the two is precisely that mboxrd will convert
">From " into ">>From " in an attempt to avoid corruption during
escape/unescape (it didn't end up fixing the problem 100% and mostly
introduced incompatibilities like this one).
I have a fix in master/stable-0.6.y and I'll release a 0.6.2 before the
end of the week.
Thanks for the report.
-K
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-12-15 20:32 Andrew Morton
2020-12-15 21:00 ` incoming Linus Torvalds
2020-12-15 22:48 ` incoming Linus Torvalds
0 siblings, 2 replies; 348+ messages in thread
From: Andrew Morton @ 2020-12-15 20:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
- more MM work: a memcg scalability improvememt
19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.
Subsystems affected by this patch series:
Alex Shi <alex.shi@linux.alibaba.com>:
Patch series "per memcg lru lock", v21:
mm/thp: move lru_add_page_tail() to huge_memory.c
mm/thp: use head for head page in lru_add_page_tail()
mm/thp: simplify lru_add_page_tail()
mm/thp: narrow lru locking
mm/vmscan: remove unnecessary lruvec adding
mm/rmap: stop store reordering issue on page->mapping
Hugh Dickins <hughd@google.com>:
mm: page_idle_get_page() does not need lru_lock
Alex Shi <alex.shi@linux.alibaba.com>:
mm/memcg: add debug checking in lock_page_memcg
mm/swap.c: fold vm event PGROTATED into pagevec_move_tail_fn
mm/lru: move lock into lru_note_cost
mm/vmscan: remove lruvec reget in move_pages_to_lru
mm/mlock: remove lru_lock on TestClearPageMlocked
mm/mlock: remove __munlock_isolate_lru_page()
mm/lru: introduce TestClearPageLRU()
mm/compaction: do page isolation first in compaction
mm/swap.c: serialize memcg changes in pagevec_lru_move_fn
mm/lru: replace pgdat lru_lock with lruvec lock
Alexander Duyck <alexander.h.duyck@linux.intel.com>:
mm/lru: introduce relock_page_lruvec()
Hugh Dickins <hughd@google.com>:
mm/lru: revise the comments of lru_lock
Documentation/admin-guide/cgroup-v1/memcg_test.rst | 15 -
Documentation/admin-guide/cgroup-v1/memory.rst | 23 -
Documentation/trace/events-kmem.rst | 2
Documentation/vm/unevictable-lru.rst | 22 -
include/linux/memcontrol.h | 110 +++++++
include/linux/mm_types.h | 2
include/linux/mmzone.h | 6
include/linux/page-flags.h | 1
include/linux/swap.h | 4
mm/compaction.c | 98 ++++---
mm/filemap.c | 4
mm/huge_memory.c | 109 ++++---
mm/memcontrol.c | 84 +++++-
mm/mlock.c | 93 ++----
mm/mmzone.c | 1
mm/page_alloc.c | 1
mm/page_idle.c | 4
mm/rmap.c | 12
mm/swap.c | 292 ++++++++-------------
mm/vmscan.c | 239 ++++++++---------
mm/workingset.c | 2
21 files changed, 644 insertions(+), 480 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-12-15 20:32 incoming Andrew Morton
@ 2020-12-15 21:00 ` Linus Torvalds
2020-12-15 22:48 ` incoming Linus Torvalds
1 sibling, 0 replies; 348+ messages in thread
From: Linus Torvalds @ 2020-12-15 21:00 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> - more MM work: a memcg scalability improvememt
>
> 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.
I'm not seeing patch 10/19 at all.
And patch 19/19 is corrupted and has an attachment with a '^P'
character in it. I could fix it up, but with the missing patch in the
middle I'm not going to even try. 'b4' is also very unhappy about that
patch 19/19.
I don't know what went wrong, but I'll ignore this send - please
re-send the series at your leisure, ok?
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-12-15 20:32 incoming Andrew Morton
2020-12-15 21:00 ` incoming Linus Torvalds
@ 2020-12-15 22:48 ` Linus Torvalds
2020-12-15 22:49 ` incoming Linus Torvalds
1 sibling, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2020-12-15 22:48 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> - more MM work: a memcg scalability improvememt
>
> 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.
With your re-send, I get all patches, but they don't actually apply cleanly.
Is that base correct?
I get
error: patch failed: mm/huge_memory.c:2750
error: mm/huge_memory.c: patch does not apply
Patch failed at 0004 mm/thp: narrow lru locking
for that patch "[patch 04/19] mm/thp: narrow lru locking", and that's
definitely true: the patch fragment has
@@ -2750,7 +2751,7 @@ int split_huge_page_to_list(struct page
__dec_lruvec_page_state(head, NR_FILE_THPS);
}
- __split_huge_page(page, list, end, flags);
+ __split_huge_page(page, list, end);
ret = 0;
} else {
if (IS_ENABLED(CONFIG_DEBUG_VM) && mapcount) {
but that __dec_lruvec_page_state() conversion was done by your
previous commit series.
So I have the feeling that what you actually mean by "base" isn't
actually really the base for that series at all..
I will try to apply it on top of my merge of your previous series instead.
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-12-15 22:48 ` incoming Linus Torvalds
@ 2020-12-15 22:49 ` Linus Torvalds
2020-12-15 22:55 ` incoming Andrew Morton
0 siblings, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2020-12-15 22:49 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> I will try to apply it on top of my merge of your previous series instead.
Yes, then it applies cleanly. So apparently we just have different
concepts of what really constitutes a "base" for applying your series.
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-12-15 22:49 ` incoming Linus Torvalds
@ 2020-12-15 22:55 ` Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-12-15 22:55 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Linux-MM, mm-commits
On Tue, 15 Dec 2020 14:49:24 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > I will try to apply it on top of my merge of your previous series instead.
>
> Yes, then it applies cleanly. So apparently we just have different
> concepts of what really constitutes a "base" for applying your series.
>
oop, sorry, yes, the "based on" thing was wrong because I had two
series in flight simultaneously. I've never tried that before..
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-12-16 4:41 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-12-16 4:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- lots of little subsystems
- a few post-linux-next MM material. Most of this awaits more merging
of other trees.
95 patches, based on 489e9fea66f31086f85d9a18e61e4791d94a56a4.
Subsystems affected by this patch series:
mm/swap
mm/memory-hotplug
alpha
procfs
misc
core-kernel
bitmap
lib
lz4
bitops
checkpatch
nilfs
kdump
rapidio
gcov
bfs
relay
resource
ubsan
reboot
fault-injection
lzo
apparmor
mm/pagemap
mm/cleanups
mm/gup
Subsystem: mm/swap
Zhaoyang Huang <huangzhaoyang@gmail.com>:
mm: fix a race on nr_swap_pages
Subsystem: mm/memory-hotplug
Laurent Dufour <ldufour@linux.ibm.com>:
mm/memory_hotplug: quieting offline operation
Subsystem: alpha
Thomas Gleixner <tglx@linutronix.de>:
alpha: replace bogus in_interrupt()
Subsystem: procfs
Randy Dunlap <rdunlap@infradead.org>:
procfs: delete duplicated words + other fixes
Anand K Mistry <amistry@google.com>:
proc: provide details on indirect branch speculation
Alexey Dobriyan <adobriyan@gmail.com>:
proc: fix lookup in /proc/net subdirectories after setns(2)
Hui Su <sh_def@163.com>:
fs/proc: make pde_get() return nothing
Subsystem: misc
Christophe Leroy <christophe.leroy@csgroup.eu>:
asm-generic: force inlining of get_order() to work around gcc10 poor decision
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: split out mathematical helpers
Subsystem: core-kernel
Hui Su <sh_def@163.com>:
kernel/acct.c: use #elif instead of #end and #elif
Subsystem: bitmap
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
include/linux/bitmap.h: convert bitmap_empty() / bitmap_full() to return boolean
"Ma, Jianpeng" <jianpeng.ma@intel.com>:
bitmap: remove unused function declaration
Subsystem: lib
Geert Uytterhoeven <geert@linux-m68k.org>:
lib/test_free_pages.c: add basic progress indicators
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
Patch series "] lib/stackdepot.c: Replace one-element array with flexible-array member":
lib/stackdepot.c: replace one-element array with flexible-array member
lib/stackdepot.c: use flex_array_size() helper in memcpy()
lib/stackdepot.c: use array_size() helper in jhash2()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
lib/test_lockup.c: minimum fix to get it compiled on PREEMPT_RT
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
lib/list_kunit: follow new file name convention for KUnit tests
lib/linear_ranges_kunit: follow new file name convention for KUnit tests
lib/bits_kunit: follow new file name convention for KUnit tests
lib/cmdline: fix get_option() for strings starting with hyphen
lib/cmdline: allow NULL to be an output for get_option()
lib/cmdline_kunit: add a new test suite for cmdline API
Jakub Jelinek <jakub@redhat.com>:
ilog2: improve ilog2 for constant arguments
Nick Desaulniers <ndesaulniers@google.com>:
lib/string: remove unnecessary #undefs
Daniel Axtens <dja@axtens.net>:
Patch series "Fortify strscpy()", v7:
lib: string.h: detect intra-object overflow in fortified string functions
lkdtm: tests for FORTIFY_SOURCE
Francis Laniel <laniel_francis@privacyrequired.com>:
string.h: add FORTIFY coverage for strscpy()
drivers/misc/lkdtm: add new file in LKDTM to test fortified strscpy
drivers/misc/lkdtm/lkdtm.h: correct wrong filenames in comment
Alexey Dobriyan <adobriyan@gmail.com>:
lib: cleanup kstrto*() usage
Subsystem: lz4
Gao Xiang <hsiangkao@redhat.com>:
lib/lz4: explicitly support in-place decompression
Subsystem: bitops
Syed Nayyar Waris <syednwaris@gmail.com>:
Patch series "Introduce the for_each_set_clump macro", v12:
bitops: introduce the for_each_set_clump macro
lib/test_bitmap.c: add for_each_set_clump test cases
gpio: thunderx: utilize for_each_set_clump macro
gpio: xilinx: utilize generic bitmap_get_value and _set_value
Subsystem: checkpatch
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: add new exception to repeated word check
Aditya Srivastava <yashsri421@gmail.com>:
checkpatch: fix false positives in REPEATED_WORD warning
Łukasz Stelmach <l.stelmach@samsung.com>:
checkpatch: ignore generated CamelCase defines and enum values
Joe Perches <joe@perches.com>:
checkpatch: prefer static const declarations
checkpatch: allow --fix removal of unnecessary break statements
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: extend attributes check to handle more patterns
Tom Rix <trix@redhat.com>:
checkpatch: add a fixer for missing newline at eof
Joe Perches <joe@perches.com>:
checkpatch: update __attribute__((section("name"))) quote removal
Aditya Srivastava <yashsri421@gmail.com>:
checkpatch: add fix option for GERRIT_CHANGE_ID
Joe Perches <joe@perches.com>:
checkpatch: add __alias and __weak to suggested __attribute__ conversions
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: improve email parsing
checkpatch: fix spelling errors and remove repeated word
Aditya Srivastava <yashsri421@gmail.com>:
checkpatch: avoid COMMIT_LOG_LONG_LINE warning for signature tags
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: fix unescaped left brace
Aditya Srivastava <yashsri421@gmail.com>:
checkpatch: add fix option for ASSIGNMENT_CONTINUATIONS
checkpatch: add fix option for LOGICAL_CONTINUATIONS
checkpatch: add fix and improve warning msg for non-standard signature
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: add warning for unnecessary use of %h[xudi] and %hh[xudi]
checkpatch: add warning for lines starting with a '#' in commit log
checkpatch: fix TYPO_SPELLING check for words with apostrophe
Joe Perches <joe@perches.com>:
checkpatch: add printk_once and printk_ratelimit to prefer pr_<level> warning
Subsystem: nilfs
Alex Shi <alex.shi@linux.alibaba.com>:
fs/nilfs2: remove some unused macros to tame gcc
Subsystem: kdump
Alexander Egorenkov <egorenar@linux.ibm.com>:
kdump: append uts_namespace.name offset to VMCOREINFO
Subsystem: rapidio
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
rapidio: remove unused rio_get_asm() and rio_get_device()
Subsystem: gcov
Nick Desaulniers <ndesaulniers@google.com>:
gcov: remove support for GCC < 4.9
Alex Shi <alex.shi@linux.alibaba.com>:
gcov: fix kernel-doc markup issue
Subsystem: bfs
Randy Dunlap <rdunlap@infradead.org>:
bfs: don't use WARNING: string when it's just info.
Subsystem: relay
Jani Nikula <jani.nikula@intel.com>:
Patch series "relay: cleanup and const callbacks", v2:
relay: remove unused buf_mapped and buf_unmapped callbacks
relay: require non-NULL callbacks in relay_open()
relay: make create_buf_file and remove_buf_file callbacks mandatory
relay: allow the use of const callback structs
drm/i915: make relay callbacks const
ath10k: make relay callbacks const
ath11k: make relay callbacks const
ath9k: make relay callbacks const
blktrace: make relay callbacks const
Subsystem: resource
Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
kernel/resource.c: fix kernel-doc markups
Subsystem: ubsan
Kees Cook <keescook@chromium.org>:
Patch series "Clean up UBSAN Makefile", v2:
ubsan: remove redundant -Wno-maybe-uninitialized
ubsan: move cc-option tests into Kconfig
ubsan: disable object-size sanitizer under GCC
ubsan: disable UBSAN_TRAP for all*config
ubsan: enable for all*config builds
ubsan: remove UBSAN_MISC in favor of individual options
ubsan: expand tests and reporting
Dmitry Vyukov <dvyukov@google.com>:
kcov: don't instrument with UBSAN
Zou Wei <zou_wei@huawei.com>:
lib/ubsan.c: mark type_check_kinds with static keyword
Subsystem: reboot
Matteo Croce <mcroce@microsoft.com>:
reboot: refactor and comment the cpu selection code
reboot: allow to specify reboot mode via sysfs
reboot: remove cf9_safe from allowed types and rename cf9_force
Patch series "reboot: sysfs improvements":
reboot: allow to override reboot type if quirks are found
reboot: hide from sysfs not applicable settings
Subsystem: fault-injection
Barnabás Pőcze <pobrn@protonmail.com>:
fault-injection: handle EI_ETYPE_TRUE
Subsystem: lzo
Jason Yan <yanaijie@huawei.com>:
lib/lzo/lzo1x_compress.c: make lzogeneric1x_1_compress() static
Subsystem: apparmor
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
apparmor: remove duplicate macro list_entry_is_head()
Subsystem: mm/pagemap
Christoph Hellwig <hch@lst.de>:
Patch series "simplify follow_pte a bit":
mm: unexport follow_pte_pmd
mm: simplify follow_pte{,pmd}
Subsystem: mm/cleanups
Haitao Shi <shihaitao1@huawei.com>:
mm: fix some spelling mistakes in comments
Subsystem: mm/gup
Jann Horn <jannh@google.com>:
mmap locking API: don't check locking if the mm isn't live yet
mm/gup: assert that the mmap lock is held in __get_user_pages()
Documentation/ABI/testing/sysfs-kernel-reboot | 32
Documentation/admin-guide/kdump/vmcoreinfo.rst | 6
Documentation/dev-tools/ubsan.rst | 1
Documentation/filesystems/proc.rst | 2
MAINTAINERS | 5
arch/alpha/kernel/process.c | 2
arch/powerpc/kernel/vmlinux.lds.S | 4
arch/s390/pci/pci_mmio.c | 4
drivers/gpio/gpio-thunderx.c | 11
drivers/gpio/gpio-xilinx.c | 61 -
drivers/gpu/drm/i915/gt/uc/intel_guc_log.c | 2
drivers/misc/lkdtm/Makefile | 1
drivers/misc/lkdtm/bugs.c | 50 +
drivers/misc/lkdtm/core.c | 3
drivers/misc/lkdtm/fortify.c | 82 ++
drivers/misc/lkdtm/lkdtm.h | 19
drivers/net/wireless/ath/ath10k/spectral.c | 2
drivers/net/wireless/ath/ath11k/spectral.c | 2
drivers/net/wireless/ath/ath9k/common-spectral.c | 2
drivers/rapidio/rio.c | 81 --
fs/bfs/inode.c | 2
fs/dax.c | 9
fs/exec.c | 8
fs/nfs/callback_proc.c | 5
fs/nilfs2/segment.c | 5
fs/proc/array.c | 28
fs/proc/base.c | 2
fs/proc/generic.c | 24
fs/proc/internal.h | 10
fs/proc/proc_net.c | 20
include/asm-generic/bitops/find.h | 19
include/asm-generic/getorder.h | 2
include/linux/bitmap.h | 67 +-
include/linux/bitops.h | 24
include/linux/dcache.h | 1
include/linux/iommu-helper.h | 4
include/linux/kernel.h | 173 -----
include/linux/log2.h | 3
include/linux/math.h | 177 +++++
include/linux/mm.h | 6
include/linux/mm_types.h | 10
include/linux/mmap_lock.h | 16
include/linux/proc_fs.h | 8
include/linux/rcu_node_tree.h | 2
include/linux/relay.h | 29
include/linux/rio_drv.h | 3
include/linux/string.h | 75 +-
include/linux/units.h | 2
kernel/Makefile | 3
kernel/acct.c | 7
kernel/crash_core.c | 1
kernel/fail_function.c | 6
kernel/gcov/gcc_4_7.c | 10
kernel/reboot.c | 308 ++++++++-
kernel/relay.c | 111 ---
kernel/resource.c | 24
kernel/trace/blktrace.c | 2
lib/Kconfig.debug | 11
lib/Kconfig.ubsan | 154 +++-
lib/Makefile | 7
lib/bits_kunit.c | 75 ++
lib/cmdline.c | 20
lib/cmdline_kunit.c | 100 +++
lib/errname.c | 1
lib/error-inject.c | 2
lib/errseq.c | 1
lib/find_bit.c | 17
lib/linear_ranges_kunit.c | 228 +++++++
lib/list-test.c | 748 -----------------------
lib/list_kunit.c | 748 +++++++++++++++++++++++
lib/lz4/lz4_decompress.c | 6
lib/lz4/lz4defs.h | 1
lib/lzo/lzo1x_compress.c | 2
lib/math/div64.c | 4
lib/math/int_pow.c | 2
lib/math/int_sqrt.c | 3
lib/math/reciprocal_div.c | 9
lib/stackdepot.c | 11
lib/string.c | 4
lib/test_bitmap.c | 143 ++++
lib/test_bits.c | 75 --
lib/test_firmware.c | 9
lib/test_free_pages.c | 5
lib/test_kmod.c | 26
lib/test_linear_ranges.c | 228 -------
lib/test_lockup.c | 16
lib/test_ubsan.c | 74 ++
lib/ubsan.c | 2
mm/filemap.c | 2
mm/gup.c | 2
mm/huge_memory.c | 2
mm/khugepaged.c | 2
mm/memblock.c | 2
mm/memory.c | 36 -
mm/memory_hotplug.c | 2
mm/migrate.c | 2
mm/page_ext.c | 2
mm/swapfile.c | 11
scripts/Makefile.ubsan | 49 -
scripts/checkpatch.pl | 495 +++++++++++----
security/apparmor/apparmorfs.c | 3
tools/testing/selftests/lkdtm/tests.txt | 1
102 files changed, 3022 insertions(+), 1899 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-12-18 22:00 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-12-18 22:00 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
78 patches, based on a409ed156a90093a03fe6a93721ddf4c591eac87.
Subsystems affected by this patch series:
mm/memcg
epoll
mm/kasan
mm/cleanups
epoll
Subsystem: mm/memcg
Alex Shi <alex.shi@linux.alibaba.com>:
Patch series "bail out early for memcg disable":
mm/memcg: bail early from swap accounting if memcg disabled
mm/memcg: warning on !memcg after readahead page charged
Wei Yang <richard.weiyang@gmail.com>:
mm/memcg: remove unused definitions
Shakeel Butt <shakeelb@google.com>:
mm, kvm: account kvm_vcpu_mmap to kmemcg
Hui Su <sh_def@163.com>:
mm/memcontrol:rewrite mem_cgroup_page_lruvec()
Subsystem: epoll
Soheil Hassas Yeganeh <soheil@google.com>:
Patch series "simplify ep_poll":
epoll: check for events when removing a timed out thread from the wait queue
epoll: simplify signal handling
epoll: pull fatal signal checks into ep_send_events()
epoll: move eavail next to the list_empty_careful check
epoll: simplify and optimize busy loop logic
epoll: pull all code between fetch_events and send_event into the loop
epoll: replace gotos with a proper loop
epoll: eliminate unnecessary lock for zero timeout
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: add hardware tag-based mode for arm64", v11:
kasan: drop unnecessary GPL text from comment headers
kasan: KASAN_VMALLOC depends on KASAN_GENERIC
kasan: group vmalloc code
kasan: shadow declarations only for software modes
kasan: rename (un)poison_shadow to (un)poison_range
kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_*
kasan: only build init.c for software modes
kasan: split out shadow.c from common.c
kasan: define KASAN_MEMORY_PER_SHADOW_PAGE
kasan: rename report and tags files
kasan: don't duplicate config dependencies
kasan: hide invalid free check implementation
kasan: decode stack frame only with KASAN_STACK_ENABLE
kasan, arm64: only init shadow for software modes
kasan, arm64: only use kasan_depth for software modes
kasan, arm64: move initialization message
kasan, arm64: rename kasan_init_tags and mark as __init
kasan: rename addr_has_shadow to addr_has_metadata
kasan: rename print_shadow_for_address to print_memory_metadata
kasan: rename SHADOW layout macros to META
kasan: separate metadata_fetch_row for each mode
kasan: introduce CONFIG_KASAN_HW_TAGS
Vincenzo Frascino <vincenzo.frascino@arm.com>:
arm64: enable armv8.5-a asm-arch option
arm64: mte: add in-kernel MTE helpers
arm64: mte: reset the page tag in page->flags
arm64: mte: add in-kernel tag fault handler
arm64: kasan: allow enabling in-kernel MTE
arm64: mte: convert gcr_user into an exclude mask
arm64: mte: switch GCR_EL1 in kernel entry and exit
kasan, mm: untag page address in free_reserved_area
Andrey Konovalov <andreyknvl@google.com>:
arm64: kasan: align allocations for HW_TAGS
arm64: kasan: add arch layer for memory tagging helpers
kasan: define KASAN_GRANULE_SIZE for HW_TAGS
kasan, x86, s390: update undef CONFIG_KASAN
kasan, arm64: expand CONFIG_KASAN checks
kasan, arm64: implement HW_TAGS runtime
kasan, arm64: print report from tag fault handler
kasan, mm: reset tags when accessing metadata
kasan, arm64: enable CONFIG_KASAN_HW_TAGS
kasan: add documentation for hardware tag-based mode
Vincenzo Frascino <vincenzo.frascino@arm.com>:
kselftest/arm64: check GCR_EL1 after context switch
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: boot parameters for hardware tag-based mode", v4:
kasan: simplify quarantine_put call site
kasan: rename get_alloc/free_info
kasan: introduce set_alloc_info
kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK
kasan: allow VMAP_STACK for HW_TAGS mode
kasan: remove __kasan_unpoison_stack
kasan: inline kasan_reset_tag for tag-based modes
kasan: inline random_tag for HW_TAGS
kasan: open-code kasan_unpoison_slab
kasan: inline (un)poison_range and check_invalid_free
kasan: add and integrate kasan boot parameters
kasan, mm: check kasan_enabled in annotations
kasan, mm: rename kasan_poison_kfree
kasan: don't round_up too much
kasan: simplify assign_tag and set_tag calls
kasan: clarify comment in __kasan_kfree_large
kasan: sanitize objects when metadata doesn't fit
kasan, mm: allow cache merging with no metadata
kasan: update documentation
Subsystem: mm/cleanups
Colin Ian King <colin.king@canonical.com>:
mm/Kconfig: fix spelling mistake "whats" -> "what's"
Subsystem: epoll
Willem de Bruijn <willemb@google.com>:
Patch series "add epoll_pwait2 syscall", v4:
epoll: convert internal api to timespec64
epoll: add syscall epoll_pwait2
epoll: wire up syscall epoll_pwait2
selftests/filesystems: expand epoll with epoll_pwait2
Documentation/dev-tools/kasan.rst | 274 +-
arch/Kconfig | 8
arch/alpha/kernel/syscalls/syscall.tbl | 1
arch/arm/tools/syscall.tbl | 1
arch/arm64/Kconfig | 9
arch/arm64/Makefile | 7
arch/arm64/include/asm/assembler.h | 2
arch/arm64/include/asm/cache.h | 3
arch/arm64/include/asm/esr.h | 1
arch/arm64/include/asm/kasan.h | 17
arch/arm64/include/asm/memory.h | 15
arch/arm64/include/asm/mte-def.h | 16
arch/arm64/include/asm/mte-kasan.h | 67
arch/arm64/include/asm/mte.h | 22
arch/arm64/include/asm/processor.h | 2
arch/arm64/include/asm/string.h | 5
arch/arm64/include/asm/uaccess.h | 23
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 2
arch/arm64/kernel/asm-offsets.c | 3
arch/arm64/kernel/cpufeature.c | 3
arch/arm64/kernel/entry.S | 41
arch/arm64/kernel/head.S | 2
arch/arm64/kernel/hibernate.c | 5
arch/arm64/kernel/image-vars.h | 2
arch/arm64/kernel/kaslr.c | 3
arch/arm64/kernel/module.c | 6
arch/arm64/kernel/mte.c | 124 +
arch/arm64/kernel/setup.c | 2
arch/arm64/kernel/sleep.S | 2
arch/arm64/kernel/smp.c | 2
arch/arm64/lib/mte.S | 16
arch/arm64/mm/copypage.c | 9
arch/arm64/mm/fault.c | 59
arch/arm64/mm/kasan_init.c | 41
arch/arm64/mm/mteswap.c | 9
arch/arm64/mm/proc.S | 23
arch/arm64/mm/ptdump.c | 6
arch/ia64/kernel/syscalls/syscall.tbl | 1
arch/m68k/kernel/syscalls/syscall.tbl | 1
arch/microblaze/kernel/syscalls/syscall.tbl | 1
arch/mips/kernel/syscalls/syscall_n32.tbl | 1
arch/mips/kernel/syscalls/syscall_n64.tbl | 1
arch/mips/kernel/syscalls/syscall_o32.tbl | 1
arch/parisc/kernel/syscalls/syscall.tbl | 1
arch/powerpc/kernel/syscalls/syscall.tbl | 1
arch/s390/boot/string.c | 1
arch/s390/kernel/syscalls/syscall.tbl | 1
arch/sh/kernel/syscalls/syscall.tbl | 1
arch/sparc/kernel/syscalls/syscall.tbl | 1
arch/x86/boot/compressed/misc.h | 1
arch/x86/entry/syscalls/syscall_32.tbl | 1
arch/x86/entry/syscalls/syscall_64.tbl | 1
arch/x86/kernel/acpi/wakeup_64.S | 2
arch/x86/kvm/x86.c | 2
arch/xtensa/kernel/syscalls/syscall.tbl | 1
fs/eventpoll.c | 359 ++-
include/linux/compat.h | 6
include/linux/kasan-checks.h | 2
include/linux/kasan.h | 423 ++--
include/linux/memcontrol.h | 137 -
include/linux/mm.h | 24
include/linux/mmdebug.h | 13
include/linux/moduleloader.h | 3
include/linux/page-flags-layout.h | 2
include/linux/sched.h | 2
include/linux/string.h | 2
include/linux/syscalls.h | 5
include/uapi/asm-generic/unistd.h | 4
init/init_task.c | 2
kernel/fork.c | 4
kernel/sys_ni.c | 2
lib/Kconfig.kasan | 71
lib/test_kasan.c | 2
lib/test_kasan_module.c | 2
mm/Kconfig | 2
mm/kasan/Makefile | 33
mm/kasan/common.c | 1006 ++--------
mm/kasan/generic.c | 72
mm/kasan/generic_report.c | 13
mm/kasan/hw_tags.c | 294 ++
mm/kasan/init.c | 25
mm/kasan/kasan.h | 204 +-
mm/kasan/quarantine.c | 35
mm/kasan/report.c | 363 +--
mm/kasan/report_generic.c | 169 +
mm/kasan/report_hw_tags.c | 44
mm/kasan/report_sw_tags.c | 22
mm/kasan/shadow.c | 541 +++++
mm/kasan/sw_tags.c | 34
mm/kasan/tags.c | 7
mm/kasan/tags_report.c | 7
mm/memcontrol.c | 53
mm/mempool.c | 4
mm/page_alloc.c | 9
mm/page_poison.c | 2
mm/ptdump.c | 13
mm/slab_common.c | 5
mm/slub.c | 29
scripts/Makefile.lib | 2
tools/testing/selftests/arm64/mte/Makefile | 2
tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c | 155 +
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 72
virt/kvm/coalesced_mmio.c | 2
virt/kvm/kvm_main.c | 2
105 files changed, 3268 insertions(+), 1873 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-12-22 19:58 Andrew Morton
2020-12-22 21:43 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2020-12-22 19:58 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e.
Subsystems affected by this patch series:
mm/kasan
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: add hardware tag-based mode for arm64", v11:
kasan: drop unnecessary GPL text from comment headers
kasan: KASAN_VMALLOC depends on KASAN_GENERIC
kasan: group vmalloc code
kasan: shadow declarations only for software modes
kasan: rename (un)poison_shadow to (un)poison_range
kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_*
kasan: only build init.c for software modes
kasan: split out shadow.c from common.c
kasan: define KASAN_MEMORY_PER_SHADOW_PAGE
kasan: rename report and tags files
kasan: don't duplicate config dependencies
kasan: hide invalid free check implementation
kasan: decode stack frame only with KASAN_STACK_ENABLE
kasan, arm64: only init shadow for software modes
kasan, arm64: only use kasan_depth for software modes
kasan, arm64: move initialization message
kasan, arm64: rename kasan_init_tags and mark as __init
kasan: rename addr_has_shadow to addr_has_metadata
kasan: rename print_shadow_for_address to print_memory_metadata
kasan: rename SHADOW layout macros to META
kasan: separate metadata_fetch_row for each mode
kasan: introduce CONFIG_KASAN_HW_TAGS
Vincenzo Frascino <vincenzo.frascino@arm.com>:
arm64: enable armv8.5-a asm-arch option
arm64: mte: add in-kernel MTE helpers
arm64: mte: reset the page tag in page->flags
arm64: mte: add in-kernel tag fault handler
arm64: kasan: allow enabling in-kernel MTE
arm64: mte: convert gcr_user into an exclude mask
arm64: mte: switch GCR_EL1 in kernel entry and exit
kasan, mm: untag page address in free_reserved_area
Andrey Konovalov <andreyknvl@google.com>:
arm64: kasan: align allocations for HW_TAGS
arm64: kasan: add arch layer for memory tagging helpers
kasan: define KASAN_GRANULE_SIZE for HW_TAGS
kasan, x86, s390: update undef CONFIG_KASAN
kasan, arm64: expand CONFIG_KASAN checks
kasan, arm64: implement HW_TAGS runtime
kasan, arm64: print report from tag fault handler
kasan, mm: reset tags when accessing metadata
kasan, arm64: enable CONFIG_KASAN_HW_TAGS
kasan: add documentation for hardware tag-based mode
Vincenzo Frascino <vincenzo.frascino@arm.com>:
kselftest/arm64: check GCR_EL1 after context switch
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: boot parameters for hardware tag-based mode", v4:
kasan: simplify quarantine_put call site
kasan: rename get_alloc/free_info
kasan: introduce set_alloc_info
kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK
kasan: allow VMAP_STACK for HW_TAGS mode
kasan: remove __kasan_unpoison_stack
kasan: inline kasan_reset_tag for tag-based modes
kasan: inline random_tag for HW_TAGS
kasan: open-code kasan_unpoison_slab
kasan: inline (un)poison_range and check_invalid_free
kasan: add and integrate kasan boot parameters
kasan, mm: check kasan_enabled in annotations
kasan, mm: rename kasan_poison_kfree
kasan: don't round_up too much
kasan: simplify assign_tag and set_tag calls
kasan: clarify comment in __kasan_kfree_large
kasan: sanitize objects when metadata doesn't fit
kasan, mm: allow cache merging with no metadata
kasan: update documentation
Documentation/dev-tools/kasan.rst | 274 ++-
arch/Kconfig | 8
arch/arm64/Kconfig | 9
arch/arm64/Makefile | 7
arch/arm64/include/asm/assembler.h | 2
arch/arm64/include/asm/cache.h | 3
arch/arm64/include/asm/esr.h | 1
arch/arm64/include/asm/kasan.h | 17
arch/arm64/include/asm/memory.h | 15
arch/arm64/include/asm/mte-def.h | 16
arch/arm64/include/asm/mte-kasan.h | 67
arch/arm64/include/asm/mte.h | 22
arch/arm64/include/asm/processor.h | 2
arch/arm64/include/asm/string.h | 5
arch/arm64/include/asm/uaccess.h | 23
arch/arm64/kernel/asm-offsets.c | 3
arch/arm64/kernel/cpufeature.c | 3
arch/arm64/kernel/entry.S | 41
arch/arm64/kernel/head.S | 2
arch/arm64/kernel/hibernate.c | 5
arch/arm64/kernel/image-vars.h | 2
arch/arm64/kernel/kaslr.c | 3
arch/arm64/kernel/module.c | 6
arch/arm64/kernel/mte.c | 124 +
arch/arm64/kernel/setup.c | 2
arch/arm64/kernel/sleep.S | 2
arch/arm64/kernel/smp.c | 2
arch/arm64/lib/mte.S | 16
arch/arm64/mm/copypage.c | 9
arch/arm64/mm/fault.c | 59
arch/arm64/mm/kasan_init.c | 41
arch/arm64/mm/mteswap.c | 9
arch/arm64/mm/proc.S | 23
arch/arm64/mm/ptdump.c | 6
arch/s390/boot/string.c | 1
arch/x86/boot/compressed/misc.h | 1
arch/x86/kernel/acpi/wakeup_64.S | 2
include/linux/kasan-checks.h | 2
include/linux/kasan.h | 423 ++++-
include/linux/mm.h | 24
include/linux/moduleloader.h | 3
include/linux/page-flags-layout.h | 2
include/linux/sched.h | 2
include/linux/string.h | 2
init/init_task.c | 2
kernel/fork.c | 4
lib/Kconfig.kasan | 71
lib/test_kasan.c | 2
lib/test_kasan_module.c | 2
mm/kasan/Makefile | 33
mm/kasan/common.c | 1006 +++-----------
mm/kasan/generic.c | 72 -
mm/kasan/generic_report.c | 13
mm/kasan/hw_tags.c | 276 +++
mm/kasan/init.c | 25
mm/kasan/kasan.h | 195 ++
mm/kasan/quarantine.c | 35
mm/kasan/report.c | 363 +----
mm/kasan/report_generic.c | 169 ++
mm/kasan/report_hw_tags.c | 44
mm/kasan/report_sw_tags.c | 22
mm/kasan/shadow.c | 528 +++++++
mm/kasan/sw_tags.c | 34
mm/kasan/tags.c | 7
mm/kasan/tags_report.c | 7
mm/mempool.c | 4
mm/page_alloc.c | 9
mm/page_poison.c | 2
mm/ptdump.c | 13
mm/slab_common.c | 5
mm/slub.c | 29
scripts/Makefile.lib | 2
tools/testing/selftests/arm64/mte/Makefile | 2
tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c | 155 ++
74 files changed, 2869 insertions(+), 1553 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2020-12-22 19:58 incoming Andrew Morton
@ 2020-12-22 21:43 ` Linus Torvalds
0 siblings, 0 replies; 348+ messages in thread
From: Linus Torvalds @ 2020-12-22 21:43 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, Dec 22, 2020 at 11:58 AM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> 60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e.
I see that you enabled renaming in the patches. Lovely.
Can you also enable it in the diffstat?
> 74 files changed, 2869 insertions(+), 1553 deletions(-)
With -M in the diffstat, you should have seen
72 files changed, 2775 insertions(+), 1460 deletions(-)
and if you add "--summary", you'll also see the rename part ofthe file
create/delete summary:
rename mm/kasan/{tags_report.c => report_sw_tags.c} (78%)
which is often nice to see in addition to the line stats..
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2020-12-29 23:13 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2020-12-29 23:13 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
16 patches, based on dea8dcf2a9fa8cc540136a6cd885c3beece16ec3.
Subsystems affected by this patch series:
mm/selftests
mm/hugetlb
kbuild
checkpatch
mm/pagecache
mm/mremap
mm/kasan
misc
lib
mm/slub
Subsystem: mm/selftests
Harish <harish@linux.ibm.com>:
selftests/vm: fix building protection keys test
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
mm/hugetlb: fix deadlock in hugetlb_cow error path
Subsystem: kbuild
Masahiro Yamada <masahiroy@kernel.org>:
Revert "kbuild: avoid static_assert for genksyms"
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: prefer strscpy to strlcpy
Subsystem: mm/pagecache
Souptick Joarder <jrdr.linux@gmail.com>:
mm: add prototype for __add_to_page_cache_locked()
Baoquan He <bhe@redhat.com>:
mm: memmap defer init doesn't work as expected
Subsystem: mm/mremap
Kalesh Singh <kaleshsingh@google.com>:
mm/mremap.c: fix extent calculation
Nicholas Piggin <npiggin@gmail.com>:
mm: generalise COW SMC TLB flushing race comment
Subsystem: mm/kasan
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: fix null pointer dereference in kasan_record_aux_stack
Subsystem: misc
Randy Dunlap <rdunlap@infradead.org>:
local64.h: make <asm/local64.h> mandatory
Huang Shijie <sjhuang@iluvatar.ai>:
sizes.h: add SZ_8G/SZ_16G/SZ_32G macros
Josh Poimboeuf <jpoimboe@redhat.com>:
kdev_t: always inline major/minor helper functions
Subsystem: lib
Huang Shijie <sjhuang@iluvatar.ai>:
lib/genalloc: fix the overflow when size is too big
Ilya Leoshkevich <iii@linux.ibm.com>:
lib/zlib: fix inflating zlib streams on s390
Randy Dunlap <rdunlap@infradead.org>:
zlib: move EXPORT_SYMBOL() and MODULE_LICENSE() out of dfltcc_syms.c
Subsystem: mm/slub
Roman Gushchin <guro@fb.com>:
mm: slub: call account_slab_page() after slab page initialization
arch/alpha/include/asm/local64.h | 1 -
arch/arc/include/asm/Kbuild | 1 -
arch/arm/include/asm/Kbuild | 1 -
arch/arm64/include/asm/Kbuild | 1 -
arch/csky/include/asm/Kbuild | 1 -
arch/h8300/include/asm/Kbuild | 1 -
arch/hexagon/include/asm/Kbuild | 1 -
arch/ia64/include/asm/local64.h | 1 -
arch/ia64/mm/init.c | 4 ++--
arch/m68k/include/asm/Kbuild | 1 -
arch/microblaze/include/asm/Kbuild | 1 -
arch/mips/include/asm/Kbuild | 1 -
arch/nds32/include/asm/Kbuild | 1 -
arch/openrisc/include/asm/Kbuild | 1 -
arch/parisc/include/asm/Kbuild | 1 -
arch/powerpc/include/asm/Kbuild | 1 -
arch/riscv/include/asm/Kbuild | 1 -
arch/s390/include/asm/Kbuild | 1 -
arch/sh/include/asm/Kbuild | 1 -
arch/sparc/include/asm/Kbuild | 1 -
arch/x86/include/asm/local64.h | 1 -
arch/xtensa/include/asm/Kbuild | 1 -
include/asm-generic/Kbuild | 1 +
include/linux/build_bug.h | 5 -----
include/linux/kdev_t.h | 22 +++++++++++-----------
include/linux/mm.h | 12 ++++++++++--
include/linux/sizes.h | 3 +++
lib/genalloc.c | 25 +++++++++++++------------
lib/zlib_dfltcc/Makefile | 2 +-
lib/zlib_dfltcc/dfltcc.c | 6 +++++-
lib/zlib_dfltcc/dfltcc_deflate.c | 3 +++
lib/zlib_dfltcc/dfltcc_inflate.c | 4 ++--
lib/zlib_dfltcc/dfltcc_syms.c | 17 -----------------
mm/hugetlb.c | 22 +++++++++++++++++++++-
mm/kasan/generic.c | 2 ++
mm/memory.c | 8 +++++---
mm/memory_hotplug.c | 2 +-
mm/mremap.c | 4 +++-
mm/page_alloc.c | 8 +++++---
mm/slub.c | 5 ++---
scripts/checkpatch.pl | 6 ++++++
tools/testing/selftests/vm/Makefile | 10 +++++-----
42 files changed, 101 insertions(+), 91 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-01-12 23:48 Andrew Morton
2021-01-15 23:32 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2021-01-12 23:48 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c.
Subsystems affected by this patch series:
mm/slub
mm/pagealloc
mm/memcg
mm/kasan
mm/vmalloc
mm/migration
mm/hugetlb
MAINTAINERS
mm/memory-failure
mm/process_vm_access
Subsystem: mm/slub
Jann Horn <jannh@google.com>:
mm, slub: consider rest of partial list if acquire_slab() fails
Subsystem: mm/pagealloc
Hailong liu <liu.hailong6@zte.com.cn>:
mm/page_alloc: add a missing mm_page_alloc_zone_locked() tracepoint
Subsystem: mm/memcg
Hugh Dickins <hughd@google.com>:
mm/memcontrol: fix warning in mem_cgroup_page_lruvec()
Subsystem: mm/kasan
Hailong Liu <liu.hailong6@zte.com.cn>:
arm/kasan: fix the array size of kasan_early_shadow_pte[]
Subsystem: mm/vmalloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/vmalloc.c: fix potential memory leak
Subsystem: mm/migration
Jan Stancek <jstancek@redhat.com>:
mm: migrate: initialize err in do_migrate_pages
Subsystem: mm/hugetlb
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: fix potential missing huge page size info
Subsystem: MAINTAINERS
Vlastimil Babka <vbabka@suse.cz>:
MAINTAINERS: add Vlastimil as slab allocators maintainer
Subsystem: mm/memory-failure
Oscar Salvador <osalvador@suse.de>:
mm,hwpoison: fix printing of page flags
Subsystem: mm/process_vm_access
Andrew Morton <akpm@linux-foundation.org>:
mm/process_vm_access.c: include compat.h
MAINTAINERS | 1 +
include/linux/kasan.h | 6 +++++-
include/linux/memcontrol.h | 2 +-
mm/hugetlb.c | 2 +-
mm/kasan/init.c | 3 ++-
mm/memory-failure.c | 2 +-
mm/mempolicy.c | 2 +-
mm/page_alloc.c | 31 ++++++++++++++++---------------
mm/process_vm_access.c | 1 +
mm/slub.c | 2 +-
mm/vmalloc.c | 4 +++-
11 files changed, 33 insertions(+), 23 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-01-12 23:48 incoming Andrew Morton
@ 2021-01-15 23:32 ` Linus Torvalds
0 siblings, 0 replies; 348+ messages in thread
From: Linus Torvalds @ 2021-01-15 23:32 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, Jan 12, 2021 at 3:48 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c.
Whee. I had completely dropped the ball on this - I had built my usual
"akpm" branch with the patches, but then had completely forgotten
about it after doing my basic build tests.
I tend to leave it for a while to see if people send belated ACK/NAK's
for the patches, but that "for a while" is typically "overnight", not
several days.
So if you ever notice that I haven't merged your patch submission, and
you haven't seen me comment on them, feel free to ping me to remind
me.
Because it might just have gotten lost in the shuffle for some random
reason. Admittedly it's rare - I think this is the first time I just
randomly noticed three days later that I'd never done the actual merge
of the patch-series).
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-01-24 5:00 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-01-24 5:00 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
19 patches, based on e1ae4b0be15891faf46d390e9f3dc9bd71a8cae1.
Subsystems affected by this patch series:
mm/pagealloc
mm/memcg
mm/kasan
ubsan
mm/memory-failure
mm/highmem
proc
MAINTAINERS
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: fix initialization of struct page for holes in memory layout", v3:
x86/setup: don't remove E820_TYPE_RAM for pfn 0
mm: fix initialization of struct page for holes in memory layout
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: optimize objcg stock draining
Shakeel Butt <shakeelb@google.com>:
mm: memcg: fix memcg file_dirty numa stat
mm: fix numa stats for thp migration
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: prevent starvation when writing memory.high
Subsystem: mm/kasan
Lecopzer Chen <lecopzer@gmail.com>:
kasan: fix unaligned address is unhandled in kasan_remove_zero_shadow
kasan: fix incorrect arguments passing in kasan_add_zero_shadow
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix HW_TAGS boot parameters
kasan, mm: fix conflicts with init_on_alloc/free
kasan, mm: fix resetting page_alloc tags for HW_TAGS
Subsystem: ubsan
Arnd Bergmann <arnd@arndb.de>:
ubsan: disable unsigned-overflow check for i386
Subsystem: mm/memory-failure
Dan Williams <dan.j.williams@intel.com>:
mm: fix page reference leak in soft_offline_page()
Subsystem: mm/highmem
Thomas Gleixner <tglx@linutronix.de>:
Patch series "mm/highmem: Fix fallout from generic kmap_local conversions":
sparc/mm/highmem: flush cache and TLB
mm/highmem: prepare for overriding set_pte_at()
mips/mm/highmem: use set_pte() for kmap_local()
powerpc/mm/highmem: use __set_pte_at() for kmap_local()
Subsystem: proc
Xiaoming Ni <nixiaoming@huawei.com>:
proc_sysctl: fix oops caused by incorrect command parameters
Subsystem: MAINTAINERS
Nathan Chancellor <natechancellor@gmail.com>:
MAINTAINERS: add a couple more files to the Clang/LLVM section
Documentation/dev-tools/kasan.rst | 27 ++---------
MAINTAINERS | 2
arch/mips/include/asm/highmem.h | 1
arch/powerpc/include/asm/highmem.h | 2
arch/sparc/include/asm/highmem.h | 9 ++-
arch/x86/kernel/setup.c | 20 +++-----
fs/proc/proc_sysctl.c | 7 ++-
lib/Kconfig.ubsan | 1
mm/highmem.c | 7 ++-
mm/kasan/hw_tags.c | 77 +++++++++++++--------------------
mm/kasan/init.c | 23 +++++----
mm/memcontrol.c | 11 +---
mm/memory-failure.c | 20 ++++++--
mm/migrate.c | 27 ++++++-----
mm/page_alloc.c | 86 ++++++++++++++++++++++---------------
mm/slub.c | 7 +--
16 files changed, 173 insertions(+), 154 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-02-05 2:31 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-02-05 2:31 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
18 patches, based on 5c279c4cf206e03995e04fd3404fa95ffd243a97.
Subsystems affected by this patch series:
mm/hugetlb
mm/compaction
mm/vmalloc
gcov
mm/shmem
mm/memblock
mailmap
mm/pagecache
mm/kasan
ubsan
mm/hugetlb
MAINTAINERS
Subsystem: mm/hugetlb
Muchun Song <songmuchun@bytedance.com>:
mm: hugetlbfs: fix cannot migrate the fallocated HugeTLB page
mm: hugetlb: fix a race between freeing and dissolving the page
mm: hugetlb: fix a race between isolating and freeing page
mm: hugetlb: remove VM_BUG_ON_PAGE from page_huge_active
mm: migrate: do not migrate HugeTLB page whose refcount is one
Subsystem: mm/compaction
Rokudo Yan <wu-yan@tcl.com>:
mm, compaction: move high_pfn to the for loop scope
Subsystem: mm/vmalloc
Rick Edgecombe <rick.p.edgecombe@intel.com>:
mm/vmalloc: separate put pages and flush VM flags
Subsystem: gcov
Johannes Berg <johannes.berg@intel.com>:
init/gcov: allow CONFIG_CONSTRUCTORS on UML to fix module gcov
Subsystem: mm/shmem
Hugh Dickins <hughd@google.com>:
mm: thp: fix MADV_REMOVE deadlock on shmem THP
Subsystem: mm/memblock
Roman Gushchin <guro@fb.com>:
memblock: do not start bottom-up allocations with kernel_end
Subsystem: mailmap
Viresh Kumar <viresh.kumar@linaro.org>:
mailmap: fix name/email for Viresh Kumar
Manivannan Sadhasivam <manivannan.sadhasivam@linaro.org>:
mailmap: add entries for Manivannan Sadhasivam
Subsystem: mm/pagecache
Waiman Long <longman@redhat.com>:
mm/filemap: add missing mem_cgroup_uncharge() to __add_to_page_cache_locked()
Subsystem: mm/kasan
Vincenzo Frascino <vincenzo.frascino@arm.com>:
Patch series "kasan: Fix metadata detection for KASAN_HW_TAGS", v5:
kasan: add explicit preconditions to kasan_report()
kasan: make addr_has_metadata() return true for valid addresses
Subsystem: ubsan
Nathan Chancellor <nathan@kernel.org>:
ubsan: implement __ubsan_handle_alignment_assumption
Subsystem: mm/hugetlb
Muchun Song <songmuchun@bytedance.com>:
mm: hugetlb: fix missing put_page in gather_surplus_pages()
Subsystem: MAINTAINERS
Nathan Chancellor <nathan@kernel.org>:
MAINTAINERS/.mailmap: use my @kernel.org address
.mailmap | 5 ++++
MAINTAINERS | 2 -
fs/hugetlbfs/inode.c | 3 +-
include/linux/hugetlb.h | 2 +
include/linux/kasan.h | 7 ++++++
include/linux/vmalloc.h | 9 +-------
init/Kconfig | 1
init/main.c | 8 ++++++-
kernel/gcov/Kconfig | 2 -
lib/ubsan.c | 31 ++++++++++++++++++++++++++++
lib/ubsan.h | 6 +++++
mm/compaction.c | 3 +-
mm/filemap.c | 4 +++
mm/huge_memory.c | 37 ++++++++++++++++++++-------------
mm/hugetlb.c | 53 ++++++++++++++++++++++++++++++++++++++++++------
mm/kasan/kasan.h | 2 -
mm/memblock.c | 49 +++++---------------------------------------
mm/migrate.c | 6 +++++
18 files changed, 153 insertions(+), 77 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-02-09 21:41 Andrew Morton
2021-02-10 19:30 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2021-02-09 21:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
14 patches, based on e0756cfc7d7cd08c98a53b6009c091a3f6a50be6.
Subsystems affected by this patch series:
squashfs
mm/kasan
firmware
mm/mremap
mm/tmpfs
mm/selftests
MAINTAINERS
mm/memcg
mm/slub
nilfs2
Subsystem: squashfs
Phillip Lougher <phillip@squashfs.org.uk>:
Patch series "Squashfs: fix BIO migration regression and add sanity checks":
squashfs: avoid out of bounds writes in decompressors
squashfs: add more sanity checks in id lookup
squashfs: add more sanity checks in inode lookup
squashfs: add more sanity checks in xattr id lookup
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix stack traces dependency for HW_TAGS
Subsystem: firmware
Fangrui Song <maskray@google.com>:
firmware_loader: align .builtin_fw to 8
Subsystem: mm/mremap
Arnd Bergmann <arnd@arndb.de>:
mm/mremap: fix BUILD_BUG_ON() error in get_extent
Subsystem: mm/tmpfs
Seth Forshee <seth.forshee@canonical.com>:
tmpfs: disallow CONFIG_TMPFS_INODE64 on s390
tmpfs: disallow CONFIG_TMPFS_INODE64 on alpha
Subsystem: mm/selftests
Rong Chen <rong.a.chen@intel.com>:
selftests/vm: rename file run_vmtests to run_vmtests.sh
Subsystem: MAINTAINERS
Andrey Ryabinin <ryabinin.a.a@gmail.com>:
MAINTAINERS: update Andrey Ryabinin's email address
Subsystem: mm/memcg
Johannes Weiner <hannes@cmpxchg.org>:
Revert "mm: memcontrol: avoid workload stalls when lowering memory.high"
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: better heuristic for number of cpus when calculating slab order
Subsystem: nilfs2
Joachim Henke <joachim.henke@t-systems.com>:
nilfs2: make splice write available again
.mailmap | 1
Documentation/dev-tools/kasan.rst | 3 -
MAINTAINERS | 2 -
fs/Kconfig | 4 +-
fs/nilfs2/file.c | 1
fs/squashfs/block.c | 8 ++++
fs/squashfs/export.c | 41 +++++++++++++++++++----
fs/squashfs/id.c | 40 ++++++++++++++++++-----
fs/squashfs/squashfs_fs_sb.h | 1
fs/squashfs/super.c | 6 +--
fs/squashfs/xattr.h | 10 +++++
fs/squashfs/xattr_id.c | 66 ++++++++++++++++++++++++++++++++------
include/asm-generic/vmlinux.lds.h | 2 -
mm/kasan/hw_tags.c | 8 +---
mm/memcontrol.c | 5 +-
mm/mremap.c | 5 +-
mm/slub.c | 18 +++++++++-
17 files changed, 172 insertions(+), 49 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-02-09 21:41 incoming Andrew Morton
@ 2021-02-10 19:30 ` Linus Torvalds
0 siblings, 0 replies; 348+ messages in thread
From: Linus Torvalds @ 2021-02-10 19:30 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
Hah. This series shows a small deficiency in your scripting wrt the diffstat:
On Tue, Feb 9, 2021 at 1:41 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> .mailmap | 1
...
> mm/slub.c | 18 +++++++++-
> 17 files changed, 172 insertions(+), 49 deletions(-)
It actually has 18 files changed, but one of them is a pure rename (no
change to the content), and apparently your diffstat tool can't handle
that case.
It *should* have ended with
...
mm/slub.c | 18 +++++-
.../selftests/vm/{run_vmtests => run_vmtests.sh} | 0
18 files changed, 172 insertions(+), 49 deletions(-)
rename tools/testing/selftests/vm/{run_vmtests => run_vmtests.sh} (100%)
if you'd done a proper "git diff -M --stat --summary" of the series.
[ Ok, by default git would actually have said
18 files changed, 171 insertions(+), 48 deletions(-)
but it looks like you use the patience diff option, which gives that
extra insertion/deletion line because it generates the diff a bit
differently ]
Not a big deal,, but it made me briefly wonder "why doesn't my
diffstat match yours".
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-02-13 4:52 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-02-13 4:52 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
6 patches, based on dcc0b49040c70ad827a7f3d58a21b01fdb14e749.
Subsystems affected by this patch series:
mm/pagemap
scripts
MAINTAINERS
h8300
Subsystem: mm/pagemap
Mike Rapoport <rppt@linux.ibm.com>:
m68k: make __pfn_to_phys() and __phys_to_pfn() available for !MMU
Subsystem: scripts
Rong Chen <rong.a.chen@intel.com>:
scripts/recordmcount.pl: support big endian for ARCH sh
Subsystem: MAINTAINERS
Andrey Konovalov <andreyknvl@google.com>:
MAINTAINERS: update KASAN file list
MAINTAINERS: update Andrey Konovalov's email address
MAINTAINERS: add Andrey Konovalov to KASAN reviewers
Subsystem: h8300
Randy Dunlap <rdunlap@infradead.org>:
h8300: fix PREEMPTION build, TI_PRE_COUNT undefined
MAINTAINERS | 8 +++++---
arch/h8300/kernel/asm-offsets.c | 3 +++
arch/m68k/include/asm/page.h | 2 +-
scripts/recordmcount.pl | 6 +++++-
4 files changed, 14 insertions(+), 5 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-02-24 19:58 Andrew Morton
2021-02-24 21:30 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2021-02-24 19:58 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
A few small subsystems and some of MM.
173 patches, based on c03c21ba6f4e95e406a1a7b4c34ef334b977c194.
Subsystems affected by this patch series:
hexagon
scripts
ntfs
ocfs2
vfs
mm/slab-generic
mm/slab
mm/slub
mm/debug
mm/pagecache
mm/swap
mm/memcg
mm/pagemap
mm/mprotect
mm/mremap
mm/page-reporting
mm/vmalloc
mm/kasan
mm/pagealloc
mm/memory-failure
mm/hugetlb
mm/vmscan
mm/z3fold
mm/compaction
mm/mempolicy
mm/oom-kill
mm/hugetlbfs
mm/migration
Subsystem: hexagon
Randy Dunlap <rdunlap@infradead.org>:
hexagon: remove CONFIG_EXPERIMENTAL from defconfigs
Subsystem: scripts
tangchunyou <tangchunyou@yulong.com>:
scripts/spelling.txt: increase error-prone spell checking
zuoqilin <zuoqilin@yulong.com>:
scripts/spelling.txt: check for "exeeds"
dingsenjie <dingsenjie@yulong.com>:
scripts/spelling.txt: add "allocted" and "exeeds" typo
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ntfs
Randy Dunlap <rdunlap@infradead.org>:
ntfs: layout.h: delete duplicated words
Rustam Kovhaev <rkovhaev@gmail.com>:
ntfs: check for valid standard information attribute
Subsystem: ocfs2
Yi Li <yili@winhong.com>:
ocfs2: remove redundant conditional before iput
guozh <guozh88@chinatelecom.cn>:
ocfs2: clean up some definitions which are not used any more
Dan Carpenter <dan.carpenter@oracle.com>:
ocfs2: fix a use after free on error
Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
ocfs2: simplify the calculation of variables
Subsystem: vfs
Randy Dunlap <rdunlap@infradead.org>:
fs: delete repeated words in comments
Alexey Dobriyan <adobriyan@gmail.com>:
ramfs: support O_TMPFILE
Subsystem: mm/slab-generic
Jacob Wen <jian.w.wen@oracle.com>:
mm, tracing: record slab name for kmem_cache_free()
Nikolay Borisov <nborisov@suse.com>:
mm/sl?b.c: remove ctor argument from kmem_cache_flags
Subsystem: mm/slab
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/slab: minor coding style tweaks
Subsystem: mm/slub
Johannes Berg <johannes.berg@intel.com>:
mm/slub: disable user tracing for kmemleak caches by default
Vlastimil Babka <vbabka@suse.cz>:
Patch series "mm, slab, slub: remove cpu and memory hotplug locks":
mm, slub: stop freeing kmem_cache_node structures on node offline
mm, slab, slub: stop taking memory hotplug lock
mm, slab, slub: stop taking cpu hotplug lock
mm, slub: splice cpu and page freelists in deactivate_slab()
mm, slub: remove slub_memcg_sysfs boot param and CONFIG_SLUB_MEMCG_SYSFS_ON
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/slub: minor coding style tweaks
Subsystem: mm/debug
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/debug: improve memcg debugging
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/debug_vm_pgtable: Some minor updates", v3:
mm/debug_vm_pgtable/basic: add validation for dirtiness after write protect
mm/debug_vm_pgtable/basic: iterate over entire protection_map[]
Miaohe Lin <linmiaohe@huawei.com>:
mm/page_owner: use helper function zone_end_pfn() to get end_pfn
Subsystem: mm/pagecache
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm/filemap: remove unused parameter and change to void type for replace_page_cache_page()
Pavel Begunkov <asml.silence@gmail.com>:
mm/filemap: don't revert iter on -EIOCBQUEUED
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Refactor generic_file_buffered_read", v5:
mm/filemap: rename generic_file_buffered_read subfunctions
mm/filemap: remove dynamically allocated array from filemap_read
mm/filemap: convert filemap_get_pages to take a pagevec
mm/filemap: use head pages in generic_file_buffered_read
mm/filemap: pass a sleep state to put_and_wait_on_page_locked
mm/filemap: support readpage splitting a page
mm/filemap: inline __wait_on_page_locked_async into caller
mm/filemap: don't call ->readpage if IOCB_WAITQ is set
mm/filemap: change filemap_read_page calling conventions
mm/filemap: change filemap_create_page calling conventions
mm/filemap: convert filemap_update_page to return an errno
mm/filemap: move the iocb checks into filemap_update_page
mm/filemap: add filemap_range_uptodate
mm/filemap: split filemap_readahead out of filemap_get_pages
mm/filemap: restructure filemap_get_pages
mm/filemap: don't relock the page after calling readpage
Christoph Hellwig <hch@lst.de>:
mm/filemap: rename generic_file_buffered_read to filemap_read
mm/filemap: simplify generic_file_read_iter
Yang Guo <guoyang2@huawei.com>:
fs/buffer.c: add checking buffer head stat before clear
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: backing-dev: Remove duplicated macro definition
Subsystem: mm/swap
Yang Li <abaci-bugfix@linux.alibaba.com>:
mm/swap_slots.c: remove redundant NULL check
Stephen Zhang <stephenzhangzsd@gmail.com>:
mm/swapfile.c: fix debugging information problem
Georgi Djakov <georgi.djakov@linaro.org>:
mm/page_io: use pr_alert_ratelimited for swap read/write errors
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
mm/swap_state: constify static struct attribute_group
Yu Zhao <yuzhao@google.com>:
mm/swap: don't SetPageWorkingset unconditionally during swapin
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: pre-allocate obj_cgroups for slab caches with SLAB_ACCOUNT
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: optimize per-lruvec stats counter memory usage
Patch series "Convert all THP vmstat counters to pages", v6:
mm: memcontrol: fix NR_ANON_THPS accounting in charge moving
mm: memcontrol: convert NR_ANON_THPS account to pages
mm: memcontrol: convert NR_FILE_THPS account to pages
mm: memcontrol: convert NR_SHMEM_THPS account to pages
mm: memcontrol: convert NR_SHMEM_PMDMAPPED account to pages
mm: memcontrol: convert NR_FILE_PMDMAPPED account to pages
mm: memcontrol: make the slab calculation consistent
Alex Shi <alex.shi@linux.alibaba.com>:
mm/memcg: revise the using condition of lock_page_lruvec function series
mm/memcg: remove rcu locking for lock_page_lruvec function series
Shakeel Butt <shakeelb@google.com>:
mm: memcg: add swapcache stat for memcg v2
Roman Gushchin <guro@fb.com>:
mm: kmem: make __memcg_kmem_(un)charge static
Feng Tang <feng.tang@intel.com>:
mm: page_counter: re-layout structure to reduce false sharing
Yang Li <abaci-bugfix@linux.alibaba.com>:
mm/memcontrol: remove redundant NULL check
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: replace the loop with a list_for_each_entry()
Shakeel Butt <shakeelb@google.com>:
mm/list_lru.c: remove kvfree_rcu_local()
Johannes Weiner <hannes@cmpxchg.org>:
fs: buffer: use raw page_memcg() on locked page
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: fix swap undercounting in cgroup2
mm: memcontrol: fix get_active_memcg return value
mm: memcontrol: fix slub memory accounting
Subsystem: mm/pagemap
Adrian Huang <ahuang12@lenovo.com>:
mm/mmap.c: remove unnecessary local variable
Miaohe Lin <linmiaohe@huawei.com>:
mm/memory.c: fix potential pte_unmap_unlock pte error
mm/pgtable-generic.c: simplify the VM_BUG_ON condition in pmdp_huge_clear_flush()
mm/pgtable-generic.c: optimize the VM_BUG_ON condition in pmdp_huge_clear_flush()
mm/memory.c: fix potential pte_unmap_unlock pte error
Subsystem: mm/mprotect
Tianjia Zhang <tianjia.zhang@linux.alibaba.com>:
mm/mprotect.c: optimize error detection in do_mprotect_pkey()
Subsystem: mm/mremap
Li Xinhai <lixinhai.lxh@gmail.com>:
mm: rmap: explicitly reset vma->anon_vma in unlink_anon_vmas()
mm: mremap: unlink anon_vmas when mremap with MREMAP_DONTUNMAP success
Subsystem: mm/page-reporting
sh <sh_def@163.com>:
mm/page_reporting: use list_entry_is_head() in page_reporting_cycle()
Subsystem: mm/vmalloc
Yang Li <abaci-bugfix@linux.alibaba.com>:
vmalloc: remove redundant NULL check
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: HW_TAGS tests support and fixes", v4:
kasan: prefix global functions with kasan_
kasan: clarify HW_TAGS impact on TBI
kasan: clean up comments in tests
kasan: add macros to simplify checking test constraints
kasan: add match-all tag tests
kasan, arm64: allow using KUnit tests with HW_TAGS mode
kasan: rename CONFIG_TEST_KASAN_MODULE
kasan: add compiler barriers to KUNIT_EXPECT_KASAN_FAIL
kasan: adapt kmalloc_uaf2 test to HW_TAGS mode
kasan: fix memory corruption in kasan_bitops_tags test
kasan: move _RET_IP_ to inline wrappers
kasan: fix bug detection via ksize for HW_TAGS mode
kasan: add proper page allocator tests
kasan: add a test for kmem_cache_alloc/free_bulk
kasan: don't run tests when KASAN is not enabled
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: remove redundant config option
Subsystem: mm/pagealloc
Baoquan He <bhe@redhat.com>:
Patch series "mm: clean up names and parameters of memmap_init_xxxx functions", v5:
mm: fix prototype warning from kernel test robot
mm: rename memmap_init() and memmap_init_zone()
mm: simplify parater of function memmap_init_zone()
mm: simplify parameter of setup_usemap()
mm: remove unneeded local variable in free_area_init_core
David Hildenbrand <david@redhat.com>:
Patch series "mm: simplify free_highmem_page() and free_reserved_page()":
video: fbdev: acornfb: remove free_unused_pages()
mm: simplify free_highmem_page() and free_reserved_page()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/gfp: add kernel-doc for gfp_t
Subsystem: mm/memory-failure
Aili Yao <yaoaili@kingsoft.com>:
mm,hwpoison: send SIGBUS to PF_MCE_EARLY processes on action required events
Subsystem: mm/hugetlb
Bibo Mao <maobibo@loongson.cn>:
mm/huge_memory.c: update tlb entry if pmd is changed
MIPS: do not call flush_tlb_all when setting pmd entry
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: fix potential double free in hugetlb_register_node() error path
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/hugetlb.c: fix unnecessary address expansion of pmd sharing
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: avoid unnecessary hugetlb_acct_memory() call
mm/hugetlb: use helper huge_page_order and pages_per_huge_page
mm/hugetlb: fix use after free when subpool max_hpages accounting is not enabled
Jiapeng Zhong <abaci-bugfix@linux.alibaba.com>:
mm/hugetlb: simplify the calculation of variables
Joao Martins <joao.m.martins@oracle.com>:
Patch series "mm/hugetlb: follow_hugetlb_page() improvements", v2:
mm/hugetlb: grab head page refcount once for group of subpages
mm/hugetlb: refactor subpage recording
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: fix some comment typos
Yanfei Xu <yanfei.xu@windriver.com>:
mm/hugetlb: remove redundant check in preparing and destroying gigantic page
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/hugetlb.c: fix typos in comments
Miaohe Lin <linmiaohe@huawei.com>:
mm/huge_memory.c: remove unused return value of set_huge_zero_page()
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/pmem: avoid inserting hugepage PTE entry with fsdax if hugepage support is disabled
Miaohe Lin <linmiaohe@huawei.com>:
hugetlb_cgroup: use helper pages_per_huge_page() in hugetlb_cgroup
mm/hugetlb: use helper function range_in_vma() in page_table_shareable()
mm/hugetlb: remove unnecessary VM_BUG_ON_PAGE on putback_active_hugepage()
mm/hugetlb: use helper huge_page_size() to get hugepage size
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: fix update_and_free_page contig page struct assumption
hugetlb: fix copy_huge_page_from_user contig page struct assumption
Chen Wandun <chenwandun@huawei.com>:
mm/hugetlb: suppress wrong warning info when alloc gigantic page
Subsystem: mm/vmscan
Alex Shi <alex.shi@linux.alibaba.com>:
mm/vmscan: __isolate_lru_page_prepare() cleanup
Miaohe Lin <linmiaohe@huawei.com>:
mm/workingset.c: avoid unnecessary max_nodes estimation in count_shadow_nodes()
Yu Zhao <yuzhao@google.com>:
Patch series "mm: lru related cleanups", v2:
mm/vmscan.c: use add_page_to_lru_list()
include/linux/mm_inline.h: shuffle lru list addition and deletion functions
mm: don't pass "enum lru_list" to lru list addition functions
mm/swap.c: don't pass "enum lru_list" to trace_mm_lru_insertion()
mm/swap.c: don't pass "enum lru_list" to del_page_from_lru_list()
mm: add __clear_page_lru_flags() to replace page_off_lru()
mm: VM_BUG_ON lru page flags
include/linux/mm_inline.h: fold page_lru_base_type() into its sole caller
include/linux/mm_inline.h: fold __update_lru_size() into its sole caller
mm/vmscan.c: make lruvec_lru_size() static
Oscar Salvador <osalvador@suse.de>:
mm: workingset: clarify eviction order and distance calculation
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "create hugetlb flags to consolidate state", v3:
hugetlb: use page.private for hugetlb specific page flags
hugetlb: convert page_huge_active() HPageMigratable flag
hugetlb: convert PageHugeTemporary() to HPageTemporary flag
hugetlb: convert PageHugeFreed to HPageFreed flag
include/linux/hugetlb.h: add synchronization information for new hugetlb specific flags
hugetlb: fix uninitialized subpool pointer
Dave Hansen <dave.hansen@linux.intel.com>:
mm/vmscan: restore zone_reclaim_mode ABI
Subsystem: mm/z3fold
Miaohe Lin <linmiaohe@huawei.com>:
z3fold: remove unused attribute for release_z3fold_page
z3fold: simplify the zhdr initialization code in init_z3fold_page()
Subsystem: mm/compaction
Alex Shi <alex.shi@linux.alibaba.com>:
mm/compaction: remove rcu_read_lock during page compaction
Miaohe Lin <linmiaohe@huawei.com>:
mm/compaction: remove duplicated VM_BUG_ON_PAGE !PageLocked
Charan Teja Reddy <charante@codeaurora.org>:
mm/compaction: correct deferral logic for proactive compaction
Wonhyuk Yang <vvghjk1234@gmail.com>:
mm/compaction: fix misbehaviors of fast_find_migrateblock()
Vlastimil Babka <vbabka@suse.cz>:
mm, compaction: make fast_isolate_freepages() stay within zone
Subsystem: mm/mempolicy
Huang Ying <ying.huang@intel.com>:
numa balancing: migrate on fault among multiple bound nodes
Miaohe Lin <linmiaohe@huawei.com>:
mm/mempolicy: use helper range_in_vma() in queue_pages_test_walk()
Subsystem: mm/oom-kill
Tang Yizhou <tangyizhou@huawei.com>:
mm, oom: fix a comment in dump_task()
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
mm/hugetlb: change hugetlb_reserve_pages() to type bool
hugetlbfs: remove special hugetlbfs_set_page_dirty()
Miaohe Lin <linmiaohe@huawei.com>:
hugetlbfs: remove useless BUG_ON(!inode) in hugetlbfs_setattr()
hugetlbfs: use helper macro default_hstate in init_hugetlbfs_fs
hugetlbfs: correct obsolete function name in hugetlbfs_read_iter()
hugetlbfs: remove meaningless variable avoid_reserve
hugetlbfs: make hugepage size conversion more readable
hugetlbfs: correct some obsolete comments about inode i_mutex
hugetlbfs: fix some comment typos
hugetlbfs: remove unneeded return value of hugetlb_vmtruncate()
Subsystem: mm/migration
Chengyang Fan <cy.fan@huawei.com>:
mm/migrate: remove unneeded semicolons
Documentation/admin-guide/cgroup-v2.rst | 4
Documentation/admin-guide/kernel-parameters.txt | 8
Documentation/admin-guide/sysctl/vm.rst | 10
Documentation/core-api/mm-api.rst | 7
Documentation/dev-tools/kasan.rst | 24
Documentation/vm/arch_pgtable_helpers.rst | 8
arch/arm64/include/asm/memory.h | 1
arch/arm64/include/asm/mte-kasan.h | 12
arch/arm64/kernel/mte.c | 12
arch/arm64/kernel/sleep.S | 2
arch/arm64/mm/fault.c | 20
arch/hexagon/configs/comet_defconfig | 1
arch/ia64/include/asm/pgtable.h | 6
arch/ia64/mm/init.c | 18
arch/mips/mm/pgtable-32.c | 1
arch/mips/mm/pgtable-64.c | 1
arch/x86/kernel/acpi/wakeup_64.S | 2
drivers/base/node.c | 33
drivers/video/fbdev/acornfb.c | 34
fs/block_dev.c | 2
fs/btrfs/file.c | 2
fs/buffer.c | 7
fs/dcache.c | 4
fs/direct-io.c | 4
fs/exec.c | 4
fs/fhandle.c | 2
fs/fuse/dev.c | 6
fs/hugetlbfs/inode.c | 72 --
fs/ntfs/inode.c | 6
fs/ntfs/layout.h | 4
fs/ocfs2/cluster/heartbeat.c | 8
fs/ocfs2/dlm/dlmast.c | 10
fs/ocfs2/dlm/dlmcommon.h | 4
fs/ocfs2/refcounttree.c | 2
fs/ocfs2/super.c | 2
fs/pipe.c | 2
fs/proc/meminfo.c | 10
fs/proc/vmcore.c | 7
fs/ramfs/inode.c | 13
include/linux/fs.h | 4
include/linux/gfp.h | 14
include/linux/highmem-internal.h | 5
include/linux/huge_mm.h | 15
include/linux/hugetlb.h | 98 ++
include/linux/kasan-checks.h | 6
include/linux/kasan.h | 39 -
include/linux/memcontrol.h | 43 -
include/linux/migrate.h | 2
include/linux/mm.h | 28
include/linux/mm_inline.h | 123 +--
include/linux/mmzone.h | 30
include/linux/page-flags.h | 6
include/linux/page_counter.h | 9
include/linux/pagemap.h | 5
include/linux/swap.h | 8
include/trace/events/kmem.h | 24
include/trace/events/pagemap.h | 11
include/uapi/linux/mempolicy.h | 4
init/Kconfig | 14
lib/Kconfig.kasan | 14
lib/Makefile | 2
lib/test_kasan.c | 446 ++++++++----
lib/test_kasan_module.c | 5
mm/backing-dev.c | 6
mm/compaction.c | 73 +-
mm/debug.c | 10
mm/debug_vm_pgtable.c | 86 ++
mm/filemap.c | 859 +++++++++++-------------
mm/gup.c | 5
mm/huge_memory.c | 28
mm/hugetlb.c | 376 ++++------
mm/hugetlb_cgroup.c | 6
mm/kasan/common.c | 60 -
mm/kasan/generic.c | 40 -
mm/kasan/hw_tags.c | 16
mm/kasan/kasan.h | 87 +-
mm/kasan/quarantine.c | 22
mm/kasan/report.c | 15
mm/kasan/report_generic.c | 10
mm/kasan/report_hw_tags.c | 8
mm/kasan/report_sw_tags.c | 8
mm/kasan/shadow.c | 27
mm/kasan/sw_tags.c | 22
mm/khugepaged.c | 6
mm/list_lru.c | 12
mm/memcontrol.c | 309 ++++----
mm/memory-failure.c | 34
mm/memory.c | 24
mm/memory_hotplug.c | 11
mm/mempolicy.c | 18
mm/mempool.c | 2
mm/migrate.c | 10
mm/mlock.c | 3
mm/mmap.c | 4
mm/mprotect.c | 7
mm/mremap.c | 8
mm/oom_kill.c | 5
mm/page_alloc.c | 70 -
mm/page_io.c | 12
mm/page_owner.c | 4
mm/page_reporting.c | 2
mm/pgtable-generic.c | 9
mm/rmap.c | 35
mm/shmem.c | 2
mm/slab.c | 21
mm/slab.h | 20
mm/slab_common.c | 40 -
mm/slob.c | 2
mm/slub.c | 169 ++--
mm/swap.c | 54 -
mm/swap_slots.c | 3
mm/swap_state.c | 31
mm/swapfile.c | 8
mm/vmscan.c | 100 +-
mm/vmstat.c | 14
mm/workingset.c | 7
mm/z3fold.c | 11
scripts/Makefile.kasan | 10
scripts/spelling.txt | 30
tools/objtool/check.c | 2
120 files changed, 2249 insertions(+), 1954 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-02-24 19:58 incoming Andrew Morton
@ 2021-02-24 21:30 ` Linus Torvalds
2021-02-24 21:37 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2021-02-24 21:30 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Wed, Feb 24, 2021 at 11:58 AM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> A few small subsystems and some of MM.
Hmm. I haven't bisected things yet, but I suspect it's something with
the KASAN patches. With this all applied, I get:
lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
and
lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
larger than 2048 bytes [-Wframe-larger-than=]
which is obviously not really acceptable. A 11kB stack frame _will_
cause issues.
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-02-24 21:30 ` incoming Linus Torvalds
@ 2021-02-24 21:37 ` Linus Torvalds
2021-02-25 8:53 ` incoming Arnd Bergmann
0 siblings, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2021-02-24 21:37 UTC (permalink / raw)
To: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor,
Arnd Bergmann, Andrey Konovalov
Cc: Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko
On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Hmm. I haven't bisected things yet, but I suspect it's something with
> the KASAN patches. With this all applied, I get:
>
> lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
>
> and
>
> lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> larger than 2048 bytes [-Wframe-larger-than=]
>
> which is obviously not really acceptable. A 11kB stack frame _will_
> cause issues.
A quick bisect shoes that this was introduced by "[patch 101/173]
kasan: remove redundant config option".
I didn't check what part of that patch screws up, but it's definitely
doing something bad.
I will drop that patch.
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-02-24 21:37 ` incoming Linus Torvalds
@ 2021-02-25 8:53 ` Arnd Bergmann
2021-02-25 9:12 ` incoming Andrey Ryabinin
0 siblings, 1 reply; 348+ messages in thread
From: Arnd Bergmann @ 2021-02-25 8:53 UTC (permalink / raw)
To: Linus Torvalds
Cc: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor,
Arnd Bergmann, Andrey Konovalov, Linux-MM, mm-commits,
Andrey Ryabinin, Alexander Potapenko
On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > Hmm. I haven't bisected things yet, but I suspect it's something with
> > the KASAN patches. With this all applied, I get:
> >
> > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> >
> > and
> >
> > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > larger than 2048 bytes [-Wframe-larger-than=]
> >
> > which is obviously not really acceptable. A 11kB stack frame _will_
> > cause issues.
>
> A quick bisect shoes that this was introduced by "[patch 101/173]
> kasan: remove redundant config option".
>
> I didn't check what part of that patch screws up, but it's definitely
> doing something bad.
I'm not sure why that patch surfaced the bug, but it's worth pointing
out that the underlying problem is asan-stack in combination
with the structleak plugin. This will happen for every user of kunit.
I sent a series[1] out earlier this year to turn off the structleak
plugin as an alternative workaround, but need to follow up on
the remaining patches. Someone suggested adding a more
generic way to turn off the plugin for a file instead of open-coding
the CLFAGS_REMOVE_*.o Makefile bit, which would help.
I am also still hoping that someone can come up with a way
to make kunit work better with the structleak plugin, as there
shouldn't be a fundamental reason why it can't work, just that
it the code pattern triggers a particularly bad case in the compiler.
Arnd
[1] https://lore.kernel.org/lkml/20210125124533.101339-1-arnd@kernel.org/
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-02-25 8:53 ` incoming Arnd Bergmann
@ 2021-02-25 9:12 ` Andrey Ryabinin
2021-02-25 11:07 ` incoming Walter Wu
0 siblings, 1 reply; 348+ messages in thread
From: Andrey Ryabinin @ 2021-02-25 9:12 UTC (permalink / raw)
To: Arnd Bergmann
Cc: Linus Torvalds, Andrew Morton, Walter Wu, Dmitry Vyukov,
Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM,
mm-commits, Andrey Ryabinin, Alexander Potapenko
On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote:
>
> On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> > <torvalds@linux-foundation.org> wrote:
> > >
> > > Hmm. I haven't bisected things yet, but I suspect it's something with
> > > the KASAN patches. With this all applied, I get:
> > >
> > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> > >
> > > and
> > >
> > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > > larger than 2048 bytes [-Wframe-larger-than=]
> > >
> > > which is obviously not really acceptable. A 11kB stack frame _will_
> > > cause issues.
> >
> > A quick bisect shoes that this was introduced by "[patch 101/173]
> > kasan: remove redundant config option".
> >
> > I didn't check what part of that patch screws up, but it's definitely
> > doing something bad.
>
> I'm not sure why that patch surfaced the bug, but it's worth pointing
> out that the underlying problem is asan-stack in combination
> with the structleak plugin. This will happen for every user of kunit.
>
The patch didn't update KASAN_STACK dependency in kconfig:
config GCC_PLUGIN_STRUCTLEAK_BYREF
....
depends on !(KASAN && KASAN_STACK=1)
This 'depends on' stopped working with the patch
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-02-25 9:12 ` incoming Andrey Ryabinin
@ 2021-02-25 11:07 ` Walter Wu
0 siblings, 0 replies; 348+ messages in thread
From: Walter Wu @ 2021-02-25 11:07 UTC (permalink / raw)
To: Andrey Ryabinin
Cc: Arnd Bergmann, Linus Torvalds, Andrew Morton, Dmitry Vyukov,
Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM,
mm-commits, Andrey Ryabinin, Alexander Potapenko
Hi Andrey,
On Thu, 2021-02-25 at 12:12 +0300, Andrey Ryabinin wrote:
> On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote:
> >
> > On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
> > <torvalds@linux-foundation.org> wrote:
> > >
> > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> > > <torvalds@linux-foundation.org> wrote:
> > > >
> > > > Hmm. I haven't bisected things yet, but I suspect it's something with
> > > > the KASAN patches. With this all applied, I get:
> > > >
> > > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > > > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> > > >
> > > > and
> > > >
> > > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > > > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > > > larger than 2048 bytes [-Wframe-larger-than=]
> > > >
> > > > which is obviously not really acceptable. A 11kB stack frame _will_
> > > > cause issues.
> > >
> > > A quick bisect shoes that this was introduced by "[patch 101/173]
> > > kasan: remove redundant config option".
> > >
> > > I didn't check what part of that patch screws up, but it's definitely
> > > doing something bad.
> >
> > I'm not sure why that patch surfaced the bug, but it's worth pointing
> > out that the underlying problem is asan-stack in combination
> > with the structleak plugin. This will happen for every user of kunit.
> >
>
> The patch didn't update KASAN_STACK dependency in kconfig:
> config GCC_PLUGIN_STRUCTLEAK_BYREF
> ....
> depends on !(KASAN && KASAN_STACK=1)
>
> This 'depends on' stopped working with the patch
Thanks for pointing out this problem. I will re-send that patch.
Walter
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-02-26 1:14 Andrew Morton
2021-02-26 17:55 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2021-02-26 1:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- The rest of MM.
Includes kfence - another runtime memory validator. Not as
thorough as KASAN, but it has unmeasurable overhead and is intended
to be usable in production builds.
- Everything else
118 patches, based on 6fbd6cf85a3be127454a1ad58525a3adcf8612ab.
Subsystems affected by this patch series:
mm/thp
mm/cma
mm/vmstat
mm/memory-hotplug
mm/mlock
mm/rmap
mm/zswap
mm/zsmalloc
mm/cleanups
mm/kfence
mm/kasan2
alpha
procfs
sysctl
misc
core-kernel
MAINTAINERS
lib
bitops
checkpatch
init
coredump
seq_file
gdb
ubsan
initramfs
mm/pagemap2
Subsystem: mm/thp
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Overhaul multi-page lookups for THP", v4:
mm: make pagecache tagged lookups return only head pages
mm/shmem: use pagevec_lookup in shmem_unlock_mapping
mm/swap: optimise get_shadow_from_swap_cache
mm: add FGP_ENTRY
mm/filemap: rename find_get_entry to mapping_get_entry
mm/filemap: add helper for finding pages
mm/filemap: add mapping_seek_hole_data
iomap: use mapping_seek_hole_data
mm: add and use find_lock_entries
mm: add an 'end' parameter to find_get_entries
mm: add an 'end' parameter to pagevec_lookup_entries
mm: remove nr_entries parameter from pagevec_lookup_entries
mm: pass pvec directly to find_get_entries
mm: remove pagevec_lookup_entries
Rik van Riel <riel@surriel.com>:
Patch series "mm,thp,shm: limit shmem THP alloc gfp_mask", v6:
mm,thp,shmem: limit shmem THP alloc gfp_mask
mm,thp,shm: limit gfp mask to no more than specified
mm,thp,shmem: make khugepaged obey tmpfs mount flags
mm,shmem,thp: limit shmem THP allocations to requested zones
Subsystem: mm/cma
Roman Gushchin <guro@fb.com>:
mm: cma: allocate cma areas bottom-up
David Hildenbrand <david@redhat.com>:
mm/cma: expose all pages to the buddy if activation of an area fails
mm/page_alloc: count CMA pages per zone and print them in /proc/zoneinfo
Patrick Daly <pdaly@codeaurora.org>:
mm: cma: print region name on failure
Subsystem: mm/vmstat
Johannes Weiner <hannes@cmpxchg.org>:
mm: vmstat: fix NOHZ wakeups for node stat changes
mm: vmstat: add some comments on internal storage of byte items
Jiang Biao <benbjiang@tencent.com>:
mm/vmstat.c: erase latency in vmstat_shepherd
Subsystem: mm/memory-hotplug
Dan Williams <dan.j.williams@intel.com>:
Patch series "mm: Fix pfn_to_online_page() with respect to ZONE_DEVICE", v4:
mm: move pfn_to_online_page() out of line
mm: teach pfn_to_online_page() to consider subsection validity
mm: teach pfn_to_online_page() about ZONE_DEVICE section collisions
mm: fix memory_failure() handling of dax-namespace metadata
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/memory_hotplug: rename all existing 'memhp' into 'mhp'
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: MEMHP_MERGE_RESOURCE -> MHP_MERGE_RESOURCE
Miaohe Lin <linmiaohe@huawei.com>:
mm/memory_hotplug: use helper function zone_end_pfn() to get end_pfn
David Hildenbrand <david@redhat.com>:
drivers/base/memory: don't store phys_device in memory blocks
Documentation: sysfs/memory: clarify some memory block device properties
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/memory_hotplug: Pre-validate the address range with platform", v5:
mm/memory_hotplug: prevalidate the address range being added with platform
arm64/mm: define arch_get_mappable_range()
s390/mm: define arch_get_mappable_range()
David Hildenbrand <david@redhat.com>:
virtio-mem: check against mhp_get_pluggable_range() which memory we can hotplug
Subsystem: mm/mlock
Miaohe Lin <linmiaohe@huawei.com>:
mm/mlock: stop counting mlocked pages when none vma is found
Subsystem: mm/rmap
Miaohe Lin <linmiaohe@huawei.com>:
mm/rmap: correct some obsolete comments of anon_vma
mm/rmap: remove unneeded semicolon in page_not_mapped()
mm/rmap: fix obsolete comment in __page_check_anon_rmap()
mm/rmap: use page_not_mapped in try_to_unmap()
mm/rmap: correct obsolete comment of page_get_anon_vma()
mm/rmap: fix potential pte_unmap on an not mapped pte
Subsystem: mm/zswap
Randy Dunlap <rdunlap@infradead.org>:
mm: zswap: clean up confusing comment
Tian Tao <tiantao6@hisilicon.com>:
Patch series "Fix the compatibility of zsmalloc and zswap":
mm/zswap: add the flag can_sleep_mapped
mm: set the sleep_mapped to true for zbud and z3fold
Subsystem: mm/zsmalloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/zsmalloc.c: convert to use kmem_cache_zalloc in cache_alloc_zspage()
Rokudo Yan <wu-yan@tcl.com>:
zsmalloc: account the number of compacted pages correctly
Miaohe Lin <linmiaohe@huawei.com>:
mm/zsmalloc.c: use page_private() to access page->private
Subsystem: mm/cleanups
Guo Ren <guoren@linux.alibaba.com>:
mm: page-flags.h: Typo fix (It -> If)
Daniel Vetter <daniel.vetter@ffwll.ch>:
mm/dmapool: use might_alloc()
mm/backing-dev.c: use might_alloc()
Stephen Zhang <stephenzhangzsd@gmail.com>:
mm/early_ioremap.c: use __func__ instead of function name
Subsystem: mm/kfence
Alexander Potapenko <glider@google.com>:
Patch series "KFENCE: A low-overhead sampling-based memory safety error detector", v7:
mm: add Kernel Electric-Fence infrastructure
x86, kfence: enable KFENCE for x86
Marco Elver <elver@google.com>:
arm64, kfence: enable KFENCE for ARM64
kfence: use pt_regs to generate stack trace on faults
Alexander Potapenko <glider@google.com>:
mm, kfence: insert KFENCE hooks for SLAB
mm, kfence: insert KFENCE hooks for SLUB
kfence, kasan: make KFENCE compatible with KASAN
Marco Elver <elver@google.com>:
kfence, Documentation: add KFENCE documentation
kfence: add test suite
MAINTAINERS: add entry for KFENCE
kfence: report sensitive information based on no_hash_pointers
Alexander Potapenko <glider@google.com>:
Patch series "Add error_report_end tracepoint to KFENCE and KASAN", v3:
tracing: add error_report_end trace point
kfence: use error_report_end tracepoint
kasan: use error_report_end tracepoint
Subsystem: mm/kasan2
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: optimizations and fixes for HW_TAGS", v4:
kasan, mm: don't save alloc stacks twice
kasan, mm: optimize kmalloc poisoning
kasan: optimize large kmalloc poisoning
kasan: clean up setting free info in kasan_slab_free
kasan: unify large kfree checks
kasan: rework krealloc tests
kasan, mm: fail krealloc on freed objects
kasan, mm: optimize krealloc poisoning
kasan: ensure poisoning size alignment
arm64: kasan: simplify and inline MTE functions
kasan: inline HW_TAGS helper functions
kasan: clarify that only first bug is reported in HW_TAGS
Subsystem: alpha
Randy Dunlap <rdunlap@infradead.org>:
alpha: remove CONFIG_EXPERIMENTAL from defconfigs
Subsystem: procfs
Helge Deller <deller@gmx.de>:
proc/wchan: use printk format instead of lookup_symbol_name()
Josef Bacik <josef@toxicpanda.com>:
proc: use kvzalloc for our kernel buffer
Subsystem: sysctl
Lin Feng <linf@wangsu.com>:
sysctl.c: fix underflow value setting risk in vm_table
Subsystem: misc
Randy Dunlap <rdunlap@infradead.org>:
include/linux: remove repeated words
Miguel Ojeda <ojeda@kernel.org>:
treewide: Miguel has moved
Subsystem: core-kernel
Hubert Jasudowicz <hubert.jasudowicz@gmail.com>:
groups: use flexible-array member in struct group_info
groups: simplify struct group_info allocation
Randy Dunlap <rdunlap@infradead.org>:
kernel: delete repeated words in comments
Subsystem: MAINTAINERS
Vlastimil Babka <vbabka@suse.cz>:
MAINTAINERS: add uapi directories to API/ABI section
Subsystem: lib
Huang Shijie <sjhuang@iluvatar.ai>:
lib/genalloc.c: change return type to unsigned long for bitmap_set_ll
Francis Laniel <laniel_francis@privacyrequired.com>:
string.h: move fortified functions definitions in a dedicated header.
Yogesh Lal <ylal@codeaurora.org>:
lib: stackdepot: add support to configure STACK_HASH_SIZE
Vijayanand Jitta <vjitta@codeaurora.org>:
lib: stackdepot: add support to disable stack depot
lib: stackdepot: fix ignoring return value warning
Masahiro Yamada <masahiroy@kernel.org>:
lib/cmdline: remove an unneeded local variable in next_arg()
Subsystem: bitops
Geert Uytterhoeven <geert+renesas@glider.be>:
include/linux/bitops.h: spelling s/synomyn/synonym/
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: improve blank line after declaration test
Peng Wang <rocking@linux.alibaba.com>:
checkpatch: ignore warning designated initializers using NR_CPUS
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: trivial style fixes
Joe Perches <joe@perches.com>:
checkpatch: prefer ftrace over function entry/exit printks
checkpatch: improve TYPECAST_INT_CONSTANT test message
Aditya Srivastava <yashsri421@gmail.com>:
checkpatch: add warning for avoiding .L prefix symbols in assembly files
Joe Perches <joe@perches.com>:
checkpatch: add kmalloc_array_node to unnecessary OOM message check
Chris Down <chris@chrisdown.name>:
checkpatch: don't warn about colon termination in linker scripts
Song Liu <songliubraving@fb.com>:
checkpatch: do not apply "initialise globals to 0" check to BPF progs
Subsystem: init
Masahiro Yamada <masahiroy@kernel.org>:
init/version.c: remove Version_<LINUX_VERSION_CODE> symbol
init: clean up early_param_on_off() macro
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
init/Kconfig: fix a typo in CC_VERSION_TEXT help text
Subsystem: coredump
Ira Weiny <ira.weiny@intel.com>:
fs/coredump: use kmap_local_page()
Subsystem: seq_file
NeilBrown <neilb@suse.de>:
Patch series "Fix some seq_file users that were recently broken":
seq_file: document how per-entry resources are managed.
x86: fix seq_file iteration for pat/memtype.c
Subsystem: gdb
George Prekas <prekageo@amazon.com>:
scripts/gdb: fix list_for_each
Sumit Garg <sumit.garg@linaro.org>:
kgdb: fix to kill breakpoints on initmem after boot
Subsystem: ubsan
Andrey Ryabinin <ryabinin.a.a@gmail.com>:
ubsan: remove overflow checks
Subsystem: initramfs
Florian Fainelli <f.fainelli@gmail.com>:
initramfs: panic with memory information
Subsystem: mm/pagemap2
Huang Pei <huangpei@loongson.cn>:
MIPS: make userspace mapping young by default
.mailmap | 1
CREDITS | 9
Documentation/ABI/testing/sysfs-devices-memory | 58 -
Documentation/admin-guide/auxdisplay/cfag12864b.rst | 2
Documentation/admin-guide/auxdisplay/ks0108.rst | 2
Documentation/admin-guide/kernel-parameters.txt | 6
Documentation/admin-guide/mm/memory-hotplug.rst | 20
Documentation/dev-tools/index.rst | 1
Documentation/dev-tools/kasan.rst | 8
Documentation/dev-tools/kfence.rst | 318 +++++++
Documentation/filesystems/seq_file.rst | 6
MAINTAINERS | 26
arch/alpha/configs/defconfig | 1
arch/arm64/Kconfig | 1
arch/arm64/include/asm/cache.h | 1
arch/arm64/include/asm/kasan.h | 1
arch/arm64/include/asm/kfence.h | 26
arch/arm64/include/asm/mte-def.h | 2
arch/arm64/include/asm/mte-kasan.h | 65 +
arch/arm64/include/asm/mte.h | 2
arch/arm64/kernel/mte.c | 46 -
arch/arm64/lib/mte.S | 16
arch/arm64/mm/fault.c | 8
arch/arm64/mm/mmu.c | 23
arch/mips/mm/cache.c | 30
arch/s390/mm/init.c | 1
arch/s390/mm/vmem.c | 14
arch/x86/Kconfig | 1
arch/x86/include/asm/kfence.h | 76 +
arch/x86/mm/fault.c | 10
arch/x86/mm/pat/memtype.c | 4
drivers/auxdisplay/cfag12864b.c | 4
drivers/auxdisplay/cfag12864bfb.c | 4
drivers/auxdisplay/ks0108.c | 4
drivers/base/memory.c | 35
drivers/block/zram/zram_drv.c | 2
drivers/hv/hv_balloon.c | 2
drivers/virtio/virtio_mem.c | 43
drivers/xen/balloon.c | 2
fs/coredump.c | 4
fs/iomap/seek.c | 125 --
fs/proc/base.c | 21
fs/proc/proc_sysctl.c | 4
include/linux/bitops.h | 2
include/linux/cfag12864b.h | 2
include/linux/cred.h | 2
include/linux/fortify-string.h | 302 ++++++
include/linux/gfp.h | 2
include/linux/init.h | 4
include/linux/kasan.h | 25
include/linux/kfence.h | 230 +++++
include/linux/kgdb.h | 2
include/linux/khugepaged.h | 2
include/linux/ks0108.h | 2
include/linux/mdev.h | 2
include/linux/memory.h | 3
include/linux/memory_hotplug.h | 33
include/linux/memremap.h | 6
include/linux/mmzone.h | 49 -
include/linux/page-flags.h | 4
include/linux/pagemap.h | 10
include/linux/pagevec.h | 10
include/linux/pgtable.h | 8
include/linux/ptrace.h | 2
include/linux/rmap.h | 3
include/linux/slab_def.h | 3
include/linux/slub_def.h | 3
include/linux/stackdepot.h | 9
include/linux/string.h | 282 ------
include/linux/vmstat.h | 6
include/linux/zpool.h | 3
include/linux/zsmalloc.h | 2
include/trace/events/error_report.h | 74 +
include/uapi/linux/firewire-cdev.h | 2
include/uapi/linux/input.h | 2
init/Kconfig | 2
init/initramfs.c | 19
init/main.c | 6
init/version.c | 8
kernel/debug/debug_core.c | 11
kernel/events/core.c | 8
kernel/events/uprobes.c | 2
kernel/groups.c | 7
kernel/locking/rtmutex.c | 4
kernel/locking/rwsem.c | 2
kernel/locking/semaphore.c | 2
kernel/sched/fair.c | 2
kernel/sched/membarrier.c | 2
kernel/sysctl.c | 8
kernel/trace/Makefile | 1
kernel/trace/error_report-traces.c | 12
lib/Kconfig | 9
lib/Kconfig.debug | 1
lib/Kconfig.kfence | 84 +
lib/Kconfig.ubsan | 17
lib/cmdline.c | 7
lib/genalloc.c | 3
lib/stackdepot.c | 41
lib/test_kasan.c | 111 ++
lib/test_ubsan.c | 49 -
lib/ubsan.c | 68 -
mm/Makefile | 1
mm/backing-dev.c | 3
mm/cma.c | 64 -
mm/dmapool.c | 3
mm/early_ioremap.c | 12
mm/filemap.c | 361 +++++---
mm/huge_memory.c | 6
mm/internal.h | 6
mm/kasan/common.c | 213 +++-
mm/kasan/generic.c | 3
mm/kasan/hw_tags.c | 2
mm/kasan/kasan.h | 97 +-
mm/kasan/report.c | 8
mm/kasan/shadow.c | 78 +
mm/kfence/Makefile | 6
mm/kfence/core.c | 875 +++++++++++++++++++-
mm/kfence/kfence.h | 126 ++
mm/kfence/kfence_test.c | 860 +++++++++++++++++++
mm/kfence/report.c | 350 ++++++--
mm/khugepaged.c | 22
mm/memory-failure.c | 6
mm/memory.c | 4
mm/memory_hotplug.c | 178 +++-
mm/memremap.c | 23
mm/mlock.c | 2
mm/page_alloc.c | 1
mm/rmap.c | 24
mm/shmem.c | 160 +--
mm/slab.c | 38
mm/slab_common.c | 29
mm/slub.c | 63 +
mm/swap.c | 54 -
mm/swap_state.c | 7
mm/truncate.c | 141 ---
mm/vmstat.c | 35
mm/z3fold.c | 1
mm/zbud.c | 1
mm/zpool.c | 13
mm/zsmalloc.c | 22
mm/zswap.c | 57 +
samples/auxdisplay/cfag12864b-example.c | 2
scripts/Makefile.ubsan | 2
scripts/checkpatch.pl | 152 ++-
scripts/gdb/linux/lists.py | 5
145 files changed, 5046 insertions(+), 1682 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-02-26 1:14 incoming Andrew Morton
@ 2021-02-26 17:55 ` Linus Torvalds
2021-02-26 19:16 ` incoming Andrew Morton
0 siblings, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2021-02-26 17:55 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> - The rest of MM.
>
> Includes kfence - another runtime memory validator. Not as
> thorough as KASAN, but it has unmeasurable overhead and is intended
> to be usable in production builds.
>
> - Everything else
Just to clarify: you have nothing else really pending?
I'm hoping to just do -rc1 this weekend after all - despite my late
start due to loss of power for several days.
I'll allow late stragglers with good reason through, but the fewer of
those there are, the better, of course.
Thanks,
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-02-26 17:55 ` incoming Linus Torvalds
@ 2021-02-26 19:16 ` Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-02-26 19:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, Linux-MM
On Fri, 26 Feb 2021 09:55:27 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > - The rest of MM.
> >
> > Includes kfence - another runtime memory validator. Not as
> > thorough as KASAN, but it has unmeasurable overhead and is intended
> > to be usable in production builds.
> >
> > - Everything else
>
> Just to clarify: you have nothing else really pending?
Yes, that's it from me for -rc1.
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-03-13 5:06 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-03-13 5:06 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
29 patches, based on f78d76e72a4671ea52d12752d92077788b4f5d50.
Subsystems affected by this patch series:
mm/memblock
core-kernel
kconfig
mm/pagealloc
fork
mm/hugetlb
mm/highmem
binfmt
MAINTAINERS
kbuild
mm/kfence
mm/oom-kill
mm/madvise
mm/kasan
mm/userfaultfd
mm/memory-failure
ia64
mm/memcg
mm/zram
Subsystem: mm/memblock
Arnd Bergmann <arnd@arndb.de>:
memblock: fix section mismatch warning
Subsystem: core-kernel
Arnd Bergmann <arnd@arndb.de>:
stop_machine: mark helpers __always_inline
Subsystem: kconfig
Masahiro Yamada <masahiroy@kernel.org>:
init/Kconfig: make COMPILE_TEST depend on HAS_IOMEM
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
mm/page_alloc.c: refactor initialization of struct page for holes in memory layout
Subsystem: fork
Fenghua Yu <fenghua.yu@intel.com>:
mm/fork: clear PASID for new mm
Subsystem: mm/hugetlb
Peter Xu <peterx@redhat.com>:
Patch series "mm/hugetlb: Early cow on fork, and a few cleanups", v5:
hugetlb: dedup the code to add a new file_region
hugetlb: break earlier in add_reservation_in_range() when we can
mm: introduce page_needs_cow_for_dma() for deciding whether cow
mm: use is_cow_mapping() across tree where proper
hugetlb: do early cow when page pinned on src mm
Subsystem: mm/highmem
OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
mm/highmem.c: fix zero_user_segments() with start > end
Subsystem: binfmt
Lior Ribak <liorribak@gmail.com>:
binfmt_misc: fix possible deadlock in bm_register_write
Subsystem: MAINTAINERS
Vlastimil Babka <vbabka@suse.cz>:
MAINTAINERS: exclude uapi directories in API/ABI section
Subsystem: kbuild
Arnd Bergmann <arnd@arndb.de>:
linux/compiler-clang.h: define HAVE_BUILTIN_BSWAP*
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: fix printk format for ptrdiff_t
kfence, slab: fix cache_alloc_debugcheck_after() for bulk allocations
kfence: fix reports if constant function prefixes exist
Subsystem: mm/oom-kill
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
include/linux/sched/mm.h: use rcu_dereference in in_vfork()
Subsystem: mm/madvise
Suren Baghdasaryan <surenb@google.com>:
mm/madvise: replace ptrace attach requirement for process_madvise
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan, mm: fix crash with HW_TAGS and DEBUG_PAGEALLOC
kasan: fix KASAN_STACK dependency for HW_TAGS
Subsystem: mm/userfaultfd
Nadav Amit <namit@vmware.com>:
mm/userfaultfd: fix memory corruption due to writeprotect
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm, hwpoison: do not lock page again when me_huge_page() successfully recovers
Subsystem: ia64
Sergei Trofimovich <slyfox@gentoo.org>:
ia64: fix ia64_syscall_get_set_arguments() for break-based syscalls
ia64: fix ptrace(PTRACE_SYSCALL_INFO_EXIT) sign
Subsystem: mm/memcg
Zhou Guanghui <zhouguanghui1@huawei.com>:
mm/memcg: rename mem_cgroup_split_huge_fixup to split_page_memcg and add nr_pages argument
mm/memcg: set memcg when splitting page
Subsystem: mm/zram
Minchan Kim <minchan@kernel.org>:
zram: fix return value on writeback_store
zram: fix broken page writeback
MAINTAINERS | 4
arch/ia64/include/asm/syscall.h | 2
arch/ia64/kernel/ptrace.c | 24 +++-
drivers/block/zram/zram_drv.c | 17 +-
drivers/gpu/drm/vmwgfx/vmwgfx_page_dirty.c | 4
drivers/gpu/drm/vmwgfx/vmwgfx_ttm_glue.c | 2
fs/binfmt_misc.c | 29 ++---
fs/proc/task_mmu.c | 2
include/linux/compiler-clang.h | 6 +
include/linux/memblock.h | 4
include/linux/memcontrol.h | 6 -
include/linux/mm.h | 21 +++
include/linux/mm_types.h | 1
include/linux/sched/mm.h | 3
include/linux/stop_machine.h | 11 +
init/Kconfig | 3
kernel/fork.c | 8 +
lib/Kconfig.kasan | 1
mm/highmem.c | 17 ++
mm/huge_memory.c | 10 -
mm/hugetlb.c | 123 +++++++++++++++------
mm/internal.h | 5
mm/kfence/report.c | 30 +++--
mm/madvise.c | 13 ++
mm/memcontrol.c | 15 +-
mm/memory-failure.c | 4
mm/memory.c | 16 +-
mm/page_alloc.c | 167 ++++++++++++++---------------
mm/slab.c | 2
29 files changed, 334 insertions(+), 216 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-03-25 4:36 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-03-25 4:36 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
14 patches, based on 7acac4b3196caee5e21fb5ea53f8bc124e6a16fc.
Subsystems affected by this patch series:
mm/hugetlb
mm/kasan
mm/gup
mm/selftests
mm/z3fold
squashfs
ia64
gcov
mm/kfence
mm/memblock
mm/highmem
mailmap
Subsystem: mm/hugetlb
Miaohe Lin <linmiaohe@huawei.com>:
hugetlb_cgroup: fix imbalanced css_get and css_put pair for shared mappings
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix per-page tags for non-page_alloc pages
Subsystem: mm/gup
Sean Christopherson <seanjc@google.com>:
mm/mmu_notifiers: ensure range_end() is paired with range_start()
Subsystem: mm/selftests
Rong Chen <rong.a.chen@intel.com>:
selftests/vm: fix out-of-tree build
Subsystem: mm/z3fold
Thomas Hebb <tommyhebb@gmail.com>:
z3fold: prevent reclaim/free race for headless pages
Subsystem: squashfs
Sean Nyekjaer <sean@geanix.com>:
squashfs: fix inode lookup sanity checks
Phillip Lougher <phillip@squashfs.org.uk>:
squashfs: fix xattr id and id lookup sanity checks
Subsystem: ia64
Sergei Trofimovich <slyfox@gentoo.org>:
ia64: mca: allocate early mca with GFP_ATOMIC
ia64: fix format strings for err_inject
Subsystem: gcov
Nick Desaulniers <ndesaulniers@google.com>:
gcov: fix clang-11+ support
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: make compatible with kmemleak
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
mm: memblock: fix section mismatch warning again
Subsystem: mm/highmem
Ira Weiny <ira.weiny@intel.com>:
mm/highmem: fix CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP
Subsystem: mailmap
Andrey Konovalov <andreyknvl@google.com>:
mailmap: update Andrey Konovalov's email address
.mailmap | 1
arch/ia64/kernel/err_inject.c | 22 +++++------
arch/ia64/kernel/mca.c | 2 -
fs/squashfs/export.c | 8 +++-
fs/squashfs/id.c | 6 ++-
fs/squashfs/squashfs_fs.h | 1
fs/squashfs/xattr_id.c | 6 ++-
include/linux/hugetlb_cgroup.h | 15 ++++++-
include/linux/memblock.h | 4 +-
include/linux/mm.h | 18 +++++++--
include/linux/mmu_notifier.h | 10 ++---
kernel/gcov/clang.c | 69 ++++++++++++++++++++++++++++++++++++
mm/highmem.c | 4 +-
mm/hugetlb.c | 41 +++++++++++++++++++--
mm/hugetlb_cgroup.c | 10 ++++-
mm/kfence/core.c | 9 ++++
mm/kmemleak.c | 3 +
mm/mmu_notifier.c | 23 ++++++++++++
mm/z3fold.c | 16 +++++++-
tools/testing/selftests/vm/Makefile | 4 +-
20 files changed, 230 insertions(+), 42 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-04-09 20:26 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-04-09 20:26 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
16 patches, based on 17e7124aad766b3f158943acb51467f86220afe9.
Subsystems affected by this patch series:
MAINTAINERS
mailmap
mm/kasan
mm/gup
nds32
gcov
ocfs2
ia64
mm/pagecache
mm/kasan
mm/kfence
lib
Subsystem: MAINTAINERS
Marek Behún <kabel@kernel.org>:
MAINTAINERS: update CZ.NIC's Turris information
treewide: change my e-mail address, fix my name
Subsystem: mailmap
Jordan Crouse <jordan@cosmicpenguin.net>:
mailmap: update email address for Jordan Crouse
Matthew Wilcox <willy@infradead.org>:
.mailmap: fix old email addresses
Subsystem: mm/kasan
Arnd Bergmann <arnd@arndb.de>:
kasan: fix hwasan build for gcc
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: remove redundant config option
Subsystem: mm/gup
Aili Yao <yaoaili@kingsoft.com>:
mm/gup: check page posion status for coredump.
Subsystem: nds32
Mike Rapoport <rppt@linux.ibm.com>:
nds32: flush_dcache_page: use page_mapping_file to avoid races with swapoff
Subsystem: gcov
Nick Desaulniers <ndesaulniers@google.com>:
gcov: re-fix clang-11+ support
Subsystem: ocfs2
Wengang Wang <wen.gang.wang@oracle.com>:
ocfs2: fix deadlock between setattr and dio_end_io_write
Subsystem: ia64
Sergei Trofimovich <slyfox@gentoo.org>:
ia64: fix user_stack_pointer() for ptrace()
Subsystem: mm/pagecache
Jack Qiu <jack.qiu@huawei.com>:
fs: direct-io: fix missing sdio->boundary
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix conflict with page poisoning
Andrew Morton <akpm@linux-foundation.org>:
lib/test_kasan_module.c: suppress unused var warning
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence, x86: fix preemptible warning on KPTI-enabled systems
Subsystem: lib
Julian Braha <julianbraha@gmail.com>:
lib: fix kconfig dependency on ARCH_WANT_FRAME_POINTERS
.mailmap | 7 ++
Documentation/ABI/testing/debugfs-moxtet | 4 -
Documentation/ABI/testing/debugfs-turris-mox-rwtm | 2
Documentation/ABI/testing/sysfs-bus-moxtet-devices | 6 +-
Documentation/ABI/testing/sysfs-class-led-driver-turris-omnia | 2
Documentation/ABI/testing/sysfs-firmware-turris-mox-rwtm | 10 +--
Documentation/devicetree/bindings/leds/cznic,turris-omnia-leds.yaml | 2
MAINTAINERS | 13 +++-
arch/arm64/boot/dts/marvell/armada-3720-turris-mox.dts | 2
arch/arm64/kernel/sleep.S | 2
arch/ia64/include/asm/ptrace.h | 8 --
arch/nds32/mm/cacheflush.c | 2
arch/x86/include/asm/kfence.h | 7 ++
arch/x86/kernel/acpi/wakeup_64.S | 2
drivers/bus/moxtet.c | 4 -
drivers/firmware/turris-mox-rwtm.c | 4 -
drivers/gpio/gpio-moxtet.c | 4 -
drivers/leds/leds-turris-omnia.c | 4 -
drivers/mailbox/armada-37xx-rwtm-mailbox.c | 4 -
drivers/watchdog/armada_37xx_wdt.c | 4 -
fs/direct-io.c | 5 +
fs/ocfs2/aops.c | 11 ---
fs/ocfs2/file.c | 8 ++
include/dt-bindings/bus/moxtet.h | 2
include/linux/armada-37xx-rwtm-mailbox.h | 2
include/linux/kasan.h | 2
include/linux/moxtet.h | 2
kernel/gcov/clang.c | 29 ++++++----
lib/Kconfig.debug | 6 +-
lib/Kconfig.kasan | 9 ---
lib/test_kasan_module.c | 2
mm/gup.c | 4 +
mm/internal.h | 20 ++++++
mm/kasan/common.c | 2
mm/kasan/kasan.h | 2
mm/kasan/report_generic.c | 2
mm/page_poison.c | 4 +
scripts/Makefile.kasan | 18 ++++--
security/Kconfig.hardening | 4 -
39 files changed, 136 insertions(+), 91 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-04-16 22:45 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-04-16 22:45 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
12 patches, based on 06c2aac4014c38247256fe49c61b7f55890271e7.
Subsystems affected by this patch series:
mm/documentation
mm/kasan
csky
ia64
mm/pagemap
gcov
lib
Subsystem: mm/documentation
Randy Dunlap <rdunlap@infradead.org>:
mm: eliminate "expecting prototype" kernel-doc warnings
Subsystem: mm/kasan
Arnd Bergmann <arnd@arndb.de>:
kasan: fix hwasan build for gcc
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: remove redundant config option
Subsystem: csky
Randy Dunlap <rdunlap@infradead.org>:
csky: change a Kconfig symbol name to fix e1000 build error
Subsystem: ia64
Randy Dunlap <rdunlap@infradead.org>:
ia64: remove duplicate entries in generic_defconfig
ia64: fix discontig.c section mismatches
John Paul Adrian Glaubitz <glaubitz () physik ! fu-berlin ! de>:
ia64: tools: remove inclusion of ia64-specific version of errno.h header
John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>:
ia64: tools: remove duplicate definition of ia64_mf() on ia64
Subsystem: mm/pagemap
Zack Rusin <zackr@vmware.com>:
mm/mapping_dirty_helpers: guard hugepage pud's usage
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm: ptdump: fix build failure
Subsystem: gcov
Johannes Berg <johannes.berg@intel.com>:
gcov: clang: fix clang-11+ build
Subsystem: lib
Randy Dunlap <rdunlap@infradead.org>:
lib: remove "expecting prototype" kernel-doc warnings
arch/arm64/kernel/sleep.S | 2 +-
arch/csky/Kconfig | 2 +-
arch/csky/include/asm/page.h | 2 +-
arch/ia64/configs/generic_defconfig | 2 --
arch/ia64/mm/discontig.c | 6 +++---
arch/x86/kernel/acpi/wakeup_64.S | 2 +-
include/linux/kasan.h | 2 +-
kernel/gcov/clang.c | 2 +-
lib/Kconfig.kasan | 9 ++-------
lib/earlycpio.c | 4 ++--
lib/lru_cache.c | 3 ++-
lib/parman.c | 4 ++--
lib/radix-tree.c | 11 ++++++-----
mm/kasan/common.c | 2 +-
mm/kasan/kasan.h | 2 +-
mm/kasan/report_generic.c | 2 +-
mm/mapping_dirty_helpers.c | 2 ++
mm/mmu_gather.c | 29 +++++++++++++++++++----------
mm/oom_kill.c | 2 +-
mm/ptdump.c | 2 +-
mm/shuffle.c | 4 ++--
scripts/Makefile.kasan | 22 ++++++++++++++--------
security/Kconfig.hardening | 4 ++--
tools/arch/ia64/include/asm/barrier.h | 3 ---
tools/include/uapi/asm/errno.h | 2 --
25 files changed, 67 insertions(+), 60 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-04-23 21:28 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-04-23 21:28 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
5 patches, based on 5bfc75d92efd494db37f5c4c173d3639d4772966.
Subsystems affected by this patch series:
coda
overlayfs
mm/pagecache
mm/memcg
Subsystem: coda
Christian König <christian.koenig@amd.com>:
coda: fix reference counting in coda_file_mmap error path
Subsystem: overlayfs
Christian König <christian.koenig@amd.com>:
ovl: fix reference counting in ovl_mmap error path
Subsystem: mm/pagecache
Hugh Dickins <hughd@google.com>:
mm/filemap: fix find_lock_entries hang on 32-bit THP
mm/filemap: fix mapping_seek_hole_data on THP & 32-bit
Subsystem: mm/memcg
Vasily Averin <vvs@virtuozzo.com>:
tools/cgroup/slabinfo.py: updated to work on current kernel
fs/coda/file.c | 6 +++---
fs/overlayfs/file.c | 11 +----------
mm/filemap.c | 31 +++++++++++++++++++------------
tools/cgroup/memcg_slabinfo.py | 8 ++++----
4 files changed, 27 insertions(+), 29 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-04-30 5:52 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-04-30 5:52 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
A few misc subsystems and some of MM.
178 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0.
Subsystems affected by this patch series:
ia64
kbuild
scripts
sh
ocfs2
kfifo
vfs
kernel/watchdog
mm/slab-generic
mm/slub
mm/kmemleak
mm/debug
mm/pagecache
mm/msync
mm/gup
mm/memremap
mm/memcg
mm/pagemap
mm/mremap
mm/dma
mm/sparsemem
mm/vmalloc
mm/documentation
mm/kasan
mm/initialization
mm/pagealloc
mm/memory-failure
Subsystem: ia64
Zhang Yunkai <zhang.yunkai@zte.com.cn>:
arch/ia64/kernel/head.S: remove duplicate include
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
arch/ia64/kernel/fsys.S: fix typos
arch/ia64/include/asm/pgtable.h: minor typo fixes
Valentin Schneider <valentin.schneider@arm.com>:
ia64: ensure proper NUMA distance and possible map initialization
Sergei Trofimovich <slyfox@gentoo.org>:
ia64: drop unused IA64_FW_EMU ifdef
ia64: simplify code flow around swiotlb init
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
ia64: trivial spelling fixes
Sergei Trofimovich <slyfox@gentoo.org>:
ia64: fix EFI_DEBUG build
ia64: mca: always make IA64_MCA_DEBUG an expression
ia64: drop marked broken DISCONTIGMEM and VIRTUAL_MEM_MAP
ia64: module: fix symbolizer crash on fdescr
Subsystem: kbuild
Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
include/linux/compiler-gcc.h: sparse can do constant folding of __builtin_bswap*()
Subsystem: scripts
Tom Saeger <tom.saeger@oracle.com>:
scripts/spelling.txt: add entries for recent discoveries
Wan Jiabing <wanjiabing@vivo.com>:
scripts: a new script for checking duplicate struct declaration
Subsystem: sh
Zhang Yunkai <zhang.yunkai@zte.com.cn>:
arch/sh/include/asm/tlb.h: remove duplicate include
Subsystem: ocfs2
Yang Li <yang.lee@linux.alibaba.com>:
ocfs2: replace DEFINE_SIMPLE_ATTRIBUTE with DEFINE_DEBUGFS_ATTRIBUTE
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: map flags directly in flags_to_o2dlm()
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
ocfs2: fix a typo
Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
ocfs2/dlm: remove unused function
Subsystem: kfifo
Dan Carpenter <dan.carpenter@oracle.com>:
kfifo: fix ternary sign extension bugs
Subsystem: vfs
Randy Dunlap <rdunlap@infradead.org>:
vfs: fs_parser: clean up kernel-doc warnings
Subsystem: kernel/watchdog
Petr Mladek <pmladek@suse.com>:
Patch series "watchdog/softlockup: Report overall time and some cleanup", v2:
watchdog: rename __touch_watchdog() to a better descriptive name
watchdog: explicitly update timestamp when reporting softlockup
watchdog/softlockup: report the overall time of softlockups
watchdog/softlockup: remove logic that tried to prevent repeated reports
watchdog: fix barriers when printing backtraces from all CPUs
watchdog: cleanup handling of false positives
Subsystem: mm/slab-generic
Rafael Aquini <aquini@redhat.com>:
mm/slab_common: provide "slab_merge" option for !IS_ENABLED(CONFIG_SLAB_MERGE_DEFAULT) builds
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: enable slub_debug static key when creating cache with explicit debug flags
Oliver Glitta <glittao@gmail.com>:
kunit: add a KUnit test for SLUB debugging functionality
slub: remove resiliency_test() function
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
mm/slub.c: trivial typo fixes
Subsystem: mm/kmemleak
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
mm/kmemleak.c: fix a typo
Subsystem: mm/debug
Georgi Djakov <georgi.djakov@linaro.org>:
mm/page_owner: record the timestamp of all pages during free
zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>:
mm, page_owner: remove unused parameter in __set_page_owner_handle
Sergei Trofimovich <slyfox@gentoo.org>:
mm: page_owner: fetch backtrace only for tracked pages
mm: page_owner: use kstrtobool() to parse bool option
mm: page_owner: detect page_owner recursion via task_struct
mm: page_poison: print page info when corruption is caught
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/memtest: add ARCH_USE_MEMTEST
Subsystem: mm/pagecache
Jens Axboe <axboe@kernel.dk>:
Patch series "Improve IOCB_NOWAIT O_DIRECT reads", v3:
mm: provide filemap_range_needs_writeback() helper
mm: use filemap_range_needs_writeback() for O_DIRECT reads
iomap: use filemap_range_needs_writeback() for O_DIRECT reads
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap: use filemap_read_page in filemap_fault
mm/filemap: drop check for truncated page after I/O
Johannes Weiner <hannes@cmpxchg.org>:
mm: page-writeback: simplify memcg handling in test_clear_page_writeback()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: move page_mapping_file to pagemap.h
Rui Sun <sunrui26@huawei.com>:
mm/filemap: update stale comment
Subsystem: mm/msync
Nikita Ermakov <sh1r4s3@mail.si-head.nl>:
mm/msync: exit early when the flags is an MS_ASYNC and start < vm_start
Subsystem: mm/gup
Joao Martins <joao.m.martins@oracle.com>:
Patch series "mm/gup: page unpining improvements", v4:
mm/gup: add compound page list iterator
mm/gup: decrement head page once for group of subpages
mm/gup: add a range variant of unpin_user_pages_dirty_lock()
RDMA/umem: batch page unpin in __ib_umem_release()
Yang Shi <shy828301@gmail.com>:
mm: gup: remove FOLL_SPLIT
Subsystem: mm/memremap
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/memremap.c: fix improper SPDX comment style
Subsystem: mm/memcg
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: fix kernel stack account
Shakeel Butt <shakeelb@google.com>:
memcg: cleanup root memcg checks
memcg: enable memcg oom-kill for __GFP_NOFAIL
Johannes Weiner <hannes@cmpxchg.org>:
Patch series "mm: memcontrol: switch to rstat", v3:
mm: memcontrol: fix cpuhotplug statistics flushing
mm: memcontrol: kill mem_cgroup_nodeinfo()
mm: memcontrol: privatize memcg_page_state query functions
cgroup: rstat: support cgroup1
cgroup: rstat: punt root-level optimization to individual controllers
mm: memcontrol: switch to rstat
mm: memcontrol: consolidate lruvec stat flushing
kselftests: cgroup: update kmem test for new vmstat implementation
Shakeel Butt <shakeelb@google.com>:
memcg: charge before adding to swapcache on swapin
Muchun Song <songmuchun@bytedance.com>:
Patch series "Use obj_cgroup APIs to charge kmem pages", v5:
mm: memcontrol: slab: fix obtain a reference to a freeing memcg
mm: memcontrol: introduce obj_cgroup_{un}charge_pages
mm: memcontrol: directly access page->memcg_data in mm/page_alloc.c
mm: memcontrol: change ug->dummy_page only if memcg changed
mm: memcontrol: use obj_cgroup APIs to charge kmem pages
mm: memcontrol: inline __memcg_kmem_{un}charge() into obj_cgroup_{un}charge_pages()
mm: memcontrol: move PageMemcgKmem to the scope of CONFIG_MEMCG_KMEM
Wan Jiabing <wanjiabing@vivo.com>:
linux/memcontrol.h: remove duplicate struct declaration
Johannes Weiner <hannes@cmpxchg.org>:
mm: page_counter: mitigate consequences of a page_counter underflow
Subsystem: mm/pagemap
Wang Qing <wangqing@vivo.com>:
mm/memory.c: do_numa_page(): delete bool "migrated"
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/interval_tree: add comments to improve code readability
Oscar Salvador <osalvador@suse.de>:
Patch series "Cleanup and fixups for vmemmap handling", v6:
x86/vmemmap: drop handling of 4K unaligned vmemmap range
x86/vmemmap: drop handling of 1GB vmemmap ranges
x86/vmemmap: handle unpopulated sub-pmd ranges
x86/vmemmap: optimize for consecutive sections in partial populated PMDs
Ovidiu Panait <ovidiu.panait@windriver.com>:
mm, tracing: improve rss_stat tracepoint message
Christoph Hellwig <hch@lst.de>:
Patch series "add remap_pfn_range_notrack instead of reinventing it in i915", v2:
mm: add remap_pfn_range_notrack
mm: add a io_mapping_map_user helper
i915: use io_mapping_map_user
i915: fix remap_io_sg to verify the pgprot
Huang Ying <ying.huang@intel.com>:
NUMA balancing: reduce TLB flush via delaying mapping on hint page fault
Subsystem: mm/mremap
Brian Geffon <bgeffon@google.com>:
Patch series "mm: Extend MREMAP_DONTUNMAP to non-anonymous mappings", v5:
mm: extend MREMAP_DONTUNMAP to non-anonymous mappings
Revert "mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio"
selftests: add a MREMAP_DONTUNMAP selftest for shmem
Subsystem: mm/dma
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/dmapool: switch from strlcpy to strscpy
Subsystem: mm/sparsemem
Wang Wensheng <wangwensheng4@huawei.com>:
mm/sparse: add the missing sparse_buffer_fini() in error branch
Subsystem: mm/vmalloc
Christoph Hellwig <hch@lst.de>:
Patch series "remap_vmalloc_range cleanups":
samples/vfio-mdev/mdpy: use remap_vmalloc_range
mm: unexport remap_vmalloc_range_partial
Serapheim Dimitropoulos <serapheim.dimitro@delphix.com>:
mm/vmalloc: use rb_tree instead of list for vread() lookups
Nicholas Piggin <npiggin@gmail.com>:
Patch series "huge vmalloc mappings", v13:
ARM: mm: add missing pud_page define to 2-level page tables
mm/vmalloc: fix HUGE_VMAP regression by enabling huge pages in vmalloc_to_page
mm: apply_to_pte_range warn and fail if a large pte is encountered
mm/vmalloc: rename vmap_*_range vmap_pages_*_range
mm/ioremap: rename ioremap_*_range to vmap_*_range
mm: HUGE_VMAP arch support cleanup
powerpc: inline huge vmap supported functions
arm64: inline huge vmap supported functions
x86: inline huge vmap supported functions
mm/vmalloc: provide fallback arch huge vmap support functions
mm: move vmap_range from mm/ioremap.c to mm/vmalloc.c
mm/vmalloc: add vmap_range_noflush variant
mm/vmalloc: hugepage vmalloc mappings
Patch series "mm/vmalloc: cleanup after hugepage series", v2:
mm/vmalloc: remove map_kernel_range
kernel/dma: remove unnecessary unmap_kernel_range
powerpc/xive: remove unnecessary unmap_kernel_range
mm/vmalloc: remove unmap_kernel_range
mm/vmalloc: improve allocation failure error messages
Vijayanand Jitta <vjitta@codeaurora.org>:
mm: vmalloc: prevent use after free in _vm_unmap_aliases
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
lib/test_vmalloc.c: remove two kvfree_rcu() tests
lib/test_vmalloc.c: add a new 'nr_threads' parameter
vm/test_vmalloc.sh: adapt for updated driver interface
mm/vmalloc: refactor the preloading loagic
mm/vmalloc: remove an empty line
Subsystem: mm/documentation
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/doc: fix fault_flag_allow_retry_first kerneldoc
mm/doc: fix page_maybe_dma_pinned kerneldoc
mm/doc: turn fault flags into an enum
mm/doc: add mm.h and mm_types.h to the mm-api document
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
Patch series "kernel-doc and MAINTAINERS clean-up":
MAINTAINERS: assign pagewalk.h to MEMORY MANAGEMENT
pagewalk: prefix struct kernel-doc descriptions
Subsystem: mm/kasan
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/kasan: switch from strlcpy to strscpy
Peter Collingbourne <pcc@google.com>:
kasan: fix kasan_byte_accessible() to be consistent with actual checks
Andrey Konovalov <andreyknvl@google.com>:
kasan: initialize shadow to TAG_INVALID for SW_TAGS
mm, kasan: don't poison boot memory with tag-based modes
Patch series "kasan: integrate with init_on_alloc/free", v3:
arm64: kasan: allow to init memory when setting tags
kasan: init memory in kasan_(un)poison for HW_TAGS
kasan, mm: integrate page_alloc init with HW_TAGS
kasan, mm: integrate slab init_on_alloc with HW_TAGS
kasan, mm: integrate slab init_on_free with HW_TAGS
kasan: docs: clean up sections
kasan: docs: update overview section
kasan: docs: update usage section
kasan: docs: update error reports section
kasan: docs: update boot parameters section
kasan: docs: update GENERIC implementation details section
kasan: docs: update SW_TAGS implementation details section
kasan: docs: update HW_TAGS implementation details section
kasan: docs: update shadow memory section
kasan: docs: update ignoring accesses section
kasan: docs: update tests section
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: record task_work_add() call stack
Andrey Konovalov <andreyknvl@google.com>:
kasan: detect false-positives in tests
Zqiang <qiang.zhang@windriver.com>:
irq_work: record irq_work_queue() call stack
Subsystem: mm/initialization
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: move mem_init_print_info() into mm_init()
Subsystem: mm/pagealloc
David Hildenbrand <david@redhat.com>:
mm/page_alloc: drop pr_info_ratelimited() in alloc_contig_range()
Minchan Kim <minchan@kernel.org>:
mm: remove lru_add_drain_all in alloc_contig_range
Yu Zhao <yuzhao@google.com>:
include/linux/page-flags-layout.h: correctly determine LAST_CPUPID_WIDTH
include/linux/page-flags-layout.h: cleanups
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Rationalise __alloc_pages wrappers", v3:
mm/page_alloc: rename alloc_mask to alloc_gfp
mm/page_alloc: rename gfp_mask to gfp
mm/page_alloc: combine __alloc_pages and __alloc_pages_nodemask
mm/mempolicy: rename alloc_pages_current to alloc_pages
mm/mempolicy: rewrite alloc_pages documentation
mm/mempolicy: rewrite alloc_pages_vma documentation
mm/mempolicy: fix mpol_misplaced kernel-doc
Minchan Kim <minchan@kernel.org>:
mm: page_alloc: dump migrate-failed pages
Geert Uytterhoeven <geert@linux-m68k.org>:
mm/Kconfig: remove default DISCONTIGMEM_MANUAL
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm, page_alloc: avoid page_to_pfn() in move_freepages()
zhouchuangao <zhouchuangao@vivo.com>:
mm/page_alloc: duplicate include linux/vmalloc.h
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Introduce a bulk order-0 page allocator with two in-tree users", v6:
mm/page_alloc: rename alloced to allocated
mm/page_alloc: add a bulk page allocator
mm/page_alloc: add an array-based interface to the bulk page allocator
Jesper Dangaard Brouer <brouer@redhat.com>:
mm/page_alloc: optimize code layout for __alloc_pages_bulk
mm/page_alloc: inline __rmqueue_pcplist
Chuck Lever <chuck.lever@oracle.com>:
Patch series "SUNRPC consumer for the bulk page allocator":
SUNRPC: set rq_page_end differently
SUNRPC: refresh rq_pages using a bulk page allocator
Jesper Dangaard Brouer <brouer@redhat.com>:
net: page_pool: refactor dma_map into own function page_pool_dma_map
net: page_pool: use alloc_pages_bulk in refill code path
Sergei Trofimovich <slyfox@gentoo.org>:
mm: page_alloc: ignore init_on_free=1 for debug_pagealloc=1
huxiang <huxiang@uniontech.com>:
mm/page_alloc: redundant definition variables of pfn in for loop
Mike Rapoport <rppt@linux.ibm.com>:
mm/mmzone.h: fix existing kernel-doc comments and link them to core-api
Subsystem: mm/memory-failure
Jane Chu <jane.chu@oracle.com>:
mm/memory-failure: unnecessary amount of unmapping
Documentation/admin-guide/kernel-parameters.txt | 7
Documentation/admin-guide/mm/transhuge.rst | 2
Documentation/core-api/cachetlb.rst | 4
Documentation/core-api/mm-api.rst | 6
Documentation/dev-tools/kasan.rst | 355 +++++-----
Documentation/vm/page_owner.rst | 2
Documentation/vm/transhuge.rst | 5
MAINTAINERS | 1
arch/Kconfig | 11
arch/alpha/mm/init.c | 1
arch/arc/mm/init.c | 1
arch/arm/Kconfig | 1
arch/arm/include/asm/pgtable-3level.h | 2
arch/arm/include/asm/pgtable.h | 3
arch/arm/mm/copypage-v4mc.c | 1
arch/arm/mm/copypage-v6.c | 1
arch/arm/mm/copypage-xscale.c | 1
arch/arm/mm/init.c | 2
arch/arm64/Kconfig | 1
arch/arm64/include/asm/memory.h | 4
arch/arm64/include/asm/mte-kasan.h | 39 -
arch/arm64/include/asm/vmalloc.h | 38 -
arch/arm64/mm/init.c | 4
arch/arm64/mm/mmu.c | 36 -
arch/csky/abiv1/cacheflush.c | 1
arch/csky/mm/init.c | 1
arch/h8300/mm/init.c | 2
arch/hexagon/mm/init.c | 1
arch/ia64/Kconfig | 23
arch/ia64/configs/bigsur_defconfig | 1
arch/ia64/include/asm/meminit.h | 11
arch/ia64/include/asm/module.h | 6
arch/ia64/include/asm/page.h | 25
arch/ia64/include/asm/pgtable.h | 7
arch/ia64/kernel/Makefile | 2
arch/ia64/kernel/acpi.c | 7
arch/ia64/kernel/efi.c | 11
arch/ia64/kernel/fsys.S | 4
arch/ia64/kernel/head.S | 6
arch/ia64/kernel/ia64_ksyms.c | 12
arch/ia64/kernel/machine_kexec.c | 2
arch/ia64/kernel/mca.c | 4
arch/ia64/kernel/module.c | 29
arch/ia64/kernel/pal.S | 6
arch/ia64/mm/Makefile | 1
arch/ia64/mm/contig.c | 4
arch/ia64/mm/discontig.c | 21
arch/ia64/mm/fault.c | 15
arch/ia64/mm/init.c | 221 ------
arch/m68k/mm/init.c | 1
arch/microblaze/mm/init.c | 1
arch/mips/Kconfig | 1
arch/mips/loongson64/numa.c | 1
arch/mips/mm/cache.c | 1
arch/mips/mm/init.c | 1
arch/mips/sgi-ip27/ip27-memory.c | 1
arch/nds32/mm/init.c | 1
arch/nios2/mm/cacheflush.c | 1
arch/nios2/mm/init.c | 1
arch/openrisc/mm/init.c | 2
arch/parisc/mm/init.c | 2
arch/powerpc/Kconfig | 1
arch/powerpc/include/asm/vmalloc.h | 34 -
arch/powerpc/kernel/isa-bridge.c | 4
arch/powerpc/kernel/pci_64.c | 2
arch/powerpc/mm/book3s64/radix_pgtable.c | 29
arch/powerpc/mm/ioremap.c | 2
arch/powerpc/mm/mem.c | 1
arch/powerpc/sysdev/xive/common.c | 4
arch/riscv/mm/init.c | 1
arch/s390/mm/init.c | 2
arch/sh/include/asm/tlb.h | 10
arch/sh/mm/cache-sh4.c | 1
arch/sh/mm/cache-sh7705.c | 1
arch/sh/mm/init.c | 1
arch/sparc/include/asm/pgtable_32.h | 3
arch/sparc/mm/init_32.c | 2
arch/sparc/mm/init_64.c | 1
arch/sparc/mm/tlb.c | 1
arch/um/kernel/mem.c | 1
arch/x86/Kconfig | 1
arch/x86/include/asm/vmalloc.h | 42 -
arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 2
arch/x86/mm/init_32.c | 2
arch/x86/mm/init_64.c | 222 ++++--
arch/x86/mm/ioremap.c | 33
arch/x86/mm/pgtable.c | 13
arch/xtensa/Kconfig | 1
arch/xtensa/mm/init.c | 1
block/blk-cgroup.c | 17
drivers/gpu/drm/i915/Kconfig | 1
drivers/gpu/drm/i915/gem/i915_gem_mman.c | 9
drivers/gpu/drm/i915/i915_drv.h | 3
drivers/gpu/drm/i915/i915_mm.c | 117 ---
drivers/infiniband/core/umem.c | 12
drivers/pci/pci.c | 2
fs/aio.c | 5
fs/fs_parser.c | 2
fs/iomap/direct-io.c | 24
fs/ocfs2/blockcheck.c | 2
fs/ocfs2/dlm/dlmrecovery.c | 7
fs/ocfs2/stack_o2cb.c | 36 -
fs/ocfs2/stackglue.c | 2
include/linux/compiler-gcc.h | 8
include/linux/fs.h | 2
include/linux/gfp.h | 45 -
include/linux/io-mapping.h | 3
include/linux/io.h | 9
include/linux/kasan.h | 51 +
include/linux/memcontrol.h | 271 ++++----
include/linux/mm.h | 50 -
include/linux/mmzone.h | 43 -
include/linux/page-flags-layout.h | 64 -
include/linux/pagemap.h | 10
include/linux/pagewalk.h | 4
include/linux/sched.h | 4
include/linux/slab.h | 2
include/linux/slub_def.h | 2
include/linux/vmalloc.h | 73 +-
include/linux/vmstat.h | 24
include/net/page_pool.h | 2
include/trace/events/kmem.h | 24
init/main.c | 2
kernel/cgroup/cgroup.c | 34 -
kernel/cgroup/rstat.c | 61 +
kernel/dma/remap.c | 1
kernel/fork.c | 13
kernel/irq_work.c | 7
kernel/task_work.c | 3
kernel/watchdog.c | 102 +--
lib/Kconfig.debug | 14
lib/Makefile | 1
lib/test_kasan.c | 59 -
lib/test_slub.c | 124 +++
lib/test_vmalloc.c | 128 +--
mm/Kconfig | 4
mm/Makefile | 1
mm/debug_vm_pgtable.c | 4
mm/dmapool.c | 2
mm/filemap.c | 61 +
mm/gup.c | 145 +++-
mm/hugetlb.c | 2
mm/internal.h | 25
mm/interval_tree.c | 2
mm/io-mapping.c | 29
mm/ioremap.c | 361 ++--------
mm/kasan/common.c | 53 -
mm/kasan/generic.c | 12
mm/kasan/kasan.h | 28
mm/kasan/report_generic.c | 2
mm/kasan/shadow.c | 10
mm/kasan/sw_tags.c | 12
mm/kmemleak.c | 2
mm/memcontrol.c | 798 ++++++++++++------------
mm/memory-failure.c | 2
mm/memory.c | 191 +++--
mm/mempolicy.c | 78 --
mm/mempool.c | 4
mm/memremap.c | 2
mm/migrate.c | 2
mm/mm_init.c | 4
mm/mmap.c | 6
mm/mremap.c | 6
mm/msync.c | 6
mm/page-writeback.c | 9
mm/page_alloc.c | 430 +++++++++---
mm/page_counter.c | 8
mm/page_owner.c | 68 --
mm/page_poison.c | 6
mm/percpu-vm.c | 7
mm/slab.c | 43 -
mm/slab.h | 24
mm/slab_common.c | 10
mm/slub.c | 215 ++----
mm/sparse.c | 1
mm/swap_state.c | 13
mm/util.c | 10
mm/vmalloc.c | 728 ++++++++++++++++-----
net/core/page_pool.c | 127 ++-
net/sunrpc/svc_xprt.c | 38 -
samples/kfifo/bytestream-example.c | 8
samples/kfifo/inttype-example.c | 8
samples/kfifo/record-example.c | 8
samples/vfio-mdev/mdpy.c | 4
scripts/checkdeclares.pl | 53 +
scripts/spelling.txt | 26
tools/testing/selftests/cgroup/test_kmem.c | 22
tools/testing/selftests/vm/mremap_dontunmap.c | 52 +
tools/testing/selftests/vm/test_vmalloc.sh | 21
189 files changed, 3642 insertions(+), 3013 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-05-05 1:32 Andrew Morton
2021-05-05 1:32 ` [patch 001/143] mm: introduce and use mapping_empty() Andrew Morton
` (140 more replies)
0 siblings, 141 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
The remainder of the main mm/ queue.
143 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus
previously sent patches.
Subsystems affected by this patch series:
mm/pagecache
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/compaction
mm/migration
mm/cma
mm/ksm
mm/vmstat
mm/mmap
mm/kconfig
mm/util
mm/memory-hotplug
mm/zswap
mm/zsmalloc
mm/highmem
mm/cleanups
mm/kfence
Subsystem: mm/pagecache
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Remove nrexceptional tracking", v2:
mm: introduce and use mapping_empty()
mm: stop accounting shadow entries
dax: account DAX entries as nrpages
mm: remove nrexceptional from inode
Hugh Dickins <hughd@google.com>:
mm: remove nrexceptional from inode: remove BUG_ON
Subsystem: mm/hugetlb
Peter Xu <peterx@redhat.com>:
Patch series "hugetlb: Disable huge pmd unshare for uffd-wp", v4:
hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share()
hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled
mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h
hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: remove redundant reservation check condition in alloc_huge_page()
Anshuman Khandual <anshuman.khandual@arm.com>:
mm: generalize HUGETLB_PAGE_SIZE_VARIABLE
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Some cleanups for hugetlb":
mm/hugetlb: use some helper functions to cleanup code
mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state()
mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate()
mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page()
mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case
Patch series "Cleanup and fixup for khugepaged", v2:
khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps()
khugepaged: reuse the smp_wmb() inside __SetPageUptodate()
khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter()
khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate()
mm/huge_memory.c: remove unnecessary local variable ret2
Patch series "Some cleanups for huge_memory", v3:
mm/huge_memory.c: rework the function vma_adjust_trans_huge()
mm/huge_memory.c: make get_huge_zero_page() return bool
mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly
mm/huge_memory.c: remove redundant PageCompound() check
mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG
mm/huge_memory.c: use helper function migration_entry_to_page()
Yanfei Xu <yanfei.xu@windriver.com>:
mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup for khugepaged":
khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp()
khugepaged: remove unnecessary out label in collapse_huge_page()
khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd()
Zi Yan <ziy@nvidia.com>:
mm: huge_memory: a new debugfs interface for splitting THP tests
mm: huge_memory: debugfs for file-backed THP split
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for hugetlb", v2:
mm/hugeltb: remove redundant VM_BUG_ON() in region_add()
mm/hugeltb: simplify the return code of __vma_reservation_common()
mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages()
mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts()
mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages()
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "make hugetlb put_page safe for all calling contexts", v5:
mm/cma: change cma mutex to irq safe spinlock
hugetlb: no need to drop hugetlb_lock to call cma_release
hugetlb: add per-hstate mutex to synchronize user adjustments
hugetlb: create remove_hugetlb_page() to separate functionality
hugetlb: call update_and_free_page without hugetlb_lock
hugetlb: change free_pool_huge_page to remove_pool_huge_page
hugetlb: make free_huge_page irq safe
hugetlb: add lockdep_assert_held() calls for hugetlb_lock
Oscar Salvador <osalvador@suse.de>:
Patch series "Make alloc_contig_range handle Hugetlb pages", v10:
mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range
mm,compaction: let isolate_migratepages_{range,block} return error codes
mm,hugetlb: drop clearing of flag from prep_new_huge_page
mm,hugetlb: split prep_new_huge_page functionality
mm: make alloc_contig_range handle free hugetlb pages
mm: make alloc_contig_range handle in-use hugetlb pages
mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig
Subsystem: mm/userfaultfd
Axel Rasmussen <axelrasmussen@google.com>:
Patch series "userfaultfd: add minor fault handling", v9:
userfaultfd: add minor fault registration mode
userfaultfd: disable huge PMD sharing for MINOR registered VMAs
userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled
userfaultfd: add UFFDIO_CONTINUE ioctl
userfaultfd: update documentation to describe minor fault handling
userfaultfd/selftests: add test exercising minor fault handling
Subsystem: mm/vmscan
Dave Hansen <dave.hansen@linux.intel.com>:
mm/vmscan: move RECLAIM* bits to uapi header
mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks
Yang Shi <shy828301@gmail.com>:
Patch series "Make shrinker's nr_deferred memcg aware", v10:
mm: vmscan: use nid from shrink_control for tracepoint
mm: vmscan: consolidate shrinker_maps handling code
mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation
mm: vmscan: remove memcg_shrinker_map_size
mm: vmscan: use kvfree_rcu instead of call_rcu
mm: memcontrol: rename shrinker_map to shrinker_info
mm: vmscan: add shrinker_info_protected() helper
mm: vmscan: use a new flag to indicate shrinker is registered
mm: vmscan: add per memcg shrinker nr_deferred
mm: vmscan: use per memcg nr_deferred of shrinker
mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers
mm: memcontrol: reparent nr_deferred when memcg offline
mm: vmscan: shrink deferred objects proportional to priority
Subsystem: mm/compaction
Pintu Kumar <pintu@codeaurora.org>:
mm/compaction: remove unused variable sysctl_compact_memory
Charan Teja Reddy <charante@codeaurora.org>:
mm: compaction: update the COMPACT[STALL|FAIL] events properly
Subsystem: mm/migration
Minchan Kim <minchan@kernel.org>:
mm: disable LRU pagevec during the migration temporarily
mm: replace migrate_[prep|finish] with lru_cache_[disable|enable]
mm: fs: invalidate BH LRU during page migration
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for mm/migrate.c", v3:
mm/migrate.c: make putback_movable_page() static
mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case
mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page()
mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole()
Revert "mm: migrate: skip shared exec THP for NUMA balancing"
Subsystem: mm/cma
Minchan Kim <minchan@kernel.org>:
mm: vmstat: add cma statistics
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: cma: use pr_err_ratelimited for CMA warning
Liam Mark <lmark@codeaurora.org>:
mm: cma: add trace events for CMA alloc perf testing
Minchan Kim <minchan@kernel.org>:
mm: cma: support sysfs
mm: cma: add the CMA instance name to cma trace events
mm: use proper type for cma_[alloc|release]
Subsystem: mm/ksm
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for ksm":
ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search()
ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()
ksm: remove dedicated macro KSM_FLAG_MASK
ksm: fix potential missing rmap_item for stable_node
Chengyang Fan <cy.fan@huawei.com>:
mm/ksm: remove unused parameter from remove_trailing_rmap_items()
Subsystem: mm/vmstat
Hugh Dickins <hughd@google.com>:
mm: restore node stat checking in /proc/sys/vm/stat_refresh
mm: no more EINVAL from /proc/sys/vm/stat_refresh
mm: /proc/sys/vm/stat_refresh skip checking known negative stats
mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats
Saravanan D <saravanand@fb.com>:
x86/mm: track linear mapping split events
Subsystem: mm/mmap
Liam Howlett <liam.howlett@oracle.com>:
mm/mmap.c: don't unlock VMAs in remap_file_pages()
Subsystem: mm/kconfig
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm: some config cleanups", v2:
mm: generalize ARCH_HAS_CACHE_LINE_SIZE
mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE]
mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION
mm: drop redundant ARCH_ENABLE_SPLIT_PMD_PTLOCK
mm: drop redundant HAVE_ARCH_TRANSPARENT_HUGEPAGE
Subsystem: mm/util
Joe Perches <joe@perches.com>:
mm/util.c: reduce mem_dump_obj() object size
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
mm/util.c: fix typo
Subsystem: mm/memory-hotplug
Pavel Tatashin <pasha.tatashin@soleen.com>:
Patch series "prohibit pinning pages in ZONE_MOVABLE", v11:
mm/gup: don't pin migrated cma pages in movable zone
mm/gup: check every subpage of a compound page during isolation
mm/gup: return an error on migration failure
mm/gup: check for isolation errors
mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN
mm: apply per-task gfp constraints in fast path
mm: honor PF_MEMALLOC_PIN for all movable pages
mm/gup: do not migrate zero page
mm/gup: migrate pinned pages out of movable zone
memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning
mm/gup: change index type to long as it counts pages
mm/gup: longterm pin migration cleanup
selftests/vm: gup_test: fix test flag
selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages
Mel Gorman <mgorman@techsingularity.net>:
mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove
Oscar Salvador <osalvador@suse.de>:
Patch series "Allocate memmap from hotadded memory (per device)", v10:
drivers/base/memory: introduce memory_block_{online,offline}
mm,memory_hotplug: relax fully spanned sections check
David Hildenbrand <david@redhat.com>:
mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count()
Oscar Salvador <osalvador@suse.de>:
mm,memory_hotplug: allocate memmap from the added memory range
acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported
mm,memory_hotplug: add kernel boot option to enable memmap_on_memory
x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
Subsystem: mm/zswap
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/zswap.c: switch from strlcpy to strscpy
Subsystem: mm/zsmalloc
zhouchuangao <zhouchuangao@vivo.com>:
mm/zsmalloc: use BUG_ON instead of if condition followed by BUG.
Subsystem: mm/highmem
Ira Weiny <ira.weiny@intel.com>:
Patch series "btrfs: Convert kmap/memset/kunmap to memzero_user()":
iov_iter: lift memzero_page() to highmem.h
btrfs: use memzero_page() instead of open coded kmap pattern
songqiang <songqiang@uniontech.com>:
mm/highmem.c: fix coding style issue
Subsystem: mm/cleanups
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/mempool: minor coding style tweaks
Zhang Yunkai <zhang.yunkai@zte.com.cn>:
mm/process_vm_access.c: remove duplicate include
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: zero guard page after out-of-bounds access
Patch series "kfence: optimize timer scheduling", v2:
kfence: await for allocation using wait_event
kfence: maximize allocation wait timeout duration
kfence: use power-efficient work queue to run delayed work
Documentation/ABI/testing/sysfs-kernel-mm-cma | 25
Documentation/admin-guide/kernel-parameters.txt | 17
Documentation/admin-guide/mm/memory-hotplug.rst | 9
Documentation/admin-guide/mm/userfaultfd.rst | 105 +-
arch/arc/Kconfig | 9
arch/arm/Kconfig | 10
arch/arm64/Kconfig | 34
arch/arm64/mm/hugetlbpage.c | 7
arch/ia64/Kconfig | 14
arch/ia64/mm/hugetlbpage.c | 3
arch/mips/Kconfig | 6
arch/mips/mm/hugetlbpage.c | 4
arch/parisc/Kconfig | 5
arch/parisc/mm/hugetlbpage.c | 2
arch/powerpc/Kconfig | 17
arch/powerpc/mm/hugetlbpage.c | 3
arch/powerpc/platforms/Kconfig.cputype | 16
arch/riscv/Kconfig | 5
arch/s390/Kconfig | 12
arch/s390/mm/hugetlbpage.c | 2
arch/sh/Kconfig | 7
arch/sh/mm/Kconfig | 8
arch/sh/mm/hugetlbpage.c | 2
arch/sparc/mm/hugetlbpage.c | 2
arch/x86/Kconfig | 33
arch/x86/mm/pat/set_memory.c | 8
drivers/acpi/acpi_memhotplug.c | 5
drivers/base/memory.c | 105 ++
fs/Kconfig | 5
fs/block_dev.c | 2
fs/btrfs/compression.c | 5
fs/btrfs/extent_io.c | 22
fs/btrfs/inode.c | 33
fs/btrfs/reflink.c | 6
fs/btrfs/zlib.c | 5
fs/btrfs/zstd.c | 5
fs/buffer.c | 36
fs/dax.c | 8
fs/gfs2/glock.c | 3
fs/hugetlbfs/inode.c | 9
fs/inode.c | 11
fs/proc/task_mmu.c | 3
fs/userfaultfd.c | 149 +++
include/linux/buffer_head.h | 4
include/linux/cma.h | 4
include/linux/compaction.h | 1
include/linux/fs.h | 2
include/linux/gfp.h | 2
include/linux/highmem.h | 7
include/linux/huge_mm.h | 3
include/linux/hugetlb.h | 37
include/linux/memcontrol.h | 27
include/linux/memory.h | 8
include/linux/memory_hotplug.h | 15
include/linux/memremap.h | 2
include/linux/migrate.h | 11
include/linux/mm.h | 28
include/linux/mmzone.h | 20
include/linux/pagemap.h | 5
include/linux/pgtable.h | 12
include/linux/sched.h | 2
include/linux/sched/mm.h | 27
include/linux/shrinker.h | 7
include/linux/swap.h | 21
include/linux/userfaultfd_k.h | 55 +
include/linux/vm_event_item.h | 8
include/trace/events/cma.h | 92 +-
include/trace/events/migrate.h | 25
include/trace/events/mmflags.h | 7
include/uapi/linux/mempolicy.h | 7
include/uapi/linux/userfaultfd.h | 36
init/Kconfig | 5
kernel/sysctl.c | 2
lib/Kconfig.kfence | 1
lib/iov_iter.c | 8
mm/Kconfig | 28
mm/Makefile | 6
mm/cma.c | 70 +
mm/cma.h | 25
mm/cma_debug.c | 8
mm/cma_sysfs.c | 112 ++
mm/compaction.c | 113 ++
mm/filemap.c | 24
mm/frontswap.c | 12
mm/gup.c | 264 +++---
mm/gup_test.c | 29
mm/gup_test.h | 3
mm/highmem.c | 11
mm/huge_memory.c | 326 +++++++-
mm/hugetlb.c | 843 ++++++++++++++--------
mm/hugetlb_cgroup.c | 9
mm/internal.h | 10
mm/kfence/core.c | 61 +
mm/khugepaged.c | 63 -
mm/ksm.c | 17
mm/list_lru.c | 6
mm/memcontrol.c | 137 ---
mm/memory_hotplug.c | 220 +++++
mm/mempolicy.c | 16
mm/mempool.c | 2
mm/migrate.c | 103 --
mm/mlock.c | 4
mm/mmap.c | 18
mm/oom_kill.c | 2
mm/page_alloc.c | 83 +-
mm/process_vm_access.c | 1
mm/shmem.c | 2
mm/sparse.c | 4
mm/swap.c | 69 +
mm/swap_state.c | 4
mm/swapfile.c | 4
mm/truncate.c | 19
mm/userfaultfd.c | 39 -
mm/util.c | 26
mm/vmalloc.c | 2
mm/vmscan.c | 543 +++++++++-----
mm/vmstat.c | 45 -
mm/workingset.c | 1
mm/zsmalloc.c | 6
mm/zswap.c | 2
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 1
tools/testing/selftests/vm/gup_test.c | 38
tools/testing/selftests/vm/split_huge_page_test.c | 400 ++++++++++
tools/testing/selftests/vm/userfaultfd.c | 164 ++++
125 files changed, 3596 insertions(+), 1668 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 001/143] mm: introduce and use mapping_empty()
2021-05-05 1:32 incoming Andrew Morton
@ 2021-05-05 1:32 ` Andrew Morton
2021-05-05 1:32 ` [patch 002/143] mm: stop accounting shadow entries Andrew Morton
` (139 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw)
To: akpm, hannes, linux-mm, mm-commits, torvalds, vishal.l.verma,
willy
From: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Subject: mm: introduce and use mapping_empty()
Patch series "Remove nrexceptional tracking", v2.
We actually use nrexceptional for very little these days. It's a minor
pain to keep in sync with nrpages, but the pain becomes much bigger with
the THP patches because we don't know how many indices a shadow entry
occupies. It's easier to just remove it than keep it accurate.
Also, we save 8 bytes per inode which is nothing to sneeze at; on my
laptop, it would improve shmem_inode_cache from 22 to 23 objects per
16kB, and inode_cache from 26 to 27 objects. Combined, that saves
a megabyte of memory from a combined usage of 25MB for both caches.
Unfortunately, ext4 doesn't cross a magic boundary, so it doesn't save
any memory for ext4.
This patch (of 4):
Instead of checking the two counters (nrpages and nrexceptional), we can
just check whether i_pages is empty.
Link: https://lkml.kernel.org/r/20201026151849.24232-1-willy@infradead.org
Link: https://lkml.kernel.org/r/20201026151849.24232-2-willy@infradead.org
Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Tested-by: Vishal Verma <vishal.l.verma@intel.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/block_dev.c | 2 +-
fs/dax.c | 2 +-
fs/gfs2/glock.c | 3 +--
include/linux/pagemap.h | 5 +++++
mm/truncate.c | 18 +++---------------
5 files changed, 11 insertions(+), 19 deletions(-)
--- a/fs/block_dev.c~mm-introduce-and-use-mapping_empty
+++ a/fs/block_dev.c
@@ -79,7 +79,7 @@ static void kill_bdev(struct block_devic
{
struct address_space *mapping = bdev->bd_inode->i_mapping;
- if (mapping->nrpages == 0 && mapping->nrexceptional == 0)
+ if (mapping_empty(mapping))
return;
invalidate_bh_lrus();
--- a/fs/dax.c~mm-introduce-and-use-mapping_empty
+++ a/fs/dax.c
@@ -965,7 +965,7 @@ int dax_writeback_mapping_range(struct a
if (WARN_ON_ONCE(inode->i_blkbits != PAGE_SHIFT))
return -EIO;
- if (!mapping->nrexceptional || wbc->sync_mode != WB_SYNC_ALL)
+ if (mapping_empty(mapping) || wbc->sync_mode != WB_SYNC_ALL)
return 0;
trace_dax_writeback_range(inode, xas.xa_index, end_index);
--- a/fs/gfs2/glock.c~mm-introduce-and-use-mapping_empty
+++ a/fs/gfs2/glock.c
@@ -273,8 +273,7 @@ static void __gfs2_glock_put(struct gfs2
if (mapping) {
truncate_inode_pages_final(mapping);
if (!gfs2_withdrawn(sdp))
- GLOCK_BUG_ON(gl, mapping->nrpages ||
- mapping->nrexceptional);
+ GLOCK_BUG_ON(gl, !mapping_empty(mapping));
}
trace_gfs2_glock_put(gl);
sdp->sd_lockstruct.ls_ops->lm_put_lock(gl);
--- a/include/linux/pagemap.h~mm-introduce-and-use-mapping_empty
+++ a/include/linux/pagemap.h
@@ -18,6 +18,11 @@
struct pagevec;
+static inline bool mapping_empty(struct address_space *mapping)
+{
+ return xa_empty(&mapping->i_pages);
+}
+
/*
* Bits in mapping->flags.
*/
--- a/mm/truncate.c~mm-introduce-and-use-mapping_empty
+++ a/mm/truncate.c
@@ -295,7 +295,7 @@ void truncate_inode_pages_range(struct a
pgoff_t index;
int i;
- if (mapping->nrpages == 0 && mapping->nrexceptional == 0)
+ if (mapping_empty(mapping))
goto out;
/* Offsets within partial pages */
@@ -440,9 +440,6 @@ EXPORT_SYMBOL(truncate_inode_pages);
*/
void truncate_inode_pages_final(struct address_space *mapping)
{
- unsigned long nrexceptional;
- unsigned long nrpages;
-
/*
* Page reclaim can not participate in regular inode lifetime
* management (can't call iput()) and thus can race with the
@@ -452,16 +449,7 @@ void truncate_inode_pages_final(struct a
*/
mapping_set_exiting(mapping);
- /*
- * When reclaim installs eviction entries, it increases
- * nrexceptional first, then decreases nrpages. Make sure we see
- * this in the right order or we might miss an entry.
- */
- nrpages = mapping->nrpages;
- smp_rmb();
- nrexceptional = mapping->nrexceptional;
-
- if (nrpages || nrexceptional) {
+ if (!mapping_empty(mapping)) {
/*
* As truncation uses a lockless tree lookup, cycle
* the tree lock to make sure any ongoing tree
@@ -633,7 +621,7 @@ int invalidate_inode_pages2_range(struct
int ret2 = 0;
int did_range_unmap = 0;
- if (mapping->nrpages == 0 && mapping->nrexceptional == 0)
+ if (mapping_empty(mapping))
goto out;
pagevec_init(&pvec);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 002/143] mm: stop accounting shadow entries
2021-05-05 1:32 incoming Andrew Morton
2021-05-05 1:32 ` [patch 001/143] mm: introduce and use mapping_empty() Andrew Morton
@ 2021-05-05 1:32 ` Andrew Morton
2021-05-05 1:32 ` [patch 003/143] dax: account DAX entries as nrpages Andrew Morton
` (138 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw)
To: akpm, hannes, linux-mm, mm-commits, torvalds, vishal.l.verma,
willy
From: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Subject: mm: stop accounting shadow entries
We no longer need to keep track of how many shadow entries are present in
a mapping. This saves a few writes to the inode and memory barriers.
Link: https://lkml.kernel.org/r/20201026151849.24232-3-willy@infradead.org
Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Tested-by: Vishal Verma <vishal.l.verma@intel.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/filemap.c | 13 -------------
mm/swap_state.c | 4 ----
mm/truncate.c | 1 -
mm/workingset.c | 1 -
4 files changed, 19 deletions(-)
--- a/mm/filemap.c~mm-stop-accounting-shadow-entries
+++ a/mm/filemap.c
@@ -142,17 +142,6 @@ static void page_cache_delete(struct add
page->mapping = NULL;
/* Leave page->index set: truncation lookup relies upon it */
-
- if (shadow) {
- mapping->nrexceptional += nr;
- /*
- * Make sure the nrexceptional update is committed before
- * the nrpages update so that final truncate racing
- * with reclaim does not see both counters 0 at the
- * same time and miss a shadow entry.
- */
- smp_wmb();
- }
mapping->nrpages -= nr;
}
@@ -925,8 +914,6 @@ noinline int __add_to_page_cache_locked(
if (xas_error(&xas))
goto unlock;
- if (old)
- mapping->nrexceptional--;
mapping->nrpages++;
/* hugetlb pages do not participate in page cache accounting */
--- a/mm/swap_state.c~mm-stop-accounting-shadow-entries
+++ a/mm/swap_state.c
@@ -132,7 +132,6 @@ int add_to_swap_cache(struct page *page,
xas_store(&xas, page);
xas_next(&xas);
}
- address_space->nrexceptional -= nr_shadows;
address_space->nrpages += nr;
__mod_node_page_state(page_pgdat(page), NR_FILE_PAGES, nr);
__mod_lruvec_page_state(page, NR_SWAPCACHE, nr);
@@ -172,8 +171,6 @@ void __delete_from_swap_cache(struct pag
xas_next(&xas);
}
ClearPageSwapCache(page);
- if (shadow)
- address_space->nrexceptional += nr;
address_space->nrpages -= nr;
__mod_node_page_state(page_pgdat(page), NR_FILE_PAGES, -nr);
__mod_lruvec_page_state(page, NR_SWAPCACHE, -nr);
@@ -275,7 +272,6 @@ void clear_shadow_from_swap_cache(int ty
xas_store(&xas, NULL);
nr_shadows++;
}
- address_space->nrexceptional -= nr_shadows;
xa_unlock_irq(&address_space->i_pages);
/* search the next swapcache until we meet end */
--- a/mm/truncate.c~mm-stop-accounting-shadow-entries
+++ a/mm/truncate.c
@@ -40,7 +40,6 @@ static inline void __clear_shadow_entry(
if (xas_load(&xas) != entry)
return;
xas_store(&xas, NULL);
- mapping->nrexceptional--;
}
static void clear_shadow_entry(struct address_space *mapping, pgoff_t index,
--- a/mm/workingset.c~mm-stop-accounting-shadow-entries
+++ a/mm/workingset.c
@@ -554,7 +554,6 @@ static enum lru_status shadow_lru_isolat
goto out_invalid;
if (WARN_ON_ONCE(node->count != node->nr_values))
goto out_invalid;
- mapping->nrexceptional -= node->nr_values;
xa_delete_node(node, workingset_update_node);
__inc_lruvec_kmem_state(node, WORKINGSET_NODERECLAIM);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 003/143] dax: account DAX entries as nrpages
2021-05-05 1:32 incoming Andrew Morton
2021-05-05 1:32 ` [patch 001/143] mm: introduce and use mapping_empty() Andrew Morton
2021-05-05 1:32 ` [patch 002/143] mm: stop accounting shadow entries Andrew Morton
@ 2021-05-05 1:32 ` Andrew Morton
2021-05-05 1:32 ` [patch 004/143] mm: remove nrexceptional from inode Andrew Morton
` (137 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw)
To: akpm, hannes, linux-mm, mm-commits, torvalds, vishal.l.verma,
willy
From: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Subject: dax: account DAX entries as nrpages
Simplify mapping_needs_writeback() by accounting DAX entries as pages
instead of exceptional entries.
Link: https://lkml.kernel.org/r/20201026151849.24232-4-willy@infradead.org
Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Tested-by: Vishal Verma <vishal.l.verma@intel.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/dax.c | 6 +++---
mm/filemap.c | 3 ---
2 files changed, 3 insertions(+), 6 deletions(-)
--- a/fs/dax.c~dax-account-dax-entries-as-nrpages
+++ a/fs/dax.c
@@ -525,7 +525,7 @@ retry:
dax_disassociate_entry(entry, mapping, false);
xas_store(xas, NULL); /* undo the PMD join */
dax_wake_entry(xas, entry, true);
- mapping->nrexceptional--;
+ mapping->nrpages -= PG_PMD_NR;
entry = NULL;
xas_set(xas, index);
}
@@ -541,7 +541,7 @@ retry:
dax_lock_entry(xas, entry);
if (xas_error(xas))
goto out_unlock;
- mapping->nrexceptional++;
+ mapping->nrpages += 1UL << order;
}
out_unlock:
@@ -661,7 +661,7 @@ static int __dax_invalidate_entry(struct
goto out;
dax_disassociate_entry(entry, mapping, trunc);
xas_store(&xas, NULL);
- mapping->nrexceptional--;
+ mapping->nrpages -= 1UL << dax_entry_order(entry);
ret = 1;
out:
put_unlocked_entry(&xas, entry);
--- a/mm/filemap.c~dax-account-dax-entries-as-nrpages
+++ a/mm/filemap.c
@@ -618,9 +618,6 @@ EXPORT_SYMBOL(filemap_fdatawait_keep_err
/* Returns true if writeback might be needed or already in progress. */
static bool mapping_needs_writeback(struct address_space *mapping)
{
- if (dax_mapping(mapping))
- return mapping->nrexceptional;
-
return mapping->nrpages;
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 004/143] mm: remove nrexceptional from inode
2021-05-05 1:32 incoming Andrew Morton
` (2 preceding siblings ...)
2021-05-05 1:32 ` [patch 003/143] dax: account DAX entries as nrpages Andrew Morton
@ 2021-05-05 1:32 ` Andrew Morton
2021-05-05 1:32 ` [patch 005/143] mm: remove nrexceptional from inode: remove BUG_ON Andrew Morton
` (136 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw)
To: akpm, hannes, linux-mm, mm-commits, torvalds, vishal.l.verma,
willy
From: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Subject: mm: remove nrexceptional from inode
We no longer track anything in nrexceptional, so remove it, saving 8 bytes
per inode.
Link: https://lkml.kernel.org/r/20201026151849.24232-5-willy@infradead.org
Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Tested-by: Vishal Verma <vishal.l.verma@intel.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/inode.c | 2 +-
include/linux/fs.h | 2 --
2 files changed, 1 insertion(+), 3 deletions(-)
--- a/fs/inode.c~mm-remove-nrexceptional-from-inode
+++ a/fs/inode.c
@@ -529,7 +529,7 @@ void clear_inode(struct inode *inode)
*/
xa_lock_irq(&inode->i_data.i_pages);
BUG_ON(inode->i_data.nrpages);
- BUG_ON(inode->i_data.nrexceptional);
+ BUG_ON(!mapping_empty(&inode->i_data));
xa_unlock_irq(&inode->i_data.i_pages);
BUG_ON(!list_empty(&inode->i_data.private_list));
BUG_ON(!(inode->i_state & I_FREEING));
--- a/include/linux/fs.h~mm-remove-nrexceptional-from-inode
+++ a/include/linux/fs.h
@@ -442,7 +442,6 @@ int pagecache_write_end(struct file *, s
* @i_mmap: Tree of private and shared mappings.
* @i_mmap_rwsem: Protects @i_mmap and @i_mmap_writable.
* @nrpages: Number of page entries, protected by the i_pages lock.
- * @nrexceptional: Shadow or DAX entries, protected by the i_pages lock.
* @writeback_index: Writeback starts here.
* @a_ops: Methods.
* @flags: Error bits and flags (AS_*).
@@ -463,7 +462,6 @@ struct address_space {
struct rb_root_cached i_mmap;
struct rw_semaphore i_mmap_rwsem;
unsigned long nrpages;
- unsigned long nrexceptional;
pgoff_t writeback_index;
const struct address_space_operations *a_ops;
unsigned long flags;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 005/143] mm: remove nrexceptional from inode: remove BUG_ON
2021-05-05 1:32 incoming Andrew Morton
` (3 preceding siblings ...)
2021-05-05 1:32 ` [patch 004/143] mm: remove nrexceptional from inode Andrew Morton
@ 2021-05-05 1:32 ` Andrew Morton
2021-05-05 1:33 ` [patch 006/143] hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share() Andrew Morton
` (135 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw)
To: akpm, hughd, linux-mm, mm-commits, torvalds, willy
From: Hugh Dickins <hughd@google.com>
Subject: mm: remove nrexceptional from inode: remove BUG_ON
clear_inode()'s BUG_ON(!mapping_empty(&inode->i_data)) is unsafe: we know
of two ways in which nodes can and do (on rare occasions) get left behind.
Until those are fixed, do not BUG_ON() nor even WARN_ON(). Yes, this
will then leak those nodes (or the next user of the struct inode may use
them); but this has been happening for years, and the new
BUG_ON(!mapping_empty) was only guilty of revealing that. A proper fix
will follow, but no hurry.
Link: https://lkml.kernel.org/r/alpine.LSU.2.11.2104292229380.16080@eggly.anvils
Signed-off-by: Hugh Dickins <hughd@google.com>
Cc: Matthew Wilcox <willy@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/inode.c | 9 ++++++++-
1 file changed, 8 insertions(+), 1 deletion(-)
--- a/fs/inode.c~mm-remove-nrexceptional-from-inode-remove-bug_on
+++ a/fs/inode.c
@@ -529,7 +529,14 @@ void clear_inode(struct inode *inode)
*/
xa_lock_irq(&inode->i_data.i_pages);
BUG_ON(inode->i_data.nrpages);
- BUG_ON(!mapping_empty(&inode->i_data));
+ /*
+ * Almost always, mapping_empty(&inode->i_data) here; but there are
+ * two known and long-standing ways in which nodes may get left behind
+ * (when deep radix-tree node allocation failed partway; or when THP
+ * collapse_file() failed). Until those two known cases are cleaned up,
+ * or a cleanup function is called here, do not BUG_ON(!mapping_empty),
+ * nor even WARN_ON(!mapping_empty).
+ */
xa_unlock_irq(&inode->i_data.i_pages);
BUG_ON(!list_empty(&inode->i_data.private_list));
BUG_ON(!(inode->i_state & I_FREEING));
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 006/143] hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share()
2021-05-05 1:32 incoming Andrew Morton
` (4 preceding siblings ...)
2021-05-05 1:32 ` [patch 005/143] mm: remove nrexceptional from inode: remove BUG_ON Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 007/143] hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled Andrew Morton
` (134 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
steven.price, torvalds, vbabka, viro, walken, willy, ying.huang
From: Peter Xu <peterx@redhat.com>
Subject: hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share()
Patch series "hugetlb: Disable huge pmd unshare for uffd-wp", v4.
This series tries to disable huge pmd unshare of hugetlbfs backed memory
for uffd-wp. Although uffd-wp of hugetlbfs is still during rfc stage, the
idea of this series may be needed for multiple tasks (Axel's uffd minor
fault series, and Mike's soft dirty series), so I picked it out from the
larger series.
This patch (of 4):
It is a preparation work to be able to behave differently in the per
architecture huge_pte_alloc() according to different VMA attributes.
Pass it deeper into huge_pmd_share() so that we can avoid the find_vma() call.
[peterx@redhat.com: build fix]
Link: https://lkml.kernel.org/r/20210304164653.GB397383@xz-x1Link: https://lkml.kernel.org/r/20210218230633.15028-1-peterx@redhat.com
Link: https://lkml.kernel.org/r/20210218230633.15028-2-peterx@redhat.com
Signed-off-by: Peter Xu <peterx@redhat.com>
Suggested-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Axel Rasmussen <axelrasmussen@google.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/arm64/mm/hugetlbpage.c | 4 ++--
arch/ia64/mm/hugetlbpage.c | 3 ++-
arch/mips/mm/hugetlbpage.c | 4 ++--
arch/parisc/mm/hugetlbpage.c | 2 +-
arch/powerpc/mm/hugetlbpage.c | 3 ++-
arch/s390/mm/hugetlbpage.c | 2 +-
arch/sh/mm/hugetlbpage.c | 2 +-
arch/sparc/mm/hugetlbpage.c | 2 +-
include/linux/hugetlb.h | 5 +++--
mm/hugetlb.c | 15 ++++++++-------
mm/userfaultfd.c | 2 +-
11 files changed, 24 insertions(+), 20 deletions(-)
--- a/arch/arm64/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/arm64/mm/hugetlbpage.c
@@ -252,7 +252,7 @@ void set_huge_swap_pte_at(struct mm_stru
set_pte(ptep, pte);
}
-pte_t *huge_pte_alloc(struct mm_struct *mm,
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
unsigned long addr, unsigned long sz)
{
pgd_t *pgdp;
@@ -286,7 +286,7 @@ pte_t *huge_pte_alloc(struct mm_struct *
} else if (sz == PMD_SIZE) {
if (IS_ENABLED(CONFIG_ARCH_WANT_HUGE_PMD_SHARE) &&
pud_none(READ_ONCE(*pudp)))
- ptep = huge_pmd_share(mm, addr, pudp);
+ ptep = huge_pmd_share(mm, vma, addr, pudp);
else
ptep = (pte_t *)pmd_alloc(mm, pudp, addr);
} else if (sz == (CONT_PMD_SIZE)) {
--- a/arch/ia64/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/ia64/mm/hugetlbpage.c
@@ -25,7 +25,8 @@ unsigned int hpage_shift = HPAGE_SHIFT_D
EXPORT_SYMBOL(hpage_shift);
pte_t *
-huge_pte_alloc(struct mm_struct *mm, unsigned long addr, unsigned long sz)
+huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
+ unsigned long addr, unsigned long sz)
{
unsigned long taddr = htlbpage_to_page(addr);
pgd_t *pgd;
--- a/arch/mips/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/mips/mm/hugetlbpage.c
@@ -21,8 +21,8 @@
#include <asm/tlb.h>
#include <asm/tlbflush.h>
-pte_t *huge_pte_alloc(struct mm_struct *mm, unsigned long addr,
- unsigned long sz)
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
+ unsigned long addr, unsigned long sz)
{
pgd_t *pgd;
p4d_t *p4d;
--- a/arch/parisc/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/parisc/mm/hugetlbpage.c
@@ -44,7 +44,7 @@ hugetlb_get_unmapped_area(struct file *f
}
-pte_t *huge_pte_alloc(struct mm_struct *mm,
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
unsigned long addr, unsigned long sz)
{
pgd_t *pgd;
--- a/arch/powerpc/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/powerpc/mm/hugetlbpage.c
@@ -106,7 +106,8 @@ static int __hugepte_alloc(struct mm_str
* At this point we do the placement change only for BOOK3S 64. This would
* possibly work on other subarchs.
*/
-pte_t *huge_pte_alloc(struct mm_struct *mm, unsigned long addr, unsigned long sz)
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
+ unsigned long addr, unsigned long sz)
{
pgd_t *pg;
p4d_t *p4;
--- a/arch/s390/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/s390/mm/hugetlbpage.c
@@ -189,7 +189,7 @@ pte_t huge_ptep_get_and_clear(struct mm_
return pte;
}
-pte_t *huge_pte_alloc(struct mm_struct *mm,
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
unsigned long addr, unsigned long sz)
{
pgd_t *pgdp;
--- a/arch/sh/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/sh/mm/hugetlbpage.c
@@ -21,7 +21,7 @@
#include <asm/tlbflush.h>
#include <asm/cacheflush.h>
-pte_t *huge_pte_alloc(struct mm_struct *mm,
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
unsigned long addr, unsigned long sz)
{
pgd_t *pgd;
--- a/arch/sparc/mm/hugetlbpage.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/arch/sparc/mm/hugetlbpage.c
@@ -279,7 +279,7 @@ unsigned long pud_leaf_size(pud_t pud) {
unsigned long pmd_leaf_size(pmd_t pmd) { return 1UL << tte_to_shift(*(pte_t *)&pmd); }
unsigned long pte_leaf_size(pte_t pte) { return 1UL << tte_to_shift(pte); }
-pte_t *huge_pte_alloc(struct mm_struct *mm,
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
unsigned long addr, unsigned long sz)
{
pgd_t *pgd;
--- a/include/linux/hugetlb.h~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/include/linux/hugetlb.h
@@ -152,7 +152,8 @@ void hugetlb_fix_reserve_counts(struct i
extern struct mutex *hugetlb_fault_mutex_table;
u32 hugetlb_fault_mutex_hash(struct address_space *mapping, pgoff_t idx);
-pte_t *huge_pmd_share(struct mm_struct *mm, unsigned long addr, pud_t *pud);
+pte_t *huge_pmd_share(struct mm_struct *mm, struct vm_area_struct *vma,
+ unsigned long addr, pud_t *pud);
struct address_space *hugetlb_page_mapping_lock_write(struct page *hpage);
@@ -161,7 +162,7 @@ extern struct list_head huge_boot_pages;
/* arch callbacks */
-pte_t *huge_pte_alloc(struct mm_struct *mm,
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
unsigned long addr, unsigned long sz);
pte_t *huge_pte_offset(struct mm_struct *mm,
unsigned long addr, unsigned long sz);
--- a/mm/hugetlb.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/mm/hugetlb.c
@@ -3795,7 +3795,7 @@ int copy_hugetlb_page_range(struct mm_st
src_pte = huge_pte_offset(src, addr, sz);
if (!src_pte)
continue;
- dst_pte = huge_pte_alloc(dst, addr, sz);
+ dst_pte = huge_pte_alloc(dst, vma, addr, sz);
if (!dst_pte) {
ret = -ENOMEM;
break;
@@ -4563,7 +4563,7 @@ vm_fault_t hugetlb_fault(struct mm_struc
*/
mapping = vma->vm_file->f_mapping;
i_mmap_lock_read(mapping);
- ptep = huge_pte_alloc(mm, haddr, huge_page_size(h));
+ ptep = huge_pte_alloc(mm, vma, haddr, huge_page_size(h));
if (!ptep) {
i_mmap_unlock_read(mapping);
return VM_FAULT_OOM;
@@ -5370,9 +5370,9 @@ void adjust_range_if_pmd_sharing_possibl
* if !vma_shareable check at the beginning of the routine. i_mmap_rwsem is
* only required for subsequent processing.
*/
-pte_t *huge_pmd_share(struct mm_struct *mm, unsigned long addr, pud_t *pud)
+pte_t *huge_pmd_share(struct mm_struct *mm, struct vm_area_struct *vma,
+ unsigned long addr, pud_t *pud)
{
- struct vm_area_struct *vma = find_vma(mm, addr);
struct address_space *mapping = vma->vm_file->f_mapping;
pgoff_t idx = ((addr - vma->vm_start) >> PAGE_SHIFT) +
vma->vm_pgoff;
@@ -5450,7 +5450,8 @@ int huge_pmd_unshare(struct mm_struct *m
}
#define want_pmd_share() (1)
#else /* !CONFIG_ARCH_WANT_HUGE_PMD_SHARE */
-pte_t *huge_pmd_share(struct mm_struct *mm, unsigned long addr, pud_t *pud)
+pte_t *huge_pmd_share(struct mm_struct *mm, struct vm_area_struct *vma,
+ unsigned long addr, pud_t *pud)
{
return NULL;
}
@@ -5469,7 +5470,7 @@ void adjust_range_if_pmd_sharing_possibl
#endif /* CONFIG_ARCH_WANT_HUGE_PMD_SHARE */
#ifdef CONFIG_ARCH_WANT_GENERAL_HUGETLB
-pte_t *huge_pte_alloc(struct mm_struct *mm,
+pte_t *huge_pte_alloc(struct mm_struct *mm, struct vm_area_struct *vma,
unsigned long addr, unsigned long sz)
{
pgd_t *pgd;
@@ -5488,7 +5489,7 @@ pte_t *huge_pte_alloc(struct mm_struct *
} else {
BUG_ON(sz != PMD_SIZE);
if (want_pmd_share() && pud_none(*pud))
- pte = huge_pmd_share(mm, addr, pud);
+ pte = huge_pmd_share(mm, vma, addr, pud);
else
pte = (pte_t *)pmd_alloc(mm, pud, addr);
}
--- a/mm/userfaultfd.c~hugetlb-pass-vma-into-huge_pte_alloc-and-huge_pmd_share
+++ a/mm/userfaultfd.c
@@ -290,7 +290,7 @@ retry:
mutex_lock(&hugetlb_fault_mutex_table[hash]);
err = -ENOMEM;
- dst_pte = huge_pte_alloc(dst_mm, dst_addr, vma_hpagesize);
+ dst_pte = huge_pte_alloc(dst_mm, dst_vma, dst_addr, vma_hpagesize);
if (!dst_pte) {
mutex_unlock(&hugetlb_fault_mutex_table[hash]);
i_mmap_unlock_read(mapping);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 007/143] hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled
2021-05-05 1:32 incoming Andrew Morton
` (5 preceding siblings ...)
2021-05-05 1:33 ` [patch 006/143] hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share() Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 008/143] mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h Andrew Morton
` (133 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
mike.kravetz, mingo, mkoutny, mm-commits, mpe, naresh.kamboju,
npiggin, oupton, peterx, rientjes, rostedt, rppt, ruprecht, shawn,
shli, steven.price, torvalds, vbabka, viro, walken, willy,
ying.huang
From: Peter Xu <peterx@redhat.com>
Subject: hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled
Huge pmd sharing could bring problem to userfaultfd. The thing is that
userfaultfd is running its logic based on the special bits on page table
entries, however the huge pmd sharing could potentially share page table
entries for different address ranges. That could cause issues on either:
- When sharing huge pmd page tables for an uffd write protected range, the
newly mapped huge pmd range will also be write protected unexpectedly, or,
- When we try to write protect a range of huge pmd shared range, we'll first
do huge_pmd_unshare() in hugetlb_change_protection(), however that also
means the UFFDIO_WRITEPROTECT could be silently skipped for the shared
region, which could lead to data loss.
Since at it, a few other things are done altogether:
- Move want_pmd_share() from mm/hugetlb.c into linux/hugetlb.h, because
that's definitely something that arch code would like to use too
- ARM64 currently directly check against CONFIG_ARCH_WANT_HUGE_PMD_SHARE when
trying to share huge pmd. Switch to the want_pmd_share() helper.
Since at it, move vma_shareable() from huge_pmd_share() into want_pmd_share().
[peterx@redhat.com: fix build with !ARCH_WANT_HUGE_PMD_SHARE]
Link: https://lkml.kernel.org/r/20210310185359.88297-1-peterx@redhat.com
Link: https://lkml.kernel.org/r/20210218231202.15426-1-peterx@redhat.com
Signed-off-by: Peter Xu <peterx@redhat.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: Axel Rasmussen <axelrasmussen@google.com>
Tested-by: Naresh Kamboju <naresh.kamboju@linaro.org>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/arm64/mm/hugetlbpage.c | 3 +--
include/linux/hugetlb.h | 2 ++
include/linux/userfaultfd_k.h | 9 +++++++++
mm/hugetlb.c | 22 ++++++++++++++++------
4 files changed, 28 insertions(+), 8 deletions(-)
--- a/arch/arm64/mm/hugetlbpage.c~hugetlb-userfaultfd-forbid-huge-pmd-sharing-when-uffd-enabled
+++ a/arch/arm64/mm/hugetlbpage.c
@@ -284,8 +284,7 @@ pte_t *huge_pte_alloc(struct mm_struct *
*/
ptep = pte_alloc_map(mm, pmdp, addr);
} else if (sz == PMD_SIZE) {
- if (IS_ENABLED(CONFIG_ARCH_WANT_HUGE_PMD_SHARE) &&
- pud_none(READ_ONCE(*pudp)))
+ if (want_pmd_share(vma, addr) && pud_none(READ_ONCE(*pudp)))
ptep = huge_pmd_share(mm, vma, addr, pudp);
else
ptep = (pte_t *)pmd_alloc(mm, pudp, addr);
--- a/include/linux/hugetlb.h~hugetlb-userfaultfd-forbid-huge-pmd-sharing-when-uffd-enabled
+++ a/include/linux/hugetlb.h
@@ -1040,4 +1040,6 @@ static inline __init void hugetlb_cma_ch
}
#endif
+bool want_pmd_share(struct vm_area_struct *vma, unsigned long addr);
+
#endif /* _LINUX_HUGETLB_H */
--- a/include/linux/userfaultfd_k.h~hugetlb-userfaultfd-forbid-huge-pmd-sharing-when-uffd-enabled
+++ a/include/linux/userfaultfd_k.h
@@ -52,6 +52,15 @@ static inline bool is_mergeable_vm_userf
return vma->vm_userfaultfd_ctx.ctx == vm_ctx.ctx;
}
+/*
+ * Never enable huge pmd sharing on uffd-wp registered vmas, because uffd-wp
+ * protect information is per pgtable entry.
+ */
+static inline bool uffd_disable_huge_pmd_share(struct vm_area_struct *vma)
+{
+ return vma->vm_flags & VM_UFFD_WP;
+}
+
static inline bool userfaultfd_missing(struct vm_area_struct *vma)
{
return vma->vm_flags & VM_UFFD_MISSING;
--- a/mm/hugetlb.c~hugetlb-userfaultfd-forbid-huge-pmd-sharing-when-uffd-enabled
+++ a/mm/hugetlb.c
@@ -5326,6 +5326,15 @@ static bool vma_shareable(struct vm_area
return false;
}
+bool want_pmd_share(struct vm_area_struct *vma, unsigned long addr)
+{
+#ifdef CONFIG_USERFAULTFD
+ if (uffd_disable_huge_pmd_share(vma))
+ return false;
+#endif
+ return vma_shareable(vma, addr);
+}
+
/*
* Determine if start,end range within vma could be mapped by shared pmd.
* If yes, adjust start and end to cover range associated with possible
@@ -5382,9 +5391,6 @@ pte_t *huge_pmd_share(struct mm_struct *
pte_t *pte;
spinlock_t *ptl;
- if (!vma_shareable(vma, addr))
- return (pte_t *)pmd_alloc(mm, pud, addr);
-
i_mmap_assert_locked(mapping);
vma_interval_tree_foreach(svma, &mapping->i_mmap, idx, idx) {
if (svma == vma)
@@ -5448,7 +5454,7 @@ int huge_pmd_unshare(struct mm_struct *m
*addr = ALIGN(*addr, HPAGE_SIZE * PTRS_PER_PTE) - HPAGE_SIZE;
return 1;
}
-#define want_pmd_share() (1)
+
#else /* !CONFIG_ARCH_WANT_HUGE_PMD_SHARE */
pte_t *huge_pmd_share(struct mm_struct *mm, struct vm_area_struct *vma,
unsigned long addr, pud_t *pud)
@@ -5466,7 +5472,11 @@ void adjust_range_if_pmd_sharing_possibl
unsigned long *start, unsigned long *end)
{
}
-#define want_pmd_share() (0)
+
+bool want_pmd_share(struct vm_area_struct *vma, unsigned long addr)
+{
+ return false;
+}
#endif /* CONFIG_ARCH_WANT_HUGE_PMD_SHARE */
#ifdef CONFIG_ARCH_WANT_GENERAL_HUGETLB
@@ -5488,7 +5498,7 @@ pte_t *huge_pte_alloc(struct mm_struct *
pte = (pte_t *)pud;
} else {
BUG_ON(sz != PMD_SIZE);
- if (want_pmd_share() && pud_none(*pud))
+ if (want_pmd_share(vma, addr) && pud_none(*pud))
pte = huge_pmd_share(mm, vma, addr, pud);
else
pte = (pte_t *)pmd_alloc(mm, pud, addr);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 008/143] mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h
2021-05-05 1:32 incoming Andrew Morton
` (6 preceding siblings ...)
2021-05-05 1:33 ` [patch 007/143] hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 009/143] hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp Andrew Morton
` (132 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
steven.price, torvalds, vbabka, viro, walken, willy, ying.huang
From: Peter Xu <peterx@redhat.com>
Subject: mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h
Prepare for it to be called outside of mm/hugetlb.c.
Link: https://lkml.kernel.org/r/20210218231204.15474-1-peterx@redhat.com
Signed-off-by: Peter Xu <peterx@redhat.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: Axel Rasmussen <axelrasmussen@google.com>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/hugetlb.h | 8 ++++++++
mm/hugetlb.c | 8 --------
2 files changed, 8 insertions(+), 8 deletions(-)
--- a/include/linux/hugetlb.h~mm-hugetlb-move-flush_hugetlb_tlb_range-into-hugetlbh
+++ a/include/linux/hugetlb.h
@@ -1042,4 +1042,12 @@ static inline __init void hugetlb_cma_ch
bool want_pmd_share(struct vm_area_struct *vma, unsigned long addr);
+#ifndef __HAVE_ARCH_FLUSH_HUGETLB_TLB_RANGE
+/*
+ * ARCHes with special requirements for evicting HUGETLB backing TLB entries can
+ * implement this.
+ */
+#define flush_hugetlb_tlb_range(vma, addr, end) flush_tlb_range(vma, addr, end)
+#endif
+
#endif /* _LINUX_HUGETLB_H */
--- a/mm/hugetlb.c~mm-hugetlb-move-flush_hugetlb_tlb_range-into-hugetlbh
+++ a/mm/hugetlb.c
@@ -4996,14 +4996,6 @@ long follow_hugetlb_page(struct mm_struc
return i ? i : err;
}
-#ifndef __HAVE_ARCH_FLUSH_HUGETLB_TLB_RANGE
-/*
- * ARCHes with special requirements for evicting HUGETLB backing TLB entries can
- * implement this.
- */
-#define flush_hugetlb_tlb_range(vma, addr, end) flush_tlb_range(vma, addr, end)
-#endif
-
unsigned long hugetlb_change_protection(struct vm_area_struct *vma,
unsigned long address, unsigned long end, pgprot_t newprot)
{
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 009/143] hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp
2021-05-05 1:32 incoming Andrew Morton
` (7 preceding siblings ...)
2021-05-05 1:33 ` [patch 008/143] mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 010/143] mm/hugetlb: remove redundant reservation check condition in alloc_huge_page() Andrew Morton
` (131 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
steven.price, torvalds, vbabka, viro, walken, willy, ying.huang
From: Peter Xu <peterx@redhat.com>
Subject: hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp
Huge pmd sharing for hugetlbfs is racy with userfaultfd-wp because
userfaultfd-wp is always based on pgtable entries, so they cannot be
shared.
Walk the hugetlb range and unshare all such mappings if there is, right
before UFFDIO_REGISTER will succeed and return to userspace.
This will pair with want_pmd_share() in hugetlb code so that huge pmd
sharing is completely disabled for userfaultfd-wp registered range.
Link: https://lkml.kernel.org/r/20210218231206.15524-1-peterx@redhat.com
Signed-off-by: Peter Xu <peterx@redhat.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Axel Rasmussen <axelrasmussen@google.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Matthew Wilcox (Oracle) <willy@infradead.org>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/userfaultfd.c | 4 ++
include/linux/hugetlb.h | 3 ++
mm/hugetlb.c | 51 ++++++++++++++++++++++++++++++++++++++
3 files changed, 58 insertions(+)
--- a/fs/userfaultfd.c~hugetlb-userfaultfd-unshare-all-pmds-for-hugetlbfs-when-register-wp
+++ a/fs/userfaultfd.c
@@ -15,6 +15,7 @@
#include <linux/sched/signal.h>
#include <linux/sched/mm.h>
#include <linux/mm.h>
+#include <linux/mmu_notifier.h>
#include <linux/poll.h>
#include <linux/slab.h>
#include <linux/seq_file.h>
@@ -1449,6 +1450,9 @@ static int userfaultfd_register(struct u
vma->vm_flags = new_flags;
vma->vm_userfaultfd_ctx.ctx = ctx;
+ if (is_vm_hugetlb_page(vma) && uffd_disable_huge_pmd_share(vma))
+ hugetlb_unshare_all_pmds(vma);
+
skip:
prev = vma;
start = vma->vm_end;
--- a/include/linux/hugetlb.h~hugetlb-userfaultfd-unshare-all-pmds-for-hugetlbfs-when-register-wp
+++ a/include/linux/hugetlb.h
@@ -188,6 +188,7 @@ unsigned long hugetlb_change_protection(
unsigned long address, unsigned long end, pgprot_t newprot);
bool is_hugetlb_entry_migration(pte_t pte);
+void hugetlb_unshare_all_pmds(struct vm_area_struct *vma);
#else /* !CONFIG_HUGETLB_PAGE */
@@ -369,6 +370,8 @@ static inline vm_fault_t hugetlb_fault(s
return 0;
}
+static inline void hugetlb_unshare_all_pmds(struct vm_area_struct *vma) { }
+
#endif /* !CONFIG_HUGETLB_PAGE */
/*
* hugepages at page global directory. If arch support
--- a/mm/hugetlb.c~hugetlb-userfaultfd-unshare-all-pmds-for-hugetlbfs-when-register-wp
+++ a/mm/hugetlb.c
@@ -5691,6 +5691,57 @@ void move_hugetlb_state(struct page *old
}
}
+/*
+ * This function will unconditionally remove all the shared pmd pgtable entries
+ * within the specific vma for a hugetlbfs memory range.
+ */
+void hugetlb_unshare_all_pmds(struct vm_area_struct *vma)
+{
+ struct hstate *h = hstate_vma(vma);
+ unsigned long sz = huge_page_size(h);
+ struct mm_struct *mm = vma->vm_mm;
+ struct mmu_notifier_range range;
+ unsigned long address, start, end;
+ spinlock_t *ptl;
+ pte_t *ptep;
+
+ if (!(vma->vm_flags & VM_MAYSHARE))
+ return;
+
+ start = ALIGN(vma->vm_start, PUD_SIZE);
+ end = ALIGN_DOWN(vma->vm_end, PUD_SIZE);
+
+ if (start >= end)
+ return;
+
+ /*
+ * No need to call adjust_range_if_pmd_sharing_possible(), because
+ * we have already done the PUD_SIZE alignment.
+ */
+ mmu_notifier_range_init(&range, MMU_NOTIFY_CLEAR, 0, vma, mm,
+ start, end);
+ mmu_notifier_invalidate_range_start(&range);
+ i_mmap_lock_write(vma->vm_file->f_mapping);
+ for (address = start; address < end; address += PUD_SIZE) {
+ unsigned long tmp = address;
+
+ ptep = huge_pte_offset(mm, address, sz);
+ if (!ptep)
+ continue;
+ ptl = huge_pte_lock(h, mm, ptep);
+ /* We don't want 'address' to be changed */
+ huge_pmd_unshare(mm, vma, &tmp, ptep);
+ spin_unlock(ptl);
+ }
+ flush_hugetlb_tlb_range(vma, start, end);
+ i_mmap_unlock_write(vma->vm_file->f_mapping);
+ /*
+ * No need to call mmu_notifier_invalidate_range(), see
+ * Documentation/vm/mmu_notifier.rst.
+ */
+ mmu_notifier_invalidate_range_end(&range);
+}
+
#ifdef CONFIG_CMA
static bool cma_reserve_called __initdata;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 010/143] mm/hugetlb: remove redundant reservation check condition in alloc_huge_page()
2021-05-05 1:32 incoming Andrew Morton
` (8 preceding siblings ...)
2021-05-05 1:33 ` [patch 009/143] hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 011/143] mm: generalize HUGETLB_PAGE_SIZE_VARIABLE Andrew Morton
` (130 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugetlb: remove redundant reservation check condition in alloc_huge_page()
vma_resv_map(vma) checks if a reserve map is associated with the vma. The
routine vma_needs_reservation() will check vma_resv_map(vma) and return 1
if no reserv map is present. map_chg is set to the return value of
vma_needs_reservation(). Therefore, !vma_resv_map(vma) is redundant in
the expression:
map_chg || avoid_reserve || !vma_resv_map(vma);
Remove the redundant check.
[Thanks Mike Kravetz for reshaping this commit message!]
Link: https://lkml.kernel.org/r/20210301104726.45159-1-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/hugetlb.c~mm-hugetlb-remove-redundant-reservation-check-condition-in-alloc_huge_page
+++ a/mm/hugetlb.c
@@ -2316,7 +2316,7 @@ struct page *alloc_huge_page(struct vm_a
/* If this allocation is not consuming a reservation, charge it now.
*/
- deferred_reserve = map_chg || avoid_reserve || !vma_resv_map(vma);
+ deferred_reserve = map_chg || avoid_reserve;
if (deferred_reserve) {
ret = hugetlb_cgroup_charge_cgroup_rsvd(
idx, pages_per_huge_page(h), &h_cg);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 011/143] mm: generalize HUGETLB_PAGE_SIZE_VARIABLE
2021-05-05 1:32 incoming Andrew Morton
` (9 preceding siblings ...)
2021-05-05 1:33 ` [patch 010/143] mm/hugetlb: remove redundant reservation check condition in alloc_huge_page() Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 012/143] mm/hugetlb: use some helper functions to cleanup code Andrew Morton
` (129 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: akpm, anshuman.khandual, benh, christophe.leroy, hch, linux-mm,
mike.kravetz, mm-commits, mpe, paulus, torvalds
From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: generalize HUGETLB_PAGE_SIZE_VARIABLE
HUGETLB_PAGE_SIZE_VARIABLE need not be defined for each individual
platform subscribing it. Instead just make it generic.
Link: https://lkml.kernel.org/r/1614914928-22039-1-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Suggested-by: Christoph Hellwig <hch@lst.de>
Reviewed-by: Christoph Hellwig <hch@lst.de>
Acked-by: Michael Ellerman <mpe@ellerman.id.au> [powerpc]
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Christophe Leroy <christophe.leroy@csgroup.eu>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/ia64/Kconfig | 6 +-----
arch/powerpc/Kconfig | 6 +-----
mm/Kconfig | 7 +++++++
3 files changed, 9 insertions(+), 10 deletions(-)
--- a/arch/ia64/Kconfig~mm-generalize-hugetlb_page_size_variable
+++ a/arch/ia64/Kconfig
@@ -32,6 +32,7 @@ config IA64
select TTY
select HAVE_ARCH_TRACEHOOK
select HAVE_VIRT_CPU_ACCOUNTING
+ select HUGETLB_PAGE_SIZE_VARIABLE if HUGETLB_PAGE
select VIRT_TO_BUS
select GENERIC_IRQ_PROBE
select GENERIC_PENDING_IRQ if SMP
@@ -82,11 +83,6 @@ config STACKTRACE_SUPPORT
config GENERIC_LOCKBREAK
def_bool n
-config HUGETLB_PAGE_SIZE_VARIABLE
- bool
- depends on HUGETLB_PAGE
- default y
-
config GENERIC_CALIBRATE_DELAY
bool
default y
--- a/arch/powerpc/Kconfig~mm-generalize-hugetlb_page_size_variable
+++ a/arch/powerpc/Kconfig
@@ -232,6 +232,7 @@ config PPC
select HAVE_HARDLOCKUP_DETECTOR_PERF if PERF_EVENTS && HAVE_PERF_EVENTS_NMI && !HAVE_HARDLOCKUP_DETECTOR_ARCH
select HAVE_PERF_REGS
select HAVE_PERF_USER_STACK_DUMP
+ select HUGETLB_PAGE_SIZE_VARIABLE if PPC_BOOK3S_64 && HUGETLB_PAGE
select MMU_GATHER_RCU_TABLE_FREE
select MMU_GATHER_PAGE_SIZE
select HAVE_REGS_AND_STACK_ACCESS_API
@@ -416,11 +417,6 @@ config HIGHMEM
source "kernel/Kconfig.hz"
-config HUGETLB_PAGE_SIZE_VARIABLE
- bool
- depends on HUGETLB_PAGE && PPC_BOOK3S_64
- default y
-
config MATH_EMULATION
bool "Math emulation"
depends on 4xx || PPC_8xx || PPC_MPC832x || BOOKE
--- a/mm/Kconfig~mm-generalize-hugetlb_page_size_variable
+++ a/mm/Kconfig
@@ -273,6 +273,13 @@ config ARCH_ENABLE_HUGEPAGE_MIGRATION
config ARCH_ENABLE_THP_MIGRATION
bool
+config HUGETLB_PAGE_SIZE_VARIABLE
+ def_bool n
+ help
+ Allows the pageblock_order value to be dynamic instead of just standard
+ HUGETLB_PAGE_ORDER when there are multiple HugeTLB page sizes available
+ on a platform.
+
config CONTIG_ALLOC
def_bool (MEMORY_ISOLATION && COMPACTION) || CMA
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 012/143] mm/hugetlb: use some helper functions to cleanup code
2021-05-05 1:32 incoming Andrew Morton
` (10 preceding siblings ...)
2021-05-05 1:33 ` [patch 011/143] mm: generalize HUGETLB_PAGE_SIZE_VARIABLE Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 013/143] mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state() Andrew Morton
` (128 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugetlb: use some helper functions to cleanup code
Patch series "Some cleanups for hugetlb".
This series contains cleanups to remove unnecessary VM_BUG_ON_PAGE, use
helper function and so on. I also collect some previous patches into this
series in case they are forgotten.
This patch (of 5):
We could use pages_per_huge_page to get the number of pages per hugepage,
use get_hstate_idx to calculate hstate index, and use hstate_is_gigantic
to check if a hstate is gigantic to make code more succinct.
Link: https://lkml.kernel.org/r/20210308112809.26107-1-linmiaohe@huawei.com
Link: https://lkml.kernel.org/r/20210308112809.26107-2-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/hugetlbfs/inode.c | 2 +-
mm/hugetlb.c | 6 +++---
2 files changed, 4 insertions(+), 4 deletions(-)
--- a/fs/hugetlbfs/inode.c~mm-hugetlb-use-some-helper-functions-to-cleanup-code
+++ a/fs/hugetlbfs/inode.c
@@ -1435,7 +1435,7 @@ static int get_hstate_idx(int page_size_
if (!h)
return -1;
- return h - hstates;
+ return hstate_index(h);
}
/*
--- a/mm/hugetlb.c~mm-hugetlb-use-some-helper-functions-to-cleanup-code
+++ a/mm/hugetlb.c
@@ -1273,7 +1273,7 @@ static void free_gigantic_page(struct pa
static struct page *alloc_gigantic_page(struct hstate *h, gfp_t gfp_mask,
int nid, nodemask_t *nodemask)
{
- unsigned long nr_pages = 1UL << huge_page_order(h);
+ unsigned long nr_pages = pages_per_huge_page(h);
if (nid == NUMA_NO_NODE)
nid = numa_mem_id();
@@ -3267,10 +3267,10 @@ static int __init hugepages_setup(char *
/*
* Global state is always initialized later in hugetlb_init.
- * But we need to allocate >= MAX_ORDER hstates here early to still
+ * But we need to allocate gigantic hstates here early to still
* use the bootmem allocator.
*/
- if (hugetlb_max_hstate && parsed_hstate->order >= MAX_ORDER)
+ if (hugetlb_max_hstate && hstate_is_gigantic(parsed_hstate))
hugetlb_hstate_alloc_pages(parsed_hstate);
last_mhp = mhp;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 013/143] mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state()
2021-05-05 1:32 incoming Andrew Morton
` (11 preceding siblings ...)
2021-05-05 1:33 ` [patch 012/143] mm/hugetlb: use some helper functions to cleanup code Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 014/143] mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate() Andrew Morton
` (127 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state()
We should not transfer the per-node surplus state when we do not cross the
node in order to save some cpu cycles
Link: https://lkml.kernel.org/r/20210308112809.26107-3-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 6 ++++++
1 file changed, 6 insertions(+)
--- a/mm/hugetlb.c~mm-hugetlb-optimize-the-surplus-state-transfer-code-in-move_hugetlb_state
+++ a/mm/hugetlb.c
@@ -5682,6 +5682,12 @@ void move_hugetlb_state(struct page *old
SetHPageTemporary(oldpage);
ClearHPageTemporary(newpage);
+ /*
+ * There is no need to transfer the per-node surplus state
+ * when we do not cross the node.
+ */
+ if (new_nid == old_nid)
+ return;
spin_lock(&hugetlb_lock);
if (h->surplus_huge_pages_node[old_nid]) {
h->surplus_huge_pages_node[old_nid]--;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 014/143] mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate()
2021-05-05 1:32 incoming Andrew Morton
` (12 preceding siblings ...)
2021-05-05 1:33 ` [patch 013/143] mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state() Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 015/143] mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page() Andrew Morton
` (126 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate()
!PageHuge(oldhpage) is implicitly checked in page_hstate() above, so we
remove this explicit one.
Link: https://lkml.kernel.org/r/20210308112809.26107-4-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb_cgroup.c | 1 -
1 file changed, 1 deletion(-)
--- a/mm/hugetlb_cgroup.c~hugetlb_cgroup-remove-unnecessary-vm_bug_on_page-in-hugetlb_cgroup_migrate
+++ a/mm/hugetlb_cgroup.c
@@ -784,7 +784,6 @@ void hugetlb_cgroup_migrate(struct page
if (hugetlb_cgroup_disabled())
return;
- VM_BUG_ON_PAGE(!PageHuge(oldhpage), oldhpage);
spin_lock(&hugetlb_lock);
h_cg = hugetlb_cgroup_from_page(oldhpage);
h_cg_rsvd = hugetlb_cgroup_from_page_rsvd(oldhpage);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 015/143] mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page()
2021-05-05 1:32 incoming Andrew Morton
` (13 preceding siblings ...)
2021-05-05 1:33 ` [patch 014/143] mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate() Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 016/143] mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case Andrew Morton
` (125 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page()
Rework the error handling code when alloc_huge_page() failed to remove
some duplicated code and simplify the code slightly.
Link: https://lkml.kernel.org/r/20210308112809.26107-5-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 9 +++------
1 file changed, 3 insertions(+), 6 deletions(-)
--- a/mm/hugetlb.c~mm-hugetlb-simplify-the-code-when-alloc_huge_page-failed-in-hugetlb_no_page
+++ a/mm/hugetlb.c
@@ -4395,13 +4395,10 @@ retry:
* sure there really is no pte entry.
*/
ptl = huge_pte_lock(h, mm, ptep);
- if (!huge_pte_none(huge_ptep_get(ptep))) {
- ret = 0;
- spin_unlock(ptl);
- goto out;
- }
+ ret = 0;
+ if (huge_pte_none(huge_ptep_get(ptep)))
+ ret = vmf_error(PTR_ERR(page));
spin_unlock(ptl);
- ret = vmf_error(PTR_ERR(page));
goto out;
}
clear_huge_page(page, address, pages_per_huge_page(h));
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 016/143] mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case
2021-05-05 1:32 incoming Andrew Morton
` (14 preceding siblings ...)
2021-05-05 1:33 ` [patch 015/143] mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page() Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 017/143] khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps() Andrew Morton
` (124 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case
The fault_mutex hashing overhead can be avoided in truncate_op case
because page faults can not race with truncation in this routine. So
calculate hash for fault_mutex only in !truncate_op case to save some cpu
cycles.
Link: https://lkml.kernel.org/r/20210308112809.26107-6-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/hugetlbfs/inode.c | 4 ++--
1 file changed, 2 insertions(+), 2 deletions(-)
--- a/fs/hugetlbfs/inode.c~mm-hugetlb-avoid-calculating-fault_mutex_hash-in-truncate_op-case
+++ a/fs/hugetlbfs/inode.c
@@ -482,10 +482,9 @@ static void remove_inode_hugepages(struc
for (i = 0; i < pagevec_count(&pvec); ++i) {
struct page *page = pvec.pages[i];
- u32 hash;
+ u32 hash = 0;
index = page->index;
- hash = hugetlb_fault_mutex_hash(mapping, index);
if (!truncate_op) {
/*
* Only need to hold the fault mutex in the
@@ -493,6 +492,7 @@ static void remove_inode_hugepages(struc
* page faults. Races are not possible in the
* case of truncation.
*/
+ hash = hugetlb_fault_mutex_hash(mapping, index);
mutex_lock(&hugetlb_fault_mutex_table[hash]);
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 017/143] khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps()
2021-05-05 1:32 incoming Andrew Morton
` (15 preceding siblings ...)
2021-05-05 1:33 ` [patch 016/143] mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 018/143] khugepaged: reuse the smp_wmb() inside __SetPageUptodate() Andrew Morton
` (123 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: akpm, dan.carpenter, ebru.akagunduz, kirill.shutemov, linmiaohe,
linux-mm, mike.kravetz, mm-commits, riel, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps()
Patch series "Cleanup and fixup for khugepaged", v2.
This series contains cleanups to remove unneeded return value, use helper
function and so on. And there is one fix to correct the wrong result
value for trace_mm_collapse_huge_page_isolate().
This patch (of 4):
The return value of khugepaged_collapse_pte_mapped_thps() is never checked
since it's introduced. We should remove such unneeded return value.
Link: https://lkml.kernel.org/r/20210306032947.35921-1-linmiaohe@huawei.com
Link: https://lkml.kernel.org/r/20210306032947.35921-2-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Cc: Rik van Riel <riel@redhat.com>
Cc: Ebru Akagunduz <ebru.akagunduz@gmail.com>
Cc: Dan Carpenter <dan.carpenter@oracle.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/khugepaged.c | 10 ++++------
1 file changed, 4 insertions(+), 6 deletions(-)
--- a/mm/khugepaged.c~khugepaged-remove-unneeded-return-value-of-khugepaged_collapse_pte_mapped_thps
+++ a/mm/khugepaged.c
@@ -1533,16 +1533,16 @@ abort:
goto drop_hpage;
}
-static int khugepaged_collapse_pte_mapped_thps(struct mm_slot *mm_slot)
+static void khugepaged_collapse_pte_mapped_thps(struct mm_slot *mm_slot)
{
struct mm_struct *mm = mm_slot->mm;
int i;
if (likely(mm_slot->nr_pte_mapped_thp == 0))
- return 0;
+ return;
if (!mmap_write_trylock(mm))
- return -EBUSY;
+ return;
if (unlikely(khugepaged_test_exit(mm)))
goto out;
@@ -1553,7 +1553,6 @@ static int khugepaged_collapse_pte_mappe
out:
mm_slot->nr_pte_mapped_thp = 0;
mmap_write_unlock(mm);
- return 0;
}
static void retract_page_tables(struct address_space *mapping, pgoff_t pgoff)
@@ -2057,9 +2056,8 @@ static void khugepaged_scan_file(struct
BUILD_BUG();
}
-static int khugepaged_collapse_pte_mapped_thps(struct mm_slot *mm_slot)
+static void khugepaged_collapse_pte_mapped_thps(struct mm_slot *mm_slot)
{
- return 0;
}
#endif
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 018/143] khugepaged: reuse the smp_wmb() inside __SetPageUptodate()
2021-05-05 1:32 incoming Andrew Morton
` (16 preceding siblings ...)
2021-05-05 1:33 ` [patch 017/143] khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps() Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 019/143] khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter() Andrew Morton
` (122 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: akpm, dan.carpenter, ebru.akagunduz, kirill.shutemov, linmiaohe,
linux-mm, mike.kravetz, mm-commits, riel, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: khugepaged: reuse the smp_wmb() inside __SetPageUptodate()
smp_wmb() is needed to avoid the copy_huge_page writes to become visible
after the set_pmd_at() write here. But we can reuse the smp_wmb() inside
__SetPageUptodate() to remove this redundant one.
Link: https://lkml.kernel.org/r/20210306032947.35921-3-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Cc: Dan Carpenter <dan.carpenter@oracle.com>
Cc: Ebru Akagunduz <ebru.akagunduz@gmail.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Rik van Riel <riel@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/khugepaged.c | 13 ++++++-------
1 file changed, 6 insertions(+), 7 deletions(-)
--- a/mm/khugepaged.c~khugepaged-reuse-the-smp_wmb-inside-__setpageuptodate
+++ a/mm/khugepaged.c
@@ -1183,19 +1183,18 @@ static void collapse_huge_page(struct mm
__collapse_huge_page_copy(pte, new_page, vma, address, pte_ptl,
&compound_pagelist);
pte_unmap(pte);
+ /*
+ * spin_lock() below is not the equivalent of smp_wmb(), but
+ * the smp_wmb() inside __SetPageUptodate() can be reused to
+ * avoid the copy_huge_page writes to become visible after
+ * the set_pmd_at() write.
+ */
__SetPageUptodate(new_page);
pgtable = pmd_pgtable(_pmd);
_pmd = mk_huge_pmd(new_page, vma->vm_page_prot);
_pmd = maybe_pmd_mkwrite(pmd_mkdirty(_pmd), vma);
- /*
- * spin_lock() below is not the equivalent of smp_wmb(), so
- * this is needed to avoid the copy_huge_page writes to become
- * visible after the set_pmd_at() write.
- */
- smp_wmb();
-
spin_lock(pmd_ptl);
BUG_ON(!pmd_none(*pmd));
page_add_new_anon_rmap(new_page, vma, address, true);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 019/143] khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter()
2021-05-05 1:32 incoming Andrew Morton
` (17 preceding siblings ...)
2021-05-05 1:33 ` [patch 018/143] khugepaged: reuse the smp_wmb() inside __SetPageUptodate() Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 020/143] khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate() Andrew Morton
` (121 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: akpm, dan.carpenter, ebru.akagunduz, kirill.shutemov, linmiaohe,
linux-mm, mike.kravetz, mm-commits, riel, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter()
Commit 4d45e75a9955 ("mm: remove the now-unnecessary mmget_still_valid()
hack") have made khugepaged_test_exit() suitable for check mm->mm_users
against 0. Use this helper here.
Link: https://lkml.kernel.org/r/20210306032947.35921-4-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Cc: Dan Carpenter <dan.carpenter@oracle.com>
Cc: Ebru Akagunduz <ebru.akagunduz@gmail.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Rik van Riel <riel@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/khugepaged.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/khugepaged.c~khugepaged-use-helper-khugepaged_test_exit-in-__khugepaged_enter
+++ a/mm/khugepaged.c
@@ -481,7 +481,7 @@ int __khugepaged_enter(struct mm_struct
return -ENOMEM;
/* __khugepaged_exit() must not run from under us */
- VM_BUG_ON_MM(atomic_read(&mm->mm_users) == 0, mm);
+ VM_BUG_ON_MM(khugepaged_test_exit(mm), mm);
if (unlikely(test_and_set_bit(MMF_VM_HUGEPAGE, &mm->flags))) {
free_mm_slot(mm_slot);
return 0;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 020/143] khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate()
2021-05-05 1:32 incoming Andrew Morton
` (18 preceding siblings ...)
2021-05-05 1:33 ` [patch 019/143] khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter() Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 021/143] mm/huge_memory.c: remove unnecessary local variable ret2 Andrew Morton
` (120 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: akpm, dan.carpenter, ebru.akagunduz, kirill.shutemov, linmiaohe,
linux-mm, mike.kravetz, mm-commits, riel, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate()
In writable and !referenced case, the result value should be
SCAN_LACK_REFERENCED_PAGE for trace_mm_collapse_huge_page_isolate()
instead of default 0 (SCAN_FAIL) here.
Link: https://lkml.kernel.org/r/20210306032947.35921-5-linmiaohe@huawei.com
Fixes: 7d2eba0557c1 ("mm: add tracepoint for scanning pages")
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Cc: Dan Carpenter <dan.carpenter@oracle.com>
Cc: Ebru Akagunduz <ebru.akagunduz@gmail.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Rik van Riel <riel@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/khugepaged.c | 18 +++++++++---------
1 file changed, 9 insertions(+), 9 deletions(-)
--- a/mm/khugepaged.c~khugepaged-fix-wrong-result-value-for-trace_mm_collapse_huge_page_isolate
+++ a/mm/khugepaged.c
@@ -716,17 +716,17 @@ next:
if (pte_write(pteval))
writable = true;
}
- if (likely(writable)) {
- if (likely(referenced)) {
- result = SCAN_SUCCEED;
- trace_mm_collapse_huge_page_isolate(page, none_or_zero,
- referenced, writable, result);
- return 1;
- }
- } else {
+
+ if (unlikely(!writable)) {
result = SCAN_PAGE_RO;
+ } else if (unlikely(!referenced)) {
+ result = SCAN_LACK_REFERENCED_PAGE;
+ } else {
+ result = SCAN_SUCCEED;
+ trace_mm_collapse_huge_page_isolate(page, none_or_zero,
+ referenced, writable, result);
+ return 1;
}
-
out:
release_pte_pages(pte, _pte, compound_pagelist);
trace_mm_collapse_huge_page_isolate(page, none_or_zero,
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 021/143] mm/huge_memory.c: remove unnecessary local variable ret2
2021-05-05 1:32 incoming Andrew Morton
` (19 preceding siblings ...)
2021-05-05 1:33 ` [patch 020/143] khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate() Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 022/143] mm/huge_memory.c: rework the function vma_adjust_trans_huge() Andrew Morton
` (119 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/huge_memory.c: remove unnecessary local variable ret2
There is no need to use a new local variable ret2 to get the return value
of handle_userfault(). Use ret directly to make code more succinct.
Link: https://lkml.kernel.org/r/20210210072409.60587-1-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Andrew Morton <akpm@linux-foundation.org>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/huge_memory.c | 8 +++-----
1 file changed, 3 insertions(+), 5 deletions(-)
--- a/mm/huge_memory.c~mm-huge_memoryc-remove-unnecessary-local-variable-ret2
+++ a/mm/huge_memory.c
@@ -624,14 +624,12 @@ static vm_fault_t __do_huge_pmd_anonymou
/* Deliver the page fault to userland */
if (userfaultfd_missing(vma)) {
- vm_fault_t ret2;
-
spin_unlock(vmf->ptl);
put_page(page);
pte_free(vma->vm_mm, pgtable);
- ret2 = handle_userfault(vmf, VM_UFFD_MISSING);
- VM_BUG_ON(ret2 & VM_FAULT_FALLBACK);
- return ret2;
+ ret = handle_userfault(vmf, VM_UFFD_MISSING);
+ VM_BUG_ON(ret & VM_FAULT_FALLBACK);
+ return ret;
}
entry = mk_huge_pmd(page, vma->vm_page_prot);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 022/143] mm/huge_memory.c: rework the function vma_adjust_trans_huge()
2021-05-05 1:32 incoming Andrew Morton
` (20 preceding siblings ...)
2021-05-05 1:33 ` [patch 021/143] mm/huge_memory.c: remove unnecessary local variable ret2 Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 023/143] mm/huge_memory.c: make get_huge_zero_page() return bool Andrew Morton
` (118 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx,
rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken,
william.kucharski, willy, yang.shi, yulei.kernel, ziy
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/huge_memory.c: rework the function vma_adjust_trans_huge()
Patch series "Some cleanups for huge_memory", v3.
This series contains cleanups to rework some function logics to make it
more readable, use helper function and so on. More details can be found
in the respective changelogs.
This patch (of 6):
The current implementation of vma_adjust_trans_huge() contains some
duplicated codes. Add helper function to get rid of these codes to make
it more succinct.
Link: https://lkml.kernel.org/r/20210318122722.13135-1-linmiaohe@huawei.com
Link: https://lkml.kernel.org/r/20210318122722.13135-2-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Zi Yan <ziy@nvidia.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: William Kucharski <william.kucharski@oracle.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Peter Xu <peterx@redhat.com>
Cc: yuleixzhang <yulei.kernel@gmail.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org>
Cc: Yang Shi <yang.shi@linux.alibaba.com>
Cc: Wei Yang <richard.weiyang@linux.alibaba.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/huge_memory.c | 44 +++++++++++++++++++-------------------------
1 file changed, 19 insertions(+), 25 deletions(-)
--- a/mm/huge_memory.c~mm-huge_memoryc-rework-the-function-vma_adjust_trans_huge
+++ a/mm/huge_memory.c
@@ -2301,44 +2301,38 @@ void split_huge_pmd_address(struct vm_ar
__split_huge_pmd(vma, pmd, address, freeze, page);
}
+static inline void split_huge_pmd_if_needed(struct vm_area_struct *vma, unsigned long address)
+{
+ /*
+ * If the new address isn't hpage aligned and it could previously
+ * contain an hugepage: check if we need to split an huge pmd.
+ */
+ if (!IS_ALIGNED(address, HPAGE_PMD_SIZE) &&
+ range_in_vma(vma, ALIGN_DOWN(address, HPAGE_PMD_SIZE),
+ ALIGN(address, HPAGE_PMD_SIZE)))
+ split_huge_pmd_address(vma, address, false, NULL);
+}
+
void vma_adjust_trans_huge(struct vm_area_struct *vma,
unsigned long start,
unsigned long end,
long adjust_next)
{
- /*
- * If the new start address isn't hpage aligned and it could
- * previously contain an hugepage: check if we need to split
- * an huge pmd.
- */
- if (start & ~HPAGE_PMD_MASK &&
- (start & HPAGE_PMD_MASK) >= vma->vm_start &&
- (start & HPAGE_PMD_MASK) + HPAGE_PMD_SIZE <= vma->vm_end)
- split_huge_pmd_address(vma, start, false, NULL);
+ /* Check if we need to split start first. */
+ split_huge_pmd_if_needed(vma, start);
- /*
- * If the new end address isn't hpage aligned and it could
- * previously contain an hugepage: check if we need to split
- * an huge pmd.
- */
- if (end & ~HPAGE_PMD_MASK &&
- (end & HPAGE_PMD_MASK) >= vma->vm_start &&
- (end & HPAGE_PMD_MASK) + HPAGE_PMD_SIZE <= vma->vm_end)
- split_huge_pmd_address(vma, end, false, NULL);
+ /* Check if we need to split end next. */
+ split_huge_pmd_if_needed(vma, end);
/*
- * If we're also updating the vma->vm_next->vm_start, if the new
- * vm_next->vm_start isn't hpage aligned and it could previously
- * contain an hugepage: check if we need to split an huge pmd.
+ * If we're also updating the vma->vm_next->vm_start,
+ * check if we need to split it.
*/
if (adjust_next > 0) {
struct vm_area_struct *next = vma->vm_next;
unsigned long nstart = next->vm_start;
nstart += adjust_next;
- if (nstart & ~HPAGE_PMD_MASK &&
- (nstart & HPAGE_PMD_MASK) >= next->vm_start &&
- (nstart & HPAGE_PMD_MASK) + HPAGE_PMD_SIZE <= next->vm_end)
- split_huge_pmd_address(next, nstart, false, NULL);
+ split_huge_pmd_if_needed(next, nstart);
}
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 023/143] mm/huge_memory.c: make get_huge_zero_page() return bool
2021-05-05 1:32 incoming Andrew Morton
` (21 preceding siblings ...)
2021-05-05 1:33 ` [patch 022/143] mm/huge_memory.c: rework the function vma_adjust_trans_huge() Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:33 ` [patch 024/143] mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly Andrew Morton
` (117 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx,
rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken,
william.kucharski, willy, yang.shi, yulei.kernel, ziy
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/huge_memory.c: make get_huge_zero_page() return bool
It's guaranteed that huge_zero_page will not be NULL if huge_zero_refcount
is increased successfully. When READ_ONCE(huge_zero_page) is returned,
there must be a huge_zero_page and it can be replaced with returning
'true' when we do not care about the value of huge_zero_page. We can thus
make it return bool to save READ_ONCE cpu cycles as the return value is
just used to check if huge_zero_page exists.
Link: https://lkml.kernel.org/r/20210318122722.13135-3-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Zi Yan <ziy@nvidia.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Michel Lespinasse <walken@google.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Wei Yang <richard.weiyang@linux.alibaba.com>
Cc: William Kucharski <william.kucharski@oracle.com>
Cc: Yang Shi <yang.shi@linux.alibaba.com>
Cc: yuleixzhang <yulei.kernel@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/huge_memory.c | 8 ++++----
1 file changed, 4 insertions(+), 4 deletions(-)
--- a/mm/huge_memory.c~mm-huge_memoryc-make-get_huge_zero_page-return-bool
+++ a/mm/huge_memory.c
@@ -77,18 +77,18 @@ bool transparent_hugepage_enabled(struct
return false;
}
-static struct page *get_huge_zero_page(void)
+static bool get_huge_zero_page(void)
{
struct page *zero_page;
retry:
if (likely(atomic_inc_not_zero(&huge_zero_refcount)))
- return READ_ONCE(huge_zero_page);
+ return true;
zero_page = alloc_pages((GFP_TRANSHUGE | __GFP_ZERO) & ~__GFP_MOVABLE,
HPAGE_PMD_ORDER);
if (!zero_page) {
count_vm_event(THP_ZERO_PAGE_ALLOC_FAILED);
- return NULL;
+ return false;
}
count_vm_event(THP_ZERO_PAGE_ALLOC);
preempt_disable();
@@ -101,7 +101,7 @@ retry:
/* We take additional reference here. It will be put back by shrinker */
atomic_set(&huge_zero_refcount, 2);
preempt_enable();
- return READ_ONCE(huge_zero_page);
+ return true;
}
static void put_huge_zero_page(void)
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 024/143] mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly
2021-05-05 1:32 incoming Andrew Morton
` (22 preceding siblings ...)
2021-05-05 1:33 ` [patch 023/143] mm/huge_memory.c: make get_huge_zero_page() return bool Andrew Morton
@ 2021-05-05 1:33 ` Andrew Morton
2021-05-05 1:34 ` [patch 025/143] mm/huge_memory.c: remove redundant PageCompound() check Andrew Morton
` (116 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:33 UTC (permalink / raw)
To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx,
rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken,
william.kucharski, willy, yang.shi, yulei.kernel, ziy
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly
The current code that checks if migrating misplaced transhuge page is
needed is pretty hard to follow. Rework it and add a comment to make its
logic more clear and improve readability.
Link: https://lkml.kernel.org/r/20210318122722.13135-4-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Zi Yan <ziy@nvidia.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Michel Lespinasse <walken@google.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Wei Yang <richard.weiyang@linux.alibaba.com>
Cc: William Kucharski <william.kucharski@oracle.com>
Cc: Yang Shi <yang.shi@linux.alibaba.com>
Cc: yuleixzhang <yulei.kernel@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/huge_memory.c | 11 +++++------
1 file changed, 5 insertions(+), 6 deletions(-)
--- a/mm/huge_memory.c~mm-huge_memoryc-rework-the-function-do_huge_pmd_numa_page-slightly
+++ a/mm/huge_memory.c
@@ -1462,12 +1462,6 @@ vm_fault_t do_huge_pmd_numa_page(struct
*/
page_locked = trylock_page(page);
target_nid = mpol_misplaced(page, vma, haddr);
- if (target_nid == NUMA_NO_NODE) {
- /* If the page was locked, there are no parallel migrations */
- if (page_locked)
- goto clear_pmdnuma;
- }
-
/* Migration could have started since the pmd_trans_migrating check */
if (!page_locked) {
page_nid = NUMA_NO_NODE;
@@ -1476,6 +1470,11 @@ vm_fault_t do_huge_pmd_numa_page(struct
spin_unlock(vmf->ptl);
put_and_wait_on_page_locked(page, TASK_UNINTERRUPTIBLE);
goto out;
+ } else if (target_nid == NUMA_NO_NODE) {
+ /* There are no parallel migrations and page is in the right
+ * node. Clear the numa hinting info in this pmd.
+ */
+ goto clear_pmdnuma;
}
/*
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 025/143] mm/huge_memory.c: remove redundant PageCompound() check
2021-05-05 1:32 incoming Andrew Morton
` (23 preceding siblings ...)
2021-05-05 1:33 ` [patch 024/143] mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 026/143] mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG Andrew Morton
` (115 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx,
rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken,
william.kucharski, willy, yang.shi, yulei.kernel, ziy
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/huge_memory.c: remove redundant PageCompound() check
The !PageCompound() check limits the page must be head or tail while
!PageHead() further limits it to page head only. So !PageHead() check is
equivalent here.
Link: https://lkml.kernel.org/r/20210318122722.13135-5-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Michel Lespinasse <walken@google.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Wei Yang <richard.weiyang@linux.alibaba.com>
Cc: William Kucharski <william.kucharski@oracle.com>
Cc: Yang Shi <yang.shi@linux.alibaba.com>
Cc: yuleixzhang <yulei.kernel@gmail.com>
Cc: Zi Yan <ziy@nvidia.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/huge_memory.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/huge_memory.c~mm-huge_memoryc-remove-redundant-pagecompound-check
+++ a/mm/huge_memory.c
@@ -1291,7 +1291,7 @@ vm_fault_t do_huge_pmd_wp_page(struct vm
}
page = pmd_page(orig_pmd);
- VM_BUG_ON_PAGE(!PageCompound(page) || !PageHead(page), page);
+ VM_BUG_ON_PAGE(!PageHead(page), page);
/* Lock page for reuse_swap_page() */
if (!trylock_page(page)) {
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 026/143] mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG
2021-05-05 1:32 incoming Andrew Morton
` (24 preceding siblings ...)
2021-05-05 1:34 ` [patch 025/143] mm/huge_memory.c: remove redundant PageCompound() check Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 027/143] mm/huge_memory.c: use helper function migration_entry_to_page() Andrew Morton
` (114 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx,
rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken,
william.kucharski, willy, yang.shi, yulei.kernel, ziy
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG
Commit 4958e4d86ecb ("mm: thp: remove debug_cow switch") forgot to remove
TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG macro. Remove it here.
Link: https://lkml.kernel.org/r/20210318122722.13135-6-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Zi Yan <ziy@nvidia.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Michel Lespinasse <walken@google.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Wei Yang <richard.weiyang@linux.alibaba.com>
Cc: William Kucharski <william.kucharski@oracle.com>
Cc: Yang Shi <yang.shi@linux.alibaba.com>
Cc: yuleixzhang <yulei.kernel@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/huge_mm.h | 3 ---
1 file changed, 3 deletions(-)
--- a/include/linux/huge_mm.h~mm-huge_memoryc-remove-unused-macro-transparent_hugepage_debug_cow_flag
+++ a/include/linux/huge_mm.h
@@ -87,9 +87,6 @@ enum transparent_hugepage_flag {
TRANSPARENT_HUGEPAGE_DEFRAG_REQ_MADV_FLAG,
TRANSPARENT_HUGEPAGE_DEFRAG_KHUGEPAGED_FLAG,
TRANSPARENT_HUGEPAGE_USE_ZERO_PAGE_FLAG,
-#ifdef CONFIG_DEBUG_VM
- TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG,
-#endif
};
struct kobject;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 027/143] mm/huge_memory.c: use helper function migration_entry_to_page()
2021-05-05 1:32 incoming Andrew Morton
` (25 preceding siblings ...)
2021-05-05 1:34 ` [patch 026/143] mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 028/143] mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable Andrew Morton
` (113 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, aneesh.kumar, linmiaohe, linux-mm, mm-commits, peterx,
rcampbell, richard.weiyang, thomas_os, torvalds, vbabka, walken,
william.kucharski, willy, yang.shi, yulei.kernel, ziy
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/huge_memory.c: use helper function migration_entry_to_page()
It's more recommended to use helper function migration_entry_to_page() to
get the page via migration entry. We can also enjoy the PageLocked()
check there.
Link: https://lkml.kernel.org/r/20210318122722.13135-7-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Michel Lespinasse <walken@google.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Thomas Hellstrm (Intel) <thomas_os@shipmail.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Wei Yang <richard.weiyang@linux.alibaba.com>
Cc: William Kucharski <william.kucharski@oracle.com>
Cc: Yang Shi <yang.shi@linux.alibaba.com>
Cc: yuleixzhang <yulei.kernel@gmail.com>
Cc: Zi Yan <ziy@nvidia.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/huge_memory.c | 4 ++--
1 file changed, 2 insertions(+), 2 deletions(-)
--- a/mm/huge_memory.c~mm-huge_memoryc-use-helper-function-migration_entry_to_page
+++ a/mm/huge_memory.c
@@ -1693,7 +1693,7 @@ int zap_huge_pmd(struct mmu_gather *tlb,
VM_BUG_ON(!is_pmd_migration_entry(orig_pmd));
entry = pmd_to_swp_entry(orig_pmd);
- page = pfn_to_page(swp_offset(entry));
+ page = migration_entry_to_page(entry);
flush_needed = 0;
} else
WARN_ONCE(1, "Non present huge pmd without pmd migration enabled!");
@@ -2101,7 +2101,7 @@ static void __split_huge_pmd_locked(stru
swp_entry_t entry;
entry = pmd_to_swp_entry(old_pmd);
- page = pfn_to_page(swp_offset(entry));
+ page = migration_entry_to_page(entry);
write = is_write_migration_entry(entry);
young = false;
soft_dirty = pmd_swp_soft_dirty(old_pmd);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 028/143] mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable
2021-05-05 1:32 incoming Andrew Morton
` (26 preceding siblings ...)
2021-05-05 1:34 ` [patch 027/143] mm/huge_memory.c: use helper function migration_entry_to_page() Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 029/143] khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp() Andrew Morton
` (112 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, kirill.shutemov, linux-mm, mike.kravetz, mm-commits,
torvalds, yanfei.xu
From: Yanfei Xu <yanfei.xu@windriver.com>
Subject: mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable
READ_ONCE() is more selective and lightweight. It is more appropriate
that using a READ_ONCE() for the certain variable to prevent the compiler
from reordering.
Link: https://lkml.kernel.org/r/20210323092730.247583-1-yanfei.xu@windriver.com
Signed-off-by: Yanfei Xu <yanfei.xu@windriver.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/khugepaged.c | 4 +---
1 file changed, 1 insertion(+), 3 deletions(-)
--- a/mm/khugepaged.c~khugepaged-raplace-barrier-with-read_once-for-a-selective-variable
+++ a/mm/khugepaged.c
@@ -2202,11 +2202,9 @@ static void khugepaged_do_scan(void)
{
struct page *hpage = NULL;
unsigned int progress = 0, pass_through_head = 0;
- unsigned int pages = khugepaged_pages_to_scan;
+ unsigned int pages = READ_ONCE(khugepaged_pages_to_scan);
bool wait = true;
- barrier(); /* write khugepaged_pages_to_scan to local stack */
-
lru_add_drain_all();
while (progress < pages) {
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 029/143] khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp()
2021-05-05 1:32 incoming Andrew Morton
` (27 preceding siblings ...)
2021-05-05 1:34 ` [patch 028/143] mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 030/143] khugepaged: remove unnecessary out label in collapse_huge_page() Andrew Morton
` (111 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds,
ziy
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp()
Patch series "Cleanup for khugepaged".
This series contains cleanups to remove unnecessary out label and
meaningless !pte_present() check. Also use helper function to simplify
the code. More details can be found in the respective changelogs.
This patch (of 3):
We could use helper function range_in_vma() to check whether the desired
range is inside the vma to simplify the code.
Link: https://lkml.kernel.org/r/20210325135647.64106-1-linmiaohe@huawei.com
Link: https://lkml.kernel.org/r/20210325135647.64106-2-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Zi Yan <ziy@nvidia.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/khugepaged.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/khugepaged.c~khugepaged-use-helper-function-range_in_vma-in-collapse_pte_mapped_thp
+++ a/mm/khugepaged.c
@@ -1446,7 +1446,7 @@ void collapse_pte_mapped_thp(struct mm_s
int i;
if (!vma || !vma->vm_file ||
- vma->vm_start > haddr || vma->vm_end < haddr + HPAGE_PMD_SIZE)
+ !range_in_vma(vma, haddr, haddr + HPAGE_PMD_SIZE))
return;
/*
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 030/143] khugepaged: remove unnecessary out label in collapse_huge_page()
2021-05-05 1:32 incoming Andrew Morton
` (28 preceding siblings ...)
2021-05-05 1:34 ` [patch 029/143] khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp() Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 031/143] khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd() Andrew Morton
` (110 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds,
ziy
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: khugepaged: remove unnecessary out label in collapse_huge_page()
The out label here is unneeded because it just goes to out_up_write label.
Remove it to make code more concise.
Link: https://lkml.kernel.org/r/20210325135647.64106-3-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Zi Yan <ziy@nvidia.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/khugepaged.c | 8 +++-----
1 file changed, 3 insertions(+), 5 deletions(-)
--- a/mm/khugepaged.c~khugepaged-remove-unnecessary-out-label-in-collapse_huge_page
+++ a/mm/khugepaged.c
@@ -1128,10 +1128,10 @@ static void collapse_huge_page(struct mm
mmap_write_lock(mm);
result = hugepage_vma_revalidate(mm, address, &vma);
if (result)
- goto out;
+ goto out_up_write;
/* check if the pmd is still valid */
if (mm_find_pmd(mm, address) != pmd)
- goto out;
+ goto out_up_write;
anon_vma_lock_write(vma->anon_vma);
@@ -1171,7 +1171,7 @@ static void collapse_huge_page(struct mm
spin_unlock(pmd_ptl);
anon_vma_unlock_write(vma->anon_vma);
result = SCAN_FAIL;
- goto out;
+ goto out_up_write;
}
/*
@@ -1215,8 +1215,6 @@ out_nolock:
mem_cgroup_uncharge(*hpage);
trace_mm_collapse_huge_page(mm, isolated, result);
return;
-out:
- goto out_up_write;
}
static int khugepaged_scan_pmd(struct mm_struct *mm,
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 031/143] khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd()
2021-05-05 1:32 incoming Andrew Morton
` (29 preceding siblings ...)
2021-05-05 1:34 ` [patch 030/143] khugepaged: remove unnecessary out label in collapse_huge_page() Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 032/143] mm: huge_memory: a new debugfs interface for splitting THP tests Andrew Morton
` (109 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, linmiaohe, linux-mm, mike.kravetz, mm-commits, torvalds,
ziy
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd()
We know it must meet the !is_swap_pte() and !pte_none() condition if we
reach here. Since !is_swap_pte() indicates pte_none() or pte_present()
is met, it's guaranteed that pte must be present here.
Link: https://lkml.kernel.org/r/20210325135647.64106-4-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Zi Yan <ziy@nvidia.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/khugepaged.c | 4 ----
1 file changed, 4 deletions(-)
--- a/mm/khugepaged.c~khugepaged-remove-meaningless-pte_present-check-in-khugepaged_scan_pmd
+++ a/mm/khugepaged.c
@@ -1271,10 +1271,6 @@ static int khugepaged_scan_pmd(struct mm
goto out_unmap;
}
}
- if (!pte_present(pteval)) {
- result = SCAN_PTE_NON_PRESENT;
- goto out_unmap;
- }
if (pte_uffd_wp(pteval)) {
/*
* Don't collapse the page if any of the small
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 032/143] mm: huge_memory: a new debugfs interface for splitting THP tests
2021-05-05 1:32 incoming Andrew Morton
` (30 preceding siblings ...)
2021-05-05 1:34 ` [patch 031/143] khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd() Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 033/143] mm: huge_memory: debugfs for file-backed THP split Andrew Morton
` (108 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, david, jhubbard, kirill.shutemov, linux-mm, mika.penttila,
mm-commits, rientjes, sandipan, shuah, shy828301, torvalds, willy,
ziy
From: Zi Yan <ziy@nvidia.com>
Subject: mm: huge_memory: a new debugfs interface for splitting THP tests
We did not have a direct user interface of splitting the compound page
backing a THP and there is no need unless we want to expose the THP
implementation details to users. Make <debugfs>/split_huge_pages accept a
new command to do that.
By writing "<pid>,<vaddr_start>,<vaddr_end>" to
<debugfs>/split_huge_pages, THPs within the given virtual address range
from the process with the given pid are split. It is used to test
split_huge_page function. In addition, a selftest program is added to
tools/testing/selftests/vm to utilize the interface by splitting
PMD THPs and PTE-mapped THPs.
This does not change the old behavior, i.e., writing 1 to the interface
to split all THPs in the system.
Link: https://lkml.kernel.org/r/20210331235309.332292-1-zi.yan@sent.com
Signed-off-by: Zi Yan <ziy@nvidia.com>
Reviewed-by: Yang Shi <shy828301@gmail.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: "Kirill A . Shutemov" <kirill.shutemov@linux.intel.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mika Penttila <mika.penttila@nextfour.com>
Cc: Sandipan Das <sandipan@linux.ibm.com>
Cc: Shuah Khan <shuah@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/huge_memory.c | 155 +++++
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 1
tools/testing/selftests/vm/split_huge_page_test.c | 318 ++++++++++++
4 files changed, 467 insertions(+), 8 deletions(-)
--- a/mm/huge_memory.c~mm-huge_memory-a-new-debugfs-interface-for-splitting-thp-tests
+++ a/mm/huge_memory.c
@@ -7,6 +7,7 @@
#include <linux/mm.h>
#include <linux/sched.h>
+#include <linux/sched/mm.h>
#include <linux/sched/coredump.h>
#include <linux/sched/numa_balancing.h>
#include <linux/highmem.h>
@@ -2915,16 +2916,14 @@ static struct shrinker deferred_split_sh
};
#ifdef CONFIG_DEBUG_FS
-static int split_huge_pages_set(void *data, u64 val)
+static void split_huge_pages_all(void)
{
struct zone *zone;
struct page *page;
unsigned long pfn, max_zone_pfn;
unsigned long total = 0, split = 0;
- if (val != 1)
- return -EINVAL;
-
+ pr_debug("Split all THPs\n");
for_each_populated_zone(zone) {
max_zone_pfn = zone_end_pfn(zone);
for (pfn = zone->zone_start_pfn; pfn < max_zone_pfn; pfn++) {
@@ -2948,15 +2947,155 @@ static int split_huge_pages_set(void *da
unlock_page(page);
next:
put_page(page);
+ cond_resched();
}
}
- pr_info("%lu of %lu THP split\n", split, total);
+ pr_debug("%lu of %lu THP split\n", split, total);
+}
- return 0;
+static inline bool vma_not_suitable_for_thp_split(struct vm_area_struct *vma)
+{
+ return vma_is_special_huge(vma) || (vma->vm_flags & VM_IO) ||
+ is_vm_hugetlb_page(vma);
+}
+
+static int split_huge_pages_pid(int pid, unsigned long vaddr_start,
+ unsigned long vaddr_end)
+{
+ int ret = 0;
+ struct task_struct *task;
+ struct mm_struct *mm;
+ unsigned long total = 0, split = 0;
+ unsigned long addr;
+
+ vaddr_start &= PAGE_MASK;
+ vaddr_end &= PAGE_MASK;
+
+ /* Find the task_struct from pid */
+ rcu_read_lock();
+ task = find_task_by_vpid(pid);
+ if (!task) {
+ rcu_read_unlock();
+ ret = -ESRCH;
+ goto out;
+ }
+ get_task_struct(task);
+ rcu_read_unlock();
+
+ /* Find the mm_struct */
+ mm = get_task_mm(task);
+ put_task_struct(task);
+
+ if (!mm) {
+ ret = -EINVAL;
+ goto out;
+ }
+
+ pr_debug("Split huge pages in pid: %d, vaddr: [0x%lx - 0x%lx]\n",
+ pid, vaddr_start, vaddr_end);
+
+ mmap_read_lock(mm);
+ /*
+ * always increase addr by PAGE_SIZE, since we could have a PTE page
+ * table filled with PTE-mapped THPs, each of which is distinct.
+ */
+ for (addr = vaddr_start; addr < vaddr_end; addr += PAGE_SIZE) {
+ struct vm_area_struct *vma = find_vma(mm, addr);
+ unsigned int follflags;
+ struct page *page;
+
+ if (!vma || addr < vma->vm_start)
+ break;
+
+ /* skip special VMA and hugetlb VMA */
+ if (vma_not_suitable_for_thp_split(vma)) {
+ addr = vma->vm_end;
+ continue;
+ }
+
+ /* FOLL_DUMP to ignore special (like zero) pages */
+ follflags = FOLL_GET | FOLL_DUMP;
+ page = follow_page(vma, addr, follflags);
+
+ if (IS_ERR(page))
+ continue;
+ if (!page)
+ continue;
+
+ if (!is_transparent_hugepage(page))
+ goto next;
+
+ total++;
+ if (!can_split_huge_page(compound_head(page), NULL))
+ goto next;
+
+ if (!trylock_page(page))
+ goto next;
+
+ if (!split_huge_page(page))
+ split++;
+
+ unlock_page(page);
+next:
+ put_page(page);
+ cond_resched();
+ }
+ mmap_read_unlock(mm);
+ mmput(mm);
+
+ pr_debug("%lu of %lu THP split\n", split, total);
+
+out:
+ return ret;
}
-DEFINE_DEBUGFS_ATTRIBUTE(split_huge_pages_fops, NULL, split_huge_pages_set,
- "%llu\n");
+
+#define MAX_INPUT_BUF_SZ 255
+
+static ssize_t split_huge_pages_write(struct file *file, const char __user *buf,
+ size_t count, loff_t *ppops)
+{
+ static DEFINE_MUTEX(split_debug_mutex);
+ ssize_t ret;
+ char input_buf[MAX_INPUT_BUF_SZ]; /* hold pid, start_vaddr, end_vaddr */
+ int pid;
+ unsigned long vaddr_start, vaddr_end;
+
+ ret = mutex_lock_interruptible(&split_debug_mutex);
+ if (ret)
+ return ret;
+
+ ret = -EFAULT;
+
+ memset(input_buf, 0, MAX_INPUT_BUF_SZ);
+ if (copy_from_user(input_buf, buf, min_t(size_t, count, MAX_INPUT_BUF_SZ)))
+ goto out;
+
+ input_buf[MAX_INPUT_BUF_SZ - 1] = '\0';
+ ret = sscanf(input_buf, "%d,0x%lx,0x%lx", &pid, &vaddr_start, &vaddr_end);
+ if (ret == 1 && pid == 1) {
+ split_huge_pages_all();
+ ret = strlen(input_buf);
+ goto out;
+ } else if (ret != 3) {
+ ret = -EINVAL;
+ goto out;
+ }
+
+ ret = split_huge_pages_pid(pid, vaddr_start, vaddr_end);
+ if (!ret)
+ ret = strlen(input_buf);
+out:
+ mutex_unlock(&split_debug_mutex);
+ return ret;
+
+}
+
+static const struct file_operations split_huge_pages_fops = {
+ .owner = THIS_MODULE,
+ .write = split_huge_pages_write,
+ .llseek = no_llseek,
+};
static int __init split_huge_pages_debugfs(void)
{
--- a/tools/testing/selftests/vm/.gitignore~mm-huge_memory-a-new-debugfs-interface-for-splitting-thp-tests
+++ a/tools/testing/selftests/vm/.gitignore
@@ -22,3 +22,4 @@ map_fixed_noreplace
write_to_hugetlbfs
hmm-tests
local_config.*
+split_huge_page_test
--- a/tools/testing/selftests/vm/Makefile~mm-huge_memory-a-new-debugfs-interface-for-splitting-thp-tests
+++ a/tools/testing/selftests/vm/Makefile
@@ -42,6 +42,7 @@ TEST_GEN_FILES += on-fault-limit
TEST_GEN_FILES += thuge-gen
TEST_GEN_FILES += transhuge-stress
TEST_GEN_FILES += userfaultfd
+TEST_GEN_FILES += split_huge_page_test
ifeq ($(MACHINE),x86_64)
CAN_BUILD_I386 := $(shell ./../x86/check_cc.sh $(CC) ../x86/trivial_32bit_program.c -m32)
--- /dev/null
+++ a/tools/testing/selftests/vm/split_huge_page_test.c
@@ -0,0 +1,318 @@
+// SPDX-License-Identifier: GPL-2.0
+/*
+ * A test of splitting PMD THPs and PTE-mapped THPs from a specified virtual
+ * address range in a process via <debugfs>/split_huge_pages interface.
+ */
+
+#define _GNU_SOURCE
+#include <stdio.h>
+#include <stdlib.h>
+#include <unistd.h>
+#include <inttypes.h>
+#include <string.h>
+#include <fcntl.h>
+#include <sys/mman.h>
+#include <malloc.h>
+#include <stdbool.h>
+
+uint64_t pagesize;
+unsigned int pageshift;
+uint64_t pmd_pagesize;
+
+#define PMD_SIZE_PATH "/sys/kernel/mm/transparent_hugepage/hpage_pmd_size"
+#define SPLIT_DEBUGFS "/sys/kernel/debug/split_huge_pages"
+#define SMAP_PATH "/proc/self/smaps"
+#define INPUT_MAX 80
+
+#define PFN_MASK ((1UL<<55)-1)
+#define KPF_THP (1UL<<22)
+
+int is_backed_by_thp(char *vaddr, int pagemap_file, int kpageflags_file)
+{
+ uint64_t paddr;
+ uint64_t page_flags;
+
+ if (pagemap_file) {
+ pread(pagemap_file, &paddr, sizeof(paddr),
+ ((long)vaddr >> pageshift) * sizeof(paddr));
+
+ if (kpageflags_file) {
+ pread(kpageflags_file, &page_flags, sizeof(page_flags),
+ (paddr & PFN_MASK) * sizeof(page_flags));
+
+ return !!(page_flags & KPF_THP);
+ }
+ }
+ return 0;
+}
+
+
+static uint64_t read_pmd_pagesize(void)
+{
+ int fd;
+ char buf[20];
+ ssize_t num_read;
+
+ fd = open(PMD_SIZE_PATH, O_RDONLY);
+ if (fd == -1) {
+ perror("Open hpage_pmd_size failed");
+ exit(EXIT_FAILURE);
+ }
+ num_read = read(fd, buf, 19);
+ if (num_read < 1) {
+ close(fd);
+ perror("Read hpage_pmd_size failed");
+ exit(EXIT_FAILURE);
+ }
+ buf[num_read] = '\0';
+ close(fd);
+
+ return strtoul(buf, NULL, 10);
+}
+
+static int write_file(const char *path, const char *buf, size_t buflen)
+{
+ int fd;
+ ssize_t numwritten;
+
+ fd = open(path, O_WRONLY);
+ if (fd == -1)
+ return 0;
+
+ numwritten = write(fd, buf, buflen - 1);
+ close(fd);
+ if (numwritten < 1)
+ return 0;
+
+ return (unsigned int) numwritten;
+}
+
+static void write_debugfs(int pid, uint64_t vaddr_start, uint64_t vaddr_end)
+{
+ char input[INPUT_MAX];
+ int ret;
+
+ ret = snprintf(input, INPUT_MAX, "%d,0x%lx,0x%lx", pid, vaddr_start,
+ vaddr_end);
+ if (ret >= INPUT_MAX) {
+ printf("%s: Debugfs input is too long\n", __func__);
+ exit(EXIT_FAILURE);
+ }
+
+ if (!write_file(SPLIT_DEBUGFS, input, ret + 1)) {
+ perror(SPLIT_DEBUGFS);
+ exit(EXIT_FAILURE);
+ }
+}
+
+#define MAX_LINE_LENGTH 500
+
+static bool check_for_pattern(FILE *fp, const char *pattern, char *buf)
+{
+ while (fgets(buf, MAX_LINE_LENGTH, fp) != NULL) {
+ if (!strncmp(buf, pattern, strlen(pattern)))
+ return true;
+ }
+ return false;
+}
+
+static uint64_t check_huge(void *addr)
+{
+ uint64_t thp = 0;
+ int ret;
+ FILE *fp;
+ char buffer[MAX_LINE_LENGTH];
+ char addr_pattern[MAX_LINE_LENGTH];
+
+ ret = snprintf(addr_pattern, MAX_LINE_LENGTH, "%08lx-",
+ (unsigned long) addr);
+ if (ret >= MAX_LINE_LENGTH) {
+ printf("%s: Pattern is too long\n", __func__);
+ exit(EXIT_FAILURE);
+ }
+
+
+ fp = fopen(SMAP_PATH, "r");
+ if (!fp) {
+ printf("%s: Failed to open file %s\n", __func__, SMAP_PATH);
+ exit(EXIT_FAILURE);
+ }
+ if (!check_for_pattern(fp, addr_pattern, buffer))
+ goto err_out;
+
+ /*
+ * Fetch the AnonHugePages: in the same block and check the number of
+ * hugepages.
+ */
+ if (!check_for_pattern(fp, "AnonHugePages:", buffer))
+ goto err_out;
+
+ if (sscanf(buffer, "AnonHugePages:%10ld kB", &thp) != 1) {
+ printf("Reading smap error\n");
+ exit(EXIT_FAILURE);
+ }
+
+err_out:
+ fclose(fp);
+ return thp;
+}
+
+void split_pmd_thp(void)
+{
+ char *one_page;
+ size_t len = 4 * pmd_pagesize;
+ uint64_t thp_size;
+ size_t i;
+
+ one_page = memalign(pmd_pagesize, len);
+
+ if (!one_page) {
+ printf("Fail to allocate memory\n");
+ exit(EXIT_FAILURE);
+ }
+
+ madvise(one_page, len, MADV_HUGEPAGE);
+
+ for (i = 0; i < len; i++)
+ one_page[i] = (char)i;
+
+ thp_size = check_huge(one_page);
+ if (!thp_size) {
+ printf("No THP is allocated\n");
+ exit(EXIT_FAILURE);
+ }
+
+ /* split all THPs */
+ write_debugfs(getpid(), (uint64_t)one_page, (uint64_t)one_page + len);
+
+ for (i = 0; i < len; i++)
+ if (one_page[i] != (char)i) {
+ printf("%ld byte corrupted\n", i);
+ exit(EXIT_FAILURE);
+ }
+
+
+ thp_size = check_huge(one_page);
+ if (thp_size) {
+ printf("Still %ld kB AnonHugePages not split\n", thp_size);
+ exit(EXIT_FAILURE);
+ }
+
+ printf("Split huge pages successful\n");
+ free(one_page);
+}
+
+void split_pte_mapped_thp(void)
+{
+ char *one_page, *pte_mapped, *pte_mapped2;
+ size_t len = 4 * pmd_pagesize;
+ uint64_t thp_size;
+ size_t i;
+ const char *pagemap_template = "/proc/%d/pagemap";
+ const char *kpageflags_proc = "/proc/kpageflags";
+ char pagemap_proc[255];
+ int pagemap_fd;
+ int kpageflags_fd;
+
+ if (snprintf(pagemap_proc, 255, pagemap_template, getpid()) < 0) {
+ perror("get pagemap proc error");
+ exit(EXIT_FAILURE);
+ }
+ pagemap_fd = open(pagemap_proc, O_RDONLY);
+
+ if (pagemap_fd == -1) {
+ perror("read pagemap:");
+ exit(EXIT_FAILURE);
+ }
+
+ kpageflags_fd = open(kpageflags_proc, O_RDONLY);
+
+ if (kpageflags_fd == -1) {
+ perror("read kpageflags:");
+ exit(EXIT_FAILURE);
+ }
+
+ one_page = mmap((void *)(1UL << 30), len, PROT_READ | PROT_WRITE,
+ MAP_ANONYMOUS | MAP_PRIVATE, -1, 0);
+
+ madvise(one_page, len, MADV_HUGEPAGE);
+
+ for (i = 0; i < len; i++)
+ one_page[i] = (char)i;
+
+ thp_size = check_huge(one_page);
+ if (!thp_size) {
+ printf("No THP is allocated\n");
+ exit(EXIT_FAILURE);
+ }
+
+ /* remap the first pagesize of first THP */
+ pte_mapped = mremap(one_page, pagesize, pagesize, MREMAP_MAYMOVE);
+
+ /* remap the Nth pagesize of Nth THP */
+ for (i = 1; i < 4; i++) {
+ pte_mapped2 = mremap(one_page + pmd_pagesize * i + pagesize * i,
+ pagesize, pagesize,
+ MREMAP_MAYMOVE|MREMAP_FIXED,
+ pte_mapped + pagesize * i);
+ if (pte_mapped2 == (char *)-1) {
+ perror("mremap failed");
+ exit(EXIT_FAILURE);
+ }
+ }
+
+ /* smap does not show THPs after mremap, use kpageflags instead */
+ thp_size = 0;
+ for (i = 0; i < pagesize * 4; i++)
+ if (i % pagesize == 0 &&
+ is_backed_by_thp(&pte_mapped[i], pagemap_fd, kpageflags_fd))
+ thp_size++;
+
+ if (thp_size != 4) {
+ printf("Some THPs are missing during mremap\n");
+ exit(EXIT_FAILURE);
+ }
+
+ /* split all remapped THPs */
+ write_debugfs(getpid(), (uint64_t)pte_mapped,
+ (uint64_t)pte_mapped + pagesize * 4);
+
+ /* smap does not show THPs after mremap, use kpageflags instead */
+ thp_size = 0;
+ for (i = 0; i < pagesize * 4; i++) {
+ if (pte_mapped[i] != (char)i) {
+ printf("%ld byte corrupted\n", i);
+ exit(EXIT_FAILURE);
+ }
+ if (i % pagesize == 0 &&
+ is_backed_by_thp(&pte_mapped[i], pagemap_fd, kpageflags_fd))
+ thp_size++;
+ }
+
+ if (thp_size) {
+ printf("Still %ld THPs not split\n", thp_size);
+ exit(EXIT_FAILURE);
+ }
+
+ printf("Split PTE-mapped huge pages successful\n");
+ munmap(one_page, len);
+ close(pagemap_fd);
+ close(kpageflags_fd);
+}
+
+int main(int argc, char **argv)
+{
+ if (geteuid() != 0) {
+ printf("Please run the benchmark as root\n");
+ exit(EXIT_FAILURE);
+ }
+
+ pagesize = getpagesize();
+ pageshift = ffs(pagesize) - 1;
+ pmd_pagesize = read_pmd_pagesize();
+
+ split_pmd_thp();
+ split_pte_mapped_thp();
+
+ return 0;
+}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 033/143] mm: huge_memory: debugfs for file-backed THP split
2021-05-05 1:32 incoming Andrew Morton
` (31 preceding siblings ...)
2021-05-05 1:34 ` [patch 032/143] mm: huge_memory: a new debugfs interface for splitting THP tests Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 034/143] mm/hugeltb: remove redundant VM_BUG_ON() in region_add() Andrew Morton
` (107 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, david, jhubbard, kirill.shutemov, linux-mm, mika.penttila,
mm-commits, rientjes, sandipan, shuah, shy828301, torvalds, willy,
ziy
From: Zi Yan <ziy@nvidia.com>
Subject: mm: huge_memory: debugfs for file-backed THP split
Further extend <debugfs>/split_huge_pages to accept
"<path>,<pgoff_start>,<pgoff_end>" for file-backed THP split tests since
tmpfs may have file backed by THP that mapped nowhere.
Update selftest program to test file-backed THP split too.
Link: https://lkml.kernel.org/r/20210331235309.332292-2-zi.yan@sent.com
Signed-off-by: Zi Yan <ziy@nvidia.com>
Suggested-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Reviewed-by: Yang Shi <shy828301@gmail.com>
Cc: "Kirill A . Shutemov" <kirill.shutemov@linux.intel.com>
Cc: Shuah Khan <shuah@kernel.org>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Sandipan Das <sandipan@linux.ibm.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: Mika Penttila <mika.penttila@nextfour.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Matthew Wilcox <willy@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/huge_memory.c | 90 +++++++++++-
tools/testing/selftests/vm/split_huge_page_test.c | 82 ++++++++++
2 files changed, 166 insertions(+), 6 deletions(-)
--- a/mm/huge_memory.c~mm-huge_memory-debugfs-for-file-backed-thp-split
+++ a/mm/huge_memory.c
@@ -3050,6 +3050,65 @@ out:
return ret;
}
+static int split_huge_pages_in_file(const char *file_path, pgoff_t off_start,
+ pgoff_t off_end)
+{
+ struct filename *file;
+ struct file *candidate;
+ struct address_space *mapping;
+ int ret = -EINVAL;
+ pgoff_t index;
+ int nr_pages = 1;
+ unsigned long total = 0, split = 0;
+
+ file = getname_kernel(file_path);
+ if (IS_ERR(file))
+ return ret;
+
+ candidate = file_open_name(file, O_RDONLY, 0);
+ if (IS_ERR(candidate))
+ goto out;
+
+ pr_debug("split file-backed THPs in file: %s, page offset: [0x%lx - 0x%lx]\n",
+ file_path, off_start, off_end);
+
+ mapping = candidate->f_mapping;
+
+ for (index = off_start; index < off_end; index += nr_pages) {
+ struct page *fpage = pagecache_get_page(mapping, index,
+ FGP_ENTRY | FGP_HEAD, 0);
+
+ nr_pages = 1;
+ if (xa_is_value(fpage) || !fpage)
+ continue;
+
+ if (!is_transparent_hugepage(fpage))
+ goto next;
+
+ total++;
+ nr_pages = thp_nr_pages(fpage);
+
+ if (!trylock_page(fpage))
+ goto next;
+
+ if (!split_huge_page(fpage))
+ split++;
+
+ unlock_page(fpage);
+next:
+ put_page(fpage);
+ cond_resched();
+ }
+
+ filp_close(candidate, NULL);
+ ret = 0;
+
+ pr_debug("%lu of %lu file-backed THP split\n", split, total);
+out:
+ putname(file);
+ return ret;
+}
+
#define MAX_INPUT_BUF_SZ 255
static ssize_t split_huge_pages_write(struct file *file, const char __user *buf,
@@ -3057,7 +3116,8 @@ static ssize_t split_huge_pages_write(st
{
static DEFINE_MUTEX(split_debug_mutex);
ssize_t ret;
- char input_buf[MAX_INPUT_BUF_SZ]; /* hold pid, start_vaddr, end_vaddr */
+ /* hold pid, start_vaddr, end_vaddr or file_path, off_start, off_end */
+ char input_buf[MAX_INPUT_BUF_SZ];
int pid;
unsigned long vaddr_start, vaddr_end;
@@ -3072,6 +3132,34 @@ static ssize_t split_huge_pages_write(st
goto out;
input_buf[MAX_INPUT_BUF_SZ - 1] = '\0';
+
+ if (input_buf[0] == '/') {
+ char *tok;
+ char *buf = input_buf;
+ char file_path[MAX_INPUT_BUF_SZ];
+ pgoff_t off_start = 0, off_end = 0;
+ size_t input_len = strlen(input_buf);
+
+ tok = strsep(&buf, ",");
+ if (tok) {
+ strncpy(file_path, tok, MAX_INPUT_BUF_SZ);
+ } else {
+ ret = -EINVAL;
+ goto out;
+ }
+
+ ret = sscanf(buf, "0x%lx,0x%lx", &off_start, &off_end);
+ if (ret != 2) {
+ ret = -EINVAL;
+ goto out;
+ }
+ ret = split_huge_pages_in_file(file_path, off_start, off_end);
+ if (!ret)
+ ret = input_len;
+
+ goto out;
+ }
+
ret = sscanf(input_buf, "%d,0x%lx,0x%lx", &pid, &vaddr_start, &vaddr_end);
if (ret == 1 && pid == 1) {
split_huge_pages_all();
--- a/tools/testing/selftests/vm/split_huge_page_test.c~mm-huge_memory-debugfs-for-file-backed-thp-split
+++ a/tools/testing/selftests/vm/split_huge_page_test.c
@@ -7,11 +7,13 @@
#define _GNU_SOURCE
#include <stdio.h>
#include <stdlib.h>
+#include <stdarg.h>
#include <unistd.h>
#include <inttypes.h>
#include <string.h>
#include <fcntl.h>
#include <sys/mman.h>
+#include <sys/mount.h>
#include <malloc.h>
#include <stdbool.h>
@@ -24,6 +26,9 @@ uint64_t pmd_pagesize;
#define SMAP_PATH "/proc/self/smaps"
#define INPUT_MAX 80
+#define PID_FMT "%d,0x%lx,0x%lx"
+#define PATH_FMT "%s,0x%lx,0x%lx"
+
#define PFN_MASK ((1UL<<55)-1)
#define KPF_THP (1UL<<22)
@@ -87,13 +92,16 @@ static int write_file(const char *path,
return (unsigned int) numwritten;
}
-static void write_debugfs(int pid, uint64_t vaddr_start, uint64_t vaddr_end)
+static void write_debugfs(const char *fmt, ...)
{
char input[INPUT_MAX];
int ret;
+ va_list argp;
+
+ va_start(argp, fmt);
+ ret = vsnprintf(input, INPUT_MAX, fmt, argp);
+ va_end(argp);
- ret = snprintf(input, INPUT_MAX, "%d,0x%lx,0x%lx", pid, vaddr_start,
- vaddr_end);
if (ret >= INPUT_MAX) {
printf("%s: Debugfs input is too long\n", __func__);
exit(EXIT_FAILURE);
@@ -183,7 +191,8 @@ void split_pmd_thp(void)
}
/* split all THPs */
- write_debugfs(getpid(), (uint64_t)one_page, (uint64_t)one_page + len);
+ write_debugfs(PID_FMT, getpid(), (uint64_t)one_page,
+ (uint64_t)one_page + len);
for (i = 0; i < len; i++)
if (one_page[i] != (char)i) {
@@ -274,7 +283,7 @@ void split_pte_mapped_thp(void)
}
/* split all remapped THPs */
- write_debugfs(getpid(), (uint64_t)pte_mapped,
+ write_debugfs(PID_FMT, getpid(), (uint64_t)pte_mapped,
(uint64_t)pte_mapped + pagesize * 4);
/* smap does not show THPs after mremap, use kpageflags instead */
@@ -300,6 +309,68 @@ void split_pte_mapped_thp(void)
close(kpageflags_fd);
}
+void split_file_backed_thp(void)
+{
+ int status;
+ int fd;
+ ssize_t num_written;
+ char tmpfs_template[] = "/tmp/thp_split_XXXXXX";
+ const char *tmpfs_loc = mkdtemp(tmpfs_template);
+ char testfile[INPUT_MAX];
+ uint64_t pgoff_start = 0, pgoff_end = 1024;
+
+ printf("Please enable pr_debug in split_huge_pages_in_file() if you need more info.\n");
+
+ status = mount("tmpfs", tmpfs_loc, "tmpfs", 0, "huge=always,size=4m");
+
+ if (status) {
+ printf("Unable to create a tmpfs for testing\n");
+ exit(EXIT_FAILURE);
+ }
+
+ status = snprintf(testfile, INPUT_MAX, "%s/thp_file", tmpfs_loc);
+ if (status >= INPUT_MAX) {
+ printf("Fail to create file-backed THP split testing file\n");
+ goto cleanup;
+ }
+
+ fd = open(testfile, O_CREAT|O_WRONLY);
+ if (fd == -1) {
+ perror("Cannot open testing file\n");
+ goto cleanup;
+ }
+
+ /* write something to the file, so a file-backed THP can be allocated */
+ num_written = write(fd, tmpfs_loc, sizeof(tmpfs_loc));
+ close(fd);
+
+ if (num_written < 1) {
+ printf("Fail to write data to testing file\n");
+ goto cleanup;
+ }
+
+ /* split the file-backed THP */
+ write_debugfs(PATH_FMT, testfile, pgoff_start, pgoff_end);
+
+ status = unlink(testfile);
+ if (status)
+ perror("Cannot remove testing file\n");
+
+cleanup:
+ status = umount(tmpfs_loc);
+ if (status) {
+ printf("Unable to umount %s\n", tmpfs_loc);
+ exit(EXIT_FAILURE);
+ }
+ status = rmdir(tmpfs_loc);
+ if (status) {
+ perror("cannot remove tmp dir");
+ exit(EXIT_FAILURE);
+ }
+
+ printf("file-backed THP split test done, please check dmesg for more information\n");
+}
+
int main(int argc, char **argv)
{
if (geteuid() != 0) {
@@ -313,6 +384,7 @@ int main(int argc, char **argv)
split_pmd_thp();
split_pte_mapped_thp();
+ split_file_backed_thp();
return 0;
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 034/143] mm/hugeltb: remove redundant VM_BUG_ON() in region_add()
2021-05-05 1:32 incoming Andrew Morton
` (32 preceding siblings ...)
2021-05-05 1:34 ` [patch 033/143] mm: huge_memory: debugfs for file-backed THP split Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 035/143] mm/hugeltb: simplify the return code of __vma_reservation_common() Andrew Morton
` (106 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, linfeilong, linmiaohe, linux-mm, mike.kravetz, mm-commits,
torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugeltb: remove redundant VM_BUG_ON() in region_add()
Patch series "Cleanup and fixup for hugetlb", v2.
This series contains cleanups to remove redundant VM_BUG_ON() and simplify
the return code. Also this handles the error case in
hugetlb_fix_reserve_counts() correctly. More details can be found in the
respective changelogs.
This patch (of 5):
The same VM_BUG_ON() check is already done in the callee. Remove this
extra one to simplify the code slightly.
Link: https://lkml.kernel.org/r/20210410072348.20437-1-linmiaohe@huawei.com
Link: https://lkml.kernel.org/r/20210410072348.20437-2-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Feilong Lin <linfeilong@huawei.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 1 -
1 file changed, 1 deletion(-)
--- a/mm/hugetlb.c~mm-hugeltb-remove-redundant-vm_bug_on-in-region_add
+++ a/mm/hugetlb.c
@@ -553,7 +553,6 @@ retry:
resv->adds_in_progress -= in_regions_needed;
spin_unlock(&resv->lock);
- VM_BUG_ON(add < 0);
return add;
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 035/143] mm/hugeltb: simplify the return code of __vma_reservation_common()
2021-05-05 1:32 incoming Andrew Morton
` (33 preceding siblings ...)
2021-05-05 1:34 ` [patch 034/143] mm/hugeltb: remove redundant VM_BUG_ON() in region_add() Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 036/143] mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages() Andrew Morton
` (105 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, linfeilong, linmiaohe, linux-mm, mike.kravetz, mm-commits,
torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugeltb: simplify the return code of __vma_reservation_common()
It's guaranteed that the vma is associated with a resv_map, i.e. either
VM_MAYSHARE or HPAGE_RESV_OWNER, when the code reaches here or we would
have returned via !resv check above. So it's unneeded to check whether
HPAGE_RESV_OWNER is set here. Simplify the return code to make it more
clear.
Link: https://lkml.kernel.org/r/20210410072348.20437-3-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Feilong Lin <linfeilong@huawei.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 41 ++++++++++++++++++++---------------------
1 file changed, 20 insertions(+), 21 deletions(-)
--- a/mm/hugetlb.c~mm-hugeltb-simplify-the-return-code-of-__vma_reservation_common
+++ a/mm/hugetlb.c
@@ -2174,27 +2174,26 @@ static long __vma_reservation_common(str
if (vma->vm_flags & VM_MAYSHARE)
return ret;
- else if (is_vma_resv_set(vma, HPAGE_RESV_OWNER) && ret >= 0) {
- /*
- * In most cases, reserves always exist for private mappings.
- * However, a file associated with mapping could have been
- * hole punched or truncated after reserves were consumed.
- * As subsequent fault on such a range will not use reserves.
- * Subtle - The reserve map for private mappings has the
- * opposite meaning than that of shared mappings. If NO
- * entry is in the reserve map, it means a reservation exists.
- * If an entry exists in the reserve map, it means the
- * reservation has already been consumed. As a result, the
- * return value of this routine is the opposite of the
- * value returned from reserve map manipulation routines above.
- */
- if (ret)
- return 0;
- else
- return 1;
- }
- else
- return ret < 0 ? ret : 0;
+ /*
+ * We know private mapping must have HPAGE_RESV_OWNER set.
+ *
+ * In most cases, reserves always exist for private mappings.
+ * However, a file associated with mapping could have been
+ * hole punched or truncated after reserves were consumed.
+ * As subsequent fault on such a range will not use reserves.
+ * Subtle - The reserve map for private mappings has the
+ * opposite meaning than that of shared mappings. If NO
+ * entry is in the reserve map, it means a reservation exists.
+ * If an entry exists in the reserve map, it means the
+ * reservation has already been consumed. As a result, the
+ * return value of this routine is the opposite of the
+ * value returned from reserve map manipulation routines above.
+ */
+ if (ret > 0)
+ return 0;
+ if (ret == 0)
+ return 1;
+ return ret;
}
static long vma_needs_reservation(struct hstate *h,
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 036/143] mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages()
2021-05-05 1:32 incoming Andrew Morton
` (34 preceding siblings ...)
2021-05-05 1:34 ` [patch 035/143] mm/hugeltb: simplify the return code of __vma_reservation_common() Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 037/143] mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts() Andrew Morton
` (104 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, linfeilong, linmiaohe, linux-mm, mike.kravetz, mm-commits,
torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages()
The resv_map could be NULL since this routine can be called in the evict
inode path for all hugetlbfs inodes and we will have chg = 0 in this case.
But (chg - freed) won't go negative as Mike pointed out:
"If resv_map is NULL, then no hugetlb pages can be allocated/associated
with the file. As a result, remove_inode_hugepages will never find any
huge pages associated with the inode and the passed value 'freed' will
always be zero."
Add a comment clarifying this to make it clear and also avoid confusion.
Link: https://lkml.kernel.org/r/20210410072348.20437-4-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Feilong Lin <linfeilong@huawei.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 3 +++
1 file changed, 3 insertions(+)
--- a/mm/hugetlb.c~mm-hugeltb-clarify-chg-freed-wont-go-negative-in-hugetlb_unreserve_pages
+++ a/mm/hugetlb.c
@@ -5267,6 +5267,9 @@ long hugetlb_unreserve_pages(struct inod
/*
* If the subpool has a minimum size, the number of global
* reservations to be released may be adjusted.
+ *
+ * Note that !resv_map implies freed == 0. So (chg - freed)
+ * won't go negative.
*/
gbl_reserve = hugepage_subpool_put_pages(spool, (chg - freed));
hugetlb_acct_memory(h, -gbl_reserve);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 037/143] mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts()
2021-05-05 1:32 incoming Andrew Morton
` (35 preceding siblings ...)
2021-05-05 1:34 ` [patch 036/143] mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages() Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 038/143] mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages() Andrew Morton
` (103 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, linfeilong, linmiaohe, linux-mm, mike.kravetz, mm-commits,
torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts()
A rare out of memory error would prevent removal of the reserve map region
for a page. hugetlb_fix_reserve_counts() handles this rare case to avoid
dangling with incorrect counts. Unfortunately, hugepage_subpool_get_pages
and hugetlb_acct_memory could possibly fail too. We should correctly
handle these cases.
Link: https://lkml.kernel.org/r/20210410072348.20437-5-linmiaohe@huawei.com
Fixes: b5cec28d36f5 ("hugetlbfs: truncate_hugepages() takes a range of pages")
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Feilong Lin <linfeilong@huawei.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 11 +++++++++--
1 file changed, 9 insertions(+), 2 deletions(-)
--- a/mm/hugetlb.c~mm-hugeltb-handle-the-error-case-in-hugetlb_fix_reserve_counts
+++ a/mm/hugetlb.c
@@ -742,13 +742,20 @@ void hugetlb_fix_reserve_counts(struct i
{
struct hugepage_subpool *spool = subpool_inode(inode);
long rsv_adjust;
+ bool reserved = false;
rsv_adjust = hugepage_subpool_get_pages(spool, 1);
- if (rsv_adjust) {
+ if (rsv_adjust > 0) {
struct hstate *h = hstate_inode(inode);
- hugetlb_acct_memory(h, 1);
+ if (!hugetlb_acct_memory(h, 1))
+ reserved = true;
+ } else if (!rsv_adjust) {
+ reserved = true;
}
+
+ if (!reserved)
+ pr_warn("hugetlb: Huge Page Reserved count may go negative.\n");
}
/*
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 038/143] mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages()
2021-05-05 1:32 incoming Andrew Morton
` (36 preceding siblings ...)
2021-05-05 1:34 ` [patch 037/143] mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts() Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 039/143] mm/cma: change cma mutex to irq safe spinlock Andrew Morton
` (102 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, linfeilong, linmiaohe, linux-mm, mike.kravetz, mm-commits,
torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages()
The local variable pseudo_vma is not used anymore.
Link: https://lkml.kernel.org/r/20210410072348.20437-6-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Feilong Lin <linfeilong@huawei.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/hugetlbfs/inode.c | 3 ---
1 file changed, 3 deletions(-)
--- a/fs/hugetlbfs/inode.c~mm-hugetlb-remove-unused-variable-pseudo_vma-in-remove_inode_hugepages
+++ a/fs/hugetlbfs/inode.c
@@ -463,14 +463,11 @@ static void remove_inode_hugepages(struc
struct address_space *mapping = &inode->i_data;
const pgoff_t start = lstart >> huge_page_shift(h);
const pgoff_t end = lend >> huge_page_shift(h);
- struct vm_area_struct pseudo_vma;
struct pagevec pvec;
pgoff_t next, index;
int i, freed = 0;
bool truncate_op = (lend == LLONG_MAX);
- vma_init(&pseudo_vma, current->mm);
- pseudo_vma.vm_flags = (VM_HUGETLB | VM_MAYSHARE | VM_SHARED);
pagevec_init(&pvec);
next = start;
while (next < end) {
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 039/143] mm/cma: change cma mutex to irq safe spinlock
2021-05-05 1:32 incoming Andrew Morton
` (37 preceding siblings ...)
2021-05-05 1:34 ` [patch 038/143] mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages() Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 040/143] hugetlb: no need to drop hugetlb_lock to call cma_release Andrew Morton
` (101 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
will, willy
From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: mm/cma: change cma mutex to irq safe spinlock
Patch series "make hugetlb put_page safe for all calling contexts", v5.
This effort is the result a recent bug report [1]. Syzbot found a
potential deadlock in the hugetlb put_page/free_huge_page_path. WARNING:
SOFTIRQ-safe -> SOFTIRQ-unsafe lock order detected Since the
free_huge_page_path already has code to 'hand off' page free requests to a
workqueue, a suggestion was proposed to make the in_irq() detection
accurate by always enabling PREEMPT_COUNT [2]. The outcome of that
discussion was that the hugetlb put_page path (free_huge_page) path should
be properly fixed and safe for all calling contexts.
This patch (of 8):
cma_release is currently a sleepable operatation because the bitmap
manipulation is protected by cma->lock mutex. Hugetlb code which relies
on cma_release for CMA backed (giga) hugetlb pages, however, needs to be
irq safe.
The lock doesn't protect any sleepable operation so it can be changed to a
(irq aware) spin lock. The bitmap processing should be quite fast in
typical case but if cma sizes grow to TB then we will likely need to
replace the lock by a more optimized bitmap implementation.
Link: https://lkml.kernel.org/r/20210409205254.242291-1-mike.kravetz@oracle.com
Link: https://lkml.kernel.org/r/20210409205254.242291-2-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Muchun Song <songmuchun@bytedance.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Miaohe Lin <linmiaohe@huawei.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/cma.c | 18 +++++++++---------
mm/cma.h | 2 +-
mm/cma_debug.c | 8 ++++----
3 files changed, 14 insertions(+), 14 deletions(-)
--- a/mm/cma.c~mm-cma-change-cma-mutex-to-irq-safe-spinlock
+++ a/mm/cma.c
@@ -24,7 +24,6 @@
#include <linux/memblock.h>
#include <linux/err.h>
#include <linux/mm.h>
-#include <linux/mutex.h>
#include <linux/sizes.h>
#include <linux/slab.h>
#include <linux/log2.h>
@@ -83,13 +82,14 @@ static void cma_clear_bitmap(struct cma
unsigned int count)
{
unsigned long bitmap_no, bitmap_count;
+ unsigned long flags;
bitmap_no = (pfn - cma->base_pfn) >> cma->order_per_bit;
bitmap_count = cma_bitmap_pages_to_bits(cma, count);
- mutex_lock(&cma->lock);
+ spin_lock_irqsave(&cma->lock, flags);
bitmap_clear(cma->bitmap, bitmap_no, bitmap_count);
- mutex_unlock(&cma->lock);
+ spin_unlock_irqrestore(&cma->lock, flags);
}
static void __init cma_activate_area(struct cma *cma)
@@ -118,7 +118,7 @@ static void __init cma_activate_area(str
pfn += pageblock_nr_pages)
init_cma_reserved_pageblock(pfn_to_page(pfn));
- mutex_init(&cma->lock);
+ spin_lock_init(&cma->lock);
#ifdef CONFIG_CMA_DEBUGFS
INIT_HLIST_HEAD(&cma->mem_head);
@@ -392,7 +392,7 @@ static void cma_debug_show_areas(struct
unsigned long nr_part, nr_total = 0;
unsigned long nbits = cma_bitmap_maxno(cma);
- mutex_lock(&cma->lock);
+ spin_lock_irq(&cma->lock);
pr_info("number of available pages: ");
for (;;) {
next_zero_bit = find_next_zero_bit(cma->bitmap, nbits, start);
@@ -407,7 +407,7 @@ static void cma_debug_show_areas(struct
start = next_zero_bit + nr_zero;
}
pr_cont("=> %lu free of %lu total pages\n", nr_total, cma->count);
- mutex_unlock(&cma->lock);
+ spin_unlock_irq(&cma->lock);
}
#else
static inline void cma_debug_show_areas(struct cma *cma) { }
@@ -452,12 +452,12 @@ struct page *cma_alloc(struct cma *cma,
return NULL;
for (;;) {
- mutex_lock(&cma->lock);
+ spin_lock_irq(&cma->lock);
bitmap_no = bitmap_find_next_zero_area_off(cma->bitmap,
bitmap_maxno, start, bitmap_count, mask,
offset);
if (bitmap_no >= bitmap_maxno) {
- mutex_unlock(&cma->lock);
+ spin_unlock_irq(&cma->lock);
break;
}
bitmap_set(cma->bitmap, bitmap_no, bitmap_count);
@@ -466,7 +466,7 @@ struct page *cma_alloc(struct cma *cma,
* our exclusive use. If the migration fails we will take the
* lock again and unmark it.
*/
- mutex_unlock(&cma->lock);
+ spin_unlock_irq(&cma->lock);
pfn = cma->base_pfn + (bitmap_no << cma->order_per_bit);
ret = alloc_contig_range(pfn, pfn + count, MIGRATE_CMA,
--- a/mm/cma_debug.c~mm-cma-change-cma-mutex-to-irq-safe-spinlock
+++ a/mm/cma_debug.c
@@ -36,10 +36,10 @@ static int cma_used_get(void *data, u64
struct cma *cma = data;
unsigned long used;
- mutex_lock(&cma->lock);
+ spin_lock_irq(&cma->lock);
/* pages counter is smaller than sizeof(int) */
used = bitmap_weight(cma->bitmap, (int)cma_bitmap_maxno(cma));
- mutex_unlock(&cma->lock);
+ spin_unlock_irq(&cma->lock);
*val = (u64)used << cma->order_per_bit;
return 0;
@@ -53,7 +53,7 @@ static int cma_maxchunk_get(void *data,
unsigned long start, end = 0;
unsigned long bitmap_maxno = cma_bitmap_maxno(cma);
- mutex_lock(&cma->lock);
+ spin_lock_irq(&cma->lock);
for (;;) {
start = find_next_zero_bit(cma->bitmap, bitmap_maxno, end);
if (start >= bitmap_maxno)
@@ -61,7 +61,7 @@ static int cma_maxchunk_get(void *data,
end = find_next_bit(cma->bitmap, bitmap_maxno, start);
maxchunk = max(end - start, maxchunk);
}
- mutex_unlock(&cma->lock);
+ spin_unlock_irq(&cma->lock);
*val = (u64)maxchunk << cma->order_per_bit;
return 0;
--- a/mm/cma.h~mm-cma-change-cma-mutex-to-irq-safe-spinlock
+++ a/mm/cma.h
@@ -9,7 +9,7 @@ struct cma {
unsigned long count;
unsigned long *bitmap;
unsigned int order_per_bit; /* Order of pages represented by one bit */
- struct mutex lock;
+ spinlock_t lock;
#ifdef CONFIG_CMA_DEBUGFS
struct hlist_head mem_head;
spinlock_t mem_head_lock;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 040/143] hugetlb: no need to drop hugetlb_lock to call cma_release
2021-05-05 1:32 incoming Andrew Morton
` (38 preceding siblings ...)
2021-05-05 1:34 ` [patch 039/143] mm/cma: change cma mutex to irq safe spinlock Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 041/143] hugetlb: add per-hstate mutex to synchronize user adjustments Andrew Morton
` (100 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
will, willy
From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: hugetlb: no need to drop hugetlb_lock to call cma_release
Now that cma_release is non-blocking and irq safe, there is no need to
drop hugetlb_lock before calling.
Link: https://lkml.kernel.org/r/20210409205254.242291-3-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Roman Gushchin <guro@fb.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Miaohe Lin <linmiaohe@huawei.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 6 ------
1 file changed, 6 deletions(-)
--- a/mm/hugetlb.c~hugetlb-no-need-to-drop-hugetlb_lock-to-call-cma_release
+++ a/mm/hugetlb.c
@@ -1355,14 +1355,8 @@ static void update_and_free_page(struct
set_compound_page_dtor(page, NULL_COMPOUND_DTOR);
set_page_refcounted(page);
if (hstate_is_gigantic(h)) {
- /*
- * Temporarily drop the hugetlb_lock, because
- * we might block in free_gigantic_page().
- */
- spin_unlock(&hugetlb_lock);
destroy_compound_gigantic_page(page, huge_page_order(h));
free_gigantic_page(page, huge_page_order(h));
- spin_lock(&hugetlb_lock);
} else {
__free_pages(page, huge_page_order(h));
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 041/143] hugetlb: add per-hstate mutex to synchronize user adjustments
2021-05-05 1:32 incoming Andrew Morton
` (39 preceding siblings ...)
2021-05-05 1:34 ` [patch 040/143] hugetlb: no need to drop hugetlb_lock to call cma_release Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 042/143] hugetlb: create remove_hugetlb_page() to separate functionality Andrew Morton
` (99 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
will, willy
From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: hugetlb: add per-hstate mutex to synchronize user adjustments
The helper routine hstate_next_node_to_alloc accesses and modifies the
hstate variable next_nid_to_alloc. The helper is used by the routines
alloc_pool_huge_page and adjust_pool_surplus. adjust_pool_surplus is
called with hugetlb_lock held. However, alloc_pool_huge_page can not be
called with the hugetlb lock held as it will call the page allocator. Two
instances of alloc_pool_huge_page could be run in parallel or
alloc_pool_huge_page could run in parallel with adjust_pool_surplus which
may result in the variable next_nid_to_alloc becoming invalid for the
caller and pages being allocated on the wrong node.
Both alloc_pool_huge_page and adjust_pool_surplus are only called from the
routine set_max_huge_pages after boot. set_max_huge_pages is only called
as the reusult of a user writing to the proc/sysfs nr_hugepages, or
nr_hugepages_mempolicy file to adjust the number of hugetlb pages.
It makes little sense to allow multiple adjustment to the number of
hugetlb pages in parallel. Add a mutex to the hstate and use it to only
allow one hugetlb page adjustment at a time. This will synchronize
modifications to the next_nid_to_alloc variable.
Link: https://lkml.kernel.org/r/20210409205254.242291-4-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Muchun Song <songmuchun@bytedance.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/hugetlb.h | 1 +
mm/hugetlb.c | 8 ++++++++
2 files changed, 9 insertions(+)
--- a/include/linux/hugetlb.h~hugetlb-add-per-hstate-mutex-to-synchronize-user-adjustments
+++ a/include/linux/hugetlb.h
@@ -559,6 +559,7 @@ HPAGEFLAG(Freed, freed)
#define HSTATE_NAME_LEN 32
/* Defines one hugetlb page size */
struct hstate {
+ struct mutex resize_lock;
int next_nid_to_alloc;
int next_nid_to_free;
unsigned int order;
--- a/mm/hugetlb.c~hugetlb-add-per-hstate-mutex-to-synchronize-user-adjustments
+++ a/mm/hugetlb.c
@@ -2621,6 +2621,11 @@ static int set_max_huge_pages(struct hst
else
return -ENOMEM;
+ /*
+ * resize_lock mutex prevents concurrent adjustments to number of
+ * pages in hstate via the proc/sysfs interfaces.
+ */
+ mutex_lock(&h->resize_lock);
spin_lock(&hugetlb_lock);
/*
@@ -2653,6 +2658,7 @@ static int set_max_huge_pages(struct hst
if (hstate_is_gigantic(h) && !IS_ENABLED(CONFIG_CONTIG_ALLOC)) {
if (count > persistent_huge_pages(h)) {
spin_unlock(&hugetlb_lock);
+ mutex_unlock(&h->resize_lock);
NODEMASK_FREE(node_alloc_noretry);
return -EINVAL;
}
@@ -2727,6 +2733,7 @@ static int set_max_huge_pages(struct hst
out:
h->max_huge_pages = persistent_huge_pages(h);
spin_unlock(&hugetlb_lock);
+ mutex_unlock(&h->resize_lock);
NODEMASK_FREE(node_alloc_noretry);
@@ -3214,6 +3221,7 @@ void __init hugetlb_add_hstate(unsigned
BUG_ON(hugetlb_max_hstate >= HUGE_MAX_HSTATE);
BUG_ON(order == 0);
h = &hstates[hugetlb_max_hstate++];
+ mutex_init(&h->resize_lock);
h->order = order;
h->mask = ~(huge_page_size(h) - 1);
for (i = 0; i < MAX_NUMNODES; ++i)
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 042/143] hugetlb: create remove_hugetlb_page() to separate functionality
2021-05-05 1:32 incoming Andrew Morton
` (40 preceding siblings ...)
2021-05-05 1:34 ` [patch 041/143] hugetlb: add per-hstate mutex to synchronize user adjustments Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:34 ` [patch 043/143] hugetlb: call update_and_free_page without hugetlb_lock Andrew Morton
` (98 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
will, willy
From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: hugetlb: create remove_hugetlb_page() to separate functionality
The new remove_hugetlb_page() routine is designed to remove a hugetlb page
from hugetlbfs processing. It will remove the page from the active or
free list, update global counters and set the compound page destructor to
NULL so that PageHuge() will return false for the 'page'. After this
call, the 'page' can be treated as a normal compound page or a collection
of base size pages.
update_and_free_page no longer decrements h->nr_huge_pages{_node} as this
is performed in remove_hugetlb_page. The only functionality performed by
update_and_free_page is to free the base pages to the lower level
allocators.
update_and_free_page is typically called after remove_hugetlb_page.
remove_hugetlb_page is to be called with the hugetlb_lock held.
Creating this routine and separating functionality is in preparation for
restructuring code to reduce lock hold times. This commit should not
introduce any changes to functionality.
Link: https://lkml.kernel.org/r/20210409205254.242291-5-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Muchun Song <songmuchun@bytedance.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 65 ++++++++++++++++++++++++++++++-------------------
1 file changed, 40 insertions(+), 25 deletions(-)
--- a/mm/hugetlb.c~hugetlb-create-remove_hugetlb_page-to-separate-functionality
+++ a/mm/hugetlb.c
@@ -1333,6 +1333,41 @@ static inline void destroy_compound_giga
unsigned int order) { }
#endif
+/*
+ * Remove hugetlb page from lists, and update dtor so that page appears
+ * as just a compound page. A reference is held on the page.
+ *
+ * Must be called with hugetlb lock held.
+ */
+static void remove_hugetlb_page(struct hstate *h, struct page *page,
+ bool adjust_surplus)
+{
+ int nid = page_to_nid(page);
+
+ VM_BUG_ON_PAGE(hugetlb_cgroup_from_page(page), page);
+ VM_BUG_ON_PAGE(hugetlb_cgroup_from_page_rsvd(page), page);
+
+ if (hstate_is_gigantic(h) && !gigantic_page_runtime_supported())
+ return;
+
+ list_del(&page->lru);
+
+ if (HPageFreed(page)) {
+ h->free_huge_pages--;
+ h->free_huge_pages_node[nid]--;
+ }
+ if (adjust_surplus) {
+ h->surplus_huge_pages--;
+ h->surplus_huge_pages_node[nid]--;
+ }
+
+ set_page_refcounted(page);
+ set_compound_page_dtor(page, NULL_COMPOUND_DTOR);
+
+ h->nr_huge_pages--;
+ h->nr_huge_pages_node[nid]--;
+}
+
static void update_and_free_page(struct hstate *h, struct page *page)
{
int i;
@@ -1341,8 +1376,6 @@ static void update_and_free_page(struct
if (hstate_is_gigantic(h) && !gigantic_page_runtime_supported())
return;
- h->nr_huge_pages--;
- h->nr_huge_pages_node[page_to_nid(page)]--;
for (i = 0; i < pages_per_huge_page(h);
i++, subpage = mem_map_next(subpage, page, i)) {
subpage->flags &= ~(1 << PG_locked | 1 << PG_error |
@@ -1350,10 +1383,6 @@ static void update_and_free_page(struct
1 << PG_active | 1 << PG_private |
1 << PG_writeback);
}
- VM_BUG_ON_PAGE(hugetlb_cgroup_from_page(page), page);
- VM_BUG_ON_PAGE(hugetlb_cgroup_from_page_rsvd(page), page);
- set_compound_page_dtor(page, NULL_COMPOUND_DTOR);
- set_page_refcounted(page);
if (hstate_is_gigantic(h)) {
destroy_compound_gigantic_page(page, huge_page_order(h));
free_gigantic_page(page, huge_page_order(h));
@@ -1421,15 +1450,12 @@ static void __free_huge_page(struct page
h->resv_huge_pages++;
if (HPageTemporary(page)) {
- list_del(&page->lru);
- ClearHPageTemporary(page);
+ remove_hugetlb_page(h, page, false);
update_and_free_page(h, page);
} else if (h->surplus_huge_pages_node[nid]) {
/* remove the page from active list */
- list_del(&page->lru);
+ remove_hugetlb_page(h, page, true);
update_and_free_page(h, page);
- h->surplus_huge_pages--;
- h->surplus_huge_pages_node[nid]--;
} else {
arch_clear_hugepage_flags(page);
enqueue_huge_page(h, page);
@@ -1714,13 +1740,7 @@ static int free_pool_huge_page(struct hs
struct page *page =
list_entry(h->hugepage_freelists[node].next,
struct page, lru);
- list_del(&page->lru);
- h->free_huge_pages--;
- h->free_huge_pages_node[node]--;
- if (acct_surplus) {
- h->surplus_huge_pages--;
- h->surplus_huge_pages_node[node]--;
- }
+ remove_hugetlb_page(h, page, acct_surplus);
update_and_free_page(h, page);
ret = 1;
break;
@@ -1758,7 +1778,6 @@ retry:
if (!page_count(page)) {
struct page *head = compound_head(page);
struct hstate *h = page_hstate(head);
- int nid = page_to_nid(head);
if (h->free_huge_pages - h->resv_huge_pages == 0)
goto out;
@@ -1789,9 +1808,7 @@ retry:
SetPageHWPoison(page);
ClearPageHWPoison(head);
}
- list_del(&head->lru);
- h->free_huge_pages--;
- h->free_huge_pages_node[nid]--;
+ remove_hugetlb_page(h, page, false);
h->max_huge_pages--;
update_and_free_page(h, head);
rc = 0;
@@ -2558,10 +2575,8 @@ static void try_to_free_low(struct hstat
return;
if (PageHighMem(page))
continue;
- list_del(&page->lru);
+ remove_hugetlb_page(h, page, false);
update_and_free_page(h, page);
- h->free_huge_pages--;
- h->free_huge_pages_node[page_to_nid(page)]--;
}
}
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 043/143] hugetlb: call update_and_free_page without hugetlb_lock
2021-05-05 1:32 incoming Andrew Morton
` (41 preceding siblings ...)
2021-05-05 1:34 ` [patch 042/143] hugetlb: create remove_hugetlb_page() to separate functionality Andrew Morton
@ 2021-05-05 1:34 ` Andrew Morton
2021-05-05 1:35 ` [patch 044/143] hugetlb: change free_pool_huge_page to remove_pool_huge_page Andrew Morton
` (97 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:34 UTC (permalink / raw)
To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
will, willy
From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: hugetlb: call update_and_free_page without hugetlb_lock
With the introduction of remove_hugetlb_page(), there is no need for
update_and_free_page to hold the hugetlb lock. Change all callers to drop
the lock before calling.
With additional code modifications, this will allow loops which decrease
the huge page pool to drop the hugetlb_lock with each page to reduce long
hold times.
The ugly unlock/lock cycle in free_pool_huge_page will be removed in a
subsequent patch which restructures free_pool_huge_page.
Link: https://lkml.kernel.org/r/20210409205254.242291-6-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Muchun Song <songmuchun@bytedance.com>
Reviewed-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 31 ++++++++++++++++++++++++++-----
1 file changed, 26 insertions(+), 5 deletions(-)
--- a/mm/hugetlb.c~hugetlb-call-update_and_free_page-without-hugetlb_lock
+++ a/mm/hugetlb.c
@@ -1451,16 +1451,18 @@ static void __free_huge_page(struct page
if (HPageTemporary(page)) {
remove_hugetlb_page(h, page, false);
+ spin_unlock(&hugetlb_lock);
update_and_free_page(h, page);
} else if (h->surplus_huge_pages_node[nid]) {
/* remove the page from active list */
remove_hugetlb_page(h, page, true);
+ spin_unlock(&hugetlb_lock);
update_and_free_page(h, page);
} else {
arch_clear_hugepage_flags(page);
enqueue_huge_page(h, page);
+ spin_unlock(&hugetlb_lock);
}
- spin_unlock(&hugetlb_lock);
}
/*
@@ -1741,7 +1743,13 @@ static int free_pool_huge_page(struct hs
list_entry(h->hugepage_freelists[node].next,
struct page, lru);
remove_hugetlb_page(h, page, acct_surplus);
+ /*
+ * unlock/lock around update_and_free_page is temporary
+ * and will be removed with subsequent patch.
+ */
+ spin_unlock(&hugetlb_lock);
update_and_free_page(h, page);
+ spin_lock(&hugetlb_lock);
ret = 1;
break;
}
@@ -1810,8 +1818,9 @@ retry:
}
remove_hugetlb_page(h, page, false);
h->max_huge_pages--;
+ spin_unlock(&hugetlb_lock);
update_and_free_page(h, head);
- rc = 0;
+ return 0;
}
out:
spin_unlock(&hugetlb_lock);
@@ -2563,22 +2572,34 @@ static void try_to_free_low(struct hstat
nodemask_t *nodes_allowed)
{
int i;
+ struct page *page, *next;
+ LIST_HEAD(page_list);
if (hstate_is_gigantic(h))
return;
+ /*
+ * Collect pages to be freed on a list, and free after dropping lock
+ */
for_each_node_mask(i, *nodes_allowed) {
- struct page *page, *next;
struct list_head *freel = &h->hugepage_freelists[i];
list_for_each_entry_safe(page, next, freel, lru) {
if (count >= h->nr_huge_pages)
- return;
+ goto out;
if (PageHighMem(page))
continue;
remove_hugetlb_page(h, page, false);
- update_and_free_page(h, page);
+ list_add(&page->lru, &page_list);
}
}
+
+out:
+ spin_unlock(&hugetlb_lock);
+ list_for_each_entry_safe(page, next, &page_list, lru) {
+ update_and_free_page(h, page);
+ cond_resched();
+ }
+ spin_lock(&hugetlb_lock);
}
#else
static inline void try_to_free_low(struct hstate *h, unsigned long count,
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 044/143] hugetlb: change free_pool_huge_page to remove_pool_huge_page
2021-05-05 1:32 incoming Andrew Morton
` (42 preceding siblings ...)
2021-05-05 1:34 ` [patch 043/143] hugetlb: call update_and_free_page without hugetlb_lock Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:35 ` [patch 045/143] hugetlb: make free_huge_page irq safe Andrew Morton
` (96 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
will, willy
From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: hugetlb: change free_pool_huge_page to remove_pool_huge_page
free_pool_huge_page was called with hugetlb_lock held. It would remove a
hugetlb page, and then free the corresponding pages to the lower level
allocators such as buddy. free_pool_huge_page was called in a loop to
remove hugetlb pages and these loops could hold the hugetlb_lock for a
considerable time.
Create new routine remove_pool_huge_page to replace free_pool_huge_page.
remove_pool_huge_page will remove the hugetlb page, and it must be called
with the hugetlb_lock held. It will return the removed page and it is the
responsibility of the caller to free the page to the lower level
allocators. The hugetlb_lock is dropped before freeing to these
allocators which results in shorter lock hold times.
Add new helper routine to call update_and_free_page for a list of pages.
Note: Some changes to the routine return_unused_surplus_pages are in need
of explanation. Commit e5bbc8a6c992 ("mm/hugetlb.c: fix reservation race
when freeing surplus pages") modified this routine to address a race which
could occur when dropping the hugetlb_lock in the loop that removes pool
pages. Accounting changes introduced in that commit were subtle and took
some thought to understand. This commit removes the cond_resched_lock()
and the potential race. Therefore, remove the subtle code and restore the
more straight forward accounting effectively reverting the commit.
Link: https://lkml.kernel.org/r/20210409205254.242291-7-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: Muchun Song <songmuchun@bytedance.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Miaohe Lin <linmiaohe@huawei.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 93 ++++++++++++++++++++++++++-----------------------
1 file changed, 51 insertions(+), 42 deletions(-)
--- a/mm/hugetlb.c~hugetlb-change-free_pool_huge_page-to-remove_pool_huge_page
+++ a/mm/hugetlb.c
@@ -1211,7 +1211,7 @@ static int hstate_next_node_to_alloc(str
}
/*
- * helper for free_pool_huge_page() - return the previously saved
+ * helper for remove_pool_huge_page() - return the previously saved
* node ["this node"] from which to free a huge page. Advance the
* next node id whether or not we find a free huge page to free so
* that the next attempt to free addresses the next node.
@@ -1391,6 +1391,16 @@ static void update_and_free_page(struct
}
}
+static void update_and_free_pages_bulk(struct hstate *h, struct list_head *list)
+{
+ struct page *page, *t_page;
+
+ list_for_each_entry_safe(page, t_page, list, lru) {
+ update_and_free_page(h, page);
+ cond_resched();
+ }
+}
+
struct hstate *size_to_hstate(unsigned long size)
{
struct hstate *h;
@@ -1721,16 +1731,18 @@ static int alloc_pool_huge_page(struct h
}
/*
- * Free huge page from pool from next node to free.
- * Attempt to keep persistent huge pages more or less
- * balanced over allowed nodes.
+ * Remove huge page from pool from next node to free. Attempt to keep
+ * persistent huge pages more or less balanced over allowed nodes.
+ * This routine only 'removes' the hugetlb page. The caller must make
+ * an additional call to free the page to low level allocators.
* Called with hugetlb_lock locked.
*/
-static int free_pool_huge_page(struct hstate *h, nodemask_t *nodes_allowed,
- bool acct_surplus)
+static struct page *remove_pool_huge_page(struct hstate *h,
+ nodemask_t *nodes_allowed,
+ bool acct_surplus)
{
int nr_nodes, node;
- int ret = 0;
+ struct page *page = NULL;
for_each_node_mask_to_free(h, nr_nodes, node, nodes_allowed) {
/*
@@ -1739,23 +1751,14 @@ static int free_pool_huge_page(struct hs
*/
if ((!acct_surplus || h->surplus_huge_pages_node[node]) &&
!list_empty(&h->hugepage_freelists[node])) {
- struct page *page =
- list_entry(h->hugepage_freelists[node].next,
+ page = list_entry(h->hugepage_freelists[node].next,
struct page, lru);
remove_hugetlb_page(h, page, acct_surplus);
- /*
- * unlock/lock around update_and_free_page is temporary
- * and will be removed with subsequent patch.
- */
- spin_unlock(&hugetlb_lock);
- update_and_free_page(h, page);
- spin_lock(&hugetlb_lock);
- ret = 1;
break;
}
}
- return ret;
+ return page;
}
/*
@@ -2075,17 +2078,16 @@ free:
* to the associated reservation map.
* 2) Free any unused surplus pages that may have been allocated to satisfy
* the reservation. As many as unused_resv_pages may be freed.
- *
- * Called with hugetlb_lock held. However, the lock could be dropped (and
- * reacquired) during calls to cond_resched_lock. Whenever dropping the lock,
- * we must make sure nobody else can claim pages we are in the process of
- * freeing. Do this by ensuring resv_huge_page always is greater than the
- * number of huge pages we plan to free when dropping the lock.
*/
static void return_unused_surplus_pages(struct hstate *h,
unsigned long unused_resv_pages)
{
unsigned long nr_pages;
+ struct page *page;
+ LIST_HEAD(page_list);
+
+ /* Uncommit the reservation */
+ h->resv_huge_pages -= unused_resv_pages;
/* Cannot return gigantic pages currently */
if (hstate_is_gigantic(h))
@@ -2102,24 +2104,21 @@ static void return_unused_surplus_pages(
* evenly across all nodes with memory. Iterate across these nodes
* until we can no longer free unreserved surplus pages. This occurs
* when the nodes with surplus pages have no free pages.
- * free_pool_huge_page() will balance the freed pages across the
+ * remove_pool_huge_page() will balance the freed pages across the
* on-line nodes with memory and will handle the hstate accounting.
- *
- * Note that we decrement resv_huge_pages as we free the pages. If
- * we drop the lock, resv_huge_pages will still be sufficiently large
- * to cover subsequent pages we may free.
*/
while (nr_pages--) {
- h->resv_huge_pages--;
- unused_resv_pages--;
- if (!free_pool_huge_page(h, &node_states[N_MEMORY], 1))
+ page = remove_pool_huge_page(h, &node_states[N_MEMORY], 1);
+ if (!page)
goto out;
- cond_resched_lock(&hugetlb_lock);
+
+ list_add(&page->lru, &page_list);
}
out:
- /* Fully uncommit the reservation */
- h->resv_huge_pages -= unused_resv_pages;
+ spin_unlock(&hugetlb_lock);
+ update_and_free_pages_bulk(h, &page_list);
+ spin_lock(&hugetlb_lock);
}
@@ -2572,7 +2571,6 @@ static void try_to_free_low(struct hstat
nodemask_t *nodes_allowed)
{
int i;
- struct page *page, *next;
LIST_HEAD(page_list);
if (hstate_is_gigantic(h))
@@ -2582,6 +2580,7 @@ static void try_to_free_low(struct hstat
* Collect pages to be freed on a list, and free after dropping lock
*/
for_each_node_mask(i, *nodes_allowed) {
+ struct page *page, *next;
struct list_head *freel = &h->hugepage_freelists[i];
list_for_each_entry_safe(page, next, freel, lru) {
if (count >= h->nr_huge_pages)
@@ -2595,10 +2594,7 @@ static void try_to_free_low(struct hstat
out:
spin_unlock(&hugetlb_lock);
- list_for_each_entry_safe(page, next, &page_list, lru) {
- update_and_free_page(h, page);
- cond_resched();
- }
+ update_and_free_pages_bulk(h, &page_list);
spin_lock(&hugetlb_lock);
}
#else
@@ -2645,6 +2641,8 @@ static int set_max_huge_pages(struct hst
nodemask_t *nodes_allowed)
{
unsigned long min_count, ret;
+ struct page *page;
+ LIST_HEAD(page_list);
NODEMASK_ALLOC(nodemask_t, node_alloc_noretry, GFP_KERNEL);
/*
@@ -2757,11 +2755,22 @@ static int set_max_huge_pages(struct hst
min_count = h->resv_huge_pages + h->nr_huge_pages - h->free_huge_pages;
min_count = max(count, min_count);
try_to_free_low(h, min_count, nodes_allowed);
+
+ /*
+ * Collect pages to be removed on list without dropping lock
+ */
while (min_count < persistent_huge_pages(h)) {
- if (!free_pool_huge_page(h, nodes_allowed, 0))
+ page = remove_pool_huge_page(h, nodes_allowed, 0);
+ if (!page)
break;
- cond_resched_lock(&hugetlb_lock);
+
+ list_add(&page->lru, &page_list);
}
+ /* free the pages after dropping lock */
+ spin_unlock(&hugetlb_lock);
+ update_and_free_pages_bulk(h, &page_list);
+ spin_lock(&hugetlb_lock);
+
while (count < persistent_huge_pages(h)) {
if (!adjust_pool_surplus(h, nodes_allowed, 1))
break;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 045/143] hugetlb: make free_huge_page irq safe
2021-05-05 1:32 incoming Andrew Morton
` (43 preceding siblings ...)
2021-05-05 1:35 ` [patch 044/143] hugetlb: change free_pool_huge_page to remove_pool_huge_page Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:35 ` [patch 046/143] hugetlb: add lockdep_assert_held() calls for hugetlb_lock Andrew Morton
` (95 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
will, willy
From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: hugetlb: make free_huge_page irq safe
Commit c77c0a8ac4c5 ("mm/hugetlb: defer freeing of huge pages if in
non-task context") was added to address the issue of free_huge_page being
called from irq context. That commit hands off free_huge_page processing
to a workqueue if !in_task. However, this doesn't cover all the cases as
pointed out by 0day bot lockdep report [1].
: Possible interrupt unsafe locking scenario:
:
: CPU0 CPU1
: ---- ----
: lock(hugetlb_lock);
: local_irq_disable();
: lock(slock-AF_INET);
: lock(hugetlb_lock);
: <Interrupt>
: lock(slock-AF_INET);
Shakeel has later explained that this is very likely TCP TX zerocopy from
hugetlb pages scenario when the networking code drops a last reference to
hugetlb page while having IRQ disabled. Hugetlb freeing path doesn't
disable IRQ while holding hugetlb_lock so a lock dependency chain can lead
to a deadlock.
This commit addresses the issue by doing the following:
- Make hugetlb_lock irq safe. This is mostly a simple process of
changing spin_*lock calls to spin_*lock_irq* calls.
- Make subpool lock irq safe in a similar manner.
- Revert the !in_task check and workqueue handoff.
[1] https://lore.kernel.org/linux-mm/000000000000f1c03b05bc43aadc@google.com/
Link: https://lkml.kernel.org/r/20210409205254.242291-8-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Muchun Song <songmuchun@bytedance.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Miaohe Lin <linmiaohe@huawei.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 169 +++++++++++++++---------------------------
mm/hugetlb_cgroup.c | 8 -
2 files changed, 67 insertions(+), 110 deletions(-)
--- a/mm/hugetlb.c~hugetlb-make-free_huge_page-irq-safe
+++ a/mm/hugetlb.c
@@ -94,9 +94,10 @@ static inline bool subpool_is_free(struc
return true;
}
-static inline void unlock_or_release_subpool(struct hugepage_subpool *spool)
+static inline void unlock_or_release_subpool(struct hugepage_subpool *spool,
+ unsigned long irq_flags)
{
- spin_unlock(&spool->lock);
+ spin_unlock_irqrestore(&spool->lock, irq_flags);
/* If no pages are used, and no other handles to the subpool
* remain, give up any reservations based on minimum size and
@@ -135,10 +136,12 @@ struct hugepage_subpool *hugepage_new_su
void hugepage_put_subpool(struct hugepage_subpool *spool)
{
- spin_lock(&spool->lock);
+ unsigned long flags;
+
+ spin_lock_irqsave(&spool->lock, flags);
BUG_ON(!spool->count);
spool->count--;
- unlock_or_release_subpool(spool);
+ unlock_or_release_subpool(spool, flags);
}
/*
@@ -157,7 +160,7 @@ static long hugepage_subpool_get_pages(s
if (!spool)
return ret;
- spin_lock(&spool->lock);
+ spin_lock_irq(&spool->lock);
if (spool->max_hpages != -1) { /* maximum size accounting */
if ((spool->used_hpages + delta) <= spool->max_hpages)
@@ -184,7 +187,7 @@ static long hugepage_subpool_get_pages(s
}
unlock_ret:
- spin_unlock(&spool->lock);
+ spin_unlock_irq(&spool->lock);
return ret;
}
@@ -198,11 +201,12 @@ static long hugepage_subpool_put_pages(s
long delta)
{
long ret = delta;
+ unsigned long flags;
if (!spool)
return delta;
- spin_lock(&spool->lock);
+ spin_lock_irqsave(&spool->lock, flags);
if (spool->max_hpages != -1) /* maximum size accounting */
spool->used_hpages -= delta;
@@ -223,7 +227,7 @@ static long hugepage_subpool_put_pages(s
* If hugetlbfs_put_super couldn't free spool due to an outstanding
* quota reference, free it now.
*/
- unlock_or_release_subpool(spool);
+ unlock_or_release_subpool(spool, flags);
return ret;
}
@@ -1412,7 +1416,7 @@ struct hstate *size_to_hstate(unsigned l
return NULL;
}
-static void __free_huge_page(struct page *page)
+void free_huge_page(struct page *page)
{
/*
* Can't pass hstate in here because it is called from the
@@ -1422,6 +1426,7 @@ static void __free_huge_page(struct page
int nid = page_to_nid(page);
struct hugepage_subpool *spool = hugetlb_page_subpool(page);
bool restore_reserve;
+ unsigned long flags;
VM_BUG_ON_PAGE(page_count(page), page);
VM_BUG_ON_PAGE(page_mapcount(page), page);
@@ -1450,7 +1455,7 @@ static void __free_huge_page(struct page
restore_reserve = true;
}
- spin_lock(&hugetlb_lock);
+ spin_lock_irqsave(&hugetlb_lock, flags);
ClearHPageMigratable(page);
hugetlb_cgroup_uncharge_page(hstate_index(h),
pages_per_huge_page(h), page);
@@ -1461,66 +1466,18 @@ static void __free_huge_page(struct page
if (HPageTemporary(page)) {
remove_hugetlb_page(h, page, false);
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irqrestore(&hugetlb_lock, flags);
update_and_free_page(h, page);
} else if (h->surplus_huge_pages_node[nid]) {
/* remove the page from active list */
remove_hugetlb_page(h, page, true);
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irqrestore(&hugetlb_lock, flags);
update_and_free_page(h, page);
} else {
arch_clear_hugepage_flags(page);
enqueue_huge_page(h, page);
- spin_unlock(&hugetlb_lock);
- }
-}
-
-/*
- * As free_huge_page() can be called from a non-task context, we have
- * to defer the actual freeing in a workqueue to prevent potential
- * hugetlb_lock deadlock.
- *
- * free_hpage_workfn() locklessly retrieves the linked list of pages to
- * be freed and frees them one-by-one. As the page->mapping pointer is
- * going to be cleared in __free_huge_page() anyway, it is reused as the
- * llist_node structure of a lockless linked list of huge pages to be freed.
- */
-static LLIST_HEAD(hpage_freelist);
-
-static void free_hpage_workfn(struct work_struct *work)
-{
- struct llist_node *node;
- struct page *page;
-
- node = llist_del_all(&hpage_freelist);
-
- while (node) {
- page = container_of((struct address_space **)node,
- struct page, mapping);
- node = node->next;
- __free_huge_page(page);
- }
-}
-static DECLARE_WORK(free_hpage_work, free_hpage_workfn);
-
-void free_huge_page(struct page *page)
-{
- /*
- * Defer freeing if in non-task context to avoid hugetlb_lock deadlock.
- */
- if (!in_task()) {
- /*
- * Only call schedule_work() if hpage_freelist is previously
- * empty. Otherwise, schedule_work() had been called but the
- * workfn hasn't retrieved the list yet.
- */
- if (llist_add((struct llist_node *)&page->mapping,
- &hpage_freelist))
- schedule_work(&free_hpage_work);
- return;
+ spin_unlock_irqrestore(&hugetlb_lock, flags);
}
-
- __free_huge_page(page);
}
static void prep_new_huge_page(struct hstate *h, struct page *page, int nid)
@@ -1530,11 +1487,11 @@ static void prep_new_huge_page(struct hs
hugetlb_set_page_subpool(page, NULL);
set_hugetlb_cgroup(page, NULL);
set_hugetlb_cgroup_rsvd(page, NULL);
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
h->nr_huge_pages++;
h->nr_huge_pages_node[nid]++;
ClearHPageFreed(page);
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
}
static void prep_compound_gigantic_page(struct page *page, unsigned int order)
@@ -1780,7 +1737,7 @@ retry:
if (!PageHuge(page))
return 0;
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
if (!PageHuge(page)) {
rc = 0;
goto out;
@@ -1797,7 +1754,7 @@ retry:
* when it is dissolved.
*/
if (unlikely(!HPageFreed(head))) {
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
cond_resched();
/*
@@ -1821,12 +1778,12 @@ retry:
}
remove_hugetlb_page(h, page, false);
h->max_huge_pages--;
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
update_and_free_page(h, head);
return 0;
}
out:
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
return rc;
}
@@ -1868,16 +1825,16 @@ static struct page *alloc_surplus_huge_p
if (hstate_is_gigantic(h))
return NULL;
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
if (h->surplus_huge_pages >= h->nr_overcommit_huge_pages)
goto out_unlock;
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
page = alloc_fresh_huge_page(h, gfp_mask, nid, nmask, NULL);
if (!page)
return NULL;
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
/*
* We could have raced with the pool size change.
* Double check that and simply deallocate the new page
@@ -1887,7 +1844,7 @@ static struct page *alloc_surplus_huge_p
*/
if (h->surplus_huge_pages >= h->nr_overcommit_huge_pages) {
SetHPageTemporary(page);
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
put_page(page);
return NULL;
} else {
@@ -1896,7 +1853,7 @@ static struct page *alloc_surplus_huge_p
}
out_unlock:
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
return page;
}
@@ -1946,17 +1903,17 @@ struct page *alloc_buddy_huge_page_with_
struct page *alloc_huge_page_nodemask(struct hstate *h, int preferred_nid,
nodemask_t *nmask, gfp_t gfp_mask)
{
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
if (h->free_huge_pages - h->resv_huge_pages > 0) {
struct page *page;
page = dequeue_huge_page_nodemask(h, gfp_mask, preferred_nid, nmask);
if (page) {
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
return page;
}
}
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
return alloc_migrate_huge_page(h, gfp_mask, preferred_nid, nmask);
}
@@ -2004,7 +1961,7 @@ static int gather_surplus_pages(struct h
ret = -ENOMEM;
retry:
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
for (i = 0; i < needed; i++) {
page = alloc_surplus_huge_page(h, htlb_alloc_mask(h),
NUMA_NO_NODE, NULL);
@@ -2021,7 +1978,7 @@ retry:
* After retaking hugetlb_lock, we need to recalculate 'needed'
* because either resv_huge_pages or free_huge_pages may have changed.
*/
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
needed = (h->resv_huge_pages + delta) -
(h->free_huge_pages + allocated);
if (needed > 0) {
@@ -2061,12 +2018,12 @@ retry:
enqueue_huge_page(h, page);
}
free:
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
/* Free unnecessary surplus pages to the buddy allocator */
list_for_each_entry_safe(page, tmp, &surplus_list, lru)
put_page(page);
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
return ret;
}
@@ -2116,9 +2073,9 @@ static void return_unused_surplus_pages(
}
out:
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
update_and_free_pages_bulk(h, &page_list);
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
}
@@ -2352,7 +2309,7 @@ struct page *alloc_huge_page(struct vm_a
if (ret)
goto out_uncharge_cgroup_reservation;
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
/*
* glb_chg is passed to indicate whether or not a page must be taken
* from the global free pool (global change). gbl_chg == 0 indicates
@@ -2360,7 +2317,7 @@ struct page *alloc_huge_page(struct vm_a
*/
page = dequeue_huge_page_vma(h, vma, addr, avoid_reserve, gbl_chg);
if (!page) {
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
page = alloc_buddy_huge_page_with_mpol(h, vma, addr);
if (!page)
goto out_uncharge_cgroup;
@@ -2368,7 +2325,7 @@ struct page *alloc_huge_page(struct vm_a
SetHPageRestoreReserve(page);
h->resv_huge_pages--;
}
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
list_add(&page->lru, &h->hugepage_activelist);
/* Fall through */
}
@@ -2381,7 +2338,7 @@ struct page *alloc_huge_page(struct vm_a
h_cg, page);
}
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
hugetlb_set_page_subpool(page, spool);
@@ -2593,9 +2550,9 @@ static void try_to_free_low(struct hstat
}
out:
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
update_and_free_pages_bulk(h, &page_list);
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
}
#else
static inline void try_to_free_low(struct hstate *h, unsigned long count,
@@ -2660,7 +2617,7 @@ static int set_max_huge_pages(struct hst
* pages in hstate via the proc/sysfs interfaces.
*/
mutex_lock(&h->resize_lock);
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
/*
* Check for a node specific request.
@@ -2691,7 +2648,7 @@ static int set_max_huge_pages(struct hst
*/
if (hstate_is_gigantic(h) && !IS_ENABLED(CONFIG_CONTIG_ALLOC)) {
if (count > persistent_huge_pages(h)) {
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
mutex_unlock(&h->resize_lock);
NODEMASK_FREE(node_alloc_noretry);
return -EINVAL;
@@ -2721,14 +2678,14 @@ static int set_max_huge_pages(struct hst
* page, free_huge_page will handle it by freeing the page
* and reducing the surplus.
*/
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
/* yield cpu to avoid soft lockup */
cond_resched();
ret = alloc_pool_huge_page(h, nodes_allowed,
node_alloc_noretry);
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
if (!ret)
goto out;
@@ -2767,9 +2724,9 @@ static int set_max_huge_pages(struct hst
list_add(&page->lru, &page_list);
}
/* free the pages after dropping lock */
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
update_and_free_pages_bulk(h, &page_list);
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
while (count < persistent_huge_pages(h)) {
if (!adjust_pool_surplus(h, nodes_allowed, 1))
@@ -2777,7 +2734,7 @@ static int set_max_huge_pages(struct hst
}
out:
h->max_huge_pages = persistent_huge_pages(h);
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
mutex_unlock(&h->resize_lock);
NODEMASK_FREE(node_alloc_noretry);
@@ -2933,9 +2890,9 @@ static ssize_t nr_overcommit_hugepages_s
if (err)
return err;
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
h->nr_overcommit_huge_pages = input;
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
return count;
}
@@ -3522,9 +3479,9 @@ int hugetlb_overcommit_handler(struct ct
goto out;
if (write) {
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
h->nr_overcommit_huge_pages = tmp;
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
}
out:
return ret;
@@ -3620,7 +3577,7 @@ static int hugetlb_acct_memory(struct hs
if (!delta)
return 0;
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
/*
* When cpuset is configured, it breaks the strict hugetlb page
* reservation as the accounting is done on a global variable. Such
@@ -3659,7 +3616,7 @@ static int hugetlb_acct_memory(struct hs
return_unused_surplus_pages(h, (unsigned long) -delta);
out:
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
return ret;
}
@@ -5687,7 +5644,7 @@ bool isolate_huge_page(struct page *page
{
bool ret = true;
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
if (!PageHeadHuge(page) ||
!HPageMigratable(page) ||
!get_page_unless_zero(page)) {
@@ -5697,16 +5654,16 @@ bool isolate_huge_page(struct page *page
ClearHPageMigratable(page);
list_move_tail(&page->lru, list);
unlock:
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
return ret;
}
void putback_active_hugepage(struct page *page)
{
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
SetHPageMigratable(page);
list_move_tail(&page->lru, &(page_hstate(page))->hugepage_activelist);
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
put_page(page);
}
@@ -5740,12 +5697,12 @@ void move_hugetlb_state(struct page *old
*/
if (new_nid == old_nid)
return;
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
if (h->surplus_huge_pages_node[old_nid]) {
h->surplus_huge_pages_node[old_nid]--;
h->surplus_huge_pages_node[new_nid]++;
}
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
}
}
--- a/mm/hugetlb_cgroup.c~hugetlb-make-free_huge_page-irq-safe
+++ a/mm/hugetlb_cgroup.c
@@ -204,11 +204,11 @@ static void hugetlb_cgroup_css_offline(s
do {
idx = 0;
for_each_hstate(h) {
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
list_for_each_entry(page, &h->hugepage_activelist, lru)
hugetlb_cgroup_move_parent(idx, h_cg, page);
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
idx++;
}
cond_resched();
@@ -784,7 +784,7 @@ void hugetlb_cgroup_migrate(struct page
if (hugetlb_cgroup_disabled())
return;
- spin_lock(&hugetlb_lock);
+ spin_lock_irq(&hugetlb_lock);
h_cg = hugetlb_cgroup_from_page(oldhpage);
h_cg_rsvd = hugetlb_cgroup_from_page_rsvd(oldhpage);
set_hugetlb_cgroup(oldhpage, NULL);
@@ -794,7 +794,7 @@ void hugetlb_cgroup_migrate(struct page
set_hugetlb_cgroup(newhpage, h_cg);
set_hugetlb_cgroup_rsvd(newhpage, h_cg_rsvd);
list_move(&newhpage->lru, &h->hugepage_activelist);
- spin_unlock(&hugetlb_lock);
+ spin_unlock_irq(&hugetlb_lock);
return;
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 046/143] hugetlb: add lockdep_assert_held() calls for hugetlb_lock
2021-05-05 1:32 incoming Andrew Morton
` (44 preceding siblings ...)
2021-05-05 1:35 ` [patch 045/143] hugetlb: make free_huge_page irq safe Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:35 ` [patch 047/143] mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range Andrew Morton
` (94 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: akpm, almasrymina, aneesh.kumar, david, guro, hdanton,
iamjoonsoo.kim, linmiaohe, linux-mm, longman, mhocko,
mike.kravetz, mm-commits, naoya.horiguchi, osalvador, peterx,
peterz, rientjes, shakeelb, song.bao.hua, songmuchun, torvalds,
will, willy
From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: hugetlb: add lockdep_assert_held() calls for hugetlb_lock
After making hugetlb lock irq safe and separating some functionality done
under the lock, add some lockdep_assert_held to help verify locking.
Link: https://lkml.kernel.org/r/20210409205254.242291-9-mike.kravetz@oracle.com
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Muchun Song <songmuchun@bytedance.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Cc: "Aneesh Kumar K . V" <aneesh.kumar@linux.ibm.com>
Cc: Barry Song <song.bao.hua@hisilicon.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: HORIGUCHI NAOYA <naoya.horiguchi@nec.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Waiman Long <longman@redhat.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 9 +++++++++
1 file changed, 9 insertions(+)
--- a/mm/hugetlb.c~hugetlb-add-lockdep_assert_held-calls-for-hugetlb_lock
+++ a/mm/hugetlb.c
@@ -1069,6 +1069,8 @@ static bool vma_has_reserves(struct vm_a
static void enqueue_huge_page(struct hstate *h, struct page *page)
{
int nid = page_to_nid(page);
+
+ lockdep_assert_held(&hugetlb_lock);
list_move(&page->lru, &h->hugepage_freelists[nid]);
h->free_huge_pages++;
h->free_huge_pages_node[nid]++;
@@ -1080,6 +1082,7 @@ static struct page *dequeue_huge_page_no
struct page *page;
bool nocma = !!(current->flags & PF_MEMALLOC_NOCMA);
+ lockdep_assert_held(&hugetlb_lock);
list_for_each_entry(page, &h->hugepage_freelists[nid], lru) {
if (nocma && is_migrate_cma_page(page))
continue;
@@ -1351,6 +1354,7 @@ static void remove_hugetlb_page(struct h
VM_BUG_ON_PAGE(hugetlb_cgroup_from_page(page), page);
VM_BUG_ON_PAGE(hugetlb_cgroup_from_page_rsvd(page), page);
+ lockdep_assert_held(&hugetlb_lock);
if (hstate_is_gigantic(h) && !gigantic_page_runtime_supported())
return;
@@ -1701,6 +1705,7 @@ static struct page *remove_pool_huge_pag
int nr_nodes, node;
struct page *page = NULL;
+ lockdep_assert_held(&hugetlb_lock);
for_each_node_mask_to_free(h, nr_nodes, node, nodes_allowed) {
/*
* If we're returning unused surplus pages, only examine
@@ -1950,6 +1955,7 @@ static int gather_surplus_pages(struct h
long needed, allocated;
bool alloc_ok = true;
+ lockdep_assert_held(&hugetlb_lock);
needed = (h->resv_huge_pages + delta) - h->free_huge_pages;
if (needed <= 0) {
h->resv_huge_pages += delta;
@@ -2043,6 +2049,7 @@ static void return_unused_surplus_pages(
struct page *page;
LIST_HEAD(page_list);
+ lockdep_assert_held(&hugetlb_lock);
/* Uncommit the reservation */
h->resv_huge_pages -= unused_resv_pages;
@@ -2530,6 +2537,7 @@ static void try_to_free_low(struct hstat
int i;
LIST_HEAD(page_list);
+ lockdep_assert_held(&hugetlb_lock);
if (hstate_is_gigantic(h))
return;
@@ -2571,6 +2579,7 @@ static int adjust_pool_surplus(struct hs
{
int nr_nodes, node;
+ lockdep_assert_held(&hugetlb_lock);
VM_BUG_ON(delta != -1 && delta != 1);
if (delta < 0) {
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 047/143] mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range
2021-05-05 1:32 incoming Andrew Morton
` (45 preceding siblings ...)
2021-05-05 1:35 ` [patch 046/143] hugetlb: add lockdep_assert_held() calls for hugetlb_lock Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:35 ` [patch 048/143] mm,compaction: let isolate_migratepages_{range,block} return error codes Andrew Morton
` (93 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits,
osalvador, songmuchun, torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range
Patch series "Make alloc_contig_range handle Hugetlb pages", v10.
alloc_contig_range lacks the ability to handle HugeTLB pages. This can be
problematic for some users, e.g: CMA and virtio-mem, where those users
will fail the call if alloc_contig_range ever sees a HugeTLB page, even
when those pages lay in ZONE_MOVABLE and are free. That problem can be
easily solved by replacing the page in the free hugepage pool.
In-use HugeTLB are no exception though, as those can be isolated and
migrated as any other LRU or Movable page.
This patchset aims for improving
alloc_contig_range->isolate_migratepages_block, so HugeTLB pages can be
recognized and handled.
Since we also need to start reporting errors down the chain (e.g: -ENOMEM
due to not be able to allocate a new hugetlb page),
isolate_migratepages_{range,block} interfaces need to change to start
reporting error codes instead of the pfn == 0 vs pfn != 0 scheme it is
using right now. From now on, isolate_migratepages_block will not return
the next pfn to be scanned anymore, but -EINTR, -ENOMEM or 0, so we the
next pfn to be scanned will be recorded in cc->migrate_pfn field (as it is
already done in isolate_migratepages_range()).
Below is an insight from David (thanks), where the problem can clearly be
seen:
"Start a VM with 4G. Hotplug 1G via virtio-mem and online it to
ZONE_MOVABLE. Allocate 512 huge pages.
[root@localhost ~]# cat /proc/meminfo
MemTotal: 5061512 kB
MemFree: 3319396 kB
MemAvailable: 3457144 kB
...
HugePages_Total: 512
HugePages_Free: 512
HugePages_Rsvd: 0
HugePages_Surp: 0
Hugepagesize: 2048 kB
The huge pages get partially allocate from ZONE_MOVABLE. Try unplugging
1G via virtio-mem (remember, all ZONE_MOVABLE). Inside the guest:
[ 180.058992] alloc_contig_range: [1b8000, 1c0000) PFNs busy
[ 180.060531] alloc_contig_range: [1b8000, 1c0000) PFNs busy
[ 180.061972] alloc_contig_range: [1b8000, 1c0000) PFNs busy
[ 180.063413] alloc_contig_range: [1b8000, 1c0000) PFNs busy
[ 180.064838] alloc_contig_range: [1b8000, 1c0000) PFNs busy
[ 180.065848] alloc_contig_range: [1bfc00, 1c0000) PFNs busy
[ 180.066794] alloc_contig_range: [1bfc00, 1c0000) PFNs busy
[ 180.067738] alloc_contig_range: [1bfc00, 1c0000) PFNs busy
[ 180.068669] alloc_contig_range: [1bfc00, 1c0000) PFNs busy
[ 180.069598] alloc_contig_range: [1bfc00, 1c0000) PFNs busy"
And then with this patchset running:
"Same experiment with ZONE_MOVABLE:
a) Free huge pages: all memory can get unplugged again.
b) Allocated/populated but idle huge pages: all memory can get unplugged
again.
c) Allocated/populated but all 512 huge pages are read/written in a
loop: all memory can get unplugged again, but I get a single
[ 121.192345] alloc_contig_range: [180000, 188000) PFNs busy
Most probably because it happened to try migrating a huge page
while it was busy. As virtio-mem retries on ZONE_MOVABLE a couple of
times, it can deal with this temporary failure.
Last but not least, I did something extreme:
# cat /proc/meminfo
MemTotal: 5061568 kB
MemFree: 186560 kB
MemAvailable: 354524 kB
...
HugePages_Total: 2048
HugePages_Free: 2048
HugePages_Rsvd: 0
HugePages_Surp: 0
Triggering unplug would require to dissolve+alloc - which now fails
when trying to allocate an additional ~512 huge pages (1G).
As expected, I can properly see memory unplug not fully succeeding. +
I get a fairly continuous stream of
[ 226.611584] alloc_contig_range: [19f400, 19f800) PFNs busy
...
But more importantly, the hugepage count remains stable, as configured
by the admin (me):
HugePages_Total: 2048
HugePages_Free: 2048
HugePages_Rsvd: 0
HugePages_Surp: 0"
This patch (of 7):
Currently, __alloc_contig_migrate_range can generate -EINTR, -ENOMEM or
-EBUSY, and report them down the chain. The problem is that when
migrate_pages() reports -ENOMEM, we keep going till we exhaust all the
try-attempts (5 at the moment) instead of bailing out.
migrate_pages() bails out right away on -ENOMEM because it is considered a
fatal error. Do the same here instead of keep going and retrying. Note
that this is not fixing a real issue, just a cosmetic change. Although we
can save some cycles by backing off ealier
Link: https://lkml.kernel.org/r/20210419075413.1064-1-osalvador@suse.de
Link: https://lkml.kernel.org/r/20210419075413.1064-2-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Acked-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_alloc.c | 9 ++++++++-
1 file changed, 8 insertions(+), 1 deletion(-)
--- a/mm/page_alloc.c~mmpage_alloc-bail-out-earlier-on-enomem-in-alloc_contig_migrate_range
+++ a/mm/page_alloc.c
@@ -8696,7 +8696,7 @@ static int __alloc_contig_migrate_range(
}
tries = 0;
} else if (++tries == 5) {
- ret = ret < 0 ? ret : -EBUSY;
+ ret = -EBUSY;
break;
}
@@ -8706,6 +8706,13 @@ static int __alloc_contig_migrate_range(
ret = migrate_pages(&cc->migratepages, alloc_migration_target,
NULL, (unsigned long)&mtc, cc->mode, MR_CONTIG_RANGE);
+
+ /*
+ * On -ENOMEM, migrate_pages() bails out right away. It is pointless
+ * to retry again over this error, so do the same here.
+ */
+ if (ret == -ENOMEM)
+ break;
}
if (ret < 0) {
alloc_contig_dump_pages(&cc->migratepages);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 048/143] mm,compaction: let isolate_migratepages_{range,block} return error codes
2021-05-05 1:32 incoming Andrew Morton
` (46 preceding siblings ...)
2021-05-05 1:35 ` [patch 047/143] mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:35 ` [patch 049/143] mm,hugetlb: drop clearing of flag from prep_new_huge_page Andrew Morton
` (92 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits,
osalvador, songmuchun, torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,compaction: let isolate_migratepages_{range,block} return error codes
Currently, isolate_migratepages_{range,block} and their callers use a pfn
== 0 vs pfn != 0 scheme to let the caller know whether there was any error
during isolation.
This does not work as soon as we need to start reporting different error
codes and make sure we pass them down the chain, so they are properly
interpreted by functions like e.g: alloc_contig_range.
Let us rework isolate_migratepages_{range,block} so we can report error
codes. Since isolate_migratepages_block will stop returning the next pfn
to be scanned, we reuse the cc->migrate_pfn field to keep track of that.
Link: https://lkml.kernel.org/r/20210419075413.1064-3-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/compaction.c | 52 ++++++++++++++++++++++------------------------
mm/internal.h | 10 +++++++-
mm/page_alloc.c | 7 ++----
3 files changed, 36 insertions(+), 33 deletions(-)
--- a/mm/compaction.c~mmcompaction-let-isolate_migratepages_rangeblock-return-error-codes
+++ a/mm/compaction.c
@@ -787,15 +787,14 @@ static bool too_many_isolated(pg_data_t
*
* Isolate all pages that can be migrated from the range specified by
* [low_pfn, end_pfn). The range is expected to be within same pageblock.
- * Returns zero if there is a fatal signal pending, otherwise PFN of the
- * first page that was not scanned (which may be both less, equal to or more
- * than end_pfn).
+ * Returns errno, like -EAGAIN or -EINTR in case e.g signal pending or congestion,
+ * or 0.
+ * cc->migrate_pfn will contain the next pfn to scan.
*
* The pages are isolated on cc->migratepages list (not required to be empty),
- * and cc->nr_migratepages is updated accordingly. The cc->migrate_pfn field
- * is neither read nor updated.
+ * and cc->nr_migratepages is updated accordingly.
*/
-static unsigned long
+static int
isolate_migratepages_block(struct compact_control *cc, unsigned long low_pfn,
unsigned long end_pfn, isolate_mode_t isolate_mode)
{
@@ -809,6 +808,9 @@ isolate_migratepages_block(struct compac
bool skip_on_failure = false;
unsigned long next_skip_pfn = 0;
bool skip_updated = false;
+ int ret = 0;
+
+ cc->migrate_pfn = low_pfn;
/*
* Ensure that there are not too many pages isolated from the LRU
@@ -818,16 +820,16 @@ isolate_migratepages_block(struct compac
while (unlikely(too_many_isolated(pgdat))) {
/* stop isolation if there are still pages not migrated */
if (cc->nr_migratepages)
- return 0;
+ return -EAGAIN;
/* async migration should just abort */
if (cc->mode == MIGRATE_ASYNC)
- return 0;
+ return -EAGAIN;
congestion_wait(BLK_RW_ASYNC, HZ/10);
if (fatal_signal_pending(current))
- return 0;
+ return -EINTR;
}
cond_resched();
@@ -875,8 +877,8 @@ isolate_migratepages_block(struct compac
if (fatal_signal_pending(current)) {
cc->contended = true;
+ ret = -EINTR;
- low_pfn = 0;
goto fatal_pending;
}
@@ -1130,7 +1132,9 @@ fatal_pending:
if (nr_isolated)
count_compact_events(COMPACTISOLATED, nr_isolated);
- return low_pfn;
+ cc->migrate_pfn = low_pfn;
+
+ return ret;
}
/**
@@ -1139,15 +1143,14 @@ fatal_pending:
* @start_pfn: The first PFN to start isolating.
* @end_pfn: The one-past-last PFN.
*
- * Returns zero if isolation fails fatally due to e.g. pending signal.
- * Otherwise, function returns one-past-the-last PFN of isolated page
- * (which may be greater than end_pfn if end fell in a middle of a THP page).
+ * Returns -EAGAIN when contented, -EINTR in case of a signal pending or 0.
*/
-unsigned long
+int
isolate_migratepages_range(struct compact_control *cc, unsigned long start_pfn,
unsigned long end_pfn)
{
unsigned long pfn, block_start_pfn, block_end_pfn;
+ int ret = 0;
/* Scan block by block. First and last block may be incomplete */
pfn = start_pfn;
@@ -1166,17 +1169,17 @@ isolate_migratepages_range(struct compac
block_end_pfn, cc->zone))
continue;
- pfn = isolate_migratepages_block(cc, pfn, block_end_pfn,
- ISOLATE_UNEVICTABLE);
+ ret = isolate_migratepages_block(cc, pfn, block_end_pfn,
+ ISOLATE_UNEVICTABLE);
- if (!pfn)
+ if (ret)
break;
if (cc->nr_migratepages >= COMPACT_CLUSTER_MAX)
break;
}
- return pfn;
+ return ret;
}
#endif /* CONFIG_COMPACTION || CONFIG_CMA */
@@ -1847,7 +1850,7 @@ static isolate_migrate_t isolate_migrate
*/
for (; block_end_pfn <= cc->free_pfn;
fast_find_block = false,
- low_pfn = block_end_pfn,
+ cc->migrate_pfn = low_pfn = block_end_pfn,
block_start_pfn = block_end_pfn,
block_end_pfn += pageblock_nr_pages) {
@@ -1889,10 +1892,8 @@ static isolate_migrate_t isolate_migrate
}
/* Perform the isolation */
- low_pfn = isolate_migratepages_block(cc, low_pfn,
- block_end_pfn, isolate_mode);
-
- if (!low_pfn)
+ if (isolate_migratepages_block(cc, low_pfn, block_end_pfn,
+ isolate_mode))
return ISOLATE_ABORT;
/*
@@ -1903,9 +1904,6 @@ static isolate_migrate_t isolate_migrate
break;
}
- /* Record where migration scanner will be restarted. */
- cc->migrate_pfn = low_pfn;
-
return cc->nr_migratepages ? ISOLATE_SUCCESS : ISOLATE_NONE;
}
--- a/mm/internal.h~mmcompaction-let-isolate_migratepages_rangeblock-return-error-codes
+++ a/mm/internal.h
@@ -244,7 +244,13 @@ struct compact_control {
unsigned int nr_freepages; /* Number of isolated free pages */
unsigned int nr_migratepages; /* Number of pages to migrate */
unsigned long free_pfn; /* isolate_freepages search base */
- unsigned long migrate_pfn; /* isolate_migratepages search base */
+ /*
+ * Acts as an in/out parameter to page isolation for migration.
+ * isolate_migratepages uses it as a search base.
+ * isolate_migratepages_block will update the value to the next pfn
+ * after the last isolated one.
+ */
+ unsigned long migrate_pfn;
unsigned long fast_start_pfn; /* a pfn to start linear scan from */
struct zone *zone;
unsigned long total_migrate_scanned;
@@ -280,7 +286,7 @@ struct capture_control {
unsigned long
isolate_freepages_range(struct compact_control *cc,
unsigned long start_pfn, unsigned long end_pfn);
-unsigned long
+int
isolate_migratepages_range(struct compact_control *cc,
unsigned long low_pfn, unsigned long end_pfn);
int find_suitable_fallback(struct free_area *area, unsigned int order,
--- a/mm/page_alloc.c~mmcompaction-let-isolate_migratepages_rangeblock-return-error-codes
+++ a/mm/page_alloc.c
@@ -8689,11 +8689,10 @@ static int __alloc_contig_migrate_range(
if (list_empty(&cc->migratepages)) {
cc->nr_migratepages = 0;
- pfn = isolate_migratepages_range(cc, pfn, end);
- if (!pfn) {
- ret = -EINTR;
+ ret = isolate_migratepages_range(cc, pfn, end);
+ if (ret && ret != -EAGAIN)
break;
- }
+ pfn = cc->migrate_pfn;
tries = 0;
} else if (++tries == 5) {
ret = -EBUSY;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 049/143] mm,hugetlb: drop clearing of flag from prep_new_huge_page
2021-05-05 1:32 incoming Andrew Morton
` (47 preceding siblings ...)
2021-05-05 1:35 ` [patch 048/143] mm,compaction: let isolate_migratepages_{range,block} return error codes Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:35 ` [patch 050/143] mm,hugetlb: split prep_new_huge_page functionality Andrew Morton
` (91 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits,
osalvador, songmuchun, torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,hugetlb: drop clearing of flag from prep_new_huge_page
Pages allocated via the page allocator or CMA get its private field
cleared by means of post_alloc_hook().
Pages allocated during boot, that is directly from the memblock allocator,
get cleared by
paging_init()->..->memmap_init_zone->..->__init_single_page() before any
memblock allocation.
Based on this ground, let us remove the clearing of the flag from
prep_new_huge_page() as it is not needed. This was a leftover from
6c0371490140 ("hugetlb: convert PageHugeFreed to HPageFreed flag").
Previously the explicit clearing was necessary because compound
allocations do not get this initialization (see prep_compound_page).
Link: https://lkml.kernel.org/r/20210419075413.1064-4-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 1 -
1 file changed, 1 deletion(-)
--- a/mm/hugetlb.c~mmhugetlb-drop-clearing-of-flag-from-prep_new_huge_page
+++ a/mm/hugetlb.c
@@ -1494,7 +1494,6 @@ static void prep_new_huge_page(struct hs
spin_lock_irq(&hugetlb_lock);
h->nr_huge_pages++;
h->nr_huge_pages_node[nid]++;
- ClearHPageFreed(page);
spin_unlock_irq(&hugetlb_lock);
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 050/143] mm,hugetlb: split prep_new_huge_page functionality
2021-05-05 1:32 incoming Andrew Morton
` (48 preceding siblings ...)
2021-05-05 1:35 ` [patch 049/143] mm,hugetlb: drop clearing of flag from prep_new_huge_page Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:35 ` [patch 051/143] mm: make alloc_contig_range handle free hugetlb pages Andrew Morton
` (90 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits,
osalvador, songmuchun, torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,hugetlb: split prep_new_huge_page functionality
Currently, prep_new_huge_page() performs two functions. It sets the right
state for a new hugetlb, and increases the hstate's counters to account
for the new page.
Let us split its functionality into two separate functions, decoupling the
handling of the counters from initializing a hugepage. The outcome is
having __prep_new_huge_page(), which only initializes the page , and
__prep_account_new_huge_page(), which adds the new page to the hstate's
counters.
This allows us to be able to set a hugetlb without having to worry about
the counter/locking. It will prove useful in the next patch.
prep_new_huge_page() still calls both functions.
Link: https://lkml.kernel.org/r/20210419075413.1064-5-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 20 +++++++++++++++++---
1 file changed, 17 insertions(+), 3 deletions(-)
--- a/mm/hugetlb.c~mmhugetlb-split-prep_new_huge_page-functionality
+++ a/mm/hugetlb.c
@@ -1484,16 +1484,30 @@ void free_huge_page(struct page *page)
}
}
-static void prep_new_huge_page(struct hstate *h, struct page *page, int nid)
+/*
+ * Must be called with the hugetlb lock held
+ */
+static void __prep_account_new_huge_page(struct hstate *h, int nid)
+{
+ lockdep_assert_held(&hugetlb_lock);
+ h->nr_huge_pages++;
+ h->nr_huge_pages_node[nid]++;
+}
+
+static void __prep_new_huge_page(struct page *page)
{
INIT_LIST_HEAD(&page->lru);
set_compound_page_dtor(page, HUGETLB_PAGE_DTOR);
hugetlb_set_page_subpool(page, NULL);
set_hugetlb_cgroup(page, NULL);
set_hugetlb_cgroup_rsvd(page, NULL);
+}
+
+static void prep_new_huge_page(struct hstate *h, struct page *page, int nid)
+{
+ __prep_new_huge_page(page);
spin_lock_irq(&hugetlb_lock);
- h->nr_huge_pages++;
- h->nr_huge_pages_node[nid]++;
+ __prep_account_new_huge_page(h, nid);
spin_unlock_irq(&hugetlb_lock);
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 051/143] mm: make alloc_contig_range handle free hugetlb pages
2021-05-05 1:32 incoming Andrew Morton
` (49 preceding siblings ...)
2021-05-05 1:35 ` [patch 050/143] mm,hugetlb: split prep_new_huge_page functionality Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:35 ` [patch 052/143] mm: make alloc_contig_range handle in-use " Andrew Morton
` (89 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits,
osalvador, songmuchun, torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: mm: make alloc_contig_range handle free hugetlb pages
alloc_contig_range will fail if it ever sees a HugeTLB page within the
range we are trying to allocate, even when that page is free and can be
easily reallocated.
This has proved to be problematic for some users of alloc_contic_range,
e.g: CMA and virtio-mem, where those would fail the call even when those
pages lay in ZONE_MOVABLE and are free.
We can do better by trying to replace such page.
Free hugepages are tricky to handle so as to no userspace application
notices disruption, we need to replace the current free hugepage with a
new one.
In order to do that, a new function called alloc_and_dissolve_huge_page is
introduced. This function will first try to get a new fresh hugepage, and
if it succeeds, it will replace the old one in the free hugepage pool.
The free page replacement is done under hugetlb_lock, so no external users
of hugetlb will notice the change. To allocate the new huge page, we use
alloc_buddy_huge_page(), so we do not have to deal with any counters, and
prep_new_huge_page() is not called. This is valulable because in case we
need to free the new page, we only need to call __free_pages().
Once we know that the page to be replaced is a genuine 0-refcounted huge
page, we remove the old page from the freelist by remove_hugetlb_page().
Then, we can call __prep_new_huge_page() and
__prep_account_new_huge_page() for the new huge page to properly
initialize it and increment the hstate->nr_huge_pages counter (previously
decremented by remove_hugetlb_page()). Once done, the page is enqueued by
enqueue_huge_page() and it is ready to be used.
There is one tricky case when page's refcount is 0 because it is in the
process of being released. A missing PageHugeFreed bit will tell us that
freeing is in flight so we retry after dropping the hugetlb_lock. The
race window should be small and the next retry should make a forward
progress.
E.g:
CPU0 CPU1
free_huge_page() isolate_or_dissolve_huge_page
PageHuge() == T
alloc_and_dissolve_huge_page
alloc_buddy_huge_page()
spin_lock_irq(hugetlb_lock)
// PageHuge() && !PageHugeFreed &&
// !PageCount()
spin_unlock_irq(hugetlb_lock)
spin_lock_irq(hugetlb_lock)
1) update_and_free_page
PageHuge() == F
__free_pages()
2) enqueue_huge_page
SetPageHugeFreed()
spin_unlock_irq(&hugetlb_lock)
spin_lock_irq(hugetlb_lock)
1) PageHuge() == F (freed by case#1 from CPU0)
2) PageHuge() == T
PageHugeFreed() == T
- proceed with replacing the page
In the case above we retry as the window race is quite small and we have
high chances to succeed next time.
With regard to the allocation, we restrict it to the node the page belongs
to with __GFP_THISNODE, meaning we do not fallback on other node's zones.
Note that gigantic hugetlb pages are fenced off since there is a cyclic
dependency between them and alloc_contig_range.
Link: https://lkml.kernel.org/r/20210419075413.1064-6-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Michal Hocko <mhocko@suse.com>
Acked-by: David Hildenbrand <david@redhat.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/hugetlb.h | 6 +
mm/compaction.c | 33 +++++++++-
mm/hugetlb.c | 116 ++++++++++++++++++++++++++++++++++++++
3 files changed, 152 insertions(+), 3 deletions(-)
--- a/include/linux/hugetlb.h~mm-make-alloc_contig_range-handle-free-hugetlb-pages
+++ a/include/linux/hugetlb.h
@@ -588,6 +588,7 @@ struct huge_bootmem_page {
struct hstate *hstate;
};
+int isolate_or_dissolve_huge_page(struct page *page);
struct page *alloc_huge_page(struct vm_area_struct *vma,
unsigned long addr, int avoid_reserve);
struct page *alloc_huge_page_nodemask(struct hstate *h, int preferred_nid,
@@ -870,6 +871,11 @@ static inline void huge_ptep_modify_prot
#else /* CONFIG_HUGETLB_PAGE */
struct hstate {};
+static inline int isolate_or_dissolve_huge_page(struct page *page)
+{
+ return -ENOMEM;
+}
+
static inline struct page *alloc_huge_page(struct vm_area_struct *vma,
unsigned long addr,
int avoid_reserve)
--- a/mm/compaction.c~mm-make-alloc_contig_range-handle-free-hugetlb-pages
+++ a/mm/compaction.c
@@ -788,7 +788,7 @@ static bool too_many_isolated(pg_data_t
* Isolate all pages that can be migrated from the range specified by
* [low_pfn, end_pfn). The range is expected to be within same pageblock.
* Returns errno, like -EAGAIN or -EINTR in case e.g signal pending or congestion,
- * or 0.
+ * -ENOMEM in case we could not allocate a page, or 0.
* cc->migrate_pfn will contain the next pfn to scan.
*
* The pages are isolated on cc->migratepages list (not required to be empty),
@@ -906,6 +906,29 @@ isolate_migratepages_block(struct compac
valid_page = page;
}
+ if (PageHuge(page) && cc->alloc_contig) {
+ ret = isolate_or_dissolve_huge_page(page);
+
+ /*
+ * Fail isolation in case isolate_or_dissolve_huge_page()
+ * reports an error. In case of -ENOMEM, abort right away.
+ */
+ if (ret < 0) {
+ /* Do not report -EBUSY down the chain */
+ if (ret == -EBUSY)
+ ret = 0;
+ low_pfn += (1UL << compound_order(page)) - 1;
+ goto isolate_fail;
+ }
+
+ /*
+ * Ok, the hugepage was dissolved. Now these pages are
+ * Buddy and cannot be re-allocated because they are
+ * isolated. Fall-through as the check below handles
+ * Buddy pages.
+ */
+ }
+
/*
* Skip if free. We read page order here without zone lock
* which is generally unsafe, but the race window is small and
@@ -1065,7 +1088,7 @@ isolate_fail_put:
put_page(page);
isolate_fail:
- if (!skip_on_failure)
+ if (!skip_on_failure && ret != -ENOMEM)
continue;
/*
@@ -1091,6 +1114,9 @@ isolate_fail:
*/
next_skip_pfn += 1UL << cc->order;
}
+
+ if (ret == -ENOMEM)
+ break;
}
/*
@@ -1143,7 +1169,8 @@ fatal_pending:
* @start_pfn: The first PFN to start isolating.
* @end_pfn: The one-past-last PFN.
*
- * Returns -EAGAIN when contented, -EINTR in case of a signal pending or 0.
+ * Returns -EAGAIN when contented, -EINTR in case of a signal pending, -ENOMEM
+ * in case we could not allocate a page, or 0.
*/
int
isolate_migratepages_range(struct compact_control *cc, unsigned long start_pfn,
--- a/mm/hugetlb.c~mm-make-alloc_contig_range-handle-free-hugetlb-pages
+++ a/mm/hugetlb.c
@@ -2267,6 +2267,122 @@ static void restore_reserve_on_error(str
}
}
+/*
+ * alloc_and_dissolve_huge_page - Allocate a new page and dissolve the old one
+ * @h: struct hstate old page belongs to
+ * @old_page: Old page to dissolve
+ * Returns 0 on success, otherwise negated error.
+ */
+static int alloc_and_dissolve_huge_page(struct hstate *h, struct page *old_page)
+{
+ gfp_t gfp_mask = htlb_alloc_mask(h) | __GFP_THISNODE;
+ int nid = page_to_nid(old_page);
+ struct page *new_page;
+ int ret = 0;
+
+ /*
+ * Before dissolving the page, we need to allocate a new one for the
+ * pool to remain stable. Using alloc_buddy_huge_page() allows us to
+ * not having to deal with prep_new_huge_page() and avoids dealing of any
+ * counters. This simplifies and let us do the whole thing under the
+ * lock.
+ */
+ new_page = alloc_buddy_huge_page(h, gfp_mask, nid, NULL, NULL);
+ if (!new_page)
+ return -ENOMEM;
+
+retry:
+ spin_lock_irq(&hugetlb_lock);
+ if (!PageHuge(old_page)) {
+ /*
+ * Freed from under us. Drop new_page too.
+ */
+ goto free_new;
+ } else if (page_count(old_page)) {
+ /*
+ * Someone has grabbed the page, fail for now.
+ */
+ ret = -EBUSY;
+ goto free_new;
+ } else if (!HPageFreed(old_page)) {
+ /*
+ * Page's refcount is 0 but it has not been enqueued in the
+ * freelist yet. Race window is small, so we can succeed here if
+ * we retry.
+ */
+ spin_unlock_irq(&hugetlb_lock);
+ cond_resched();
+ goto retry;
+ } else {
+ /*
+ * Ok, old_page is still a genuine free hugepage. Remove it from
+ * the freelist and decrease the counters. These will be
+ * incremented again when calling __prep_account_new_huge_page()
+ * and enqueue_huge_page() for new_page. The counters will remain
+ * stable since this happens under the lock.
+ */
+ remove_hugetlb_page(h, old_page, false);
+
+ /*
+ * new_page needs to be initialized with the standard hugetlb
+ * state. This is normally done by prep_new_huge_page() but
+ * that takes hugetlb_lock which is already held so we need to
+ * open code it here.
+ * Reference count trick is needed because allocator gives us
+ * referenced page but the pool requires pages with 0 refcount.
+ */
+ __prep_new_huge_page(new_page);
+ __prep_account_new_huge_page(h, nid);
+ page_ref_dec(new_page);
+ enqueue_huge_page(h, new_page);
+
+ /*
+ * Pages have been replaced, we can safely free the old one.
+ */
+ spin_unlock_irq(&hugetlb_lock);
+ update_and_free_page(h, old_page);
+ }
+
+ return ret;
+
+free_new:
+ spin_unlock_irq(&hugetlb_lock);
+ __free_pages(new_page, huge_page_order(h));
+
+ return ret;
+}
+
+int isolate_or_dissolve_huge_page(struct page *page)
+{
+ struct hstate *h;
+ struct page *head;
+
+ /*
+ * The page might have been dissolved from under our feet, so make sure
+ * to carefully check the state under the lock.
+ * Return success when racing as if we dissolved the page ourselves.
+ */
+ spin_lock_irq(&hugetlb_lock);
+ if (PageHuge(page)) {
+ head = compound_head(page);
+ h = page_hstate(head);
+ } else {
+ spin_unlock_irq(&hugetlb_lock);
+ return 0;
+ }
+ spin_unlock_irq(&hugetlb_lock);
+
+ /*
+ * Fence off gigantic pages as there is a cyclic dependency between
+ * alloc_contig_range and them. Return -ENOMEM as this has the effect
+ * of bailing out right away without further retrying.
+ */
+ if (hstate_is_gigantic(h))
+ return -ENOMEM;
+
+ return alloc_and_dissolve_huge_page(h, head);
+}
+
struct page *alloc_huge_page(struct vm_area_struct *vma,
unsigned long addr, int avoid_reserve)
{
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 052/143] mm: make alloc_contig_range handle in-use hugetlb pages
2021-05-05 1:32 incoming Andrew Morton
` (50 preceding siblings ...)
2021-05-05 1:35 ` [patch 051/143] mm: make alloc_contig_range handle free hugetlb pages Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:35 ` [patch 053/143] mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig Andrew Morton
` (88 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits,
osalvador, songmuchun, torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: mm: make alloc_contig_range handle in-use hugetlb pages
alloc_contig_range() will fail if it finds a HugeTLB page within the
range, without a chance to handle them. Since HugeTLB pages can be
migrated as any LRU or Movable page, it does not make sense to bail out
without trying. Enable the interface to recognize in-use HugeTLB pages so
we can migrate them, and have much better chances to succeed the call.
Link: https://lkml.kernel.org/r/20210419075413.1064-7-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Acked-by: David Hildenbrand <david@redhat.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/hugetlb.h | 5 +++--
mm/compaction.c | 12 +++++++++++-
mm/hugetlb.c | 22 +++++++++++++++++-----
mm/vmscan.c | 5 +++--
4 files changed, 34 insertions(+), 10 deletions(-)
--- a/include/linux/hugetlb.h~mm-make-alloc_contig_range-handle-in-use-hugetlb-pages
+++ a/include/linux/hugetlb.h
@@ -588,7 +588,7 @@ struct huge_bootmem_page {
struct hstate *hstate;
};
-int isolate_or_dissolve_huge_page(struct page *page);
+int isolate_or_dissolve_huge_page(struct page *page, struct list_head *list);
struct page *alloc_huge_page(struct vm_area_struct *vma,
unsigned long addr, int avoid_reserve);
struct page *alloc_huge_page_nodemask(struct hstate *h, int preferred_nid,
@@ -871,7 +871,8 @@ static inline void huge_ptep_modify_prot
#else /* CONFIG_HUGETLB_PAGE */
struct hstate {};
-static inline int isolate_or_dissolve_huge_page(struct page *page)
+static inline int isolate_or_dissolve_huge_page(struct page *page,
+ struct list_head *list)
{
return -ENOMEM;
}
--- a/mm/compaction.c~mm-make-alloc_contig_range-handle-in-use-hugetlb-pages
+++ a/mm/compaction.c
@@ -907,7 +907,7 @@ isolate_migratepages_block(struct compac
}
if (PageHuge(page) && cc->alloc_contig) {
- ret = isolate_or_dissolve_huge_page(page);
+ ret = isolate_or_dissolve_huge_page(page, &cc->migratepages);
/*
* Fail isolation in case isolate_or_dissolve_huge_page()
@@ -921,6 +921,15 @@ isolate_migratepages_block(struct compac
goto isolate_fail;
}
+ if (PageHuge(page)) {
+ /*
+ * Hugepage was successfully isolated and placed
+ * on the cc->migratepages list.
+ */
+ low_pfn += compound_nr(page) - 1;
+ goto isolate_success_no_list;
+ }
+
/*
* Ok, the hugepage was dissolved. Now these pages are
* Buddy and cannot be re-allocated because they are
@@ -1062,6 +1071,7 @@ isolate_migratepages_block(struct compac
isolate_success:
list_add(&page->lru, &cc->migratepages);
+isolate_success_no_list:
cc->nr_migratepages += compound_nr(page);
nr_isolated += compound_nr(page);
--- a/mm/hugetlb.c~mm-make-alloc_contig_range-handle-in-use-hugetlb-pages
+++ a/mm/hugetlb.c
@@ -2271,9 +2271,11 @@ static void restore_reserve_on_error(str
* alloc_and_dissolve_huge_page - Allocate a new page and dissolve the old one
* @h: struct hstate old page belongs to
* @old_page: Old page to dissolve
+ * @list: List to isolate the page in case we need to
* Returns 0 on success, otherwise negated error.
*/
-static int alloc_and_dissolve_huge_page(struct hstate *h, struct page *old_page)
+static int alloc_and_dissolve_huge_page(struct hstate *h, struct page *old_page,
+ struct list_head *list)
{
gfp_t gfp_mask = htlb_alloc_mask(h) | __GFP_THISNODE;
int nid = page_to_nid(old_page);
@@ -2300,9 +2302,13 @@ retry:
goto free_new;
} else if (page_count(old_page)) {
/*
- * Someone has grabbed the page, fail for now.
+ * Someone has grabbed the page, try to isolate it here.
+ * Fail with -EBUSY if not possible.
*/
- ret = -EBUSY;
+ spin_unlock_irq(&hugetlb_lock);
+ if (!isolate_huge_page(old_page, list))
+ ret = -EBUSY;
+ spin_lock_irq(&hugetlb_lock);
goto free_new;
} else if (!HPageFreed(old_page)) {
/*
@@ -2352,10 +2358,11 @@ free_new:
return ret;
}
-int isolate_or_dissolve_huge_page(struct page *page)
+int isolate_or_dissolve_huge_page(struct page *page, struct list_head *list)
{
struct hstate *h;
struct page *head;
+ int ret = -EBUSY;
/*
* The page might have been dissolved from under our feet, so make sure
@@ -2380,7 +2387,12 @@ int isolate_or_dissolve_huge_page(struct
if (hstate_is_gigantic(h))
return -ENOMEM;
- return alloc_and_dissolve_huge_page(h, head);
+ if (page_count(head) && isolate_huge_page(head, list))
+ ret = 0;
+ else if (!page_count(head))
+ ret = alloc_and_dissolve_huge_page(h, head, list);
+
+ return ret;
}
struct page *alloc_huge_page(struct vm_area_struct *vma,
--- a/mm/vmscan.c~mm-make-alloc_contig_range-handle-in-use-hugetlb-pages
+++ a/mm/vmscan.c
@@ -1507,8 +1507,9 @@ unsigned int reclaim_clean_pages_from_li
LIST_HEAD(clean_pages);
list_for_each_entry_safe(page, next, page_list, lru) {
- if (page_is_file_lru(page) && !PageDirty(page) &&
- !__PageMovable(page) && !PageUnevictable(page)) {
+ if (!PageHuge(page) && page_is_file_lru(page) &&
+ !PageDirty(page) && !__PageMovable(page) &&
+ !PageUnevictable(page)) {
ClearPageActive(page);
list_move(&page->lru, &clean_pages);
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 053/143] mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig
2021-05-05 1:32 incoming Andrew Morton
` (51 preceding siblings ...)
2021-05-05 1:35 ` [patch 052/143] mm: make alloc_contig_range handle in-use " Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:35 ` [patch 054/143] userfaultfd: add minor fault registration mode Andrew Morton
` (87 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: akpm, david, linux-mm, mhocko, mike.kravetz, mm-commits,
osalvador, songmuchun, torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig
pfn_range_valid_contig() bails out when it finds an in-use page or a
hugetlb page, among other things. We can drop the in-use page check since
__alloc_contig_pages can migrate away those pages, and the hugetlb page
check can go too since isolate_migratepages_range is now capable of
dealing with hugetlb pages. Either way, those checks are racy so let the
end function handle it when the time comes.
Link: https://lkml.kernel.org/r/20210419075413.1064-8-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Suggested-by: David Hildenbrand <david@redhat.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Mike Kravetz <mike.kravetz@oracle.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Muchun Song <songmuchun@bytedance.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_alloc.c | 6 ------
1 file changed, 6 deletions(-)
--- a/mm/page_alloc.c~mmpage_alloc-drop-unnecessary-checks-from-pfn_range_valid_contig
+++ a/mm/page_alloc.c
@@ -8898,12 +8898,6 @@ static bool pfn_range_valid_contig(struc
if (PageReserved(page))
return false;
-
- if (page_count(page) > 0)
- return false;
-
- if (PageHuge(page))
- return false;
}
return true;
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 054/143] userfaultfd: add minor fault registration mode
2021-05-05 1:32 incoming Andrew Morton
` (52 preceding siblings ...)
2021-05-05 1:35 ` [patch 053/143] mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:35 ` [patch 055/143] userfaultfd: disable huge PMD sharing for MINOR registered VMAs Andrew Morton
` (86 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
steven.price, torvalds, vbabka, viro, walken, willy, ying.huang
From: Axel Rasmussen <axelrasmussen@google.com>
Subject: userfaultfd: add minor fault registration mode
Patch series "userfaultfd: add minor fault handling", v9.
Overview
========
This series adds a new userfaultfd feature, UFFD_FEATURE_MINOR_HUGETLBFS.
When enabled (via the UFFDIO_API ioctl), this feature means that any
hugetlbfs VMAs registered with UFFDIO_REGISTER_MODE_MISSING will *also*
get events for "minor" faults. By "minor" fault, I mean the following
situation:
Let there exist two mappings (i.e., VMAs) to the same page(s) (shared
memory). One of the mappings is registered with userfaultfd (in minor
mode), and the other is not. Via the non-UFFD mapping, the underlying
pages have already been allocated & filled with some contents. The UFFD
mapping has not yet been faulted in; when it is touched for the first
time, this results in what I'm calling a "minor" fault. As a concrete
example, when working with hugetlbfs, we have huge_pte_none(), but
find_lock_page() finds an existing page.
We also add a new ioctl to resolve such faults: UFFDIO_CONTINUE. The idea
is, userspace resolves the fault by either a) doing nothing if the
contents are already correct, or b) updating the underlying contents using
the second, non-UFFD mapping (via memcpy/memset or similar, or something
fancier like RDMA, or etc...). In either case, userspace issues
UFFDIO_CONTINUE to tell the kernel "I have ensured the page contents are
correct, carry on setting up the mapping".
Use Case
========
Consider the use case of VM live migration (e.g. under QEMU/KVM):
1. While a VM is still running, we copy the contents of its memory to a
target machine. The pages are populated on the target by writing to the
non-UFFD mapping, using the setup described above. The VM is still running
(and therefore its memory is likely changing), so this may be repeated
several times, until we decide the target is "up to date enough".
2. We pause the VM on the source, and start executing on the target machine.
During this gap, the VM's user(s) will *see* a pause, so it is desirable to
minimize this window.
3. Between the last time any page was copied from the source to the target, and
when the VM was paused, the contents of that page may have changed - and
therefore the copy we have on the target machine is out of date. Although we
can keep track of which pages are out of date, for VMs with large amounts of
memory, it is "slow" to transfer this information to the target machine. We
want to resume execution before such a transfer would complete.
4. So, the guest begins executing on the target machine. The first time it
touches its memory (via the UFFD-registered mapping), userspace wants to
intercept this fault. Userspace checks whether or not the page is up to date,
and if not, copies the updated page from the source machine, via the non-UFFD
mapping. Finally, whether a copy was performed or not, userspace issues a
UFFDIO_CONTINUE ioctl to tell the kernel "I have ensured the page contents
are correct, carry on setting up the mapping".
We don't have to do all of the final updates on-demand. The userfaultfd manager
can, in the background, also copy over updated pages once it receives the map of
which pages are up-to-date or not.
Interaction with Existing APIs
==============================
Because this is a feature, a registered VMA could potentially receive both
missing and minor faults. I spent some time thinking through how the
existing API interacts with the new feature:
UFFDIO_CONTINUE cannot be used to resolve non-minor faults, as it does not
allocate a new page. If UFFDIO_CONTINUE is used on a non-minor fault:
- For non-shared memory or shmem, -EINVAL is returned.
- For hugetlb, -EFAULT is returned.
UFFDIO_COPY and UFFDIO_ZEROPAGE cannot be used to resolve minor faults.
Without modifications, the existing codepath assumes a new page needs to
be allocated. This is okay, since userspace must have a second
non-UFFD-registered mapping anyway, thus there isn't much reason to want
to use these in any case (just memcpy or memset or similar).
- If UFFDIO_COPY is used on a minor fault, -EEXIST is returned.
- If UFFDIO_ZEROPAGE is used on a minor fault, -EEXIST is returned (or -EINVAL
in the case of hugetlb, as UFFDIO_ZEROPAGE is unsupported in any case).
- UFFDIO_WRITEPROTECT simply doesn't work with shared memory, and returns
-ENOENT in that case (regardless of the kind of fault).
Future Work
===========
This series only supports hugetlbfs. I have a second series in flight to
support shmem as well, extending the functionality. This series is more
mature than the shmem support at this point, and the functionality works
fully on hugetlbfs, so this series can be merged first and then shmem
support will follow.
This patch (of 6):
This feature allows userspace to intercept "minor" faults. By "minor"
faults, I mean the following situation:
Let there exist two mappings (i.e., VMAs) to the same page(s). One of the
mappings is registered with userfaultfd (in minor mode), and the other is
not. Via the non-UFFD mapping, the underlying pages have already been
allocated & filled with some contents. The UFFD mapping has not yet been
faulted in; when it is touched for the first time, this results in what
I'm calling a "minor" fault. As a concrete example, when working with
hugetlbfs, we have huge_pte_none(), but find_lock_page() finds an existing
page.
This commit adds the new registration mode, and sets the relevant flag on
the VMAs being registered. In the hugetlb fault path, if we find that we
have huge_pte_none(), but find_lock_page() does indeed find an existing
page, then we have a "minor" fault, and if the VMA has the userfaultfd
registration flag, we call into userfaultfd to handle it.
This is implemented as a new registration mode, instead of an API feature.
This is because the alternative implementation has significant drawbacks
[1].
However, doing it this was requires we allocate a VM_* flag for the new
registration mode. On 32-bit systems, there are no unused bits, so this
feature is only supported on architectures with
CONFIG_ARCH_USES_HIGH_VMA_FLAGS. When attempting to register a VMA in
MINOR mode on 32-bit architectures, we return -EINVAL.
[1] https://lore.kernel.org/patchwork/patch/1380226/
[peterx@redhat.com: fix minor fault page leak]
Link: https://lkml.kernel.org/r/20210322175132.36659-1-peterx@redhat.com
Link: https://lkml.kernel.org/r/20210301222728.176417-1-axelrasmussen@google.com
Link: https://lkml.kernel.org/r/20210301222728.176417-2-axelrasmussen@google.com
Signed-off-by: Axel Rasmussen <axelrasmussen@google.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Steven Price <steven.price@arm.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Axel Rasmussen <axelrasmussen@google.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/arm64/Kconfig | 1
arch/x86/Kconfig | 1
fs/proc/task_mmu.c | 3 +
fs/userfaultfd.c | 78 +++++++++++++++++-----------
include/linux/mm.h | 7 ++
include/linux/userfaultfd_k.h | 15 +++++
include/trace/events/mmflags.h | 7 ++
include/uapi/linux/userfaultfd.h | 15 ++++-
init/Kconfig | 5 +
mm/hugetlb.c | 80 ++++++++++++++++++-----------
10 files changed, 150 insertions(+), 62 deletions(-)
--- a/arch/arm64/Kconfig~userfaultfd-add-minor-fault-registration-mode
+++ a/arch/arm64/Kconfig
@@ -213,6 +213,7 @@ config ARM64
select SWIOTLB
select SYSCTL_EXCEPTION_TRACE
select THREAD_INFO_IN_TASK
+ select HAVE_ARCH_USERFAULTFD_MINOR if USERFAULTFD
help
ARM 64-bit (AArch64) Linux support.
--- a/arch/x86/Kconfig~userfaultfd-add-minor-fault-registration-mode
+++ a/arch/x86/Kconfig
@@ -165,6 +165,7 @@ config X86
select HAVE_ARCH_TRANSPARENT_HUGEPAGE
select HAVE_ARCH_TRANSPARENT_HUGEPAGE_PUD if X86_64
select HAVE_ARCH_USERFAULTFD_WP if X86_64 && USERFAULTFD
+ select HAVE_ARCH_USERFAULTFD_MINOR if X86_64 && USERFAULTFD
select HAVE_ARCH_VMAP_STACK if X86_64
select HAVE_ARCH_RANDOMIZE_KSTACK_OFFSET
select HAVE_ARCH_WITHIN_STACK_FRAMES
--- a/fs/proc/task_mmu.c~userfaultfd-add-minor-fault-registration-mode
+++ a/fs/proc/task_mmu.c
@@ -661,6 +661,9 @@ static void show_smap_vma_flags(struct s
[ilog2(VM_PKEY_BIT4)] = "",
#endif
#endif /* CONFIG_ARCH_HAS_PKEYS */
+#ifdef CONFIG_HAVE_ARCH_USERFAULTFD_MINOR
+ [ilog2(VM_UFFD_MINOR)] = "ui",
+#endif /* CONFIG_HAVE_ARCH_USERFAULTFD_MINOR */
};
size_t i;
--- a/fs/userfaultfd.c~userfaultfd-add-minor-fault-registration-mode
+++ a/fs/userfaultfd.c
@@ -197,24 +197,21 @@ static inline struct uffd_msg userfault_
msg_init(&msg);
msg.event = UFFD_EVENT_PAGEFAULT;
msg.arg.pagefault.address = address;
+ /*
+ * These flags indicate why the userfault occurred:
+ * - UFFD_PAGEFAULT_FLAG_WP indicates a write protect fault.
+ * - UFFD_PAGEFAULT_FLAG_MINOR indicates a minor fault.
+ * - Neither of these flags being set indicates a MISSING fault.
+ *
+ * Separately, UFFD_PAGEFAULT_FLAG_WRITE indicates it was a write
+ * fault. Otherwise, it was a read fault.
+ */
if (flags & FAULT_FLAG_WRITE)
- /*
- * If UFFD_FEATURE_PAGEFAULT_FLAG_WP was set in the
- * uffdio_api.features and UFFD_PAGEFAULT_FLAG_WRITE
- * was not set in a UFFD_EVENT_PAGEFAULT, it means it
- * was a read fault, otherwise if set it means it's
- * a write fault.
- */
msg.arg.pagefault.flags |= UFFD_PAGEFAULT_FLAG_WRITE;
if (reason & VM_UFFD_WP)
- /*
- * If UFFD_FEATURE_PAGEFAULT_FLAG_WP was set in the
- * uffdio_api.features and UFFD_PAGEFAULT_FLAG_WP was
- * not set in a UFFD_EVENT_PAGEFAULT, it means it was
- * a missing fault, otherwise if set it means it's a
- * write protect fault.
- */
msg.arg.pagefault.flags |= UFFD_PAGEFAULT_FLAG_WP;
+ if (reason & VM_UFFD_MINOR)
+ msg.arg.pagefault.flags |= UFFD_PAGEFAULT_FLAG_MINOR;
if (features & UFFD_FEATURE_THREAD_ID)
msg.arg.pagefault.feat.ptid = task_pid_vnr(current);
return msg;
@@ -401,8 +398,10 @@ vm_fault_t handle_userfault(struct vm_fa
BUG_ON(ctx->mm != mm);
- VM_BUG_ON(reason & ~(VM_UFFD_MISSING|VM_UFFD_WP));
- VM_BUG_ON(!(reason & VM_UFFD_MISSING) ^ !!(reason & VM_UFFD_WP));
+ /* Any unrecognized flag is a bug. */
+ VM_BUG_ON(reason & ~__VM_UFFD_FLAGS);
+ /* 0 or > 1 flags set is a bug; we expect exactly 1. */
+ VM_BUG_ON(!reason || (reason & (reason - 1)));
if (ctx->features & UFFD_FEATURE_SIGBUS)
goto out;
@@ -612,7 +611,7 @@ static void userfaultfd_event_wait_compl
for (vma = mm->mmap; vma; vma = vma->vm_next)
if (vma->vm_userfaultfd_ctx.ctx == release_new_ctx) {
vma->vm_userfaultfd_ctx = NULL_VM_UFFD_CTX;
- vma->vm_flags &= ~(VM_UFFD_WP | VM_UFFD_MISSING);
+ vma->vm_flags &= ~__VM_UFFD_FLAGS;
}
mmap_write_unlock(mm);
@@ -644,7 +643,7 @@ int dup_userfaultfd(struct vm_area_struc
octx = vma->vm_userfaultfd_ctx.ctx;
if (!octx || !(octx->features & UFFD_FEATURE_EVENT_FORK)) {
vma->vm_userfaultfd_ctx = NULL_VM_UFFD_CTX;
- vma->vm_flags &= ~(VM_UFFD_WP | VM_UFFD_MISSING);
+ vma->vm_flags &= ~__VM_UFFD_FLAGS;
return 0;
}
@@ -726,7 +725,7 @@ void mremap_userfaultfd_prep(struct vm_a
} else {
/* Drop uffd context if remap feature not enabled */
vma->vm_userfaultfd_ctx = NULL_VM_UFFD_CTX;
- vma->vm_flags &= ~(VM_UFFD_WP | VM_UFFD_MISSING);
+ vma->vm_flags &= ~__VM_UFFD_FLAGS;
}
}
@@ -867,12 +866,12 @@ static int userfaultfd_release(struct in
for (vma = mm->mmap; vma; vma = vma->vm_next) {
cond_resched();
BUG_ON(!!vma->vm_userfaultfd_ctx.ctx ^
- !!(vma->vm_flags & (VM_UFFD_MISSING | VM_UFFD_WP)));
+ !!(vma->vm_flags & __VM_UFFD_FLAGS));
if (vma->vm_userfaultfd_ctx.ctx != ctx) {
prev = vma;
continue;
}
- new_flags = vma->vm_flags & ~(VM_UFFD_MISSING | VM_UFFD_WP);
+ new_flags = vma->vm_flags & ~__VM_UFFD_FLAGS;
prev = vma_merge(mm, prev, vma->vm_start, vma->vm_end,
new_flags, vma->anon_vma,
vma->vm_file, vma->vm_pgoff,
@@ -1262,9 +1261,19 @@ static inline bool vma_can_userfault(str
unsigned long vm_flags)
{
/* FIXME: add WP support to hugetlbfs and shmem */
- return vma_is_anonymous(vma) ||
- ((is_vm_hugetlb_page(vma) || vma_is_shmem(vma)) &&
- !(vm_flags & VM_UFFD_WP));
+ if (vm_flags & VM_UFFD_WP) {
+ if (is_vm_hugetlb_page(vma) || vma_is_shmem(vma))
+ return false;
+ }
+
+ if (vm_flags & VM_UFFD_MINOR) {
+ /* FIXME: Add minor fault interception for shmem. */
+ if (!is_vm_hugetlb_page(vma))
+ return false;
+ }
+
+ return vma_is_anonymous(vma) || is_vm_hugetlb_page(vma) ||
+ vma_is_shmem(vma);
}
static int userfaultfd_register(struct userfaultfd_ctx *ctx,
@@ -1290,14 +1299,19 @@ static int userfaultfd_register(struct u
ret = -EINVAL;
if (!uffdio_register.mode)
goto out;
- if (uffdio_register.mode & ~(UFFDIO_REGISTER_MODE_MISSING|
- UFFDIO_REGISTER_MODE_WP))
+ if (uffdio_register.mode & ~UFFD_API_REGISTER_MODES)
goto out;
vm_flags = 0;
if (uffdio_register.mode & UFFDIO_REGISTER_MODE_MISSING)
vm_flags |= VM_UFFD_MISSING;
if (uffdio_register.mode & UFFDIO_REGISTER_MODE_WP)
vm_flags |= VM_UFFD_WP;
+ if (uffdio_register.mode & UFFDIO_REGISTER_MODE_MINOR) {
+#ifndef CONFIG_HAVE_ARCH_USERFAULTFD_MINOR
+ goto out;
+#endif
+ vm_flags |= VM_UFFD_MINOR;
+ }
ret = validate_range(mm, &uffdio_register.range.start,
uffdio_register.range.len);
@@ -1341,7 +1355,7 @@ static int userfaultfd_register(struct u
cond_resched();
BUG_ON(!!cur->vm_userfaultfd_ctx.ctx ^
- !!(cur->vm_flags & (VM_UFFD_MISSING | VM_UFFD_WP)));
+ !!(cur->vm_flags & __VM_UFFD_FLAGS));
/* check not compatible vmas */
ret = -EINVAL;
@@ -1421,8 +1435,7 @@ static int userfaultfd_register(struct u
start = vma->vm_start;
vma_end = min(end, vma->vm_end);
- new_flags = (vma->vm_flags &
- ~(VM_UFFD_MISSING|VM_UFFD_WP)) | vm_flags;
+ new_flags = (vma->vm_flags & ~__VM_UFFD_FLAGS) | vm_flags;
prev = vma_merge(mm, prev, start, vma_end, new_flags,
vma->anon_vma, vma->vm_file, vma->vm_pgoff,
vma_policy(vma),
@@ -1544,7 +1557,7 @@ static int userfaultfd_unregister(struct
cond_resched();
BUG_ON(!!cur->vm_userfaultfd_ctx.ctx ^
- !!(cur->vm_flags & (VM_UFFD_MISSING | VM_UFFD_WP)));
+ !!(cur->vm_flags & __VM_UFFD_FLAGS));
/*
* Check not compatible vmas, not strictly required
@@ -1595,7 +1608,7 @@ static int userfaultfd_unregister(struct
wake_userfault(vma->vm_userfaultfd_ctx.ctx, &range);
}
- new_flags = vma->vm_flags & ~(VM_UFFD_MISSING | VM_UFFD_WP);
+ new_flags = vma->vm_flags & ~__VM_UFFD_FLAGS;
prev = vma_merge(mm, prev, start, vma_end, new_flags,
vma->anon_vma, vma->vm_file, vma->vm_pgoff,
vma_policy(vma),
@@ -1863,6 +1876,9 @@ static int userfaultfd_api(struct userfa
goto err_out;
/* report all available features and ioctls to userland */
uffdio_api.features = UFFD_API_FEATURES;
+#ifndef CONFIG_HAVE_ARCH_USERFAULTFD_MINOR
+ uffdio_api.features &= ~UFFD_FEATURE_MINOR_HUGETLBFS;
+#endif
uffdio_api.ioctls = UFFD_API_IOCTLS;
ret = -EFAULT;
if (copy_to_user(buf, &uffdio_api, sizeof(uffdio_api)))
--- a/include/linux/mm.h~userfaultfd-add-minor-fault-registration-mode
+++ a/include/linux/mm.h
@@ -372,6 +372,13 @@ extern unsigned int kobjsize(const void
# define VM_GROWSUP VM_NONE
#endif
+#ifdef CONFIG_HAVE_ARCH_USERFAULTFD_MINOR
+# define VM_UFFD_MINOR_BIT 37
+# define VM_UFFD_MINOR BIT(VM_UFFD_MINOR_BIT) /* UFFD minor faults */
+#else /* !CONFIG_HAVE_ARCH_USERFAULTFD_MINOR */
+# define VM_UFFD_MINOR VM_NONE
+#endif /* CONFIG_HAVE_ARCH_USERFAULTFD_MINOR */
+
/* Bits set in the VMA until the stack is in its final location */
#define VM_STACK_INCOMPLETE_SETUP (VM_RAND_READ | VM_SEQ_READ)
--- a/include/linux/userfaultfd_k.h~userfaultfd-add-minor-fault-registration-mode
+++ a/include/linux/userfaultfd_k.h
@@ -17,6 +17,9 @@
#include <linux/mm.h>
#include <asm-generic/pgtable_uffd.h>
+/* The set of all possible UFFD-related VM flags. */
+#define __VM_UFFD_FLAGS (VM_UFFD_MISSING | VM_UFFD_WP | VM_UFFD_MINOR)
+
/*
* CAREFUL: Check include/uapi/asm-generic/fcntl.h when defining
* new flags, since they might collide with O_* ones. We want
@@ -71,6 +74,11 @@ static inline bool userfaultfd_wp(struct
return vma->vm_flags & VM_UFFD_WP;
}
+static inline bool userfaultfd_minor(struct vm_area_struct *vma)
+{
+ return vma->vm_flags & VM_UFFD_MINOR;
+}
+
static inline bool userfaultfd_pte_wp(struct vm_area_struct *vma,
pte_t pte)
{
@@ -85,7 +93,7 @@ static inline bool userfaultfd_huge_pmd_
static inline bool userfaultfd_armed(struct vm_area_struct *vma)
{
- return vma->vm_flags & (VM_UFFD_MISSING | VM_UFFD_WP);
+ return vma->vm_flags & __VM_UFFD_FLAGS;
}
extern int dup_userfaultfd(struct vm_area_struct *, struct list_head *);
@@ -131,6 +139,11 @@ static inline bool userfaultfd_wp(struct
{
return false;
}
+
+static inline bool userfaultfd_minor(struct vm_area_struct *vma)
+{
+ return false;
+}
static inline bool userfaultfd_pte_wp(struct vm_area_struct *vma,
pte_t pte)
--- a/include/trace/events/mmflags.h~userfaultfd-add-minor-fault-registration-mode
+++ a/include/trace/events/mmflags.h
@@ -137,6 +137,12 @@ IF_HAVE_PG_ARCH_2(PG_arch_2, "arch_2" )
#define IF_HAVE_VM_SOFTDIRTY(flag,name)
#endif
+#ifdef CONFIG_HAVE_ARCH_USERFAULTFD_MINOR
+# define IF_HAVE_UFFD_MINOR(flag, name) {flag, name},
+#else
+# define IF_HAVE_UFFD_MINOR(flag, name)
+#endif
+
#define __def_vmaflag_names \
{VM_READ, "read" }, \
{VM_WRITE, "write" }, \
@@ -148,6 +154,7 @@ IF_HAVE_PG_ARCH_2(PG_arch_2, "arch_2" )
{VM_MAYSHARE, "mayshare" }, \
{VM_GROWSDOWN, "growsdown" }, \
{VM_UFFD_MISSING, "uffd_missing" }, \
+IF_HAVE_UFFD_MINOR(VM_UFFD_MINOR, "uffd_minor" ) \
{VM_PFNMAP, "pfnmap" }, \
{VM_DENYWRITE, "denywrite" }, \
{VM_UFFD_WP, "uffd_wp" }, \
--- a/include/uapi/linux/userfaultfd.h~userfaultfd-add-minor-fault-registration-mode
+++ a/include/uapi/linux/userfaultfd.h
@@ -19,15 +19,19 @@
* means the userland is reading).
*/
#define UFFD_API ((__u64)0xAA)
+#define UFFD_API_REGISTER_MODES (UFFDIO_REGISTER_MODE_MISSING | \
+ UFFDIO_REGISTER_MODE_WP | \
+ UFFDIO_REGISTER_MODE_MINOR)
#define UFFD_API_FEATURES (UFFD_FEATURE_PAGEFAULT_FLAG_WP | \
UFFD_FEATURE_EVENT_FORK | \
UFFD_FEATURE_EVENT_REMAP | \
- UFFD_FEATURE_EVENT_REMOVE | \
+ UFFD_FEATURE_EVENT_REMOVE | \
UFFD_FEATURE_EVENT_UNMAP | \
UFFD_FEATURE_MISSING_HUGETLBFS | \
UFFD_FEATURE_MISSING_SHMEM | \
UFFD_FEATURE_SIGBUS | \
- UFFD_FEATURE_THREAD_ID)
+ UFFD_FEATURE_THREAD_ID | \
+ UFFD_FEATURE_MINOR_HUGETLBFS)
#define UFFD_API_IOCTLS \
((__u64)1 << _UFFDIO_REGISTER | \
(__u64)1 << _UFFDIO_UNREGISTER | \
@@ -127,6 +131,7 @@ struct uffd_msg {
/* flags for UFFD_EVENT_PAGEFAULT */
#define UFFD_PAGEFAULT_FLAG_WRITE (1<<0) /* If this was a write fault */
#define UFFD_PAGEFAULT_FLAG_WP (1<<1) /* If reason is VM_UFFD_WP */
+#define UFFD_PAGEFAULT_FLAG_MINOR (1<<2) /* If reason is VM_UFFD_MINOR */
struct uffdio_api {
/* userland asks for an API number and the features to enable */
@@ -171,6 +176,10 @@ struct uffdio_api {
*
* UFFD_FEATURE_THREAD_ID pid of the page faulted task_struct will
* be returned, if feature is not requested 0 will be returned.
+ *
+ * UFFD_FEATURE_MINOR_HUGETLBFS indicates that minor faults
+ * can be intercepted (via REGISTER_MODE_MINOR) for
+ * hugetlbfs-backed pages.
*/
#define UFFD_FEATURE_PAGEFAULT_FLAG_WP (1<<0)
#define UFFD_FEATURE_EVENT_FORK (1<<1)
@@ -181,6 +190,7 @@ struct uffdio_api {
#define UFFD_FEATURE_EVENT_UNMAP (1<<6)
#define UFFD_FEATURE_SIGBUS (1<<7)
#define UFFD_FEATURE_THREAD_ID (1<<8)
+#define UFFD_FEATURE_MINOR_HUGETLBFS (1<<9)
__u64 features;
__u64 ioctls;
@@ -195,6 +205,7 @@ struct uffdio_register {
struct uffdio_range range;
#define UFFDIO_REGISTER_MODE_MISSING ((__u64)1<<0)
#define UFFDIO_REGISTER_MODE_WP ((__u64)1<<1)
+#define UFFDIO_REGISTER_MODE_MINOR ((__u64)1<<2)
__u64 mode;
/*
--- a/init/Kconfig~userfaultfd-add-minor-fault-registration-mode
+++ a/init/Kconfig
@@ -1644,6 +1644,11 @@ config HAVE_ARCH_USERFAULTFD_WP
help
Arch has userfaultfd write protection support
+config HAVE_ARCH_USERFAULTFD_MINOR
+ bool
+ help
+ Arch has userfaultfd minor fault support
+
config MEMBARRIER
bool "Enable membarrier() system call" if EXPERT
default y
--- a/mm/hugetlb.c~userfaultfd-add-minor-fault-registration-mode
+++ a/mm/hugetlb.c
@@ -4469,6 +4469,44 @@ int huge_add_to_page_cache(struct page *
return 0;
}
+static inline vm_fault_t hugetlb_handle_userfault(struct vm_area_struct *vma,
+ struct address_space *mapping,
+ pgoff_t idx,
+ unsigned int flags,
+ unsigned long haddr,
+ unsigned long reason)
+{
+ vm_fault_t ret;
+ u32 hash;
+ struct vm_fault vmf = {
+ .vma = vma,
+ .address = haddr,
+ .flags = flags,
+
+ /*
+ * Hard to debug if it ends up being
+ * used by a callee that assumes
+ * something about the other
+ * uninitialized fields... same as in
+ * memory.c
+ */
+ };
+
+ /*
+ * hugetlb_fault_mutex and i_mmap_rwsem must be
+ * dropped before handling userfault. Reacquire
+ * after handling fault to make calling code simpler.
+ */
+ hash = hugetlb_fault_mutex_hash(mapping, idx);
+ mutex_unlock(&hugetlb_fault_mutex_table[hash]);
+ i_mmap_unlock_read(mapping);
+ ret = handle_userfault(&vmf, reason);
+ i_mmap_lock_read(mapping);
+ mutex_lock(&hugetlb_fault_mutex_table[hash]);
+
+ return ret;
+}
+
static vm_fault_t hugetlb_no_page(struct mm_struct *mm,
struct vm_area_struct *vma,
struct address_space *mapping, pgoff_t idx,
@@ -4507,35 +4545,11 @@ static vm_fault_t hugetlb_no_page(struct
retry:
page = find_lock_page(mapping, idx);
if (!page) {
- /*
- * Check for page in userfault range
- */
+ /* Check for page in userfault range */
if (userfaultfd_missing(vma)) {
- u32 hash;
- struct vm_fault vmf = {
- .vma = vma,
- .address = haddr,
- .flags = flags,
- /*
- * Hard to debug if it ends up being
- * used by a callee that assumes
- * something about the other
- * uninitialized fields... same as in
- * memory.c
- */
- };
-
- /*
- * hugetlb_fault_mutex and i_mmap_rwsem must be
- * dropped before handling userfault. Reacquire
- * after handling fault to make calling code simpler.
- */
- hash = hugetlb_fault_mutex_hash(mapping, idx);
- mutex_unlock(&hugetlb_fault_mutex_table[hash]);
- i_mmap_unlock_read(mapping);
- ret = handle_userfault(&vmf, VM_UFFD_MISSING);
- i_mmap_lock_read(mapping);
- mutex_lock(&hugetlb_fault_mutex_table[hash]);
+ ret = hugetlb_handle_userfault(vma, mapping, idx,
+ flags, haddr,
+ VM_UFFD_MISSING);
goto out;
}
@@ -4591,6 +4605,16 @@ retry:
VM_FAULT_SET_HINDEX(hstate_index(h));
goto backout_unlocked;
}
+
+ /* Check for page in userfault range. */
+ if (userfaultfd_minor(vma)) {
+ unlock_page(page);
+ put_page(page);
+ ret = hugetlb_handle_userfault(vma, mapping, idx,
+ flags, haddr,
+ VM_UFFD_MINOR);
+ goto out;
+ }
}
/*
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 055/143] userfaultfd: disable huge PMD sharing for MINOR registered VMAs
2021-05-05 1:32 incoming Andrew Morton
` (53 preceding siblings ...)
2021-05-05 1:35 ` [patch 054/143] userfaultfd: add minor fault registration mode Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:35 ` [patch 056/143] userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled Andrew Morton
` (85 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
steven.price, torvalds, vbabka, viro, walken, willy, ying.huang
From: Axel Rasmussen <axelrasmussen@google.com>
Subject: userfaultfd: disable huge PMD sharing for MINOR registered VMAs
As the comment says: for the MINOR fault use case, although the page might
be present and populated in the other (non-UFFD-registered) half of the
mapping, it may be out of date, and we explicitly want userspace to get a
minor fault so it can check and potentially update the page's contents.
Huge PMD sharing would prevent these faults from occurring for suitably
aligned areas, so disable it upon UFFD registration.
Link: https://lkml.kernel.org/r/20210301222728.176417-3-axelrasmussen@google.com
Signed-off-by: Axel Rasmussen <axelrasmussen@google.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/userfaultfd_k.h | 13 ++++++++++---
1 file changed, 10 insertions(+), 3 deletions(-)
--- a/include/linux/userfaultfd_k.h~userfaultfd-disable-huge-pmd-sharing-for-minor-registered-vmas
+++ a/include/linux/userfaultfd_k.h
@@ -56,12 +56,19 @@ static inline bool is_mergeable_vm_userf
}
/*
- * Never enable huge pmd sharing on uffd-wp registered vmas, because uffd-wp
- * protect information is per pgtable entry.
+ * Never enable huge pmd sharing on some uffd registered vmas:
+ *
+ * - VM_UFFD_WP VMAs, because write protect information is per pgtable entry.
+ *
+ * - VM_UFFD_MINOR VMAs, because otherwise we would never get minor faults for
+ * VMAs which share huge pmds. (If you have two mappings to the same
+ * underlying pages, and fault in the non-UFFD-registered one with a write,
+ * with huge pmd sharing this would *also* setup the second UFFD-registered
+ * mapping, and we'd not get minor faults.)
*/
static inline bool uffd_disable_huge_pmd_share(struct vm_area_struct *vma)
{
- return vma->vm_flags & VM_UFFD_WP;
+ return vma->vm_flags & (VM_UFFD_WP | VM_UFFD_MINOR);
}
static inline bool userfaultfd_missing(struct vm_area_struct *vma)
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 056/143] userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled
2021-05-05 1:32 incoming Andrew Morton
` (54 preceding siblings ...)
2021-05-05 1:35 ` [patch 055/143] userfaultfd: disable huge PMD sharing for MINOR registered VMAs Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:35 ` [patch 057/143] userfaultfd: add UFFDIO_CONTINUE ioctl Andrew Morton
` (84 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
steven.price, torvalds, vbabka, viro, walken, willy, ying.huang
From: Axel Rasmussen <axelrasmussen@google.com>
Subject: userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled
For background, mm/userfaultfd.c provides a general mcopy_atomic
implementation. But some types of memory (i.e., hugetlb and shmem) need a
slightly different implementation, so they provide their own helpers for
this. In other words, userfaultfd is the only caller of these functions.
This patch achieves two things:
1. Don't spend time compiling code which will end up never being
referenced anyway (a small build time optimization).
2. In patches later in this series, we extend the signature of these
helpers with UFFD-specific state (a mode enumeration). Once this
happens, we *have to* either not compile the helpers, or
unconditionally define the UFFD-only state (which seems messier to me).
This includes the declarations in the headers, as otherwise they'd
yield warnings about implicitly defining the type of those arguments.
Link: https://lkml.kernel.org/r/20210301222728.176417-4-axelrasmussen@google.com
Signed-off-by: Axel Rasmussen <axelrasmussen@google.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/hugetlb.h | 4 ++++
mm/hugetlb.c | 2 ++
2 files changed, 6 insertions(+)
--- a/include/linux/hugetlb.h~userfaultfd-hugetlbfs-only-compile-uffd-helpers-if-config-enabled
+++ a/include/linux/hugetlb.h
@@ -134,11 +134,13 @@ void hugetlb_show_meminfo(void);
unsigned long hugetlb_total_pages(void);
vm_fault_t hugetlb_fault(struct mm_struct *mm, struct vm_area_struct *vma,
unsigned long address, unsigned int flags);
+#ifdef CONFIG_USERFAULTFD
int hugetlb_mcopy_atomic_pte(struct mm_struct *dst_mm, pte_t *dst_pte,
struct vm_area_struct *dst_vma,
unsigned long dst_addr,
unsigned long src_addr,
struct page **pagep);
+#endif /* CONFIG_USERFAULTFD */
bool hugetlb_reserve_pages(struct inode *inode, long from, long to,
struct vm_area_struct *vma,
vm_flags_t vm_flags);
@@ -310,6 +312,7 @@ static inline void hugetlb_free_pgd_rang
BUG();
}
+#ifdef CONFIG_USERFAULTFD
static inline int hugetlb_mcopy_atomic_pte(struct mm_struct *dst_mm,
pte_t *dst_pte,
struct vm_area_struct *dst_vma,
@@ -320,6 +323,7 @@ static inline int hugetlb_mcopy_atomic_p
BUG();
return 0;
}
+#endif /* CONFIG_USERFAULTFD */
static inline pte_t *huge_pte_offset(struct mm_struct *mm, unsigned long addr,
unsigned long sz)
--- a/mm/hugetlb.c~userfaultfd-hugetlbfs-only-compile-uffd-helpers-if-config-enabled
+++ a/mm/hugetlb.c
@@ -4855,6 +4855,7 @@ out_mutex:
return ret;
}
+#ifdef CONFIG_USERFAULTFD
/*
* Used by userfaultfd UFFDIO_COPY. Based on mcopy_atomic_pte with
* modifications for huge pages.
@@ -4985,6 +4986,7 @@ out_release_nounlock:
put_page(page);
goto out;
}
+#endif /* CONFIG_USERFAULTFD */
static void record_subpages_vmas(struct page *page, struct vm_area_struct *vma,
int refs, struct page **pages,
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 057/143] userfaultfd: add UFFDIO_CONTINUE ioctl
2021-05-05 1:32 incoming Andrew Morton
` (55 preceding siblings ...)
2021-05-05 1:35 ` [patch 056/143] userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:35 ` [patch 058/143] userfaultfd: update documentation to describe minor fault handling Andrew Morton
` (83 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
steven.price, torvalds, vbabka, viro, walken, willy, ying.huang
From: Axel Rasmussen <axelrasmussen@google.com>
Subject: userfaultfd: add UFFDIO_CONTINUE ioctl
This ioctl is how userspace ought to resolve "minor" userfaults. The
idea is, userspace is notified that a minor fault has occurred. It might
change the contents of the page using its second non-UFFD mapping, or
not. Then, it calls UFFDIO_CONTINUE to tell the kernel "I have ensured
the page contents are correct, carry on setting up the mapping".
Note that it doesn't make much sense to use UFFDIO_{COPY,ZEROPAGE} for
MINOR registered VMAs. ZEROPAGE maps the VMA to the zero page; but in
the minor fault case, we already have some pre-existing underlying page.
Likewise, UFFDIO_COPY isn't useful if we have a second non-UFFD mapping.
We'd just use memcpy() or similar instead.
It turns out hugetlb_mcopy_atomic_pte() already does very close to what
we want, if an existing page is provided via `struct page **pagep`. We
already special-case the behavior a bit for the UFFDIO_ZEROPAGE case, so
just extend that design: add an enum for the three modes of operation,
and make the small adjustments needed for the MCOPY_ATOMIC_CONTINUE
case. (Basically, look up the existing page, and avoid adding the
existing page to the page cache or calling set_page_huge_active() on
it.)
Link: https://lkml.kernel.org/r/20210301222728.176417-5-axelrasmussen@google.com
Signed-off-by: Axel Rasmussen <axelrasmussen@google.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/userfaultfd.c | 67 +++++++++++++++++++++++++++++
include/linux/hugetlb.h | 3 +
include/linux/userfaultfd_k.h | 18 +++++++
include/uapi/linux/userfaultfd.h | 21 ++++++++-
mm/hugetlb.c | 40 +++++++++++------
mm/userfaultfd.c | 37 +++++++++-------
6 files changed, 156 insertions(+), 30 deletions(-)
--- a/fs/userfaultfd.c~userfaultfd-add-uffdio_continue-ioctl
+++ a/fs/userfaultfd.c
@@ -1487,6 +1487,10 @@ out_unlock:
if (!(uffdio_register.mode & UFFDIO_REGISTER_MODE_WP))
ioctls_out &= ~((__u64)1 << _UFFDIO_WRITEPROTECT);
+ /* CONTINUE ioctl is only supported for MINOR ranges. */
+ if (!(uffdio_register.mode & UFFDIO_REGISTER_MODE_MINOR))
+ ioctls_out &= ~((__u64)1 << _UFFDIO_CONTINUE);
+
/*
* Now that we scanned all vmas we can already tell
* userland which ioctls methods are guaranteed to
@@ -1840,6 +1844,66 @@ static int userfaultfd_writeprotect(stru
return ret;
}
+static int userfaultfd_continue(struct userfaultfd_ctx *ctx, unsigned long arg)
+{
+ __s64 ret;
+ struct uffdio_continue uffdio_continue;
+ struct uffdio_continue __user *user_uffdio_continue;
+ struct userfaultfd_wake_range range;
+
+ user_uffdio_continue = (struct uffdio_continue __user *)arg;
+
+ ret = -EAGAIN;
+ if (READ_ONCE(ctx->mmap_changing))
+ goto out;
+
+ ret = -EFAULT;
+ if (copy_from_user(&uffdio_continue, user_uffdio_continue,
+ /* don't copy the output fields */
+ sizeof(uffdio_continue) - (sizeof(__s64))))
+ goto out;
+
+ ret = validate_range(ctx->mm, &uffdio_continue.range.start,
+ uffdio_continue.range.len);
+ if (ret)
+ goto out;
+
+ ret = -EINVAL;
+ /* double check for wraparound just in case. */
+ if (uffdio_continue.range.start + uffdio_continue.range.len <=
+ uffdio_continue.range.start) {
+ goto out;
+ }
+ if (uffdio_continue.mode & ~UFFDIO_CONTINUE_MODE_DONTWAKE)
+ goto out;
+
+ if (mmget_not_zero(ctx->mm)) {
+ ret = mcopy_continue(ctx->mm, uffdio_continue.range.start,
+ uffdio_continue.range.len,
+ &ctx->mmap_changing);
+ mmput(ctx->mm);
+ } else {
+ return -ESRCH;
+ }
+
+ if (unlikely(put_user(ret, &user_uffdio_continue->mapped)))
+ return -EFAULT;
+ if (ret < 0)
+ goto out;
+
+ /* len == 0 would wake all */
+ BUG_ON(!ret);
+ range.len = ret;
+ if (!(uffdio_continue.mode & UFFDIO_CONTINUE_MODE_DONTWAKE)) {
+ range.start = uffdio_continue.range.start;
+ wake_userfault(ctx, &range);
+ }
+ ret = range.len == uffdio_continue.range.len ? 0 : -EAGAIN;
+
+out:
+ return ret;
+}
+
static inline unsigned int uffd_ctx_features(__u64 user_features)
{
/*
@@ -1927,6 +1991,9 @@ static long userfaultfd_ioctl(struct fil
case UFFDIO_WRITEPROTECT:
ret = userfaultfd_writeprotect(ctx, arg);
break;
+ case UFFDIO_CONTINUE:
+ ret = userfaultfd_continue(ctx, arg);
+ break;
}
return ret;
}
--- a/include/linux/hugetlb.h~userfaultfd-add-uffdio_continue-ioctl
+++ a/include/linux/hugetlb.h
@@ -11,6 +11,7 @@
#include <linux/kref.h>
#include <linux/pgtable.h>
#include <linux/gfp.h>
+#include <linux/userfaultfd_k.h>
struct ctl_table;
struct user_struct;
@@ -139,6 +140,7 @@ int hugetlb_mcopy_atomic_pte(struct mm_s
struct vm_area_struct *dst_vma,
unsigned long dst_addr,
unsigned long src_addr,
+ enum mcopy_atomic_mode mode,
struct page **pagep);
#endif /* CONFIG_USERFAULTFD */
bool hugetlb_reserve_pages(struct inode *inode, long from, long to,
@@ -318,6 +320,7 @@ static inline int hugetlb_mcopy_atomic_p
struct vm_area_struct *dst_vma,
unsigned long dst_addr,
unsigned long src_addr,
+ enum mcopy_atomic_mode mode,
struct page **pagep)
{
BUG();
--- a/include/linux/userfaultfd_k.h~userfaultfd-add-uffdio_continue-ioctl
+++ a/include/linux/userfaultfd_k.h
@@ -37,6 +37,22 @@ extern int sysctl_unprivileged_userfault
extern vm_fault_t handle_userfault(struct vm_fault *vmf, unsigned long reason);
+/*
+ * The mode of operation for __mcopy_atomic and its helpers.
+ *
+ * This is almost an implementation detail (mcopy_atomic below doesn't take this
+ * as a parameter), but it's exposed here because memory-kind-specific
+ * implementations (e.g. hugetlbfs) need to know the mode of operation.
+ */
+enum mcopy_atomic_mode {
+ /* A normal copy_from_user into the destination range. */
+ MCOPY_ATOMIC_NORMAL,
+ /* Don't copy; map the destination range to the zero page. */
+ MCOPY_ATOMIC_ZEROPAGE,
+ /* Just install pte(s) with the existing page(s) in the page cache. */
+ MCOPY_ATOMIC_CONTINUE,
+};
+
extern ssize_t mcopy_atomic(struct mm_struct *dst_mm, unsigned long dst_start,
unsigned long src_start, unsigned long len,
bool *mmap_changing, __u64 mode);
@@ -44,6 +60,8 @@ extern ssize_t mfill_zeropage(struct mm_
unsigned long dst_start,
unsigned long len,
bool *mmap_changing);
+extern ssize_t mcopy_continue(struct mm_struct *dst_mm, unsigned long dst_start,
+ unsigned long len, bool *mmap_changing);
extern int mwriteprotect_range(struct mm_struct *dst_mm,
unsigned long start, unsigned long len,
bool enable_wp, bool *mmap_changing);
--- a/include/uapi/linux/userfaultfd.h~userfaultfd-add-uffdio_continue-ioctl
+++ a/include/uapi/linux/userfaultfd.h
@@ -40,10 +40,12 @@
((__u64)1 << _UFFDIO_WAKE | \
(__u64)1 << _UFFDIO_COPY | \
(__u64)1 << _UFFDIO_ZEROPAGE | \
- (__u64)1 << _UFFDIO_WRITEPROTECT)
+ (__u64)1 << _UFFDIO_WRITEPROTECT | \
+ (__u64)1 << _UFFDIO_CONTINUE)
#define UFFD_API_RANGE_IOCTLS_BASIC \
((__u64)1 << _UFFDIO_WAKE | \
- (__u64)1 << _UFFDIO_COPY)
+ (__u64)1 << _UFFDIO_COPY | \
+ (__u64)1 << _UFFDIO_CONTINUE)
/*
* Valid ioctl command number range with this API is from 0x00 to
@@ -59,6 +61,7 @@
#define _UFFDIO_COPY (0x03)
#define _UFFDIO_ZEROPAGE (0x04)
#define _UFFDIO_WRITEPROTECT (0x06)
+#define _UFFDIO_CONTINUE (0x07)
#define _UFFDIO_API (0x3F)
/* userfaultfd ioctl ids */
@@ -77,6 +80,8 @@
struct uffdio_zeropage)
#define UFFDIO_WRITEPROTECT _IOWR(UFFDIO, _UFFDIO_WRITEPROTECT, \
struct uffdio_writeprotect)
+#define UFFDIO_CONTINUE _IOR(UFFDIO, _UFFDIO_CONTINUE, \
+ struct uffdio_continue)
/* read() structure */
struct uffd_msg {
@@ -268,6 +273,18 @@ struct uffdio_writeprotect {
__u64 mode;
};
+struct uffdio_continue {
+ struct uffdio_range range;
+#define UFFDIO_CONTINUE_MODE_DONTWAKE ((__u64)1<<0)
+ __u64 mode;
+
+ /*
+ * Fields below here are written by the ioctl and must be at the end:
+ * the copy_from_user will not read past here.
+ */
+ __s64 mapped;
+};
+
/*
* Flags for the userfaultfd(2) system call itself.
*/
--- a/mm/hugetlb.c~userfaultfd-add-uffdio_continue-ioctl
+++ a/mm/hugetlb.c
@@ -39,7 +39,6 @@
#include <linux/hugetlb.h>
#include <linux/hugetlb_cgroup.h>
#include <linux/node.h>
-#include <linux/userfaultfd_k.h>
#include <linux/page_owner.h>
#include "internal.h"
@@ -4865,8 +4864,10 @@ int hugetlb_mcopy_atomic_pte(struct mm_s
struct vm_area_struct *dst_vma,
unsigned long dst_addr,
unsigned long src_addr,
+ enum mcopy_atomic_mode mode,
struct page **pagep)
{
+ bool is_continue = (mode == MCOPY_ATOMIC_CONTINUE);
struct address_space *mapping;
pgoff_t idx;
unsigned long size;
@@ -4876,8 +4877,17 @@ int hugetlb_mcopy_atomic_pte(struct mm_s
spinlock_t *ptl;
int ret;
struct page *page;
+ int writable;
- if (!*pagep) {
+ mapping = dst_vma->vm_file->f_mapping;
+ idx = vma_hugecache_offset(h, dst_vma, dst_addr);
+
+ if (is_continue) {
+ ret = -EFAULT;
+ page = find_lock_page(mapping, idx);
+ if (!page)
+ goto out;
+ } else if (!*pagep) {
ret = -ENOMEM;
page = alloc_huge_page(dst_vma, dst_addr, 0);
if (IS_ERR(page))
@@ -4906,13 +4916,8 @@ int hugetlb_mcopy_atomic_pte(struct mm_s
*/
__SetPageUptodate(page);
- mapping = dst_vma->vm_file->f_mapping;
- idx = vma_hugecache_offset(h, dst_vma, dst_addr);
-
- /*
- * If shared, add to page cache
- */
- if (vm_shared) {
+ /* Add shared, newly allocated pages to the page cache. */
+ if (vm_shared && !is_continue) {
size = i_size_read(mapping->host) >> huge_page_shift(h);
ret = -EFAULT;
if (idx >= size)
@@ -4957,8 +4962,14 @@ int hugetlb_mcopy_atomic_pte(struct mm_s
hugepage_add_new_anon_rmap(page, dst_vma, dst_addr);
}
- _dst_pte = make_huge_pte(dst_vma, page, dst_vma->vm_flags & VM_WRITE);
- if (dst_vma->vm_flags & VM_WRITE)
+ /* For CONTINUE on a non-shared VMA, don't set VM_WRITE for CoW. */
+ if (is_continue && !vm_shared)
+ writable = 0;
+ else
+ writable = dst_vma->vm_flags & VM_WRITE;
+
+ _dst_pte = make_huge_pte(dst_vma, page, writable);
+ if (writable)
_dst_pte = huge_pte_mkdirty(_dst_pte);
_dst_pte = pte_mkyoung(_dst_pte);
@@ -4972,15 +4983,16 @@ int hugetlb_mcopy_atomic_pte(struct mm_s
update_mmu_cache(dst_vma, dst_addr, dst_pte);
spin_unlock(ptl);
- SetHPageMigratable(page);
- if (vm_shared)
+ if (!is_continue)
+ SetHPageMigratable(page);
+ if (vm_shared || is_continue)
unlock_page(page);
ret = 0;
out:
return ret;
out_release_unlock:
spin_unlock(ptl);
- if (vm_shared)
+ if (vm_shared || is_continue)
unlock_page(page);
out_release_nounlock:
put_page(page);
--- a/mm/userfaultfd.c~userfaultfd-add-uffdio_continue-ioctl
+++ a/mm/userfaultfd.c
@@ -207,7 +207,7 @@ static __always_inline ssize_t __mcopy_a
unsigned long dst_start,
unsigned long src_start,
unsigned long len,
- bool zeropage)
+ enum mcopy_atomic_mode mode)
{
int vm_alloc_shared = dst_vma->vm_flags & VM_SHARED;
int vm_shared = dst_vma->vm_flags & VM_SHARED;
@@ -227,7 +227,7 @@ static __always_inline ssize_t __mcopy_a
* by THP. Since we can not reliably insert a zero page, this
* feature is not supported.
*/
- if (zeropage) {
+ if (mode == MCOPY_ATOMIC_ZEROPAGE) {
mmap_read_unlock(dst_mm);
return -EINVAL;
}
@@ -273,8 +273,6 @@ retry:
}
while (src_addr < src_start + len) {
- pte_t dst_pteval;
-
BUG_ON(dst_addr >= dst_start + len);
/*
@@ -297,16 +295,16 @@ retry:
goto out_unlock;
}
- err = -EEXIST;
- dst_pteval = huge_ptep_get(dst_pte);
- if (!huge_pte_none(dst_pteval)) {
+ if (mode != MCOPY_ATOMIC_CONTINUE &&
+ !huge_pte_none(huge_ptep_get(dst_pte))) {
+ err = -EEXIST;
mutex_unlock(&hugetlb_fault_mutex_table[hash]);
i_mmap_unlock_read(mapping);
goto out_unlock;
}
err = hugetlb_mcopy_atomic_pte(dst_mm, dst_pte, dst_vma,
- dst_addr, src_addr, &page);
+ dst_addr, src_addr, mode, &page);
mutex_unlock(&hugetlb_fault_mutex_table[hash]);
i_mmap_unlock_read(mapping);
@@ -408,7 +406,7 @@ extern ssize_t __mcopy_atomic_hugetlb(st
unsigned long dst_start,
unsigned long src_start,
unsigned long len,
- bool zeropage);
+ enum mcopy_atomic_mode mode);
#endif /* CONFIG_HUGETLB_PAGE */
static __always_inline ssize_t mfill_atomic_pte(struct mm_struct *dst_mm,
@@ -458,7 +456,7 @@ static __always_inline ssize_t __mcopy_a
unsigned long dst_start,
unsigned long src_start,
unsigned long len,
- bool zeropage,
+ enum mcopy_atomic_mode mcopy_mode,
bool *mmap_changing,
__u64 mode)
{
@@ -469,6 +467,7 @@ static __always_inline ssize_t __mcopy_a
long copied;
struct page *page;
bool wp_copy;
+ bool zeropage = (mcopy_mode == MCOPY_ATOMIC_ZEROPAGE);
/*
* Sanitize the command parameters:
@@ -527,10 +526,12 @@ retry:
*/
if (is_vm_hugetlb_page(dst_vma))
return __mcopy_atomic_hugetlb(dst_mm, dst_vma, dst_start,
- src_start, len, zeropage);
+ src_start, len, mcopy_mode);
if (!vma_is_anonymous(dst_vma) && !vma_is_shmem(dst_vma))
goto out_unlock;
+ if (mcopy_mode == MCOPY_ATOMIC_CONTINUE)
+ goto out_unlock;
/*
* Ensure the dst_vma has a anon_vma or this page
@@ -626,14 +627,22 @@ ssize_t mcopy_atomic(struct mm_struct *d
unsigned long src_start, unsigned long len,
bool *mmap_changing, __u64 mode)
{
- return __mcopy_atomic(dst_mm, dst_start, src_start, len, false,
- mmap_changing, mode);
+ return __mcopy_atomic(dst_mm, dst_start, src_start, len,
+ MCOPY_ATOMIC_NORMAL, mmap_changing, mode);
}
ssize_t mfill_zeropage(struct mm_struct *dst_mm, unsigned long start,
unsigned long len, bool *mmap_changing)
{
- return __mcopy_atomic(dst_mm, start, 0, len, true, mmap_changing, 0);
+ return __mcopy_atomic(dst_mm, start, 0, len, MCOPY_ATOMIC_ZEROPAGE,
+ mmap_changing, 0);
+}
+
+ssize_t mcopy_continue(struct mm_struct *dst_mm, unsigned long start,
+ unsigned long len, bool *mmap_changing)
+{
+ return __mcopy_atomic(dst_mm, start, 0, len, MCOPY_ATOMIC_CONTINUE,
+ mmap_changing, 0);
}
int mwriteprotect_range(struct mm_struct *dst_mm, unsigned long start,
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 058/143] userfaultfd: update documentation to describe minor fault handling
2021-05-05 1:32 incoming Andrew Morton
` (56 preceding siblings ...)
2021-05-05 1:35 ` [patch 057/143] userfaultfd: add UFFDIO_CONTINUE ioctl Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:35 ` [patch 059/143] userfaultfd/selftests: add test exercising " Andrew Morton
` (82 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
steven.price, torvalds, vbabka, viro, walken, willy, ying.huang
From: Axel Rasmussen <axelrasmussen@google.com>
Subject: userfaultfd: update documentation to describe minor fault handling
Reword / reorganize things a little bit into "lists", so new features /
modes / ioctls can sort of just be appended.
Describe how UFFDIO_REGISTER_MODE_MINOR and UFFDIO_CONTINUE can be used to
intercept and resolve minor faults. Make it clear that COPY and ZEROPAGE
are used for MISSING faults, whereas CONTINUE is used for MINOR faults.
Link: https://lkml.kernel.org/r/20210301222728.176417-6-axelrasmussen@google.com
Signed-off-by: Axel Rasmussen <axelrasmussen@google.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/admin-guide/mm/userfaultfd.rst | 105 ++++++++++-------
1 file changed, 65 insertions(+), 40 deletions(-)
--- a/Documentation/admin-guide/mm/userfaultfd.rst~userfaultfd-update-documentation-to-describe-minor-fault-handling
+++ a/Documentation/admin-guide/mm/userfaultfd.rst
@@ -63,36 +63,36 @@ the generic ioctl available.
The ``uffdio_api.features`` bitmask returned by the ``UFFDIO_API`` ioctl
defines what memory types are supported by the ``userfaultfd`` and what
-events, except page fault notifications, may be generated.
+events, except page fault notifications, may be generated:
-If the kernel supports registering ``userfaultfd`` ranges on hugetlbfs
-virtual memory areas, ``UFFD_FEATURE_MISSING_HUGETLBFS`` will be set in
-``uffdio_api.features``. Similarly, ``UFFD_FEATURE_MISSING_SHMEM`` will be
-set if the kernel supports registering ``userfaultfd`` ranges on shared
-memory (covering all shmem APIs, i.e. tmpfs, ``IPCSHM``, ``/dev/zero``,
-``MAP_SHARED``, ``memfd_create``, etc).
-
-The userland application that wants to use ``userfaultfd`` with hugetlbfs
-or shared memory need to set the corresponding flag in
-``uffdio_api.features`` to enable those features.
-
-If the userland desires to receive notifications for events other than
-page faults, it has to verify that ``uffdio_api.features`` has appropriate
-``UFFD_FEATURE_EVENT_*`` bits set. These events are described in more
-detail below in `Non-cooperative userfaultfd`_ section.
-
-Once the ``userfaultfd`` has been enabled the ``UFFDIO_REGISTER`` ioctl should
-be invoked (if present in the returned ``uffdio_api.ioctls`` bitmask) to
-register a memory range in the ``userfaultfd`` by setting the
+- The ``UFFD_FEATURE_EVENT_*`` flags indicate that various other events
+ other than page faults are supported. These events are described in more
+ detail below in the `Non-cooperative userfaultfd`_ section.
+
+- ``UFFD_FEATURE_MISSING_HUGETLBFS`` and ``UFFD_FEATURE_MISSING_SHMEM``
+ indicate that the kernel supports ``UFFDIO_REGISTER_MODE_MISSING``
+ registrations for hugetlbfs and shared memory (covering all shmem APIs,
+ i.e. tmpfs, ``IPCSHM``, ``/dev/zero``, ``MAP_SHARED``, ``memfd_create``,
+ etc) virtual memory areas, respectively.
+
+- ``UFFD_FEATURE_MINOR_HUGETLBFS`` indicates that the kernel supports
+ ``UFFDIO_REGISTER_MODE_MINOR`` registration for hugetlbfs virtual memory
+ areas.
+
+The userland application should set the feature flags it intends to use
+when invoking the ``UFFDIO_API`` ioctl, to request that those features be
+enabled if supported.
+
+Once the ``userfaultfd`` API has been enabled the ``UFFDIO_REGISTER``
+ioctl should be invoked (if present in the returned ``uffdio_api.ioctls``
+bitmask) to register a memory range in the ``userfaultfd`` by setting the
uffdio_register structure accordingly. The ``uffdio_register.mode``
bitmask will specify to the kernel which kind of faults to track for
-the range (``UFFDIO_REGISTER_MODE_MISSING`` would track missing
-pages). The ``UFFDIO_REGISTER`` ioctl will return the
+the range. The ``UFFDIO_REGISTER`` ioctl will return the
``uffdio_register.ioctls`` bitmask of ioctls that are suitable to resolve
userfaults on the range registered. Not all ioctls will necessarily be
-supported for all memory types depending on the underlying virtual
-memory backend (anonymous memory vs tmpfs vs real filebacked
-mappings).
+supported for all memory types (e.g. anonymous memory vs. shmem vs.
+hugetlbfs), or all types of intercepted faults.
Userland can use the ``uffdio_register.ioctls`` to manage the virtual
address space in the background (to add or potentially also remove
@@ -100,21 +100,46 @@ memory from the ``userfaultfd`` register
could be triggering just before userland maps in the background the
user-faulted page.
-The primary ioctl to resolve userfaults is ``UFFDIO_COPY``. That
-atomically copies a page into the userfault registered range and wakes
-up the blocked userfaults
-(unless ``uffdio_copy.mode & UFFDIO_COPY_MODE_DONTWAKE`` is set).
-Other ioctl works similarly to ``UFFDIO_COPY``. They're atomic as in
-guaranteeing that nothing can see an half copied page since it'll
-keep userfaulting until the copy has finished.
+Resolving Userfaults
+--------------------
+
+There are three basic ways to resolve userfaults:
+
+- ``UFFDIO_COPY`` atomically copies some existing page contents from
+ userspace.
+
+- ``UFFDIO_ZEROPAGE`` atomically zeros the new page.
+
+- ``UFFDIO_CONTINUE`` maps an existing, previously-populated page.
+
+These operations are atomic in the sense that they guarantee nothing can
+see a half-populated page, since readers will keep userfaulting until the
+operation has finished.
+
+By default, these wake up userfaults blocked on the range in question.
+They support a ``UFFDIO_*_MODE_DONTWAKE`` ``mode`` flag, which indicates
+that waking will be done separately at some later time.
+
+Which ioctl to choose depends on the kind of page fault, and what we'd
+like to do to resolve it:
+
+- For ``UFFDIO_REGISTER_MODE_MISSING`` faults, the fault needs to be
+ resolved by either providing a new page (``UFFDIO_COPY``), or mapping
+ the zero page (``UFFDIO_ZEROPAGE``). By default, the kernel would map
+ the zero page for a missing fault. With userfaultfd, userspace can
+ decide what content to provide before the faulting thread continues.
+
+- For ``UFFDIO_REGISTER_MODE_MINOR`` faults, there is an existing page (in
+ the page cache). Userspace has the option of modifying the page's
+ contents before resolving the fault. Once the contents are correct
+ (modified or not), userspace asks the kernel to map the page and let the
+ faulting thread continue with ``UFFDIO_CONTINUE``.
Notes:
-- If you requested ``UFFDIO_REGISTER_MODE_MISSING`` when registering then
- you must provide some kind of page in your thread after reading from
- the uffd. You must provide either ``UFFDIO_COPY`` or ``UFFDIO_ZEROPAGE``.
- The normal behavior of the OS automatically providing a zero page on
- an anonymous mmaping is not in place.
+- You can tell which kind of fault occurred by examining
+ ``pagefault.flags`` within the ``uffd_msg``, checking for the
+ ``UFFD_PAGEFAULT_FLAG_*`` flags.
- None of the page-delivering ioctls default to the range that you
registered with. You must fill in all fields for the appropriate
@@ -122,9 +147,9 @@ Notes:
- You get the address of the access that triggered the missing page
event out of a struct uffd_msg that you read in the thread from the
- uffd. You can supply as many pages as you want with ``UFFDIO_COPY`` or
- ``UFFDIO_ZEROPAGE``. Keep in mind that unless you used DONTWAKE then
- the first of any of those IOCTLs wakes up the faulting thread.
+ uffd. You can supply as many pages as you want with these IOCTLs.
+ Keep in mind that unless you used DONTWAKE then the first of any of
+ those IOCTLs wakes up the faulting thread.
- Be sure to test for all errors including
(``pollfd[0].revents & POLLERR``). This can happen, e.g. when ranges
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 059/143] userfaultfd/selftests: add test exercising minor fault handling
2021-05-05 1:32 incoming Andrew Morton
` (57 preceding siblings ...)
2021-05-05 1:35 ` [patch 058/143] userfaultfd: update documentation to describe minor fault handling Andrew Morton
@ 2021-05-05 1:35 ` Andrew Morton
2021-05-05 1:36 ` [patch 060/143] mm/vmscan: move RECLAIM* bits to uapi header Andrew Morton
` (81 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:35 UTC (permalink / raw)
To: aarcange, adobriyan, akpm, almasrymina, anshuman.khandual,
axelrasmussen, cannonmatthews, catalin.marinas, chinwen.chang,
dgilbert, jannh, jglisse, kirill, linux-mm, lokeshgidra,
mike.kravetz, mingo, mkoutny, mm-commits, mpe, npiggin, oupton,
peterx, rientjes, rostedt, rppt, ruprecht, shawn, shli,
steven.price, torvalds, vbabka, viro, walken, willy, ying.huang
From: Axel Rasmussen <axelrasmussen@google.com>
Subject: userfaultfd/selftests: add test exercising minor fault handling
Fix a dormant bug in userfaultfd_events_test(), where we did `return
faulting_process(0)` instead of `exit(faulting_process(0))`. This caused
the forked process to keep running, trying to execute any further test
cases after the events test in parallel with the "real" process.
Add a simple test case which exercises minor faults. In short, it does
the following:
1. "Sets up" an area (area_dst) and a second shared mapping to the same
underlying pages (area_dst_alias).
2. Register one of these areas with userfaultfd, in minor fault mode.
3. Start a second thread to handle any minor faults.
4. Populate the underlying pages with the non-UFFD-registered side of
the mapping. Basically, memset() each page with some arbitrary
contents.
5. Then, using the UFFD-registered mapping, read all of the page
contents, asserting that the contents match expectations (we expect
the minor fault handling thread can modify the page contents before
resolving the fault).
The minor fault handling thread, upon receiving an event, flips all the
bits (~) in that page, just to prove that it can modify it in some
arbitrary way. Then it issues a UFFDIO_CONTINUE ioctl, to setup the
mapping and resolve the fault. The reading thread should wake up and see
this modification.
Currently the minor fault test is only enabled in hugetlb_shared mode, as
this is the only configuration the kernel feature supports.
Link: https://lkml.kernel.org/r/20210301222728.176417-7-axelrasmussen@google.com
Signed-off-by: Axel Rasmussen <axelrasmussen@google.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Cc: Adam Ruprecht <ruprecht@google.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Cannon Matthews <cannonmatthews@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Dr . David Alan Gilbert" <dgilbert@redhat.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jann Horn <jannh@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Kirill A. Shutemov <kirill@shutemov.name>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: "Michal Koutn" <mkoutny@suse.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Oliver Upton <oupton@google.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Shawn Anastasio <shawn@anastas.io>
Cc: Steven Price <steven.price@arm.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
tools/testing/selftests/vm/userfaultfd.c | 164 ++++++++++++++++++++-
1 file changed, 158 insertions(+), 6 deletions(-)
--- a/tools/testing/selftests/vm/userfaultfd.c~userfaultfd-selftests-add-test-exercising-minor-fault-handling
+++ a/tools/testing/selftests/vm/userfaultfd.c
@@ -81,6 +81,8 @@ static volatile bool test_uffdio_copy_ee
static volatile bool test_uffdio_zeropage_eexist = true;
/* Whether to test uffd write-protection */
static bool test_uffdio_wp = false;
+/* Whether to test uffd minor faults */
+static bool test_uffdio_minor = false;
static bool map_shared;
static int huge_fd;
@@ -96,6 +98,7 @@ struct uffd_stats {
int cpu;
unsigned long missing_faults;
unsigned long wp_faults;
+ unsigned long minor_faults;
};
/* pthread_mutex_t starts at page offset 0 */
@@ -153,17 +156,19 @@ static void uffd_stats_reset(struct uffd
uffd_stats[i].cpu = i;
uffd_stats[i].missing_faults = 0;
uffd_stats[i].wp_faults = 0;
+ uffd_stats[i].minor_faults = 0;
}
}
static void uffd_stats_report(struct uffd_stats *stats, int n_cpus)
{
int i;
- unsigned long long miss_total = 0, wp_total = 0;
+ unsigned long long miss_total = 0, wp_total = 0, minor_total = 0;
for (i = 0; i < n_cpus; i++) {
miss_total += stats[i].missing_faults;
wp_total += stats[i].wp_faults;
+ minor_total += stats[i].minor_faults;
}
printf("userfaults: %llu missing (", miss_total);
@@ -172,6 +177,9 @@ static void uffd_stats_report(struct uff
printf("\b), %llu wp (", wp_total);
for (i = 0; i < n_cpus; i++)
printf("%lu+", stats[i].wp_faults);
+ printf("\b), %llu minor (", minor_total);
+ for (i = 0; i < n_cpus; i++)
+ printf("%lu+", stats[i].minor_faults);
printf("\b)\n");
}
@@ -328,7 +336,7 @@ static struct uffd_test_ops shmem_uffd_t
};
static struct uffd_test_ops hugetlb_uffd_test_ops = {
- .expected_ioctls = UFFD_API_RANGE_IOCTLS_BASIC,
+ .expected_ioctls = UFFD_API_RANGE_IOCTLS_BASIC & ~(1 << _UFFDIO_CONTINUE),
.allocate_area = hugetlb_allocate_area,
.release_pages = hugetlb_release_pages,
.alias_mapping = hugetlb_alias_mapping,
@@ -362,6 +370,22 @@ static void wp_range(int ufd, __u64 star
}
}
+static void continue_range(int ufd, __u64 start, __u64 len)
+{
+ struct uffdio_continue req;
+
+ req.range.start = start;
+ req.range.len = len;
+ req.mode = 0;
+
+ if (ioctl(ufd, UFFDIO_CONTINUE, &req)) {
+ fprintf(stderr,
+ "UFFDIO_CONTINUE failed for address 0x%" PRIx64 "\n",
+ (uint64_t)start);
+ exit(1);
+ }
+}
+
static void *locking_thread(void *arg)
{
unsigned long cpu = (unsigned long) arg;
@@ -569,8 +593,32 @@ static void uffd_handle_page_fault(struc
}
if (msg->arg.pagefault.flags & UFFD_PAGEFAULT_FLAG_WP) {
+ /* Write protect page faults */
wp_range(uffd, msg->arg.pagefault.address, page_size, false);
stats->wp_faults++;
+ } else if (msg->arg.pagefault.flags & UFFD_PAGEFAULT_FLAG_MINOR) {
+ uint8_t *area;
+ int b;
+
+ /*
+ * Minor page faults
+ *
+ * To prove we can modify the original range for testing
+ * purposes, we're going to bit flip this range before
+ * continuing.
+ *
+ * Note that this requires all minor page fault tests operate on
+ * area_dst (non-UFFD-registered) and area_dst_alias
+ * (UFFD-registered).
+ */
+
+ area = (uint8_t *)(area_dst +
+ ((char *)msg->arg.pagefault.address -
+ area_dst_alias));
+ for (b = 0; b < page_size; ++b)
+ area[b] = ~area[b];
+ continue_range(uffd, msg->arg.pagefault.address, page_size);
+ stats->minor_faults++;
} else {
/* Missing page faults */
if (bounces & BOUNCE_VERIFY &&
@@ -779,7 +827,7 @@ static int stress(struct uffd_stats *uff
return 0;
}
-static int userfaultfd_open(int features)
+static int userfaultfd_open_ext(uint64_t *features)
{
struct uffdio_api uffdio_api;
@@ -792,7 +840,7 @@ static int userfaultfd_open(int features
uffd_flags = fcntl(uffd, F_GETFD, NULL);
uffdio_api.api = UFFD_API;
- uffdio_api.features = features;
+ uffdio_api.features = *features;
if (ioctl(uffd, UFFDIO_API, &uffdio_api)) {
fprintf(stderr, "UFFDIO_API failed.\nPlease make sure to "
"run with either root or ptrace capability.\n");
@@ -804,9 +852,15 @@ static int userfaultfd_open(int features
return 1;
}
+ *features = uffdio_api.features;
return 0;
}
+static int userfaultfd_open(uint64_t features)
+{
+ return userfaultfd_open_ext(&features);
+}
+
sigjmp_buf jbuf, *sigbuf;
static void sighndl(int sig, siginfo_t *siginfo, void *ptr)
@@ -1112,7 +1166,7 @@ static int userfaultfd_events_test(void)
}
if (!pid)
- return faulting_process(0);
+ exit(faulting_process(0));
waitpid(pid, &err, 0);
if (err) {
@@ -1215,6 +1269,102 @@ static int userfaultfd_sig_test(void)
return userfaults != 0;
}
+static int userfaultfd_minor_test(void)
+{
+ struct uffdio_register uffdio_register;
+ unsigned long expected_ioctls;
+ unsigned long p;
+ pthread_t uffd_mon;
+ uint8_t expected_byte;
+ void *expected_page;
+ char c;
+ struct uffd_stats stats = { 0 };
+ uint64_t features = UFFD_FEATURE_MINOR_HUGETLBFS;
+
+ if (!test_uffdio_minor)
+ return 0;
+
+ printf("testing minor faults: ");
+ fflush(stdout);
+
+ if (uffd_test_ops->release_pages(area_dst))
+ return 1;
+
+ if (userfaultfd_open_ext(&features))
+ return 1;
+ /* If kernel reports the feature isn't supported, skip the test. */
+ if (!(features & UFFD_FEATURE_MINOR_HUGETLBFS)) {
+ printf("skipping test due to lack of feature support\n");
+ fflush(stdout);
+ return 0;
+ }
+
+ uffdio_register.range.start = (unsigned long)area_dst_alias;
+ uffdio_register.range.len = nr_pages * page_size;
+ uffdio_register.mode = UFFDIO_REGISTER_MODE_MINOR;
+ if (ioctl(uffd, UFFDIO_REGISTER, &uffdio_register)) {
+ fprintf(stderr, "register failure\n");
+ exit(1);
+ }
+
+ expected_ioctls = uffd_test_ops->expected_ioctls;
+ expected_ioctls |= 1 << _UFFDIO_CONTINUE;
+ if ((uffdio_register.ioctls & expected_ioctls) != expected_ioctls) {
+ fprintf(stderr, "unexpected missing ioctl(s)\n");
+ exit(1);
+ }
+
+ /*
+ * After registering with UFFD, populate the non-UFFD-registered side of
+ * the shared mapping. This should *not* trigger any UFFD minor faults.
+ */
+ for (p = 0; p < nr_pages; ++p) {
+ memset(area_dst + (p * page_size), p % ((uint8_t)-1),
+ page_size);
+ }
+
+ if (pthread_create(&uffd_mon, &attr, uffd_poll_thread, &stats)) {
+ perror("uffd_poll_thread create");
+ exit(1);
+ }
+
+ /*
+ * Read each of the pages back using the UFFD-registered mapping. We
+ * expect that the first time we touch a page, it will result in a minor
+ * fault. uffd_poll_thread will resolve the fault by bit-flipping the
+ * page's contents, and then issuing a CONTINUE ioctl.
+ */
+
+ if (posix_memalign(&expected_page, page_size, page_size)) {
+ fprintf(stderr, "out of memory\n");
+ return 1;
+ }
+
+ for (p = 0; p < nr_pages; ++p) {
+ expected_byte = ~((uint8_t)(p % ((uint8_t)-1)));
+ memset(expected_page, expected_byte, page_size);
+ if (my_bcmp(expected_page, area_dst_alias + (p * page_size),
+ page_size)) {
+ fprintf(stderr,
+ "unexpected page contents after minor fault\n");
+ exit(1);
+ }
+ }
+
+ if (write(pipefd[1], &c, sizeof(c)) != sizeof(c)) {
+ perror("pipe write");
+ exit(1);
+ }
+ if (pthread_join(uffd_mon, NULL))
+ return 1;
+
+ close(uffd);
+
+ uffd_stats_report(&stats, 1);
+
+ return stats.missing_faults != 0 || stats.minor_faults != nr_pages;
+}
+
static int userfaultfd_stress(void)
{
void *area;
@@ -1413,7 +1563,7 @@ static int userfaultfd_stress(void)
close(uffd);
return userfaultfd_zeropage_test() || userfaultfd_sig_test()
- || userfaultfd_events_test();
+ || userfaultfd_events_test() || userfaultfd_minor_test();
}
/*
@@ -1454,6 +1604,8 @@ static void set_test_type(const char *ty
map_shared = true;
test_type = TEST_HUGETLB;
uffd_test_ops = &hugetlb_uffd_test_ops;
+ /* Minor faults require shared hugetlb; only enable here. */
+ test_uffdio_minor = true;
} else if (!strcmp(type, "shmem")) {
map_shared = true;
test_type = TEST_SHMEM;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 060/143] mm/vmscan: move RECLAIM* bits to uapi header
2021-05-05 1:32 incoming Andrew Morton
` (58 preceding siblings ...)
2021-05-05 1:35 ` [patch 059/143] userfaultfd/selftests: add test exercising " Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 061/143] mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks Andrew Morton
` (80 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, alex.shi, ben.widawsky, cai, cl, dan.j.williams,
dave.hansen, dwagner, linux-mm, mm-commits, osalvador, rientjes,
tobin, torvalds, ying.huang
From: Dave Hansen <dave.hansen@linux.intel.com>
Subject: mm/vmscan: move RECLAIM* bits to uapi header
It is currently not obvious that the RECLAIM_* bits are part of the uapi
since they are defined in vmscan.c. Move them to a uapi header to make it
obvious.
This should have no functional impact.
Link: https://lkml.kernel.org/r/20210219172557.08074910@viggo.jf.intel.com
Signed-off-by: Dave Hansen <dave.hansen@linux.intel.com>
Reviewed-by: Ben Widawsky <ben.widawsky@intel.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Acked-by: David Rientjes <rientjes@google.com>
Acked-by: Christoph Lameter <cl@linux.com>
Cc: Alex Shi <alex.shi@linux.alibaba.com>
Cc: Daniel Wagner <dwagner@suse.de>
Cc: "Tobin C. Harding" <tobin@kernel.org>
Cc: Christoph Lameter <cl@linux.com>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: Qian Cai <cai@lca.pw>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/uapi/linux/mempolicy.h | 7 +++++++
mm/vmscan.c | 8 --------
2 files changed, 7 insertions(+), 8 deletions(-)
--- a/include/uapi/linux/mempolicy.h~mm-vmscan-move-reclaim-bits-to-uapi-header
+++ a/include/uapi/linux/mempolicy.h
@@ -64,5 +64,12 @@ enum {
#define MPOL_F_MOF (1 << 3) /* this policy wants migrate on fault */
#define MPOL_F_MORON (1 << 4) /* Migrate On protnone Reference On Node */
+/*
+ * These bit locations are exposed in the vm.zone_reclaim_mode sysctl
+ * ABI. New bits are OK, but existing bits can never change.
+ */
+#define RECLAIM_ZONE (1<<0) /* Run shrink_inactive_list on the zone */
+#define RECLAIM_WRITE (1<<1) /* Writeout pages during reclaim */
+#define RECLAIM_UNMAP (1<<2) /* Unmap pages during reclaim */
#endif /* _UAPI_LINUX_MEMPOLICY_H */
--- a/mm/vmscan.c~mm-vmscan-move-reclaim-bits-to-uapi-header
+++ a/mm/vmscan.c
@@ -4087,14 +4087,6 @@ module_init(kswapd_init)
int node_reclaim_mode __read_mostly;
/*
- * These bit locations are exposed in the vm.zone_reclaim_mode sysctl
- * ABI. New bits are OK, but existing bits can never change.
- */
-#define RECLAIM_ZONE (1<<0) /* Run shrink_inactive_list on the zone */
-#define RECLAIM_WRITE (1<<1) /* Writeout pages during reclaim */
-#define RECLAIM_UNMAP (1<<2) /* Unmap pages during reclaim */
-
-/*
* Priority for NODE_RECLAIM. This determines the fraction of pages
* of a node considered for each zone_reclaim. 4 scans 1/16th of
* a zone.
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 061/143] mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks
2021-05-05 1:32 incoming Andrew Morton
` (59 preceding siblings ...)
2021-05-05 1:36 ` [patch 060/143] mm/vmscan: move RECLAIM* bits to uapi header Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 062/143] mm: vmscan: use nid from shrink_control for tracepoint Andrew Morton
` (79 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, alex.shi, ben.widawsky, cai, cl, dan.j.williams,
dave.hansen, dwagner, linux-mm, mm-commits, osalvador, rientjes,
tobin, torvalds, ying.huang
From: Dave Hansen <dave.hansen@linux.intel.com>
Subject: mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks
RECLAIM_ZONE was assumed to be unused because it was never explicitly used
in the kernel. However, there were a number of places where it was
checked implicitly by checking 'node_reclaim_mode' for a zero value.
These zero checks are not great because it is not obvious what a zero mode
*means* in the code. Replace them with a helper which makes it more
obvious: node_reclaim_enabled().
This helper also provides a handy place to explicitly check the
RECLAIM_ZONE bit itself. Check it explicitly there to make it more
obvious where the bit can affect behavior.
This should have no functional impact.
Link: https://lkml.kernel.org/r/20210219172559.BF589C44@viggo.jf.intel.com
Signed-off-by: Dave Hansen <dave.hansen@linux.intel.com>
Reviewed-by: Ben Widawsky <ben.widawsky@intel.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Christoph Lameter <cl@linux.com>
Acked-by: David Rientjes <rientjes@google.com>
Cc: Alex Shi <alex.shi@linux.alibaba.com>
Cc: "Tobin C. Harding" <tobin@kernel.org>
Cc: Huang Ying <ying.huang@intel.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: Qian Cai <cai@lca.pw>
Cc: Daniel Wagner <dwagner@suse.de>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/swap.h | 7 +++++++
mm/khugepaged.c | 2 +-
mm/page_alloc.c | 2 +-
3 files changed, 9 insertions(+), 2 deletions(-)
--- a/include/linux/swap.h~mm-vmscan-replace-implicit-reclaim_zone-checks-with-explicit-checks
+++ a/include/linux/swap.h
@@ -12,6 +12,7 @@
#include <linux/fs.h>
#include <linux/atomic.h>
#include <linux/page-flags.h>
+#include <uapi/linux/mempolicy.h>
#include <asm/page.h>
struct notifier_block;
@@ -378,6 +379,12 @@ extern int sysctl_min_slab_ratio;
#define node_reclaim_mode 0
#endif
+static inline bool node_reclaim_enabled(void)
+{
+ /* Is any node_reclaim_mode bit set? */
+ return node_reclaim_mode & (RECLAIM_ZONE|RECLAIM_WRITE|RECLAIM_UNMAP);
+}
+
extern void check_move_unevictable_pages(struct pagevec *pvec);
extern int kswapd_run(int nid);
--- a/mm/khugepaged.c~mm-vmscan-replace-implicit-reclaim_zone-checks-with-explicit-checks
+++ a/mm/khugepaged.c
@@ -809,7 +809,7 @@ static bool khugepaged_scan_abort(int ni
* If node_reclaim_mode is disabled, then no extra effort is made to
* allocate memory locally.
*/
- if (!node_reclaim_mode)
+ if (!node_reclaim_enabled())
return false;
/* If there is a count for this node already, it must be acceptable */
--- a/mm/page_alloc.c~mm-vmscan-replace-implicit-reclaim_zone-checks-with-explicit-checks
+++ a/mm/page_alloc.c
@@ -3968,7 +3968,7 @@ retry:
if (alloc_flags & ALLOC_NO_WATERMARKS)
goto try_this_zone;
- if (node_reclaim_mode == 0 ||
+ if (!node_reclaim_enabled() ||
!zone_allows_reclaim(ac->preferred_zoneref->zone, zone))
continue;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 062/143] mm: vmscan: use nid from shrink_control for tracepoint
2021-05-05 1:32 incoming Andrew Morton
` (60 preceding siblings ...)
2021-05-05 1:36 ` [patch 061/143] mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 063/143] mm: vmscan: consolidate shrinker_maps handling code Andrew Morton
` (78 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
shakeelb, shy828301, torvalds, vbabka
From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: use nid from shrink_control for tracepoint
Patch series "Make shrinker's nr_deferred memcg aware", v10.
Recently huge amount one-off slab drop was seen on some vfs metadata heavy
workloads, it turned out there were huge amount accumulated nr_deferred
objects seen by the shrinker.
On our production machine, I saw absurd number of nr_deferred shown as the
below tracing result:
<...>-48776 [032] .... 27970562.458916: mm_shrink_slab_start:
super_cache_scan+0x0/0x1a0 ffff9a83046f3458: nid: 0 objects to shrink
2531805877005 gfp_flags GFP_HIGHUSER_MOVABLE pgs_scanned 32 lru_pgs
9300 cache items 1667 delta 11 total_scan 833
There are 2.5 trillion deferred objects on one node, assuming all of them
are dentry (192 bytes per object), so the total size of deferred on one
node is ~480TB. It is definitely ridiculous.
I managed to reproduce this problem with kernel build workload plus
negative dentry generator.
First step, run the below kernel build test script:
NR_CPUS=`cat /proc/cpuinfo | grep -e processor | wc -l`
cd /root/Buildarea/linux-stable
for i in `seq 1500`; do
cgcreate -g memory:kern_build
echo 4G > /sys/fs/cgroup/memory/kern_build/memory.limit_in_bytes
echo 3 > /proc/sys/vm/drop_caches
cgexec -g memory:kern_build make clean > /dev/null 2>&1
cgexec -g memory:kern_build make -j$NR_CPUS > /dev/null 2>&1
cgdelete -g memory:kern_build
done
Then run the below negative dentry generator script:
NR_CPUS=`cat /proc/cpuinfo | grep -e processor | wc -l`
mkdir /sys/fs/cgroup/memory/test
echo $$ > /sys/fs/cgroup/memory/test/tasks
for i in `seq $NR_CPUS`; do
while true; do
FILE=`head /dev/urandom | tr -dc A-Za-z0-9 | head -c 64`
cat $FILE 2>/dev/null
done &
done
Then kswapd will shrink half of dentry cache in just one loop as the below
tracing result showed:
kswapd0-475 [028] .... 305968.252561: mm_shrink_slab_start: super_cache_scan+0x0/0x190 0000000024acf00c: nid: 0
objects to shrink 4994376020 gfp_flags GFP_KERNEL cache items 93689873 delta 45746 total_scan 46844936 priority 12
kswapd0-475 [021] .... 306013.099399: mm_shrink_slab_end: super_cache_scan+0x0/0x190 0000000024acf00c: nid: 0 unused
scan count 4994376020 new scan count 4947576838 total_scan 8 last shrinker return val 46844928
There were huge number of deferred objects before the shrinker was called,
the behavior does match the code but it might be not desirable from the
user's stand of point.
The excessive amount of nr_deferred might be accumulated due to various
reasons, for example:
* GFP_NOFS allocation
* Significant times of small amount scan (< scan_batch, 1024 for vfs
metadata)
However the LRUs of slabs are per memcg (memcg-aware shrinkers) but the
deferred objects is per shrinker, this may have some bad effects:
* Poor isolation among memcgs. Some memcgs which happen to have
frequent limit reclaim may get nr_deferred accumulated to a huge number,
then other innocent memcgs may take the fall. In our case the main
workload was hit.
* Unbounded deferred objects. There is no cap for deferred objects, it
can outgrow ridiculously as the tracing result showed.
* Easy to get out of control. Although shrinkers take into account
deferred objects, but it can go out of control easily. One
misconfigured memcg could incur absurd amount of deferred objects in a
period of time.
* Sort of reclaim problems, i.e. over reclaim, long reclaim latency,
etc. There may be hundred GB slab caches for vfe metadata heavy
workload, shrink half of them may take minutes. We observed latency
spike due to the prolonged reclaim.
These issues also have been discussed in
https://lore.kernel.org/linux-mm/20200916185823.5347-1-shy828301@gmail.com/.
The patchset is the outcome of that discussion.
So this patchset makes nr_deferred per-memcg to tackle the problem. It
does:
* Have memcg_shrinker_deferred per memcg per node, just like what
shrinker_map does. Instead it is an atomic_long_t array, each element
represent one shrinker even though the shrinker is not memcg aware, this
simplifies the implementation. For memcg aware shrinkers, the deferred
objects are just accumulated to its own memcg. The shrinkers just see
nr_deferred from its own memcg. Non memcg aware shrinkers still use
global nr_deferred from struct shrinker.
* Once the memcg is offlined, its nr_deferred will be reparented to its
parent along with LRUs.
* The root memcg has memcg_shrinker_deferred array too. It simplifies
the handling of reparenting to root memcg.
* Cap nr_deferred to 2x of the length of lru. The idea is borrowed from
Dave Chinner's series
(https://lore.kernel.org/linux-xfs/20191031234618.15403-1-david@fromorbit.com/)
The downside is each memcg has to allocate extra memory to store the
nr_deferred array. On our production environment, there are typically
around 40 shrinkers, so each memcg needs ~320 bytes. 10K memcgs would
need ~3.2MB memory. It seems fine.
We have been running the patched kernel on some hosts of our fleet (test
and production) for months, it works very well. The monitor data shows
the working set is sustained as expected.
This patch (of 13):
The tracepoint's nid should show what node the shrink happens on, the
start tracepoint uses nid from shrinkctl, but the nid might be set to 0
before end tracepoint if the shrinker is not NUMA aware, so the tracing
log may show the shrink happens on one node but end up on the other node.
It seems confusing. And the following patch will remove using nid
directly in do_shrink_slab(), this patch also helps cleanup the code.
Link: https://lkml.kernel.org/r/20210311190845.9708-1-shy828301@gmail.com
Link: https://lkml.kernel.org/r/20210311190845.9708-2-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Acked-by: Roman Gushchin <guro@fb.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmscan.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/vmscan.c~mm-vmscan-use-nid-from-shrink_control-for-tracepoint
+++ a/mm/vmscan.c
@@ -536,7 +536,7 @@ static unsigned long do_shrink_slab(stru
else
new_nr = atomic_long_read(&shrinker->nr_deferred[nid]);
- trace_mm_shrink_slab_end(shrinker, nid, freed, nr, new_nr, total_scan);
+ trace_mm_shrink_slab_end(shrinker, shrinkctl->nid, freed, nr, new_nr, total_scan);
return freed;
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 063/143] mm: vmscan: consolidate shrinker_maps handling code
2021-05-05 1:32 incoming Andrew Morton
` (61 preceding siblings ...)
2021-05-05 1:36 ` [patch 062/143] mm: vmscan: use nid from shrink_control for tracepoint Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 064/143] mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation Andrew Morton
` (77 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
shakeelb, shy828301, torvalds, vbabka
From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: consolidate shrinker_maps handling code
The shrinker map management is not purely memcg specific, it is at the
intersection between memory cgroup and shrinkers. It's allocation and
assignment of a structure, and the only memcg bit is the map is being
stored in a memcg structure. So move the shrinker_maps handling code into
vmscan.c for tighter integration with shrinker code, and remove the
"memcg_" prefix. There is no functional change.
Link: https://lkml.kernel.org/r/20210311190845.9708-3-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/memcontrol.h | 11 +-
mm/huge_memory.c | 4 -
mm/list_lru.c | 6 -
mm/memcontrol.c | 130 ----------------------------------
mm/vmscan.c | 132 ++++++++++++++++++++++++++++++++++-
5 files changed, 142 insertions(+), 141 deletions(-)
--- a/include/linux/memcontrol.h~mm-vmscan-consolidate-shrinker_maps-handling-code
+++ a/include/linux/memcontrol.h
@@ -1610,10 +1610,9 @@ static inline bool mem_cgroup_under_sock
return false;
}
-extern int memcg_expand_shrinker_maps(int new_id);
-
-extern void memcg_set_shrinker_bit(struct mem_cgroup *memcg,
- int nid, int shrinker_id);
+int alloc_shrinker_maps(struct mem_cgroup *memcg);
+void free_shrinker_maps(struct mem_cgroup *memcg);
+void set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id);
#else
#define mem_cgroup_sockets_enabled 0
static inline void mem_cgroup_sk_alloc(struct sock *sk) { };
@@ -1623,8 +1622,8 @@ static inline bool mem_cgroup_under_sock
return false;
}
-static inline void memcg_set_shrinker_bit(struct mem_cgroup *memcg,
- int nid, int shrinker_id)
+static inline void set_shrinker_bit(struct mem_cgroup *memcg,
+ int nid, int shrinker_id)
{
}
#endif
--- a/mm/huge_memory.c~mm-vmscan-consolidate-shrinker_maps-handling-code
+++ a/mm/huge_memory.c
@@ -2830,8 +2830,8 @@ void deferred_split_huge_page(struct pag
ds_queue->split_queue_len++;
#ifdef CONFIG_MEMCG
if (memcg)
- memcg_set_shrinker_bit(memcg, page_to_nid(page),
- deferred_split_shrinker.id);
+ set_shrinker_bit(memcg, page_to_nid(page),
+ deferred_split_shrinker.id);
#endif
}
spin_unlock_irqrestore(&ds_queue->split_queue_lock, flags);
--- a/mm/list_lru.c~mm-vmscan-consolidate-shrinker_maps-handling-code
+++ a/mm/list_lru.c
@@ -125,8 +125,8 @@ bool list_lru_add(struct list_lru *lru,
list_add_tail(item, &l->list);
/* Set shrinker bit if the first element was added */
if (!l->nr_items++)
- memcg_set_shrinker_bit(memcg, nid,
- lru_shrinker_id(lru));
+ set_shrinker_bit(memcg, nid,
+ lru_shrinker_id(lru));
nlru->nr_items++;
spin_unlock(&nlru->lock);
return true;
@@ -540,7 +540,7 @@ static void memcg_drain_list_lru_node(st
if (src->nr_items) {
dst->nr_items += src->nr_items;
- memcg_set_shrinker_bit(dst_memcg, nid, lru_shrinker_id(lru));
+ set_shrinker_bit(dst_memcg, nid, lru_shrinker_id(lru));
src->nr_items = 0;
}
--- a/mm/memcontrol.c~mm-vmscan-consolidate-shrinker_maps-handling-code
+++ a/mm/memcontrol.c
@@ -400,130 +400,6 @@ DEFINE_STATIC_KEY_FALSE(memcg_kmem_enabl
EXPORT_SYMBOL(memcg_kmem_enabled_key);
#endif
-static int memcg_shrinker_map_size;
-static DEFINE_MUTEX(memcg_shrinker_map_mutex);
-
-static void memcg_free_shrinker_map_rcu(struct rcu_head *head)
-{
- kvfree(container_of(head, struct memcg_shrinker_map, rcu));
-}
-
-static int memcg_expand_one_shrinker_map(struct mem_cgroup *memcg,
- int size, int old_size)
-{
- struct memcg_shrinker_map *new, *old;
- struct mem_cgroup_per_node *pn;
- int nid;
-
- lockdep_assert_held(&memcg_shrinker_map_mutex);
-
- for_each_node(nid) {
- pn = memcg->nodeinfo[nid];
- old = rcu_dereference_protected(pn->shrinker_map, true);
- /* Not yet online memcg */
- if (!old)
- return 0;
-
- new = kvmalloc_node(sizeof(*new) + size, GFP_KERNEL, nid);
- if (!new)
- return -ENOMEM;
-
- /* Set all old bits, clear all new bits */
- memset(new->map, (int)0xff, old_size);
- memset((void *)new->map + old_size, 0, size - old_size);
-
- rcu_assign_pointer(pn->shrinker_map, new);
- call_rcu(&old->rcu, memcg_free_shrinker_map_rcu);
- }
-
- return 0;
-}
-
-static void memcg_free_shrinker_maps(struct mem_cgroup *memcg)
-{
- struct mem_cgroup_per_node *pn;
- struct memcg_shrinker_map *map;
- int nid;
-
- if (mem_cgroup_is_root(memcg))
- return;
-
- for_each_node(nid) {
- pn = memcg->nodeinfo[nid];
- map = rcu_dereference_protected(pn->shrinker_map, true);
- kvfree(map);
- rcu_assign_pointer(pn->shrinker_map, NULL);
- }
-}
-
-static int memcg_alloc_shrinker_maps(struct mem_cgroup *memcg)
-{
- struct memcg_shrinker_map *map;
- int nid, size, ret = 0;
-
- if (mem_cgroup_is_root(memcg))
- return 0;
-
- mutex_lock(&memcg_shrinker_map_mutex);
- size = memcg_shrinker_map_size;
- for_each_node(nid) {
- map = kvzalloc_node(sizeof(*map) + size, GFP_KERNEL, nid);
- if (!map) {
- memcg_free_shrinker_maps(memcg);
- ret = -ENOMEM;
- break;
- }
- rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_map, map);
- }
- mutex_unlock(&memcg_shrinker_map_mutex);
-
- return ret;
-}
-
-int memcg_expand_shrinker_maps(int new_id)
-{
- int size, old_size, ret = 0;
- struct mem_cgroup *memcg;
-
- size = DIV_ROUND_UP(new_id + 1, BITS_PER_LONG) * sizeof(unsigned long);
- old_size = memcg_shrinker_map_size;
- if (size <= old_size)
- return 0;
-
- mutex_lock(&memcg_shrinker_map_mutex);
- if (!root_mem_cgroup)
- goto unlock;
-
- for_each_mem_cgroup(memcg) {
- if (mem_cgroup_is_root(memcg))
- continue;
- ret = memcg_expand_one_shrinker_map(memcg, size, old_size);
- if (ret) {
- mem_cgroup_iter_break(NULL, memcg);
- goto unlock;
- }
- }
-unlock:
- if (!ret)
- memcg_shrinker_map_size = size;
- mutex_unlock(&memcg_shrinker_map_mutex);
- return ret;
-}
-
-void memcg_set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id)
-{
- if (shrinker_id >= 0 && memcg && !mem_cgroup_is_root(memcg)) {
- struct memcg_shrinker_map *map;
-
- rcu_read_lock();
- map = rcu_dereference(memcg->nodeinfo[nid]->shrinker_map);
- /* Pairs with smp mb in shrink_slab() */
- smp_mb__before_atomic();
- set_bit(shrinker_id, map->map);
- rcu_read_unlock();
- }
-}
-
/**
* mem_cgroup_css_from_page - css of the memcg associated with a page
* @page: page of interest
@@ -5242,11 +5118,11 @@ static int mem_cgroup_css_online(struct
struct mem_cgroup *memcg = mem_cgroup_from_css(css);
/*
- * A memcg must be visible for memcg_expand_shrinker_maps()
+ * A memcg must be visible for expand_shrinker_maps()
* by the time the maps are allocated. So, we allocate maps
* here, when for_each_mem_cgroup() can't skip it.
*/
- if (memcg_alloc_shrinker_maps(memcg)) {
+ if (alloc_shrinker_maps(memcg)) {
mem_cgroup_id_remove(memcg);
return -ENOMEM;
}
@@ -5310,7 +5186,7 @@ static void mem_cgroup_css_free(struct c
vmpressure_cleanup(&memcg->vmpressure);
cancel_work_sync(&memcg->high_work);
mem_cgroup_remove_from_trees(memcg);
- memcg_free_shrinker_maps(memcg);
+ free_shrinker_maps(memcg);
memcg_free_kmem(memcg);
mem_cgroup_free(memcg);
}
--- a/mm/vmscan.c~mm-vmscan-consolidate-shrinker_maps-handling-code
+++ a/mm/vmscan.c
@@ -185,6 +185,132 @@ static LIST_HEAD(shrinker_list);
static DECLARE_RWSEM(shrinker_rwsem);
#ifdef CONFIG_MEMCG
+
+static int memcg_shrinker_map_size;
+static DEFINE_MUTEX(memcg_shrinker_map_mutex);
+
+static void free_shrinker_map_rcu(struct rcu_head *head)
+{
+ kvfree(container_of(head, struct memcg_shrinker_map, rcu));
+}
+
+static int expand_one_shrinker_map(struct mem_cgroup *memcg,
+ int size, int old_size)
+{
+ struct memcg_shrinker_map *new, *old;
+ struct mem_cgroup_per_node *pn;
+ int nid;
+
+ lockdep_assert_held(&memcg_shrinker_map_mutex);
+
+ for_each_node(nid) {
+ pn = memcg->nodeinfo[nid];
+ old = rcu_dereference_protected(pn->shrinker_map, true);
+ /* Not yet online memcg */
+ if (!old)
+ return 0;
+
+ new = kvmalloc_node(sizeof(*new) + size, GFP_KERNEL, nid);
+ if (!new)
+ return -ENOMEM;
+
+ /* Set all old bits, clear all new bits */
+ memset(new->map, (int)0xff, old_size);
+ memset((void *)new->map + old_size, 0, size - old_size);
+
+ rcu_assign_pointer(pn->shrinker_map, new);
+ call_rcu(&old->rcu, free_shrinker_map_rcu);
+ }
+
+ return 0;
+}
+
+void free_shrinker_maps(struct mem_cgroup *memcg)
+{
+ struct mem_cgroup_per_node *pn;
+ struct memcg_shrinker_map *map;
+ int nid;
+
+ if (mem_cgroup_is_root(memcg))
+ return;
+
+ for_each_node(nid) {
+ pn = memcg->nodeinfo[nid];
+ map = rcu_dereference_protected(pn->shrinker_map, true);
+ kvfree(map);
+ rcu_assign_pointer(pn->shrinker_map, NULL);
+ }
+}
+
+int alloc_shrinker_maps(struct mem_cgroup *memcg)
+{
+ struct memcg_shrinker_map *map;
+ int nid, size, ret = 0;
+
+ if (mem_cgroup_is_root(memcg))
+ return 0;
+
+ mutex_lock(&memcg_shrinker_map_mutex);
+ size = memcg_shrinker_map_size;
+ for_each_node(nid) {
+ map = kvzalloc_node(sizeof(*map) + size, GFP_KERNEL, nid);
+ if (!map) {
+ free_shrinker_maps(memcg);
+ ret = -ENOMEM;
+ break;
+ }
+ rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_map, map);
+ }
+ mutex_unlock(&memcg_shrinker_map_mutex);
+
+ return ret;
+}
+
+static int expand_shrinker_maps(int new_id)
+{
+ int size, old_size, ret = 0;
+ struct mem_cgroup *memcg;
+
+ size = DIV_ROUND_UP(new_id + 1, BITS_PER_LONG) * sizeof(unsigned long);
+ old_size = memcg_shrinker_map_size;
+ if (size <= old_size)
+ return 0;
+
+ mutex_lock(&memcg_shrinker_map_mutex);
+ if (!root_mem_cgroup)
+ goto unlock;
+
+ memcg = mem_cgroup_iter(NULL, NULL, NULL);
+ do {
+ if (mem_cgroup_is_root(memcg))
+ continue;
+ ret = expand_one_shrinker_map(memcg, size, old_size);
+ if (ret) {
+ mem_cgroup_iter_break(NULL, memcg);
+ goto unlock;
+ }
+ } while ((memcg = mem_cgroup_iter(NULL, memcg, NULL)) != NULL);
+unlock:
+ if (!ret)
+ memcg_shrinker_map_size = size;
+ mutex_unlock(&memcg_shrinker_map_mutex);
+ return ret;
+}
+
+void set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id)
+{
+ if (shrinker_id >= 0 && memcg && !mem_cgroup_is_root(memcg)) {
+ struct memcg_shrinker_map *map;
+
+ rcu_read_lock();
+ map = rcu_dereference(memcg->nodeinfo[nid]->shrinker_map);
+ /* Pairs with smp mb in shrink_slab() */
+ smp_mb__before_atomic();
+ set_bit(shrinker_id, map->map);
+ rcu_read_unlock();
+ }
+}
+
/*
* We allow subsystems to populate their shrinker-related
* LRU lists before register_shrinker_prepared() is called
@@ -212,7 +338,7 @@ static int prealloc_memcg_shrinker(struc
goto unlock;
if (id >= shrinker_nr_max) {
- if (memcg_expand_shrinker_maps(id)) {
+ if (expand_shrinker_maps(id)) {
idr_remove(&shrinker_idr, id);
goto unlock;
}
@@ -590,7 +716,7 @@ static unsigned long shrink_slab_memcg(g
* case, we invoke the shrinker one more time and reset
* the bit if it reports that it is not empty anymore.
* The memory barrier here pairs with the barrier in
- * memcg_set_shrinker_bit():
+ * set_shrinker_bit():
*
* list_lru_add() shrink_slab_memcg()
* list_add_tail() clear_bit()
@@ -602,7 +728,7 @@ static unsigned long shrink_slab_memcg(g
if (ret == SHRINK_EMPTY)
ret = 0;
else
- memcg_set_shrinker_bit(memcg, nid, i);
+ set_shrinker_bit(memcg, nid, i);
}
freed += ret;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 064/143] mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation
2021-05-05 1:32 incoming Andrew Morton
` (62 preceding siblings ...)
2021-05-05 1:36 ` [patch 063/143] mm: vmscan: consolidate shrinker_maps handling code Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 065/143] mm: vmscan: remove memcg_shrinker_map_size Andrew Morton
` (76 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
shakeelb, shy828301, torvalds, vbabka
From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation
Since memcg_shrinker_map_size just can be changed under holding
shrinker_rwsem exclusively, the read side can be protected by holding read
lock, so it sounds superfluous to have a dedicated mutex.
Kirill Tkhai suggested use write lock since:
* We want the assignment to shrinker_maps is visible for shrink_slab_memcg().
* The rcu_dereference_protected() dereferrencing in shrink_slab_memcg(), but
in case of we use READ lock in alloc_shrinker_maps(), the dereferrencing
is not actually protected.
* READ lock makes alloc_shrinker_info() racy against memory allocation fail.
alloc_shrinker_info()->free_shrinker_info() may free memory right after
shrink_slab_memcg() dereferenced it. You may say
shrink_slab_memcg()->mem_cgroup_online() protects us from it? Yes, sure,
but this is not the thing we want to remember in the future, since this
spreads modularity.
And a test with heavy paging workload didn't show write lock makes things worse.
Link: https://lkml.kernel.org/r/20210311190845.9708-4-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmscan.c | 18 ++++++++----------
1 file changed, 8 insertions(+), 10 deletions(-)
--- a/mm/vmscan.c~mm-vmscan-use-shrinker_rwsem-to-protect-shrinker_maps-allocation
+++ a/mm/vmscan.c
@@ -187,7 +187,6 @@ static DECLARE_RWSEM(shrinker_rwsem);
#ifdef CONFIG_MEMCG
static int memcg_shrinker_map_size;
-static DEFINE_MUTEX(memcg_shrinker_map_mutex);
static void free_shrinker_map_rcu(struct rcu_head *head)
{
@@ -201,8 +200,6 @@ static int expand_one_shrinker_map(struc
struct mem_cgroup_per_node *pn;
int nid;
- lockdep_assert_held(&memcg_shrinker_map_mutex);
-
for_each_node(nid) {
pn = memcg->nodeinfo[nid];
old = rcu_dereference_protected(pn->shrinker_map, true);
@@ -250,7 +247,7 @@ int alloc_shrinker_maps(struct mem_cgrou
if (mem_cgroup_is_root(memcg))
return 0;
- mutex_lock(&memcg_shrinker_map_mutex);
+ down_write(&shrinker_rwsem);
size = memcg_shrinker_map_size;
for_each_node(nid) {
map = kvzalloc_node(sizeof(*map) + size, GFP_KERNEL, nid);
@@ -261,7 +258,7 @@ int alloc_shrinker_maps(struct mem_cgrou
}
rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_map, map);
}
- mutex_unlock(&memcg_shrinker_map_mutex);
+ up_write(&shrinker_rwsem);
return ret;
}
@@ -276,9 +273,10 @@ static int expand_shrinker_maps(int new_
if (size <= old_size)
return 0;
- mutex_lock(&memcg_shrinker_map_mutex);
if (!root_mem_cgroup)
- goto unlock;
+ goto out;
+
+ lockdep_assert_held(&shrinker_rwsem);
memcg = mem_cgroup_iter(NULL, NULL, NULL);
do {
@@ -287,13 +285,13 @@ static int expand_shrinker_maps(int new_
ret = expand_one_shrinker_map(memcg, size, old_size);
if (ret) {
mem_cgroup_iter_break(NULL, memcg);
- goto unlock;
+ goto out;
}
} while ((memcg = mem_cgroup_iter(NULL, memcg, NULL)) != NULL);
-unlock:
+out:
if (!ret)
memcg_shrinker_map_size = size;
- mutex_unlock(&memcg_shrinker_map_mutex);
+
return ret;
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 065/143] mm: vmscan: remove memcg_shrinker_map_size
2021-05-05 1:32 incoming Andrew Morton
` (63 preceding siblings ...)
2021-05-05 1:36 ` [patch 064/143] mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 066/143] mm: vmscan: use kvfree_rcu instead of call_rcu Andrew Morton
` (75 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
shakeelb, shy828301, torvalds, vbabka
From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: remove memcg_shrinker_map_size
Both memcg_shrinker_map_size and shrinker_nr_max is maintained, but
actually the map size can be calculated via shrinker_nr_max, so it seems
unnecessary to keep both. Remove memcg_shrinker_map_size since
shrinker_nr_max is also used by iterating the bit map.
Link: https://lkml.kernel.org/r/20210311190845.9708-5-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Roman Gushchin <guro@fb.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmscan.c | 20 +++++++++++---------
1 file changed, 11 insertions(+), 9 deletions(-)
--- a/mm/vmscan.c~mm-vmscan-remove-memcg_shrinker_map_size
+++ a/mm/vmscan.c
@@ -185,8 +185,12 @@ static LIST_HEAD(shrinker_list);
static DECLARE_RWSEM(shrinker_rwsem);
#ifdef CONFIG_MEMCG
+static int shrinker_nr_max;
-static int memcg_shrinker_map_size;
+static inline int shrinker_map_size(int nr_items)
+{
+ return (DIV_ROUND_UP(nr_items, BITS_PER_LONG) * sizeof(unsigned long));
+}
static void free_shrinker_map_rcu(struct rcu_head *head)
{
@@ -248,7 +252,7 @@ int alloc_shrinker_maps(struct mem_cgrou
return 0;
down_write(&shrinker_rwsem);
- size = memcg_shrinker_map_size;
+ size = shrinker_map_size(shrinker_nr_max);
for_each_node(nid) {
map = kvzalloc_node(sizeof(*map) + size, GFP_KERNEL, nid);
if (!map) {
@@ -266,12 +270,13 @@ int alloc_shrinker_maps(struct mem_cgrou
static int expand_shrinker_maps(int new_id)
{
int size, old_size, ret = 0;
+ int new_nr_max = new_id + 1;
struct mem_cgroup *memcg;
- size = DIV_ROUND_UP(new_id + 1, BITS_PER_LONG) * sizeof(unsigned long);
- old_size = memcg_shrinker_map_size;
+ size = shrinker_map_size(new_nr_max);
+ old_size = shrinker_map_size(shrinker_nr_max);
if (size <= old_size)
- return 0;
+ goto out;
if (!root_mem_cgroup)
goto out;
@@ -290,7 +295,7 @@ static int expand_shrinker_maps(int new_
} while ((memcg = mem_cgroup_iter(NULL, memcg, NULL)) != NULL);
out:
if (!ret)
- memcg_shrinker_map_size = size;
+ shrinker_nr_max = new_nr_max;
return ret;
}
@@ -323,7 +328,6 @@ void set_shrinker_bit(struct mem_cgroup
#define SHRINKER_REGISTERING ((struct shrinker *)~0UL)
static DEFINE_IDR(shrinker_idr);
-static int shrinker_nr_max;
static int prealloc_memcg_shrinker(struct shrinker *shrinker)
{
@@ -340,8 +344,6 @@ static int prealloc_memcg_shrinker(struc
idr_remove(&shrinker_idr, id);
goto unlock;
}
-
- shrinker_nr_max = id + 1;
}
shrinker->id = id;
ret = 0;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 066/143] mm: vmscan: use kvfree_rcu instead of call_rcu
2021-05-05 1:32 incoming Andrew Morton
` (64 preceding siblings ...)
2021-05-05 1:36 ` [patch 065/143] mm: vmscan: remove memcg_shrinker_map_size Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 067/143] mm: memcontrol: rename shrinker_map to shrinker_info Andrew Morton
` (74 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
shakeelb, shy828301, torvalds, vbabka
From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: use kvfree_rcu instead of call_rcu
Using kvfree_rcu() to free the old shrinker_maps instead of call_rcu().
We don't have to define a dedicated callback for call_rcu() anymore.
Link: https://lkml.kernel.org/r/20210311190845.9708-6-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Roman Gushchin <guro@fb.com>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmscan.c | 7 +------
1 file changed, 1 insertion(+), 6 deletions(-)
--- a/mm/vmscan.c~mm-vmscan-use-kvfree_rcu-instead-of-call_rcu
+++ a/mm/vmscan.c
@@ -192,11 +192,6 @@ static inline int shrinker_map_size(int
return (DIV_ROUND_UP(nr_items, BITS_PER_LONG) * sizeof(unsigned long));
}
-static void free_shrinker_map_rcu(struct rcu_head *head)
-{
- kvfree(container_of(head, struct memcg_shrinker_map, rcu));
-}
-
static int expand_one_shrinker_map(struct mem_cgroup *memcg,
int size, int old_size)
{
@@ -220,7 +215,7 @@ static int expand_one_shrinker_map(struc
memset((void *)new->map + old_size, 0, size - old_size);
rcu_assign_pointer(pn->shrinker_map, new);
- call_rcu(&old->rcu, free_shrinker_map_rcu);
+ kvfree_rcu(old, rcu);
}
return 0;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 067/143] mm: memcontrol: rename shrinker_map to shrinker_info
2021-05-05 1:32 incoming Andrew Morton
` (65 preceding siblings ...)
2021-05-05 1:36 ` [patch 066/143] mm: vmscan: use kvfree_rcu instead of call_rcu Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 068/143] mm: vmscan: add shrinker_info_protected() helper Andrew Morton
` (73 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
shakeelb, shy828301, torvalds, vbabka
From: Yang Shi <shy828301@gmail.com>
Subject: mm: memcontrol: rename shrinker_map to shrinker_info
The following patch is going to add nr_deferred into shrinker_map, the
change will make shrinker_map not only include map anymore, so rename it
to "memcg_shrinker_info". And this should make the patch adding
nr_deferred cleaner and readable and make review easier. Also remove the
"memcg_" prefix.
Link: https://lkml.kernel.org/r/20210311190845.9708-7-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/memcontrol.h | 8 ++--
mm/memcontrol.c | 6 +--
mm/vmscan.c | 58 +++++++++++++++++------------------
3 files changed, 36 insertions(+), 36 deletions(-)
--- a/include/linux/memcontrol.h~mm-memcontrol-rename-shrinker_map-to-shrinker_info
+++ a/include/linux/memcontrol.h
@@ -117,7 +117,7 @@ struct batched_lruvec_stat {
* Bitmap of shrinker::id corresponding to memcg-aware shrinkers,
* which have elements charged to this memcg.
*/
-struct memcg_shrinker_map {
+struct shrinker_info {
struct rcu_head rcu;
unsigned long map[];
};
@@ -145,7 +145,7 @@ struct mem_cgroup_per_node {
struct mem_cgroup_reclaim_iter iter;
- struct memcg_shrinker_map __rcu *shrinker_map;
+ struct shrinker_info __rcu *shrinker_info;
struct rb_node tree_node; /* RB tree node */
unsigned long usage_in_excess;/* Set to the value by which */
@@ -1610,8 +1610,8 @@ static inline bool mem_cgroup_under_sock
return false;
}
-int alloc_shrinker_maps(struct mem_cgroup *memcg);
-void free_shrinker_maps(struct mem_cgroup *memcg);
+int alloc_shrinker_info(struct mem_cgroup *memcg);
+void free_shrinker_info(struct mem_cgroup *memcg);
void set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id);
#else
#define mem_cgroup_sockets_enabled 0
--- a/mm/memcontrol.c~mm-memcontrol-rename-shrinker_map-to-shrinker_info
+++ a/mm/memcontrol.c
@@ -5118,11 +5118,11 @@ static int mem_cgroup_css_online(struct
struct mem_cgroup *memcg = mem_cgroup_from_css(css);
/*
- * A memcg must be visible for expand_shrinker_maps()
+ * A memcg must be visible for expand_shrinker_info()
* by the time the maps are allocated. So, we allocate maps
* here, when for_each_mem_cgroup() can't skip it.
*/
- if (alloc_shrinker_maps(memcg)) {
+ if (alloc_shrinker_info(memcg)) {
mem_cgroup_id_remove(memcg);
return -ENOMEM;
}
@@ -5186,7 +5186,7 @@ static void mem_cgroup_css_free(struct c
vmpressure_cleanup(&memcg->vmpressure);
cancel_work_sync(&memcg->high_work);
mem_cgroup_remove_from_trees(memcg);
- free_shrinker_maps(memcg);
+ free_shrinker_info(memcg);
memcg_free_kmem(memcg);
mem_cgroup_free(memcg);
}
--- a/mm/vmscan.c~mm-memcontrol-rename-shrinker_map-to-shrinker_info
+++ a/mm/vmscan.c
@@ -192,16 +192,16 @@ static inline int shrinker_map_size(int
return (DIV_ROUND_UP(nr_items, BITS_PER_LONG) * sizeof(unsigned long));
}
-static int expand_one_shrinker_map(struct mem_cgroup *memcg,
- int size, int old_size)
+static int expand_one_shrinker_info(struct mem_cgroup *memcg,
+ int size, int old_size)
{
- struct memcg_shrinker_map *new, *old;
+ struct shrinker_info *new, *old;
struct mem_cgroup_per_node *pn;
int nid;
for_each_node(nid) {
pn = memcg->nodeinfo[nid];
- old = rcu_dereference_protected(pn->shrinker_map, true);
+ old = rcu_dereference_protected(pn->shrinker_info, true);
/* Not yet online memcg */
if (!old)
return 0;
@@ -214,17 +214,17 @@ static int expand_one_shrinker_map(struc
memset(new->map, (int)0xff, old_size);
memset((void *)new->map + old_size, 0, size - old_size);
- rcu_assign_pointer(pn->shrinker_map, new);
+ rcu_assign_pointer(pn->shrinker_info, new);
kvfree_rcu(old, rcu);
}
return 0;
}
-void free_shrinker_maps(struct mem_cgroup *memcg)
+void free_shrinker_info(struct mem_cgroup *memcg)
{
struct mem_cgroup_per_node *pn;
- struct memcg_shrinker_map *map;
+ struct shrinker_info *info;
int nid;
if (mem_cgroup_is_root(memcg))
@@ -232,15 +232,15 @@ void free_shrinker_maps(struct mem_cgrou
for_each_node(nid) {
pn = memcg->nodeinfo[nid];
- map = rcu_dereference_protected(pn->shrinker_map, true);
- kvfree(map);
- rcu_assign_pointer(pn->shrinker_map, NULL);
+ info = rcu_dereference_protected(pn->shrinker_info, true);
+ kvfree(info);
+ rcu_assign_pointer(pn->shrinker_info, NULL);
}
}
-int alloc_shrinker_maps(struct mem_cgroup *memcg)
+int alloc_shrinker_info(struct mem_cgroup *memcg)
{
- struct memcg_shrinker_map *map;
+ struct shrinker_info *info;
int nid, size, ret = 0;
if (mem_cgroup_is_root(memcg))
@@ -249,20 +249,20 @@ int alloc_shrinker_maps(struct mem_cgrou
down_write(&shrinker_rwsem);
size = shrinker_map_size(shrinker_nr_max);
for_each_node(nid) {
- map = kvzalloc_node(sizeof(*map) + size, GFP_KERNEL, nid);
- if (!map) {
- free_shrinker_maps(memcg);
+ info = kvzalloc_node(sizeof(*info) + size, GFP_KERNEL, nid);
+ if (!info) {
+ free_shrinker_info(memcg);
ret = -ENOMEM;
break;
}
- rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_map, map);
+ rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_info, info);
}
up_write(&shrinker_rwsem);
return ret;
}
-static int expand_shrinker_maps(int new_id)
+static int expand_shrinker_info(int new_id)
{
int size, old_size, ret = 0;
int new_nr_max = new_id + 1;
@@ -282,7 +282,7 @@ static int expand_shrinker_maps(int new_
do {
if (mem_cgroup_is_root(memcg))
continue;
- ret = expand_one_shrinker_map(memcg, size, old_size);
+ ret = expand_one_shrinker_info(memcg, size, old_size);
if (ret) {
mem_cgroup_iter_break(NULL, memcg);
goto out;
@@ -298,13 +298,13 @@ out:
void set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id)
{
if (shrinker_id >= 0 && memcg && !mem_cgroup_is_root(memcg)) {
- struct memcg_shrinker_map *map;
+ struct shrinker_info *info;
rcu_read_lock();
- map = rcu_dereference(memcg->nodeinfo[nid]->shrinker_map);
+ info = rcu_dereference(memcg->nodeinfo[nid]->shrinker_info);
/* Pairs with smp mb in shrink_slab() */
smp_mb__before_atomic();
- set_bit(shrinker_id, map->map);
+ set_bit(shrinker_id, info->map);
rcu_read_unlock();
}
}
@@ -335,7 +335,7 @@ static int prealloc_memcg_shrinker(struc
goto unlock;
if (id >= shrinker_nr_max) {
- if (expand_shrinker_maps(id)) {
+ if (expand_shrinker_info(id)) {
idr_remove(&shrinker_idr, id);
goto unlock;
}
@@ -665,7 +665,7 @@ static unsigned long do_shrink_slab(stru
static unsigned long shrink_slab_memcg(gfp_t gfp_mask, int nid,
struct mem_cgroup *memcg, int priority)
{
- struct memcg_shrinker_map *map;
+ struct shrinker_info *info;
unsigned long ret, freed = 0;
int i;
@@ -675,12 +675,12 @@ static unsigned long shrink_slab_memcg(g
if (!down_read_trylock(&shrinker_rwsem))
return 0;
- map = rcu_dereference_protected(memcg->nodeinfo[nid]->shrinker_map,
- true);
- if (unlikely(!map))
+ info = rcu_dereference_protected(memcg->nodeinfo[nid]->shrinker_info,
+ true);
+ if (unlikely(!info))
goto unlock;
- for_each_set_bit(i, map->map, shrinker_nr_max) {
+ for_each_set_bit(i, info->map, shrinker_nr_max) {
struct shrink_control sc = {
.gfp_mask = gfp_mask,
.nid = nid,
@@ -691,7 +691,7 @@ static unsigned long shrink_slab_memcg(g
shrinker = idr_find(&shrinker_idr, i);
if (unlikely(!shrinker || shrinker == SHRINKER_REGISTERING)) {
if (!shrinker)
- clear_bit(i, map->map);
+ clear_bit(i, info->map);
continue;
}
@@ -702,7 +702,7 @@ static unsigned long shrink_slab_memcg(g
ret = do_shrink_slab(&sc, shrinker, priority);
if (ret == SHRINK_EMPTY) {
- clear_bit(i, map->map);
+ clear_bit(i, info->map);
/*
* After the shrinker reported that it had no objects to
* free, but before we cleared the corresponding bit in
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 068/143] mm: vmscan: add shrinker_info_protected() helper
2021-05-05 1:32 incoming Andrew Morton
` (66 preceding siblings ...)
2021-05-05 1:36 ` [patch 067/143] mm: memcontrol: rename shrinker_map to shrinker_info Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 069/143] mm: vmscan: use a new flag to indicate shrinker is registered Andrew Morton
` (72 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
shakeelb, shy828301, torvalds, vbabka
From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: add shrinker_info_protected() helper
The shrinker_info is dereferenced in a couple of places via
rcu_dereference_protected with different calling conventions, for example,
using mem_cgroup_nodeinfo helper or dereferencing
memcg->nodeinfo[nid]->shrinker_info. And the later patch will add more
dereference places.
So extract the dereference into a helper to make the code more readable.
No functional change.
[akpm@linux-foundation.org: retain rcu_dereference_protected() in free_shrinker_info(), per Hugh]
Link: https://lkml.kernel.org/r/20210311190845.9708-8-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Roman Gushchin <guro@fb.com>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmscan.c | 12 +++++++++---
1 file changed, 9 insertions(+), 3 deletions(-)
--- a/mm/vmscan.c~mm-vmscan-add-shrinker_info_protected-helper
+++ a/mm/vmscan.c
@@ -192,6 +192,13 @@ static inline int shrinker_map_size(int
return (DIV_ROUND_UP(nr_items, BITS_PER_LONG) * sizeof(unsigned long));
}
+static struct shrinker_info *shrinker_info_protected(struct mem_cgroup *memcg,
+ int nid)
+{
+ return rcu_dereference_protected(memcg->nodeinfo[nid]->shrinker_info,
+ lockdep_is_held(&shrinker_rwsem));
+}
+
static int expand_one_shrinker_info(struct mem_cgroup *memcg,
int size, int old_size)
{
@@ -201,7 +208,7 @@ static int expand_one_shrinker_info(stru
for_each_node(nid) {
pn = memcg->nodeinfo[nid];
- old = rcu_dereference_protected(pn->shrinker_info, true);
+ old = shrinker_info_protected(memcg, nid);
/* Not yet online memcg */
if (!old)
return 0;
@@ -675,8 +682,7 @@ static unsigned long shrink_slab_memcg(g
if (!down_read_trylock(&shrinker_rwsem))
return 0;
- info = rcu_dereference_protected(memcg->nodeinfo[nid]->shrinker_info,
- true);
+ info = shrinker_info_protected(memcg, nid);
if (unlikely(!info))
goto unlock;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 069/143] mm: vmscan: use a new flag to indicate shrinker is registered
2021-05-05 1:32 incoming Andrew Morton
` (67 preceding siblings ...)
2021-05-05 1:36 ` [patch 068/143] mm: vmscan: add shrinker_info_protected() helper Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 070/143] mm: vmscan: add per memcg shrinker nr_deferred Andrew Morton
` (71 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
shakeelb, shy828301, torvalds, vbabka
From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: use a new flag to indicate shrinker is registered
Currently registered shrinker is indicated by non-NULL
shrinker->nr_deferred. This approach is fine with nr_deferred at the
shrinker level, but the following patches will move MEMCG_AWARE shrinkers'
nr_deferred to memcg level, so their shrinker->nr_deferred would always be
NULL. This would prevent the shrinkers from unregistering correctly.
Remove SHRINKER_REGISTERING since we could check if shrinker is registered
successfully by the new flag.
Link: https://lkml.kernel.org/r/20210311190845.9708-9-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/shrinker.h | 7 +++---
mm/vmscan.c | 40 +++++++++++++------------------------
2 files changed, 19 insertions(+), 28 deletions(-)
--- a/include/linux/shrinker.h~mm-vmscan-use-a-new-flag-to-indicate-shrinker-is-registered
+++ a/include/linux/shrinker.h
@@ -79,13 +79,14 @@ struct shrinker {
#define DEFAULT_SEEKS 2 /* A good number if you don't know better. */
/* Flags */
-#define SHRINKER_NUMA_AWARE (1 << 0)
-#define SHRINKER_MEMCG_AWARE (1 << 1)
+#define SHRINKER_REGISTERED (1 << 0)
+#define SHRINKER_NUMA_AWARE (1 << 1)
+#define SHRINKER_MEMCG_AWARE (1 << 2)
/*
* It just makes sense when the shrinker is also MEMCG_AWARE for now,
* non-MEMCG_AWARE shrinker should not have this flag set.
*/
-#define SHRINKER_NONSLAB (1 << 2)
+#define SHRINKER_NONSLAB (1 << 3)
extern int prealloc_shrinker(struct shrinker *shrinker);
extern void register_shrinker_prepared(struct shrinker *shrinker);
--- a/mm/vmscan.c~mm-vmscan-use-a-new-flag-to-indicate-shrinker-is-registered
+++ a/mm/vmscan.c
@@ -316,19 +316,6 @@ void set_shrinker_bit(struct mem_cgroup
}
}
-/*
- * We allow subsystems to populate their shrinker-related
- * LRU lists before register_shrinker_prepared() is called
- * for the shrinker, since we don't want to impose
- * restrictions on their internal registration order.
- * In this case shrink_slab_memcg() may find corresponding
- * bit is set in the shrinkers map.
- *
- * This value is used by the function to detect registering
- * shrinkers and to skip do_shrink_slab() calls for them.
- */
-#define SHRINKER_REGISTERING ((struct shrinker *)~0UL)
-
static DEFINE_IDR(shrinker_idr);
static int prealloc_memcg_shrinker(struct shrinker *shrinker)
@@ -337,7 +324,7 @@ static int prealloc_memcg_shrinker(struc
down_write(&shrinker_rwsem);
/* This may call shrinker, so it must use down_read_trylock() */
- id = idr_alloc(&shrinker_idr, SHRINKER_REGISTERING, 0, 0, GFP_KERNEL);
+ id = idr_alloc(&shrinker_idr, shrinker, 0, 0, GFP_KERNEL);
if (id < 0)
goto unlock;
@@ -360,9 +347,9 @@ static void unregister_memcg_shrinker(st
BUG_ON(id < 0);
- down_write(&shrinker_rwsem);
+ lockdep_assert_held(&shrinker_rwsem);
+
idr_remove(&shrinker_idr, id);
- up_write(&shrinker_rwsem);
}
static bool cgroup_reclaim(struct scan_control *sc)
@@ -490,8 +477,11 @@ void free_prealloced_shrinker(struct shr
if (!shrinker->nr_deferred)
return;
- if (shrinker->flags & SHRINKER_MEMCG_AWARE)
+ if (shrinker->flags & SHRINKER_MEMCG_AWARE) {
+ down_write(&shrinker_rwsem);
unregister_memcg_shrinker(shrinker);
+ up_write(&shrinker_rwsem);
+ }
kfree(shrinker->nr_deferred);
shrinker->nr_deferred = NULL;
@@ -501,10 +491,7 @@ void register_shrinker_prepared(struct s
{
down_write(&shrinker_rwsem);
list_add_tail(&shrinker->list, &shrinker_list);
-#ifdef CONFIG_MEMCG
- if (shrinker->flags & SHRINKER_MEMCG_AWARE)
- idr_replace(&shrinker_idr, shrinker, shrinker->id);
-#endif
+ shrinker->flags |= SHRINKER_REGISTERED;
up_write(&shrinker_rwsem);
}
@@ -524,13 +511,16 @@ EXPORT_SYMBOL(register_shrinker);
*/
void unregister_shrinker(struct shrinker *shrinker)
{
- if (!shrinker->nr_deferred)
+ if (!(shrinker->flags & SHRINKER_REGISTERED))
return;
- if (shrinker->flags & SHRINKER_MEMCG_AWARE)
- unregister_memcg_shrinker(shrinker);
+
down_write(&shrinker_rwsem);
list_del(&shrinker->list);
+ shrinker->flags &= ~SHRINKER_REGISTERED;
+ if (shrinker->flags & SHRINKER_MEMCG_AWARE)
+ unregister_memcg_shrinker(shrinker);
up_write(&shrinker_rwsem);
+
kfree(shrinker->nr_deferred);
shrinker->nr_deferred = NULL;
}
@@ -695,7 +685,7 @@ static unsigned long shrink_slab_memcg(g
struct shrinker *shrinker;
shrinker = idr_find(&shrinker_idr, i);
- if (unlikely(!shrinker || shrinker == SHRINKER_REGISTERING)) {
+ if (unlikely(!shrinker || !(shrinker->flags & SHRINKER_REGISTERED))) {
if (!shrinker)
clear_bit(i, info->map);
continue;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 070/143] mm: vmscan: add per memcg shrinker nr_deferred
2021-05-05 1:32 incoming Andrew Morton
` (68 preceding siblings ...)
2021-05-05 1:36 ` [patch 069/143] mm: vmscan: use a new flag to indicate shrinker is registered Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 071/143] mm: vmscan: use per memcg nr_deferred of shrinker Andrew Morton
` (70 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
shakeelb, shy828301, torvalds, vbabka
From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: add per memcg shrinker nr_deferred
Currently the number of deferred objects are per shrinker, but some slabs,
for example, vfs inode/dentry cache are per memcg, this would result in
poor isolation among memcgs.
The deferred objects typically are generated by __GFP_NOFS allocations,
one memcg with excessive __GFP_NOFS allocations may blow up deferred
objects, then other innocent memcgs may suffer from over shrink, excessive
reclaim latency, etc.
For example, two workloads run in memcgA and memcgB respectively, workload
in B is vfs heavy workload. Workload in A generates excessive deferred
objects, then B's vfs cache might be hit heavily (drop half of caches) by
B's limit reclaim or global reclaim.
We observed this hit in our production environment which was running vfs
heavy workload shown as the below tracing log:
<...>-409454 [016] .... 28286961.747146: mm_shrink_slab_start: super_cache_scan+0x0/0x1a0 ffff9a83046f3458:
nid: 1 objects to shrink 3641681686040 gfp_flags GFP_HIGHUSER_MOVABLE|__GFP_ZERO pgs_scanned 1 lru_pgs 15721
cache items 246404277 delta 31345 total_scan 123202138
<...>-409454 [022] .... 28287105.928018: mm_shrink_slab_end: super_cache_scan+0x0/0x1a0 ffff9a83046f3458:
nid: 1 unused scan count 3641681686040 new scan count 3641798379189 total_scan 602
last shrinker return val 123186855
The vfs cache and page cache ratio was 10:1 on this machine, and half of
caches were dropped. This also resulted in significant amount of page
caches were dropped due to inodes eviction.
Make nr_deferred per memcg for memcg aware shrinkers would solve the
unfairness and bring better isolation.
The following patch will add nr_deferred to parent memcg when memcg
offline. To preserve nr_deferred when reparenting memcgs to root, root
memcg needs shrinker_info allocated too.
When memcg is not enabled (!CONFIG_MEMCG or memcg disabled), the
shrinker's nr_deferred would be used. And non memcg aware shrinkers use
shrinker's nr_deferred all the time.
Link: https://lkml.kernel.org/r/20210311190845.9708-10-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Roman Gushchin <guro@fb.com>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/memcontrol.h | 7 ++--
mm/vmscan.c | 60 ++++++++++++++++++++++++-----------
2 files changed, 46 insertions(+), 21 deletions(-)
--- a/include/linux/memcontrol.h~mm-vmscan-add-per-memcg-shrinker-nr_deferred
+++ a/include/linux/memcontrol.h
@@ -114,12 +114,13 @@ struct batched_lruvec_stat {
};
/*
- * Bitmap of shrinker::id corresponding to memcg-aware shrinkers,
- * which have elements charged to this memcg.
+ * Bitmap and deferred work of shrinker::id corresponding to memcg-aware
+ * shrinkers, which have elements charged to this memcg.
*/
struct shrinker_info {
struct rcu_head rcu;
- unsigned long map[];
+ atomic_long_t *nr_deferred;
+ unsigned long *map;
};
/*
--- a/mm/vmscan.c~mm-vmscan-add-per-memcg-shrinker-nr_deferred
+++ a/mm/vmscan.c
@@ -187,11 +187,17 @@ static DECLARE_RWSEM(shrinker_rwsem);
#ifdef CONFIG_MEMCG
static int shrinker_nr_max;
+/* The shrinker_info is expanded in a batch of BITS_PER_LONG */
static inline int shrinker_map_size(int nr_items)
{
return (DIV_ROUND_UP(nr_items, BITS_PER_LONG) * sizeof(unsigned long));
}
+static inline int shrinker_defer_size(int nr_items)
+{
+ return (round_up(nr_items, BITS_PER_LONG) * sizeof(atomic_long_t));
+}
+
static struct shrinker_info *shrinker_info_protected(struct mem_cgroup *memcg,
int nid)
{
@@ -200,11 +206,13 @@ static struct shrinker_info *shrinker_in
}
static int expand_one_shrinker_info(struct mem_cgroup *memcg,
- int size, int old_size)
+ int map_size, int defer_size,
+ int old_map_size, int old_defer_size)
{
struct shrinker_info *new, *old;
struct mem_cgroup_per_node *pn;
int nid;
+ int size = map_size + defer_size;
for_each_node(nid) {
pn = memcg->nodeinfo[nid];
@@ -217,9 +225,16 @@ static int expand_one_shrinker_info(stru
if (!new)
return -ENOMEM;
- /* Set all old bits, clear all new bits */
- memset(new->map, (int)0xff, old_size);
- memset((void *)new->map + old_size, 0, size - old_size);
+ new->nr_deferred = (atomic_long_t *)(new + 1);
+ new->map = (void *)new->nr_deferred + defer_size;
+
+ /* map: set all old bits, clear all new bits */
+ memset(new->map, (int)0xff, old_map_size);
+ memset((void *)new->map + old_map_size, 0, map_size - old_map_size);
+ /* nr_deferred: copy old values, clear all new values */
+ memcpy(new->nr_deferred, old->nr_deferred, old_defer_size);
+ memset((void *)new->nr_deferred + old_defer_size, 0,
+ defer_size - old_defer_size);
rcu_assign_pointer(pn->shrinker_info, new);
kvfree_rcu(old, rcu);
@@ -234,9 +249,6 @@ void free_shrinker_info(struct mem_cgrou
struct shrinker_info *info;
int nid;
- if (mem_cgroup_is_root(memcg))
- return;
-
for_each_node(nid) {
pn = memcg->nodeinfo[nid];
info = rcu_dereference_protected(pn->shrinker_info, true);
@@ -249,12 +261,12 @@ int alloc_shrinker_info(struct mem_cgrou
{
struct shrinker_info *info;
int nid, size, ret = 0;
-
- if (mem_cgroup_is_root(memcg))
- return 0;
+ int map_size, defer_size = 0;
down_write(&shrinker_rwsem);
- size = shrinker_map_size(shrinker_nr_max);
+ map_size = shrinker_map_size(shrinker_nr_max);
+ defer_size = shrinker_defer_size(shrinker_nr_max);
+ size = map_size + defer_size;
for_each_node(nid) {
info = kvzalloc_node(sizeof(*info) + size, GFP_KERNEL, nid);
if (!info) {
@@ -262,6 +274,8 @@ int alloc_shrinker_info(struct mem_cgrou
ret = -ENOMEM;
break;
}
+ info->nr_deferred = (atomic_long_t *)(info + 1);
+ info->map = (void *)info->nr_deferred + defer_size;
rcu_assign_pointer(memcg->nodeinfo[nid]->shrinker_info, info);
}
up_write(&shrinker_rwsem);
@@ -269,15 +283,21 @@ int alloc_shrinker_info(struct mem_cgrou
return ret;
}
+static inline bool need_expand(int nr_max)
+{
+ return round_up(nr_max, BITS_PER_LONG) >
+ round_up(shrinker_nr_max, BITS_PER_LONG);
+}
+
static int expand_shrinker_info(int new_id)
{
- int size, old_size, ret = 0;
+ int ret = 0;
int new_nr_max = new_id + 1;
+ int map_size, defer_size = 0;
+ int old_map_size, old_defer_size = 0;
struct mem_cgroup *memcg;
- size = shrinker_map_size(new_nr_max);
- old_size = shrinker_map_size(shrinker_nr_max);
- if (size <= old_size)
+ if (!need_expand(new_nr_max))
goto out;
if (!root_mem_cgroup)
@@ -285,11 +305,15 @@ static int expand_shrinker_info(int new_
lockdep_assert_held(&shrinker_rwsem);
+ map_size = shrinker_map_size(new_nr_max);
+ defer_size = shrinker_defer_size(new_nr_max);
+ old_map_size = shrinker_map_size(shrinker_nr_max);
+ old_defer_size = shrinker_defer_size(shrinker_nr_max);
+
memcg = mem_cgroup_iter(NULL, NULL, NULL);
do {
- if (mem_cgroup_is_root(memcg))
- continue;
- ret = expand_one_shrinker_info(memcg, size, old_size);
+ ret = expand_one_shrinker_info(memcg, map_size, defer_size,
+ old_map_size, old_defer_size);
if (ret) {
mem_cgroup_iter_break(NULL, memcg);
goto out;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 071/143] mm: vmscan: use per memcg nr_deferred of shrinker
2021-05-05 1:32 incoming Andrew Morton
` (69 preceding siblings ...)
2021-05-05 1:36 ` [patch 070/143] mm: vmscan: add per memcg shrinker nr_deferred Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 072/143] mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers Andrew Morton
` (69 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
shakeelb, shy828301, torvalds, vbabka
From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: use per memcg nr_deferred of shrinker
Use per memcg's nr_deferred for memcg aware shrinkers. The shrinker's
nr_deferred will be used in the following cases:
1. Non memcg aware shrinkers
2. !CONFIG_MEMCG
3. memcg is disabled by boot parameter
Link: https://lkml.kernel.org/r/20210311190845.9708-11-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Roman Gushchin <guro@fb.com>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmscan.c | 78 ++++++++++++++++++++++++++++++++++++++++++--------
1 file changed, 66 insertions(+), 12 deletions(-)
--- a/mm/vmscan.c~mm-vmscan-use-per-memcg-nr_deferred-of-shrinker
+++ a/mm/vmscan.c
@@ -376,6 +376,24 @@ static void unregister_memcg_shrinker(st
idr_remove(&shrinker_idr, id);
}
+static long xchg_nr_deferred_memcg(int nid, struct shrinker *shrinker,
+ struct mem_cgroup *memcg)
+{
+ struct shrinker_info *info;
+
+ info = shrinker_info_protected(memcg, nid);
+ return atomic_long_xchg(&info->nr_deferred[shrinker->id], 0);
+}
+
+static long add_nr_deferred_memcg(long nr, int nid, struct shrinker *shrinker,
+ struct mem_cgroup *memcg)
+{
+ struct shrinker_info *info;
+
+ info = shrinker_info_protected(memcg, nid);
+ return atomic_long_add_return(nr, &info->nr_deferred[shrinker->id]);
+}
+
static bool cgroup_reclaim(struct scan_control *sc)
{
return sc->target_mem_cgroup;
@@ -414,6 +432,18 @@ static void unregister_memcg_shrinker(st
{
}
+static long xchg_nr_deferred_memcg(int nid, struct shrinker *shrinker,
+ struct mem_cgroup *memcg)
+{
+ return 0;
+}
+
+static long add_nr_deferred_memcg(long nr, int nid, struct shrinker *shrinker,
+ struct mem_cgroup *memcg)
+{
+ return 0;
+}
+
static bool cgroup_reclaim(struct scan_control *sc)
{
return false;
@@ -425,6 +455,39 @@ static bool writeback_throttling_sane(st
}
#endif
+static long xchg_nr_deferred(struct shrinker *shrinker,
+ struct shrink_control *sc)
+{
+ int nid = sc->nid;
+
+ if (!(shrinker->flags & SHRINKER_NUMA_AWARE))
+ nid = 0;
+
+ if (sc->memcg &&
+ (shrinker->flags & SHRINKER_MEMCG_AWARE))
+ return xchg_nr_deferred_memcg(nid, shrinker,
+ sc->memcg);
+
+ return atomic_long_xchg(&shrinker->nr_deferred[nid], 0);
+}
+
+
+static long add_nr_deferred(long nr, struct shrinker *shrinker,
+ struct shrink_control *sc)
+{
+ int nid = sc->nid;
+
+ if (!(shrinker->flags & SHRINKER_NUMA_AWARE))
+ nid = 0;
+
+ if (sc->memcg &&
+ (shrinker->flags & SHRINKER_MEMCG_AWARE))
+ return add_nr_deferred_memcg(nr, nid, shrinker,
+ sc->memcg);
+
+ return atomic_long_add_return(nr, &shrinker->nr_deferred[nid]);
+}
+
/*
* This misses isolated pages which are not accounted for to save counters.
* As the data only determines if reclaim or compaction continues, it is
@@ -561,14 +624,10 @@ static unsigned long do_shrink_slab(stru
long freeable;
long nr;
long new_nr;
- int nid = shrinkctl->nid;
long batch_size = shrinker->batch ? shrinker->batch
: SHRINK_BATCH;
long scanned = 0, next_deferred;
- if (!(shrinker->flags & SHRINKER_NUMA_AWARE))
- nid = 0;
-
freeable = shrinker->count_objects(shrinker, shrinkctl);
if (freeable == 0 || freeable == SHRINK_EMPTY)
return freeable;
@@ -578,7 +637,7 @@ static unsigned long do_shrink_slab(stru
* and zero it so that other concurrent shrinker invocations
* don't also do this scanning work.
*/
- nr = atomic_long_xchg(&shrinker->nr_deferred[nid], 0);
+ nr = xchg_nr_deferred(shrinker, shrinkctl);
total_scan = nr;
if (shrinker->seeks) {
@@ -669,14 +728,9 @@ static unsigned long do_shrink_slab(stru
next_deferred = 0;
/*
* move the unused scan count back into the shrinker in a
- * manner that handles concurrent updates. If we exhausted the
- * scan, there is no need to do an update.
+ * manner that handles concurrent updates.
*/
- if (next_deferred > 0)
- new_nr = atomic_long_add_return(next_deferred,
- &shrinker->nr_deferred[nid]);
- else
- new_nr = atomic_long_read(&shrinker->nr_deferred[nid]);
+ new_nr = add_nr_deferred(next_deferred, shrinker, shrinkctl);
trace_mm_shrink_slab_end(shrinker, shrinkctl->nid, freed, nr, new_nr, total_scan);
return freed;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 072/143] mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers
2021-05-05 1:32 incoming Andrew Morton
` (70 preceding siblings ...)
2021-05-05 1:36 ` [patch 071/143] mm: vmscan: use per memcg nr_deferred of shrinker Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 073/143] mm: memcontrol: reparent nr_deferred when memcg offline Andrew Morton
` (68 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
shakeelb, shy828301, torvalds, vbabka
From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers
Now nr_deferred is available on per memcg level for memcg aware shrinkers,
so don't need allocate shrinker->nr_deferred for such shrinkers anymore.
The prealloc_memcg_shrinker() would return -ENOSYS if !CONFIG_MEMCG or
memcg is disabled by kernel command line, then shrinker's
SHRINKER_MEMCG_AWARE flag would be cleared. This makes the implementation
of this patch simpler.
Link: https://lkml.kernel.org/r/20210311190845.9708-12-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmscan.c | 31 ++++++++++++++++---------------
1 file changed, 16 insertions(+), 15 deletions(-)
--- a/mm/vmscan.c~mm-vmscan-dont-need-allocate-shrinker-nr_deferred-for-memcg-aware-shrinkers
+++ a/mm/vmscan.c
@@ -346,6 +346,9 @@ static int prealloc_memcg_shrinker(struc
{
int id, ret = -ENOMEM;
+ if (mem_cgroup_disabled())
+ return -ENOSYS;
+
down_write(&shrinker_rwsem);
/* This may call shrinker, so it must use down_read_trylock() */
id = idr_alloc(&shrinker_idr, shrinker, 0, 0, GFP_KERNEL);
@@ -425,7 +428,7 @@ static bool writeback_throttling_sane(st
#else
static int prealloc_memcg_shrinker(struct shrinker *shrinker)
{
- return 0;
+ return -ENOSYS;
}
static void unregister_memcg_shrinker(struct shrinker *shrinker)
@@ -537,8 +540,18 @@ static unsigned long lruvec_lru_size(str
*/
int prealloc_shrinker(struct shrinker *shrinker)
{
- unsigned int size = sizeof(*shrinker->nr_deferred);
+ unsigned int size;
+ int err;
+
+ if (shrinker->flags & SHRINKER_MEMCG_AWARE) {
+ err = prealloc_memcg_shrinker(shrinker);
+ if (err != -ENOSYS)
+ return err;
+ shrinker->flags &= ~SHRINKER_MEMCG_AWARE;
+ }
+
+ size = sizeof(*shrinker->nr_deferred);
if (shrinker->flags & SHRINKER_NUMA_AWARE)
size *= nr_node_ids;
@@ -546,28 +559,16 @@ int prealloc_shrinker(struct shrinker *s
if (!shrinker->nr_deferred)
return -ENOMEM;
- if (shrinker->flags & SHRINKER_MEMCG_AWARE) {
- if (prealloc_memcg_shrinker(shrinker))
- goto free_deferred;
- }
-
return 0;
-
-free_deferred:
- kfree(shrinker->nr_deferred);
- shrinker->nr_deferred = NULL;
- return -ENOMEM;
}
void free_prealloced_shrinker(struct shrinker *shrinker)
{
- if (!shrinker->nr_deferred)
- return;
-
if (shrinker->flags & SHRINKER_MEMCG_AWARE) {
down_write(&shrinker_rwsem);
unregister_memcg_shrinker(shrinker);
up_write(&shrinker_rwsem);
+ return;
}
kfree(shrinker->nr_deferred);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 073/143] mm: memcontrol: reparent nr_deferred when memcg offline
2021-05-05 1:32 incoming Andrew Morton
` (71 preceding siblings ...)
2021-05-05 1:36 ` [patch 072/143] mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 074/143] mm: vmscan: shrink deferred objects proportional to priority Andrew Morton
` (67 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, david, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
shakeelb, shy828301, torvalds, vbabka
From: Yang Shi <shy828301@gmail.com>
Subject: mm: memcontrol: reparent nr_deferred when memcg offline
Now shrinker's nr_deferred is per memcg for memcg aware shrinkers, add to
parent's corresponding nr_deferred when memcg offline.
Link: https://lkml.kernel.org/r/20210311190845.9708-13-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Acked-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/memcontrol.h | 1 +
mm/memcontrol.c | 1 +
mm/vmscan.c | 24 ++++++++++++++++++++++++
3 files changed, 26 insertions(+)
--- a/include/linux/memcontrol.h~mm-memcontrol-reparent-nr_deferred-when-memcg-offline
+++ a/include/linux/memcontrol.h
@@ -1614,6 +1614,7 @@ static inline bool mem_cgroup_under_sock
int alloc_shrinker_info(struct mem_cgroup *memcg);
void free_shrinker_info(struct mem_cgroup *memcg);
void set_shrinker_bit(struct mem_cgroup *memcg, int nid, int shrinker_id);
+void reparent_shrinker_deferred(struct mem_cgroup *memcg);
#else
#define mem_cgroup_sockets_enabled 0
static inline void mem_cgroup_sk_alloc(struct sock *sk) { };
--- a/mm/memcontrol.c~mm-memcontrol-reparent-nr_deferred-when-memcg-offline
+++ a/mm/memcontrol.c
@@ -5154,6 +5154,7 @@ static void mem_cgroup_css_offline(struc
page_counter_set_low(&memcg->memory, 0);
memcg_offline_kmem(memcg);
+ reparent_shrinker_deferred(memcg);
wb_memcg_offline(memcg);
drain_all_stock(memcg);
--- a/mm/vmscan.c~mm-memcontrol-reparent-nr_deferred-when-memcg-offline
+++ a/mm/vmscan.c
@@ -397,6 +397,30 @@ static long add_nr_deferred_memcg(long n
return atomic_long_add_return(nr, &info->nr_deferred[shrinker->id]);
}
+void reparent_shrinker_deferred(struct mem_cgroup *memcg)
+{
+ int i, nid;
+ long nr;
+ struct mem_cgroup *parent;
+ struct shrinker_info *child_info, *parent_info;
+
+ parent = parent_mem_cgroup(memcg);
+ if (!parent)
+ parent = root_mem_cgroup;
+
+ /* Prevent from concurrent shrinker_info expand */
+ down_read(&shrinker_rwsem);
+ for_each_node(nid) {
+ child_info = shrinker_info_protected(memcg, nid);
+ parent_info = shrinker_info_protected(parent, nid);
+ for (i = 0; i < shrinker_nr_max; i++) {
+ nr = atomic_long_read(&child_info->nr_deferred[i]);
+ atomic_long_add(nr, &parent_info->nr_deferred[i]);
+ }
+ }
+ up_read(&shrinker_rwsem);
+}
+
static bool cgroup_reclaim(struct scan_control *sc)
{
return sc->target_mem_cgroup;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 074/143] mm: vmscan: shrink deferred objects proportional to priority
2021-05-05 1:32 incoming Andrew Morton
` (72 preceding siblings ...)
2021-05-05 1:36 ` [patch 073/143] mm: memcontrol: reparent nr_deferred when memcg offline Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 075/143] mm/compaction: remove unused variable sysctl_compact_memory Andrew Morton
` (66 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, guro, hannes, ktkhai, linux-mm, mhocko, mm-commits,
shakeelb, shy828301, torvalds, vbabka
From: Yang Shi <shy828301@gmail.com>
Subject: mm: vmscan: shrink deferred objects proportional to priority
The number of deferred objects might get windup to an absurd number, and
it results in clamp of slab objects. It is undesirable for sustaining
workingset.
So shrink deferred objects proportional to priority and cap nr_deferred to
twice of cache items.
The idea is borrowed from Dave Chinner's patch:
https://lore.kernel.org/linux-xfs/20191031234618.15403-13-david@fromorbit.com/
Tested with kernel build and vfs metadata heavy workload in our production
environment, no regression is spotted so far.
Link: https://lkml.kernel.org/r/20210311190845.9708-14-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Kirill Tkhai <ktkhai@virtuozzo.com>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Roman Gushchin <guro@fb.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmscan.c | 46 +++++++++++-----------------------------------
1 file changed, 11 insertions(+), 35 deletions(-)
--- a/mm/vmscan.c~mm-vmscan-shrink-deferred-objects-proportional-to-priority
+++ a/mm/vmscan.c
@@ -664,7 +664,6 @@ static unsigned long do_shrink_slab(stru
*/
nr = xchg_nr_deferred(shrinker, shrinkctl);
- total_scan = nr;
if (shrinker->seeks) {
delta = freeable >> priority;
delta *= 4;
@@ -678,37 +677,9 @@ static unsigned long do_shrink_slab(stru
delta = freeable / 2;
}
+ total_scan = nr >> priority;
total_scan += delta;
- if (total_scan < 0) {
- pr_err("shrink_slab: %pS negative objects to delete nr=%ld\n",
- shrinker->scan_objects, total_scan);
- total_scan = freeable;
- next_deferred = nr;
- } else
- next_deferred = total_scan;
-
- /*
- * We need to avoid excessive windup on filesystem shrinkers
- * due to large numbers of GFP_NOFS allocations causing the
- * shrinkers to return -1 all the time. This results in a large
- * nr being built up so when a shrink that can do some work
- * comes along it empties the entire cache due to nr >>>
- * freeable. This is bad for sustaining a working set in
- * memory.
- *
- * Hence only allow the shrinker to scan the entire cache when
- * a large delta change is calculated directly.
- */
- if (delta < freeable / 4)
- total_scan = min(total_scan, freeable / 2);
-
- /*
- * Avoid risking looping forever due to too large nr value:
- * never try to free more than twice the estimate number of
- * freeable entries.
- */
- if (total_scan > freeable * 2)
- total_scan = freeable * 2;
+ total_scan = min(total_scan, (2 * freeable));
trace_mm_shrink_slab_start(shrinker, shrinkctl, nr,
freeable, delta, total_scan, priority);
@@ -747,10 +718,15 @@ static unsigned long do_shrink_slab(stru
cond_resched();
}
- if (next_deferred >= scanned)
- next_deferred -= scanned;
- else
- next_deferred = 0;
+ /*
+ * The deferred work is increased by any new work (delta) that wasn't
+ * done, decreased by old deferred work that was done now.
+ *
+ * And it is capped to two times of the freeable items.
+ */
+ next_deferred = max_t(long, (nr + delta - scanned), 0);
+ next_deferred = min(next_deferred, (2 * freeable));
+
/*
* move the unused scan count back into the shrinker in a
* manner that handles concurrent updates.
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 075/143] mm/compaction: remove unused variable sysctl_compact_memory
2021-05-05 1:32 incoming Andrew Morton
` (73 preceding siblings ...)
2021-05-05 1:36 ` [patch 074/143] mm: vmscan: shrink deferred objects proportional to priority Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 076/143] mm: compaction: update the COMPACT[STALL|FAIL] events properly Andrew Morton
` (65 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, linux-mm, mm-commits, pintu.ping, pintu, torvalds, vbabka
From: Pintu Kumar <pintu@codeaurora.org>
Subject: mm/compaction: remove unused variable sysctl_compact_memory
The sysctl_compact_memory is mostly unused in mm/compaction.c
It just acts as a place holder for sysctl to store .data.
But the .data itself is not needed here.
So we can get ride of this variable completely and make .data as NULL.
This will also eliminate the extern declaration from header file.
No functionality is broken or changed this way.
Link: https://lkml.kernel.org/r/1614852224-14671-1-git-send-email-pintu@codeaurora.org
Signed-off-by: Pintu Kumar <pintu@codeaurora.org>
Signed-off-by: Pintu Agarwal <pintu.ping@gmail.com>
Reviewed-by: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/compaction.h | 1 -
kernel/sysctl.c | 2 +-
mm/compaction.c | 3 ---
3 files changed, 1 insertion(+), 5 deletions(-)
--- a/include/linux/compaction.h~mm-compaction-remove-unused-variable-sysctl_compact_memory
+++ a/include/linux/compaction.h
@@ -81,7 +81,6 @@ static inline unsigned long compact_gap(
}
#ifdef CONFIG_COMPACTION
-extern int sysctl_compact_memory;
extern unsigned int sysctl_compaction_proactiveness;
extern int sysctl_compaction_handler(struct ctl_table *table, int write,
void *buffer, size_t *length, loff_t *ppos);
--- a/kernel/sysctl.c~mm-compaction-remove-unused-variable-sysctl_compact_memory
+++ a/kernel/sysctl.c
@@ -2830,7 +2830,7 @@ static struct ctl_table vm_table[] = {
#ifdef CONFIG_COMPACTION
{
.procname = "compact_memory",
- .data = &sysctl_compact_memory,
+ .data = NULL,
.maxlen = sizeof(int),
.mode = 0200,
.proc_handler = sysctl_compaction_handler,
--- a/mm/compaction.c~mm-compaction-remove-unused-variable-sysctl_compact_memory
+++ a/mm/compaction.c
@@ -2692,9 +2692,6 @@ static void compact_nodes(void)
compact_node(nid);
}
-/* The written value is actually unused, all memory is compacted */
-int sysctl_compact_memory;
-
/*
* Tunable for proactive compaction. It determines how
* aggressively the kernel should compact memory in the
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 076/143] mm: compaction: update the COMPACT[STALL|FAIL] events properly
2021-05-05 1:32 incoming Andrew Morton
` (74 preceding siblings ...)
2021-05-05 1:36 ` [patch 075/143] mm/compaction: remove unused variable sysctl_compact_memory Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 077/143] mm: disable LRU pagevec during the migration temporarily Andrew Morton
` (64 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, charante, linux-mm, mm-commits, rientjes, torvalds, vbabka
From: Charan Teja Reddy <charante@codeaurora.org>
Subject: mm: compaction: update the COMPACT[STALL|FAIL] events properly
By definition, COMPACT[STALL|FAIL] events needs to be counted when there
is 'At least in one zone compaction wasn't deferred or skipped from the
direct compaction'. And when compaction is skipped or deferred,
COMPACT_SKIPPED will be returned but it will still go and update these
compaction events which is wrong in the sense that COMPACT[STALL|FAIL] is
counted without even trying the compaction.
Correct this by skipping the counting of these events when COMPACT_SKIPPED
is returned for compaction. This indirectly also avoid the unnecessary
try into the get_page_from_freelist() when compaction is not even tried.
There is a corner case where compaction is skipped but still count
COMPACTSTALL event, which is that IRQ came and freed the page and the same
is captured in capture_control.
Link: https://lkml.kernel.org/r/1613151184-21213-1-git-send-email-charante@codeaurora.org
Signed-off-by: Charan Teja Reddy <charante@codeaurora.org>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: David Rientjes <rientjes@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/compaction.c | 8 ++++++++
mm/page_alloc.c | 2 ++
2 files changed, 10 insertions(+)
--- a/mm/compaction.c~mm-compaction-update-the-compact-events-properly
+++ a/mm/compaction.c
@@ -2529,6 +2529,14 @@ static enum compact_result compact_zone_
*/
WRITE_ONCE(current->capture_control, NULL);
*capture = READ_ONCE(capc.page);
+ /*
+ * Technically, it is also possible that compaction is skipped but
+ * the page is still captured out of luck(IRQ came and freed the page).
+ * Returning COMPACT_SUCCESS in such cases helps in properly accounting
+ * the COMPACT[STALL|FAIL] when compaction is skipped.
+ */
+ if (*capture)
+ ret = COMPACT_SUCCESS;
return ret;
}
--- a/mm/page_alloc.c~mm-compaction-update-the-compact-events-properly
+++ a/mm/page_alloc.c
@@ -4204,6 +4204,8 @@ __alloc_pages_direct_compact(gfp_t gfp_m
memalloc_noreclaim_restore(noreclaim_flag);
psi_memstall_leave(&pflags);
+ if (*compact_result == COMPACT_SKIPPED)
+ return NULL;
/*
* At least in one zone compaction wasn't deferred or skipped, so let's
* count a compaction stall
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 077/143] mm: disable LRU pagevec during the migration temporarily
2021-05-05 1:32 incoming Andrew Morton
` (75 preceding siblings ...)
2021-05-05 1:36 ` [patch 076/143] mm: compaction: update the COMPACT[STALL|FAIL] events properly Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:36 ` [patch 078/143] mm: replace migrate_[prep|finish] with lru_cache_[disable|enable] Andrew Morton
` (63 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, cgoldswo, david, joaodias, linux-mm, mhocko, minchan,
mm-commits, oliver.sang, surenb, torvalds, vbabka, willy
From: Minchan Kim <minchan@kernel.org>
Subject: mm: disable LRU pagevec during the migration temporarily
LRU pagevec holds refcount of pages until the pagevec are drained. It
could prevent migration since the refcount of the page is greater than the
expection in migration logic. To mitigate the issue, callers of
migrate_pages drains LRU pagevec via migrate_prep or lru_add_drain_all
before migrate_pages call.
However, it's not enough because pages coming into pagevec after the
draining call still could stay at the pagevec so it could keep preventing
page migration. Since some callers of migrate_pages have retrial logic
with LRU draining, the page would migrate at next trail but it is still
fragile in that it doesn't close the fundamental race between upcoming LRU
pages into pagvec and migration so the migration failure could cause
contiguous memory allocation failure in the end.
To close the race, this patch disables lru caches(i.e, pagevec) during
ongoing migration until migrate is done.
Since it's really hard to reproduce, I measured how many times
migrate_pages retried with force mode(it is about a fallback to a sync
migration) with below debug code.
int migrate_pages(struct list_head *from, new_page_t get_new_page,
..
..
if (rc && reason == MR_CONTIG_RANGE && pass > 2) {
printk(KERN_ERR, "pfn 0x%lx reason %d
", page_to_pfn(page), rc);
dump_page(page, "fail to migrate");
}
The test was repeating android apps launching with cma allocation in
background every five seconds. Total cma allocation count was about 500
during the testing. With this patch, the dump_page count was reduced from
400 to 30.
The new interface is also useful for memory hotplug which currently drains
lru pcp caches after each migration failure. This is rather suboptimal as
it has to disrupt others running during the operation. With the new
interface the operation happens only once. This is also in line with pcp
allocator cache which are disabled for the offlining as well.
Link: https://lkml.kernel.org/r/20210319175127.886124-1-minchan@kernel.org
Signed-off-by: Minchan Kim <minchan@kernel.org>
Reviewed-by: Chris Goldsworthy <cgoldswo@codeaurora.org>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: John Dias <joaodias@google.com>
Cc: Suren Baghdasaryan <surenb@google.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: David Hildenbrand <david@redhat.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Oliver Sang <oliver.sang@intel.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/migrate.h | 2 +
include/linux/swap.h | 14 ++++++++
mm/memory_hotplug.c | 3 +
mm/mempolicy.c | 4 ++
mm/migrate.c | 11 ++++--
mm/page_alloc.c | 2 +
mm/swap.c | 64 ++++++++++++++++++++++++++++++++------
7 files changed, 86 insertions(+), 14 deletions(-)
--- a/include/linux/migrate.h~mm-disable-lru-pagevec-during-the-migration-temporarily
+++ a/include/linux/migrate.h
@@ -46,6 +46,7 @@ extern int isolate_movable_page(struct p
extern void putback_movable_page(struct page *page);
extern void migrate_prep(void);
+extern void migrate_finish(void);
extern void migrate_prep_local(void);
extern void migrate_page_states(struct page *newpage, struct page *page);
extern void migrate_page_copy(struct page *newpage, struct page *page);
@@ -67,6 +68,7 @@ static inline int isolate_movable_page(s
{ return -EBUSY; }
static inline int migrate_prep(void) { return -ENOSYS; }
+static inline int migrate_finish(void) { return -ENOSYS; }
static inline int migrate_prep_local(void) { return -ENOSYS; }
static inline void migrate_page_states(struct page *newpage, struct page *page)
--- a/include/linux/swap.h~mm-disable-lru-pagevec-during-the-migration-temporarily
+++ a/include/linux/swap.h
@@ -340,6 +340,20 @@ extern void lru_note_cost(struct lruvec
extern void lru_note_cost_page(struct page *);
extern void lru_cache_add(struct page *);
extern void mark_page_accessed(struct page *);
+
+extern atomic_t lru_disable_count;
+
+static inline bool lru_cache_disabled(void)
+{
+ return atomic_read(&lru_disable_count);
+}
+
+static inline void lru_cache_enable(void)
+{
+ atomic_dec(&lru_disable_count);
+}
+
+extern void lru_cache_disable(void);
extern void lru_add_drain(void);
extern void lru_add_drain_cpu(int cpu);
extern void lru_add_drain_cpu_zone(struct zone *zone);
--- a/mm/memory_hotplug.c~mm-disable-lru-pagevec-during-the-migration-temporarily
+++ a/mm/memory_hotplug.c
@@ -1611,6 +1611,7 @@ int __ref offline_pages(unsigned long st
* in a way that pages from isolated pageblock are left on pcplists.
*/
zone_pcp_disable(zone);
+ lru_cache_disable();
/* set above range as isolated */
ret = start_isolate_page_range(start_pfn, end_pfn,
@@ -1642,7 +1643,6 @@ int __ref offline_pages(unsigned long st
}
cond_resched();
- lru_add_drain_all();
ret = scan_movable_pages(pfn, end_pfn, &pfn);
if (!ret) {
@@ -1687,6 +1687,7 @@ int __ref offline_pages(unsigned long st
zone->nr_isolate_pageblock -= nr_pages / pageblock_nr_pages;
spin_unlock_irqrestore(&zone->lock, flags);
+ lru_cache_enable();
zone_pcp_enable(zone);
/* removal success */
--- a/mm/mempolicy.c~mm-disable-lru-pagevec-during-the-migration-temporarily
+++ a/mm/mempolicy.c
@@ -1208,6 +1208,8 @@ int do_migrate_pages(struct mm_struct *m
break;
}
mmap_read_unlock(mm);
+
+ migrate_finish();
if (err < 0)
return err;
return busy;
@@ -1371,6 +1373,8 @@ up_out:
mmap_write_unlock(mm);
mpol_out:
mpol_put(new);
+ if (flags & (MPOL_MF_MOVE | MPOL_MF_MOVE_ALL))
+ migrate_finish();
return err;
}
--- a/mm/migrate.c~mm-disable-lru-pagevec-during-the-migration-temporarily
+++ a/mm/migrate.c
@@ -66,11 +66,13 @@ void migrate_prep(void)
{
/*
* Clear the LRU lists so pages can be isolated.
- * Note that pages may be moved off the LRU after we have
- * drained them. Those pages will fail to migrate like other
- * pages that may be busy.
*/
- lru_add_drain_all();
+ lru_cache_disable();
+}
+
+void migrate_finish(void)
+{
+ lru_cache_enable();
}
/* Do the necessary work of migrate_prep but not if it involves other CPUs */
@@ -1838,6 +1840,7 @@ out_flush:
if (err >= 0)
err = err1;
out:
+ migrate_finish();
return err;
}
--- a/mm/page_alloc.c~mm-disable-lru-pagevec-during-the-migration-temporarily
+++ a/mm/page_alloc.c
@@ -8715,6 +8715,8 @@ static int __alloc_contig_migrate_range(
if (ret == -ENOMEM)
break;
}
+
+ migrate_finish();
if (ret < 0) {
alloc_contig_dump_pages(&cc->migratepages);
putback_movable_pages(&cc->migratepages);
--- a/mm/swap.c~mm-disable-lru-pagevec-during-the-migration-temporarily
+++ a/mm/swap.c
@@ -235,6 +235,18 @@ static void pagevec_move_tail_fn(struct
}
}
+/* return true if pagevec needs to drain */
+static bool pagevec_add_and_need_flush(struct pagevec *pvec, struct page *page)
+{
+ bool ret = false;
+
+ if (!pagevec_add(pvec, page) || PageCompound(page) ||
+ lru_cache_disabled())
+ ret = true;
+
+ return ret;
+}
+
/*
* Writeback is about to end against a page which has been marked for immediate
* reclaim. If it still appears to be reclaimable, move it to the tail of the
@@ -252,7 +264,7 @@ void rotate_reclaimable_page(struct page
get_page(page);
local_lock_irqsave(&lru_rotate.lock, flags);
pvec = this_cpu_ptr(&lru_rotate.pvec);
- if (!pagevec_add(pvec, page) || PageCompound(page))
+ if (pagevec_add_and_need_flush(pvec, page))
pagevec_lru_move_fn(pvec, pagevec_move_tail_fn);
local_unlock_irqrestore(&lru_rotate.lock, flags);
}
@@ -343,7 +355,7 @@ static void activate_page(struct page *p
local_lock(&lru_pvecs.lock);
pvec = this_cpu_ptr(&lru_pvecs.activate_page);
get_page(page);
- if (!pagevec_add(pvec, page) || PageCompound(page))
+ if (pagevec_add_and_need_flush(pvec, page))
pagevec_lru_move_fn(pvec, __activate_page);
local_unlock(&lru_pvecs.lock);
}
@@ -458,7 +470,7 @@ void lru_cache_add(struct page *page)
get_page(page);
local_lock(&lru_pvecs.lock);
pvec = this_cpu_ptr(&lru_pvecs.lru_add);
- if (!pagevec_add(pvec, page) || PageCompound(page))
+ if (pagevec_add_and_need_flush(pvec, page))
__pagevec_lru_add(pvec);
local_unlock(&lru_pvecs.lock);
}
@@ -654,7 +666,7 @@ void deactivate_file_page(struct page *p
local_lock(&lru_pvecs.lock);
pvec = this_cpu_ptr(&lru_pvecs.lru_deactivate_file);
- if (!pagevec_add(pvec, page) || PageCompound(page))
+ if (pagevec_add_and_need_flush(pvec, page))
pagevec_lru_move_fn(pvec, lru_deactivate_file_fn);
local_unlock(&lru_pvecs.lock);
}
@@ -676,7 +688,7 @@ void deactivate_page(struct page *page)
local_lock(&lru_pvecs.lock);
pvec = this_cpu_ptr(&lru_pvecs.lru_deactivate);
get_page(page);
- if (!pagevec_add(pvec, page) || PageCompound(page))
+ if (pagevec_add_and_need_flush(pvec, page))
pagevec_lru_move_fn(pvec, lru_deactivate_fn);
local_unlock(&lru_pvecs.lock);
}
@@ -698,7 +710,7 @@ void mark_page_lazyfree(struct page *pag
local_lock(&lru_pvecs.lock);
pvec = this_cpu_ptr(&lru_pvecs.lru_lazyfree);
get_page(page);
- if (!pagevec_add(pvec, page) || PageCompound(page))
+ if (pagevec_add_and_need_flush(pvec, page))
pagevec_lru_move_fn(pvec, lru_lazyfree_fn);
local_unlock(&lru_pvecs.lock);
}
@@ -735,7 +747,7 @@ static void lru_add_drain_per_cpu(struct
* Calling this function with cpu hotplug locks held can actually lead
* to obscure indirect dependencies via WQ context.
*/
-void lru_add_drain_all(void)
+inline void __lru_add_drain_all(bool force_all_cpus)
{
/*
* lru_drain_gen - Global pages generation number
@@ -780,7 +792,7 @@ void lru_add_drain_all(void)
* (C) Exit the draining operation if a newer generation, from another
* lru_add_drain_all(), was already scheduled for draining. Check (A).
*/
- if (unlikely(this_gen != lru_drain_gen))
+ if (unlikely(this_gen != lru_drain_gen && !force_all_cpus))
goto done;
/*
@@ -810,7 +822,8 @@ void lru_add_drain_all(void)
for_each_online_cpu(cpu) {
struct work_struct *work = &per_cpu(lru_add_drain_work, cpu);
- if (pagevec_count(&per_cpu(lru_pvecs.lru_add, cpu)) ||
+ if (force_all_cpus ||
+ pagevec_count(&per_cpu(lru_pvecs.lru_add, cpu)) ||
data_race(pagevec_count(&per_cpu(lru_rotate.pvec, cpu))) ||
pagevec_count(&per_cpu(lru_pvecs.lru_deactivate_file, cpu)) ||
pagevec_count(&per_cpu(lru_pvecs.lru_deactivate, cpu)) ||
@@ -828,6 +841,11 @@ void lru_add_drain_all(void)
done:
mutex_unlock(&lock);
}
+
+void lru_add_drain_all(void)
+{
+ __lru_add_drain_all(false);
+}
#else
void lru_add_drain_all(void)
{
@@ -835,6 +853,34 @@ void lru_add_drain_all(void)
}
#endif /* CONFIG_SMP */
+atomic_t lru_disable_count = ATOMIC_INIT(0);
+
+/*
+ * lru_cache_disable() needs to be called before we start compiling
+ * a list of pages to be migrated using isolate_lru_page().
+ * It drains pages on LRU cache and then disable on all cpus until
+ * lru_cache_enable is called.
+ *
+ * Must be paired with a call to lru_cache_enable().
+ */
+void lru_cache_disable(void)
+{
+ atomic_inc(&lru_disable_count);
+#ifdef CONFIG_SMP
+ /*
+ * lru_add_drain_all in the force mode will schedule draining on
+ * all online CPUs so any calls of lru_cache_disabled wrapped by
+ * local_lock or preemption disabled would be ordered by that.
+ * The atomic operation doesn't need to have stronger ordering
+ * requirements because that is enforeced by the scheduling
+ * guarantees.
+ */
+ __lru_add_drain_all(true);
+#else
+ lru_add_drain();
+#endif
+}
+
/**
* release_pages - batched put_page()
* @pages: array of pages to release
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 078/143] mm: replace migrate_[prep|finish] with lru_cache_[disable|enable]
2021-05-05 1:32 incoming Andrew Morton
` (76 preceding siblings ...)
2021-05-05 1:36 ` [patch 077/143] mm: disable LRU pagevec during the migration temporarily Andrew Morton
@ 2021-05-05 1:36 ` Andrew Morton
2021-05-05 1:37 ` [patch 079/143] mm: fs: invalidate BH LRU during page migration Andrew Morton
` (62 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:36 UTC (permalink / raw)
To: akpm, cgoldswo, david, joaodias, linux-mm, mhocko, minchan,
mm-commits, oliver.sang, surenb, torvalds, vbabka, willy
From: Minchan Kim <minchan@kernel.org>
Subject: mm: replace migrate_[prep|finish] with lru_cache_[disable|enable]
Currently, migrate_[prep|finish] is merely a wrapper of
lru_cache_[disable|enable]. There is not much to gain from having
additional abstraction.
Use lru_cache_[disable|enable] instead of migrate_[prep|finish], which
would be more descriptive.
note: migrate_prep_local in compaction.c changed into lru_add_drain to
avoid CPU schedule cost with involving many other CPUs to keep old
behavior.
Link: https://lkml.kernel.org/r/20210319175127.886124-2-minchan@kernel.org
Signed-off-by: Minchan Kim <minchan@kernel.org>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Chris Goldsworthy <cgoldswo@codeaurora.org>
Cc: John Dias <joaodias@google.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Oliver Sang <oliver.sang@intel.com>
Cc: Suren Baghdasaryan <surenb@google.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/migrate.h | 7 -------
mm/compaction.c | 3 ++-
mm/mempolicy.c | 8 ++++----
mm/migrate.c | 28 ++--------------------------
mm/page_alloc.c | 4 ++--
5 files changed, 10 insertions(+), 40 deletions(-)
--- a/include/linux/migrate.h~mm-replace-migrate_-with-lru_cache_
+++ a/include/linux/migrate.h
@@ -45,9 +45,6 @@ extern struct page *alloc_migration_targ
extern int isolate_movable_page(struct page *page, isolate_mode_t mode);
extern void putback_movable_page(struct page *page);
-extern void migrate_prep(void);
-extern void migrate_finish(void);
-extern void migrate_prep_local(void);
extern void migrate_page_states(struct page *newpage, struct page *page);
extern void migrate_page_copy(struct page *newpage, struct page *page);
extern int migrate_huge_page_move_mapping(struct address_space *mapping,
@@ -67,10 +64,6 @@ static inline struct page *alloc_migrati
static inline int isolate_movable_page(struct page *page, isolate_mode_t mode)
{ return -EBUSY; }
-static inline int migrate_prep(void) { return -ENOSYS; }
-static inline int migrate_finish(void) { return -ENOSYS; }
-static inline int migrate_prep_local(void) { return -ENOSYS; }
-
static inline void migrate_page_states(struct page *newpage, struct page *page)
{
}
--- a/mm/compaction.c~mm-replace-migrate_-with-lru_cache_
+++ a/mm/compaction.c
@@ -2354,7 +2354,8 @@ compact_zone(struct compact_control *cc,
trace_mm_compaction_begin(start_pfn, cc->migrate_pfn,
cc->free_pfn, end_pfn, sync);
- migrate_prep_local();
+ /* lru_add_drain_all could be expensive with involving other CPUs */
+ lru_add_drain();
while ((ret = compact_finished(cc)) == COMPACT_CONTINUE) {
int err;
--- a/mm/mempolicy.c~mm-replace-migrate_-with-lru_cache_
+++ a/mm/mempolicy.c
@@ -1124,7 +1124,7 @@ int do_migrate_pages(struct mm_struct *m
int err = 0;
nodemask_t tmp;
- migrate_prep();
+ lru_cache_disable();
mmap_read_lock(mm);
@@ -1209,7 +1209,7 @@ int do_migrate_pages(struct mm_struct *m
}
mmap_read_unlock(mm);
- migrate_finish();
+ lru_cache_enable();
if (err < 0)
return err;
return busy;
@@ -1325,7 +1325,7 @@ static long do_mbind(unsigned long start
if (flags & (MPOL_MF_MOVE | MPOL_MF_MOVE_ALL)) {
- migrate_prep();
+ lru_cache_disable();
}
{
NODEMASK_SCRATCH(scratch);
@@ -1374,7 +1374,7 @@ up_out:
mpol_out:
mpol_put(new);
if (flags & (MPOL_MF_MOVE | MPOL_MF_MOVE_ALL))
- migrate_finish();
+ lru_cache_enable();
return err;
}
--- a/mm/migrate.c~mm-replace-migrate_-with-lru_cache_
+++ a/mm/migrate.c
@@ -57,30 +57,6 @@
#include "internal.h"
-/*
- * migrate_prep() needs to be called before we start compiling a list of pages
- * to be migrated using isolate_lru_page(). If scheduling work on other CPUs is
- * undesirable, use migrate_prep_local()
- */
-void migrate_prep(void)
-{
- /*
- * Clear the LRU lists so pages can be isolated.
- */
- lru_cache_disable();
-}
-
-void migrate_finish(void)
-{
- lru_cache_enable();
-}
-
-/* Do the necessary work of migrate_prep but not if it involves other CPUs */
-void migrate_prep_local(void)
-{
- lru_add_drain();
-}
-
int isolate_movable_page(struct page *page, isolate_mode_t mode)
{
struct address_space *mapping;
@@ -1771,7 +1747,7 @@ static int do_pages_move(struct mm_struc
int start, i;
int err = 0, err1;
- migrate_prep();
+ lru_cache_disable();
for (i = start = 0; i < nr_pages; i++) {
const void __user *p;
@@ -1840,7 +1816,7 @@ out_flush:
if (err >= 0)
err = err1;
out:
- migrate_finish();
+ lru_cache_enable();
return err;
}
--- a/mm/page_alloc.c~mm-replace-migrate_-with-lru_cache_
+++ a/mm/page_alloc.c
@@ -8681,7 +8681,7 @@ static int __alloc_contig_migrate_range(
.gfp_mask = GFP_USER | __GFP_MOVABLE | __GFP_RETRY_MAYFAIL,
};
- migrate_prep();
+ lru_cache_disable();
while (pfn < end || !list_empty(&cc->migratepages)) {
if (fatal_signal_pending(current)) {
@@ -8716,7 +8716,7 @@ static int __alloc_contig_migrate_range(
break;
}
- migrate_finish();
+ lru_cache_enable();
if (ret < 0) {
alloc_contig_dump_pages(&cc->migratepages);
putback_movable_pages(&cc->migratepages);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 079/143] mm: fs: invalidate BH LRU during page migration
2021-05-05 1:32 incoming Andrew Morton
` (77 preceding siblings ...)
2021-05-05 1:36 ` [patch 078/143] mm: replace migrate_[prep|finish] with lru_cache_[disable|enable] Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 080/143] mm/migrate.c: make putback_movable_page() static Andrew Morton
` (61 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, cgoldswo, david, joaodias, labbott, linux-mm, mhocko,
minchan, mm-commits, oliver.sang, surenb, torvalds, vbabka, willy
From: Minchan Kim <minchan@kernel.org>
Subject: mm: fs: invalidate BH LRU during page migration
Pages containing buffer_heads that are in one of the per-CPU buffer_head
LRU caches will be pinned and thus cannot be migrated. This can prevent
CMA allocations from succeeding, which are often used on platforms with
co-processors (such as a DSP) that can only use physically contiguous
memory. It can also prevent memory hot-unplugging from succeeding, which
involves migrating at least MIN_MEMORY_BLOCK_SIZE bytes of memory, which
ranges from 8 MiB to 1 GiB based on the architecture in use.
Correspondingly, invalidate the BH LRU caches before a migration starts
and stop any buffer_head from being cached in the LRU caches, until
migration has finished.
Link: https://lkml.kernel.org/r/20210319175127.886124-3-minchan@kernel.org
Signed-off-by: Minchan Kim <minchan@kernel.org>
Reported-by: Chris Goldsworthy <cgoldswo@codeaurora.org>
Reported-by: Laura Abbott <labbott@kernel.org>
Tested-by: Oliver Sang <oliver.sang@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: John Dias <joaodias@google.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Suren Baghdasaryan <surenb@google.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/buffer.c | 36 ++++++++++++++++++++++++++++------
include/linux/buffer_head.h | 4 +++
mm/swap.c | 5 +++-
3 files changed, 38 insertions(+), 7 deletions(-)
--- a/fs/buffer.c~mm-fs-invalidate-bh-lru-during-page-migration
+++ a/fs/buffer.c
@@ -1264,6 +1264,15 @@ static void bh_lru_install(struct buffer
int i;
check_irqs_on();
+ /*
+ * the refcount of buffer_head in bh_lru prevents dropping the
+ * attached page(i.e., try_to_free_buffers) so it could cause
+ * failing page migration.
+ * Skip putting upcoming bh into bh_lru until migration is done.
+ */
+ if (lru_cache_disabled())
+ return;
+
bh_lru_lock();
b = this_cpu_ptr(&bh_lrus);
@@ -1404,6 +1413,15 @@ __bread_gfp(struct block_device *bdev, s
}
EXPORT_SYMBOL(__bread_gfp);
+static void __invalidate_bh_lrus(struct bh_lru *b)
+{
+ int i;
+
+ for (i = 0; i < BH_LRU_SIZE; i++) {
+ brelse(b->bhs[i]);
+ b->bhs[i] = NULL;
+ }
+}
/*
* invalidate_bh_lrus() is called rarely - but not only at unmount.
* This doesn't race because it runs in each cpu either in irq
@@ -1412,16 +1430,12 @@ EXPORT_SYMBOL(__bread_gfp);
static void invalidate_bh_lru(void *arg)
{
struct bh_lru *b = &get_cpu_var(bh_lrus);
- int i;
- for (i = 0; i < BH_LRU_SIZE; i++) {
- brelse(b->bhs[i]);
- b->bhs[i] = NULL;
- }
+ __invalidate_bh_lrus(b);
put_cpu_var(bh_lrus);
}
-static bool has_bh_in_lru(int cpu, void *dummy)
+bool has_bh_in_lru(int cpu, void *dummy)
{
struct bh_lru *b = per_cpu_ptr(&bh_lrus, cpu);
int i;
@@ -1440,6 +1454,16 @@ void invalidate_bh_lrus(void)
}
EXPORT_SYMBOL_GPL(invalidate_bh_lrus);
+void invalidate_bh_lrus_cpu(int cpu)
+{
+ struct bh_lru *b;
+
+ bh_lru_lock();
+ b = per_cpu_ptr(&bh_lrus, cpu);
+ __invalidate_bh_lrus(b);
+ bh_lru_unlock();
+}
+
void set_bh_page(struct buffer_head *bh,
struct page *page, unsigned long offset)
{
--- a/include/linux/buffer_head.h~mm-fs-invalidate-bh-lru-during-page-migration
+++ a/include/linux/buffer_head.h
@@ -194,6 +194,8 @@ void __breadahead_gfp(struct block_devic
struct buffer_head *__bread_gfp(struct block_device *,
sector_t block, unsigned size, gfp_t gfp);
void invalidate_bh_lrus(void);
+void invalidate_bh_lrus_cpu(int cpu);
+bool has_bh_in_lru(int cpu, void *dummy);
struct buffer_head *alloc_buffer_head(gfp_t gfp_flags);
void free_buffer_head(struct buffer_head * bh);
void unlock_buffer(struct buffer_head *bh);
@@ -406,6 +408,8 @@ static inline int inode_has_buffers(stru
static inline void invalidate_inode_buffers(struct inode *inode) {}
static inline int remove_inode_buffers(struct inode *inode) { return 1; }
static inline int sync_mapping_buffers(struct address_space *mapping) { return 0; }
+static inline void invalidate_bh_lrus_cpu(int cpu) {}
+static inline bool has_bh_in_lru(int cpu, void *dummy) { return 0; }
#define buffer_heads_over_limit 0
#endif /* CONFIG_BLOCK */
--- a/mm/swap.c~mm-fs-invalidate-bh-lru-during-page-migration
+++ a/mm/swap.c
@@ -36,6 +36,7 @@
#include <linux/hugetlb.h>
#include <linux/page_idle.h>
#include <linux/local_lock.h>
+#include <linux/buffer_head.h>
#include "internal.h"
@@ -641,6 +642,7 @@ void lru_add_drain_cpu(int cpu)
pagevec_lru_move_fn(pvec, lru_lazyfree_fn);
activate_page_drain(cpu);
+ invalidate_bh_lrus_cpu(cpu);
}
/**
@@ -828,7 +830,8 @@ inline void __lru_add_drain_all(bool for
pagevec_count(&per_cpu(lru_pvecs.lru_deactivate_file, cpu)) ||
pagevec_count(&per_cpu(lru_pvecs.lru_deactivate, cpu)) ||
pagevec_count(&per_cpu(lru_pvecs.lru_lazyfree, cpu)) ||
- need_activate_page_drain(cpu)) {
+ need_activate_page_drain(cpu) ||
+ has_bh_in_lru(cpu, NULL)) {
INIT_WORK(work, lru_add_drain_per_cpu);
queue_work_on(cpu, mm_percpu_wq, work);
__cpumask_set_cpu(cpu, &has_work);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 080/143] mm/migrate.c: make putback_movable_page() static
2021-05-05 1:32 incoming Andrew Morton
` (78 preceding siblings ...)
2021-05-05 1:37 ` [patch 079/143] mm: fs: invalidate BH LRU during page migration Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 081/143] mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case Andrew Morton
` (60 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, apopple, aquini, david, jglisse, linmiaohe, linux-mm,
mm-commits, shy828301, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/migrate.c: make putback_movable_page() static
Patch series "Cleanup and fixup for mm/migrate.c", v3.
This series contains cleanups to remove unnecessary VM_BUG_ON_PAGE and rc
!= MIGRATEPAGE_SUCCESS check. Also use helper function to remove some
duplicated codes. What's more, this fixes potential deadlock in NUMA
balancing shared exec THP case and so on. More details can be found in
the respective changelogs.
This patch (of 5):
The putback_movable_page() is just called by putback_movable_pages() and
we know the page is locked and both PageMovable() and PageIsolated() is
checked right before calling putback_movable_page(). So we make it static
and remove all the 3 VM_BUG_ON_PAGE().
Link: https://lkml.kernel.org/r/20210325131524.48181-1-linmiaohe@huawei.com
Link: https://lkml.kernel.org/r/20210325131524.48181-2-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Reviewed-by: Yang Shi <shy828301@gmail.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Rafael Aquini <aquini@redhat.com>
Cc: Alistair Popple <apopple@nvidia.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/migrate.h | 1 -
mm/migrate.c | 7 +------
2 files changed, 1 insertion(+), 7 deletions(-)
--- a/include/linux/migrate.h~mm-migratec-make-putback_movable_page-static
+++ a/include/linux/migrate.h
@@ -43,7 +43,6 @@ extern int migrate_pages(struct list_hea
unsigned long private, enum migrate_mode mode, int reason);
extern struct page *alloc_migration_target(struct page *page, unsigned long private);
extern int isolate_movable_page(struct page *page, isolate_mode_t mode);
-extern void putback_movable_page(struct page *page);
extern void migrate_page_states(struct page *newpage, struct page *page);
extern void migrate_page_copy(struct page *newpage, struct page *page);
--- a/mm/migrate.c~mm-migratec-make-putback_movable_page-static
+++ a/mm/migrate.c
@@ -118,15 +118,10 @@ out:
return -EBUSY;
}
-/* It should be called on page which is PG_movable */
-void putback_movable_page(struct page *page)
+static void putback_movable_page(struct page *page)
{
struct address_space *mapping;
- VM_BUG_ON_PAGE(!PageLocked(page), page);
- VM_BUG_ON_PAGE(!PageMovable(page), page);
- VM_BUG_ON_PAGE(!PageIsolated(page), page);
-
mapping = page_mapping(page);
mapping->a_ops->putback_page(page);
__ClearPageIsolated(page);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 081/143] mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case
2021-05-05 1:32 incoming Andrew Morton
` (79 preceding siblings ...)
2021-05-05 1:37 ` [patch 080/143] mm/migrate.c: make putback_movable_page() static Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 082/143] mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page() Andrew Morton
` (59 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, apopple, aquini, david, jglisse, linmiaohe, linux-mm,
mm-commits, shy828301, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case
It's guaranteed that in the 'else' case of the rc == MIGRATEPAGE_SUCCESS
check, rc does not equal to MIGRATEPAGE_SUCCESS. Remove this unnecessary
check.
Link: https://lkml.kernel.org/r/20210325131524.48181-3-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Reviewed-by: Yang Shi <shy828301@gmail.com>
Cc: Alistair Popple <apopple@nvidia.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Rafael Aquini <aquini@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/migrate.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/migrate.c~mm-migratec-remove-unnecessary-rc-=-migratepage_success-check-in-else-case
+++ a/mm/migrate.c
@@ -1348,7 +1348,7 @@ out_unlock:
out:
if (rc == MIGRATEPAGE_SUCCESS)
putback_active_hugepage(hpage);
- else if (rc != -EAGAIN && rc != MIGRATEPAGE_SUCCESS)
+ else if (rc != -EAGAIN)
list_move_tail(&hpage->lru, ret);
/*
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 082/143] mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page()
2021-05-05 1:32 incoming Andrew Morton
` (80 preceding siblings ...)
2021-05-05 1:37 ` [patch 081/143] mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 083/143] mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole() Andrew Morton
` (58 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, apopple, aquini, david, jglisse, linmiaohe, linux-mm,
mm-commits, shy828301, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page()
If the zone device page does not belong to un-addressable device memory,
the variable entry will be uninitialized and lead to indeterminate pte
entry ultimately. Fix this unexpected case and warn about it.
Link: https://lkml.kernel.org/r/20210325131524.48181-4-linmiaohe@huawei.com
Fixes: df6ad69838fc ("mm/device-public-memory: device memory cache coherent with CPU")
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Alistair Popple <apopple@nvidia.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Rafael Aquini <aquini@redhat.com>
Cc: Yang Shi <shy828301@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/migrate.c | 7 +++++++
1 file changed, 7 insertions(+)
--- a/mm/migrate.c~mm-migratec-fix-potential-indeterminate-pte-entry-in-migrate_vma_insert_page
+++ a/mm/migrate.c
@@ -2947,6 +2947,13 @@ static void migrate_vma_insert_page(stru
swp_entry = make_device_private_entry(page, vma->vm_flags & VM_WRITE);
entry = swp_entry_to_pte(swp_entry);
+ } else {
+ /*
+ * For now we only support migrating to un-addressable
+ * device memory.
+ */
+ pr_warn_once("Unsupported ZONE_DEVICE page type.\n");
+ goto abort;
}
} else {
entry = mk_pte(page, vma->vm_page_prot);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 083/143] mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole()
2021-05-05 1:32 incoming Andrew Morton
` (81 preceding siblings ...)
2021-05-05 1:37 ` [patch 082/143] mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page() Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 084/143] Revert "mm: migrate: skip shared exec THP for NUMA balancing" Andrew Morton
` (57 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, apopple, aquini, david, jglisse, linmiaohe, linux-mm,
mm-commits, shy828301, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole()
It's more recommended to use helper function migrate_vma_collect_skip() to
skip the unexpected case and it also helps remove some duplicated codes.
Move migrate_vma_collect_skip() above migrate_vma_collect_hole() to avoid
compiler warning.
Link: https://lkml.kernel.org/r/20210325131524.48181-5-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Alistair Popple <apopple@nvidia.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Rafael Aquini <aquini@redhat.com>
Cc: Yang Shi <shy828301@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/migrate.c | 28 +++++++++++-----------------
1 file changed, 11 insertions(+), 17 deletions(-)
--- a/mm/migrate.c~mm-migratec-use-helper-migrate_vma_collect_skip-in-migrate_vma_collect_hole
+++ a/mm/migrate.c
@@ -2290,44 +2290,38 @@ out:
#endif /* CONFIG_NUMA */
#ifdef CONFIG_DEVICE_PRIVATE
-static int migrate_vma_collect_hole(unsigned long start,
+static int migrate_vma_collect_skip(unsigned long start,
unsigned long end,
- __always_unused int depth,
struct mm_walk *walk)
{
struct migrate_vma *migrate = walk->private;
unsigned long addr;
- /* Only allow populating anonymous memory. */
- if (!vma_is_anonymous(walk->vma)) {
- for (addr = start; addr < end; addr += PAGE_SIZE) {
- migrate->src[migrate->npages] = 0;
- migrate->dst[migrate->npages] = 0;
- migrate->npages++;
- }
- return 0;
- }
-
for (addr = start; addr < end; addr += PAGE_SIZE) {
- migrate->src[migrate->npages] = MIGRATE_PFN_MIGRATE;
migrate->dst[migrate->npages] = 0;
- migrate->npages++;
- migrate->cpages++;
+ migrate->src[migrate->npages++] = 0;
}
return 0;
}
-static int migrate_vma_collect_skip(unsigned long start,
+static int migrate_vma_collect_hole(unsigned long start,
unsigned long end,
+ __always_unused int depth,
struct mm_walk *walk)
{
struct migrate_vma *migrate = walk->private;
unsigned long addr;
+ /* Only allow populating anonymous memory. */
+ if (!vma_is_anonymous(walk->vma))
+ return migrate_vma_collect_skip(start, end, walk);
+
for (addr = start; addr < end; addr += PAGE_SIZE) {
+ migrate->src[migrate->npages] = MIGRATE_PFN_MIGRATE;
migrate->dst[migrate->npages] = 0;
- migrate->src[migrate->npages++] = 0;
+ migrate->npages++;
+ migrate->cpages++;
}
return 0;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 084/143] Revert "mm: migrate: skip shared exec THP for NUMA balancing"
2021-05-05 1:32 incoming Andrew Morton
` (82 preceding siblings ...)
2021-05-05 1:37 ` [patch 083/143] mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole() Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 085/143] mm: vmstat: add cma statistics Andrew Morton
` (56 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, apopple, aquini, david, jglisse, linmiaohe, linux-mm,
mm-commits, shy828301, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: Revert "mm: migrate: skip shared exec THP for NUMA balancing"
This reverts commit c77c5cbafe549eb330e8909861a3e16cbda2c848.
Since commit c77c5cbafe54 ("mm: migrate: skip shared exec THP for NUMA
balancing"), the NUMA balancing would skip shared exec transhuge page.
But this enhancement is not suitable for transhuge page. Because it's
required that page_mapcount() must be 1 due to no migration pte dance is
done here. On the other hand, the shared exec transhuge page will leave
the migrate_misplaced_page() with pte entry untouched and page locked.
Thus pagefault for NUMA will be triggered again and deadlock occurs when
we start waiting for the page lock held by ourselves.
Yang Shi said:
"Thanks for catching this. By relooking the code I think the other
important reason for removing this is
migrate_misplaced_transhuge_page() actually can't see shared exec
file THP at all since page_lock_anon_vma_read() is called before
and if page is not anonymous page it will just restore the PMD
without migrating anything.
The pages for private mapped file vma may be anonymous pages due to
COW but they can't be THP so it won't trigger THP numa fault at all. I
think this is why no bug was reported. I overlooked this in the first
place."
Link: https://lkml.kernel.org/r/20210325131524.48181-6-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Yang Shi <shy828301@gmail.com>
Cc: Alistair Popple <apopple@nvidia.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Rafael Aquini <aquini@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/migrate.c | 18 ++----------------
1 file changed, 2 insertions(+), 16 deletions(-)
--- a/mm/migrate.c~revert-mm-migrate-skip-shared-exec-thp-for-numa-balancing
+++ a/mm/migrate.c
@@ -2084,17 +2084,6 @@ bool pmd_trans_migrating(pmd_t pmd)
return PageLocked(page);
}
-static inline bool is_shared_exec_page(struct vm_area_struct *vma,
- struct page *page)
-{
- if (page_mapcount(page) != 1 &&
- (page_is_file_lru(page) || vma_is_shmem(vma)) &&
- (vma->vm_flags & VM_EXEC))
- return true;
-
- return false;
-}
-
/*
* Attempt to migrate a misplaced page to the specified destination
* node. Caller is expected to have an elevated reference count on
@@ -2112,7 +2101,8 @@ int migrate_misplaced_page(struct page *
* Don't migrate file pages that are mapped in multiple processes
* with execute permissions as they are probably shared libraries.
*/
- if (is_shared_exec_page(vma, page))
+ if (page_mapcount(page) != 1 && page_is_file_lru(page) &&
+ (vma->vm_flags & VM_EXEC))
goto out;
/*
@@ -2167,9 +2157,6 @@ int migrate_misplaced_transhuge_page(str
int page_lru = page_is_file_lru(page);
unsigned long start = address & HPAGE_PMD_MASK;
- if (is_shared_exec_page(vma, page))
- goto out;
-
new_page = alloc_pages_node(node,
(GFP_TRANSHUGE_LIGHT | __GFP_THISNODE),
HPAGE_PMD_ORDER);
@@ -2281,7 +2268,6 @@ out_fail:
out_unlock:
unlock_page(page);
-out:
put_page(page);
return 0;
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 085/143] mm: vmstat: add cma statistics
2021-05-05 1:32 incoming Andrew Morton
` (83 preceding siblings ...)
2021-05-05 1:37 ` [patch 084/143] Revert "mm: migrate: skip shared exec THP for NUMA balancing" Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 086/143] mm: cma: use pr_err_ratelimited for CMA warning Andrew Morton
` (55 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, jhubbard, joaodias, linux-mm, minchan, mm-commits, surenb,
torvalds
From: Minchan Kim <minchan@kernel.org>
Subject: mm: vmstat: add cma statistics
Since CMA is used more widely, it's worth to have CMA allocation
statistics into vmstat. With it, we could know how agressively system
uses cma allocation and how often it fails.
Link: https://lkml.kernel.org/r/20210302183346.3707237-1-minchan@kernel.org
Signed-off-by: Minchan Kim <minchan@kernel.org>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Cc: John Dias <joaodias@google.com>
Cc: Suren Baghdasaryan <surenb@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/vm_event_item.h | 4 ++++
mm/cma.c | 12 +++++++++---
mm/vmstat.c | 4 ++++
3 files changed, 17 insertions(+), 3 deletions(-)
--- a/include/linux/vm_event_item.h~mm-vmstat-add-cma-statistics
+++ a/include/linux/vm_event_item.h
@@ -71,6 +71,10 @@ enum vm_event_item { PGPGIN, PGPGOUT, PS
#ifdef CONFIG_HUGETLB_PAGE
HTLB_BUDDY_PGALLOC, HTLB_BUDDY_PGALLOC_FAIL,
#endif
+#ifdef CONFIG_CMA
+ CMA_ALLOC_SUCCESS,
+ CMA_ALLOC_FAIL,
+#endif
UNEVICTABLE_PGCULLED, /* culled to noreclaim list */
UNEVICTABLE_PGSCANNED, /* scanned for reclaimability */
UNEVICTABLE_PGRESCUED, /* rescued from noreclaim list */
--- a/mm/cma.c~mm-vmstat-add-cma-statistics
+++ a/mm/cma.c
@@ -435,13 +435,13 @@ struct page *cma_alloc(struct cma *cma,
int ret = -ENOMEM;
if (!cma || !cma->count || !cma->bitmap)
- return NULL;
+ goto out;
pr_debug("%s(cma %p, count %zu, align %d)\n", __func__, (void *)cma,
count, align);
if (!count)
- return NULL;
+ goto out;
mask = cma_bitmap_aligned_mask(cma, align);
offset = cma_bitmap_aligned_offset(cma, align);
@@ -449,7 +449,7 @@ struct page *cma_alloc(struct cma *cma,
bitmap_count = cma_bitmap_pages_to_bits(cma, count);
if (bitmap_count > bitmap_maxno)
- return NULL;
+ goto out;
for (;;) {
spin_lock_irq(&cma->lock);
@@ -506,6 +506,12 @@ struct page *cma_alloc(struct cma *cma,
}
pr_debug("%s(): returned %p\n", __func__, page);
+out:
+ if (page)
+ count_vm_event(CMA_ALLOC_SUCCESS);
+ else
+ count_vm_event(CMA_ALLOC_FAIL);
+
return page;
}
--- a/mm/vmstat.c~mm-vmstat-add-cma-statistics
+++ a/mm/vmstat.c
@@ -1313,6 +1313,10 @@ const char * const vmstat_text[] = {
"htlb_buddy_alloc_success",
"htlb_buddy_alloc_fail",
#endif
+#ifdef CONFIG_CMA
+ "cma_alloc_success",
+ "cma_alloc_fail",
+#endif
"unevictable_pgs_culled",
"unevictable_pgs_scanned",
"unevictable_pgs_rescued",
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 086/143] mm: cma: use pr_err_ratelimited for CMA warning
2021-05-05 1:32 incoming Andrew Morton
` (84 preceding siblings ...)
2021-05-05 1:37 ` [patch 085/143] mm: vmstat: add cma statistics Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 087/143] mm: cma: add trace events for CMA alloc perf testing Andrew Morton
` (54 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, baolin.wang, david, linux-mm, minchan, mm-commits, torvalds
From: Baolin Wang <baolin.wang@linux.alibaba.com>
Subject: mm: cma: use pr_err_ratelimited for CMA warning
If we did not reserve extra CMA memory, the log buffer can be easily
filled up by CMA failure warning when the devices calling
dmam_alloc_coherent() to alloc DMA memory. Thus we can use
pr_err_ratelimited() instead to reduce the duplicate CMA warning.
Link: https://lkml.kernel.org/r/ce2251ef49e1727a9a40531d1996660b05462bd2.1615279825.git.baolin.wang@linux.alibaba.com
Signed-off-by: Baolin Wang <baolin.wang@linux.alibaba.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Minchan Kim <minchan@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/cma.c | 4 ++--
1 file changed, 2 insertions(+), 2 deletions(-)
--- a/mm/cma.c~mm-cma-use-pr_err_ratelimited-for-cma-warning
+++ a/mm/cma.c
@@ -500,8 +500,8 @@ struct page *cma_alloc(struct cma *cma,
}
if (ret && !no_warn) {
- pr_err("%s: %s: alloc failed, req-size: %zu pages, ret: %d\n",
- __func__, cma->name, count, ret);
+ pr_err_ratelimited("%s: %s: alloc failed, req-size: %zu pages, ret: %d\n",
+ __func__, cma->name, count, ret);
cma_debug_show_areas(cma);
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 087/143] mm: cma: add trace events for CMA alloc perf testing
2021-05-05 1:32 incoming Andrew Morton
` (85 preceding siblings ...)
2021-05-05 1:37 ` [patch 086/143] mm: cma: use pr_err_ratelimited for CMA warning Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 088/143] mm: cma: support sysfs Andrew Morton
` (53 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, georgi.djakov, linux-mm, lmark, minchan, mm-commits,
torvalds
From: Liam Mark <lmark@codeaurora.org>
Subject: mm: cma: add trace events for CMA alloc perf testing
Add cma and migrate trace events to enable CMA allocation performance to
be measured via ftrace.
[georgi.djakov@linaro.org: add the CMA instance name to the cma_alloc_start trace event]
Link: https://lkml.kernel.org/r/20210326155414.25006-1-georgi.djakov@linaro.org
Link: https://lkml.kernel.org/r/20210324160740.15901-1-georgi.djakov@linaro.org
Signed-off-by: Liam Mark <lmark@codeaurora.org>
Signed-off-by: Georgi Djakov <georgi.djakov@linaro.org>
Acked-by: Minchan Kim <minchan@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/trace/events/cma.h | 42 ++++++++++++++++++++++++++++++-
include/trace/events/migrate.h | 22 ++++++++++++++++
mm/cma.c | 4 ++
mm/migrate.c | 2 +
4 files changed, 69 insertions(+), 1 deletion(-)
--- a/include/trace/events/cma.h~mm-cma-add-trace-events-for-cma-alloc-perf-testing
+++ a/include/trace/events/cma.h
@@ -8,7 +8,7 @@
#include <linux/types.h>
#include <linux/tracepoint.h>
-TRACE_EVENT(cma_alloc,
+DECLARE_EVENT_CLASS(cma_alloc_class,
TP_PROTO(unsigned long pfn, const struct page *page,
unsigned int count, unsigned int align),
@@ -61,6 +61,46 @@ TRACE_EVENT(cma_release,
__entry->count)
);
+TRACE_EVENT(cma_alloc_start,
+
+ TP_PROTO(const char *name, unsigned int count, unsigned int align),
+
+ TP_ARGS(name, count, align),
+
+ TP_STRUCT__entry(
+ __string(name, name)
+ __field(unsigned int, count)
+ __field(unsigned int, align)
+ ),
+
+ TP_fast_assign(
+ __assign_str(name, name);
+ __entry->count = count;
+ __entry->align = align;
+ ),
+
+ TP_printk("name=%s count=%u align=%u",
+ __get_str(name),
+ __entry->count,
+ __entry->align)
+);
+
+DEFINE_EVENT(cma_alloc_class, cma_alloc,
+
+ TP_PROTO(unsigned long pfn, const struct page *page,
+ unsigned int count, unsigned int align),
+
+ TP_ARGS(pfn, page, count, align)
+);
+
+DEFINE_EVENT(cma_alloc_class, cma_alloc_busy_retry,
+
+ TP_PROTO(unsigned long pfn, const struct page *page,
+ unsigned int count, unsigned int align),
+
+ TP_ARGS(pfn, page, count, align)
+);
+
#endif /* _TRACE_CMA_H */
/* This part must be outside protection */
--- a/include/trace/events/migrate.h~mm-cma-add-trace-events-for-cma-alloc-perf-testing
+++ a/include/trace/events/migrate.h
@@ -81,6 +81,28 @@ TRACE_EVENT(mm_migrate_pages,
__print_symbolic(__entry->mode, MIGRATE_MODE),
__print_symbolic(__entry->reason, MIGRATE_REASON))
);
+
+TRACE_EVENT(mm_migrate_pages_start,
+
+ TP_PROTO(enum migrate_mode mode, int reason),
+
+ TP_ARGS(mode, reason),
+
+ TP_STRUCT__entry(
+ __field(enum migrate_mode, mode)
+ __field(int, reason)
+ ),
+
+ TP_fast_assign(
+ __entry->mode = mode;
+ __entry->reason = reason;
+ ),
+
+ TP_printk("mode=%s reason=%s",
+ __print_symbolic(__entry->mode, MIGRATE_MODE),
+ __print_symbolic(__entry->reason, MIGRATE_REASON))
+);
+
#endif /* _TRACE_MIGRATE_H */
/* This part must be outside protection */
--- a/mm/cma.c~mm-cma-add-trace-events-for-cma-alloc-perf-testing
+++ a/mm/cma.c
@@ -443,6 +443,8 @@ struct page *cma_alloc(struct cma *cma,
if (!count)
goto out;
+ trace_cma_alloc_start(cma->name, count, align);
+
mask = cma_bitmap_aligned_mask(cma, align);
offset = cma_bitmap_aligned_offset(cma, align);
bitmap_maxno = cma_bitmap_maxno(cma);
@@ -483,6 +485,8 @@ struct page *cma_alloc(struct cma *cma,
pr_debug("%s(): memory range at %p is busy, retrying\n",
__func__, pfn_to_page(pfn));
+
+ trace_cma_alloc_busy_retry(pfn, pfn_to_page(pfn), count, align);
/* try again with a bit different memory target */
start = bitmap_no + mask + 1;
}
--- a/mm/migrate.c~mm-cma-add-trace-events-for-cma-alloc-perf-testing
+++ a/mm/migrate.c
@@ -1418,6 +1418,8 @@ int migrate_pages(struct list_head *from
int rc, nr_subpages;
LIST_HEAD(ret_pages);
+ trace_mm_migrate_pages_start(mode, reason);
+
if (!swapwrite)
current->flags |= PF_SWAPWRITE;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 088/143] mm: cma: support sysfs
2021-05-05 1:32 incoming Andrew Morton
` (86 preceding siblings ...)
2021-05-05 1:37 ` [patch 087/143] mm: cma: add trace events for CMA alloc perf testing Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 089/143] mm: cma: add the CMA instance name to cma trace events Andrew Morton
` (52 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, anders.roxell, colin.king, digetx, gregkh, jhubbard,
joaodias, linux-mm, minchan, mm-commits, surenb, torvalds, willy
From: Minchan Kim <minchan@kernel.org>
Subject: mm: cma: support sysfs
Since CMA is getting used more widely, it's more important to keep
monitoring CMA statistics for system health since it's directly related to
user experience.
This patch introduces sysfs statistics for CMA, in order to provide some
basic monitoring of the CMA allocator.
* the number of CMA page successful allocations
* the number of CMA page allocation failures
These two values allow the user to calcuate the allocation
failure rate for each CMA area.
e.g.)
/sys/kernel/mm/cma/WIFI/alloc_pages_[success|fail]
/sys/kernel/mm/cma/SENSOR/alloc_pages_[success|fail]
/sys/kernel/mm/cma/BLUETOOTH/alloc_pages_[success|fail]
The cma_stat was intentionally allocated by dynamic allocation
to harmonize with kobject lifetime management.
https://lore.kernel.org/linux-mm/YCOAmXqt6dZkCQYs@kroah.com/
Link: https://lkml.kernel.org/r/20210324230759.2213957-1-minchan@kernel.org
Link: https://lore.kernel.org/linux-mm/20210316100433.17665-1-colin.king@canonical.com/
Signed-off-by: Minchan Kim <minchan@kernel.org>
Signed-off-by: Colin Ian King <colin.king@canonical.com>
Tested-by: Dmitry Osipenko <digetx@gmail.com>
Reviewed-by: Dmitry Osipenko <digetx@gmail.com>
Reviewed-by: Greg Kroah-Hartman <gregkh@linuxfoundation.org>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Tested-by: Anders Roxell <anders.roxell@linaro.org>
Cc: Suren Baghdasaryan <surenb@google.com>
Cc: John Dias <joaodias@google.com>
Cc: Matthew Wilcox (Oracle) <willy@infradead.org>
Cc: Colin Ian King <colin.king@canonical.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/ABI/testing/sysfs-kernel-mm-cma | 25 +++
mm/Kconfig | 7 +
mm/Makefile | 1
mm/cma.c | 8 -
mm/cma.h | 23 +++
mm/cma_sysfs.c | 112 ++++++++++++++++
6 files changed, 174 insertions(+), 2 deletions(-)
--- /dev/null
+++ a/Documentation/ABI/testing/sysfs-kernel-mm-cma
@@ -0,0 +1,25 @@
+What: /sys/kernel/mm/cma/
+Date: Feb 2021
+Contact: Minchan Kim <minchan@kernel.org>
+Description:
+ /sys/kernel/mm/cma/ contains a subdirectory for each CMA
+ heap name (also sometimes called CMA areas).
+
+ Each CMA heap subdirectory (that is, each
+ /sys/kernel/mm/cma/<cma-heap-name> directory) contains the
+ following items:
+
+ alloc_pages_success
+ alloc_pages_fail
+
+What: /sys/kernel/mm/cma/<cma-heap-name>/alloc_pages_success
+Date: Feb 2021
+Contact: Minchan Kim <minchan@kernel.org>
+Description:
+ the number of pages CMA API succeeded to allocate
+
+What: /sys/kernel/mm/cma/<cma-heap-name>/alloc_pages_fail
+Date: Feb 2021
+Contact: Minchan Kim <minchan@kernel.org>
+Description:
+ the number of pages CMA API failed to allocate
--- a/mm/cma.c~mm-cma-support-sysfs
+++ a/mm/cma.c
@@ -511,10 +511,14 @@ struct page *cma_alloc(struct cma *cma,
pr_debug("%s(): returned %p\n", __func__, page);
out:
- if (page)
+ if (page) {
count_vm_event(CMA_ALLOC_SUCCESS);
- else
+ cma_sysfs_account_success_pages(cma, count);
+ } else {
count_vm_event(CMA_ALLOC_FAIL);
+ if (cma)
+ cma_sysfs_account_fail_pages(cma, count);
+ }
return page;
}
--- a/mm/cma.h~mm-cma-support-sysfs
+++ a/mm/cma.h
@@ -3,6 +3,12 @@
#define __MM_CMA_H__
#include <linux/debugfs.h>
+#include <linux/kobject.h>
+
+struct cma_kobject {
+ struct kobject kobj;
+ struct cma *cma;
+};
struct cma {
unsigned long base_pfn;
@@ -16,6 +22,14 @@ struct cma {
struct debugfs_u32_array dfs_bitmap;
#endif
char name[CMA_MAX_NAME];
+#ifdef CONFIG_CMA_SYSFS
+ /* the number of CMA page successful allocations */
+ atomic64_t nr_pages_succeeded;
+ /* the number of CMA page allocation failures */
+ atomic64_t nr_pages_failed;
+ /* kobject requires dynamic object */
+ struct cma_kobject *cma_kobj;
+#endif
};
extern struct cma cma_areas[MAX_CMA_AREAS];
@@ -26,4 +40,13 @@ static inline unsigned long cma_bitmap_m
return cma->count >> cma->order_per_bit;
}
+#ifdef CONFIG_CMA_SYSFS
+void cma_sysfs_account_success_pages(struct cma *cma, unsigned long nr_pages);
+void cma_sysfs_account_fail_pages(struct cma *cma, unsigned long nr_pages);
+#else
+static inline void cma_sysfs_account_success_pages(struct cma *cma,
+ unsigned long nr_pages) {};
+static inline void cma_sysfs_account_fail_pages(struct cma *cma,
+ unsigned long nr_pages) {};
+#endif
#endif
--- /dev/null
+++ a/mm/cma_sysfs.c
@@ -0,0 +1,112 @@
+// SPDX-License-Identifier: GPL-2.0
+/*
+ * CMA SysFS Interface
+ *
+ * Copyright (c) 2021 Minchan Kim <minchan@kernel.org>
+ */
+
+#include <linux/cma.h>
+#include <linux/kernel.h>
+#include <linux/slab.h>
+
+#include "cma.h"
+
+#define CMA_ATTR_RO(_name) \
+ static struct kobj_attribute _name##_attr = __ATTR_RO(_name)
+
+void cma_sysfs_account_success_pages(struct cma *cma, unsigned long nr_pages)
+{
+ atomic64_add(nr_pages, &cma->nr_pages_succeeded);
+}
+
+void cma_sysfs_account_fail_pages(struct cma *cma, unsigned long nr_pages)
+{
+ atomic64_add(nr_pages, &cma->nr_pages_failed);
+}
+
+static inline struct cma *cma_from_kobj(struct kobject *kobj)
+{
+ return container_of(kobj, struct cma_kobject, kobj)->cma;
+}
+
+static ssize_t alloc_pages_success_show(struct kobject *kobj,
+ struct kobj_attribute *attr, char *buf)
+{
+ struct cma *cma = cma_from_kobj(kobj);
+
+ return sysfs_emit(buf, "%llu\n",
+ atomic64_read(&cma->nr_pages_succeeded));
+}
+CMA_ATTR_RO(alloc_pages_success);
+
+static ssize_t alloc_pages_fail_show(struct kobject *kobj,
+ struct kobj_attribute *attr, char *buf)
+{
+ struct cma *cma = cma_from_kobj(kobj);
+
+ return sysfs_emit(buf, "%llu\n", atomic64_read(&cma->nr_pages_failed));
+}
+CMA_ATTR_RO(alloc_pages_fail);
+
+static void cma_kobj_release(struct kobject *kobj)
+{
+ struct cma *cma = cma_from_kobj(kobj);
+ struct cma_kobject *cma_kobj = cma->cma_kobj;
+
+ kfree(cma_kobj);
+ cma->cma_kobj = NULL;
+}
+
+static struct attribute *cma_attrs[] = {
+ &alloc_pages_success_attr.attr,
+ &alloc_pages_fail_attr.attr,
+ NULL,
+};
+ATTRIBUTE_GROUPS(cma);
+
+static struct kobj_type cma_ktype = {
+ .release = cma_kobj_release,
+ .sysfs_ops = &kobj_sysfs_ops,
+ .default_groups = cma_groups,
+};
+
+static int __init cma_sysfs_init(void)
+{
+ struct kobject *cma_kobj_root;
+ struct cma_kobject *cma_kobj;
+ struct cma *cma;
+ int i, err;
+
+ cma_kobj_root = kobject_create_and_add("cma", mm_kobj);
+ if (!cma_kobj_root)
+ return -ENOMEM;
+
+ for (i = 0; i < cma_area_count; i++) {
+ cma_kobj = kzalloc(sizeof(*cma_kobj), GFP_KERNEL);
+ if (!cma_kobj) {
+ err = -ENOMEM;
+ goto out;
+ }
+
+ cma = &cma_areas[i];
+ cma->cma_kobj = cma_kobj;
+ cma_kobj->cma = cma;
+ err = kobject_init_and_add(&cma_kobj->kobj, &cma_ktype,
+ cma_kobj_root, "%s", cma->name);
+ if (err) {
+ kobject_put(&cma_kobj->kobj);
+ goto out;
+ }
+ }
+
+ return 0;
+out:
+ while (--i >= 0) {
+ cma = &cma_areas[i];
+ kobject_put(&cma->cma_kobj->kobj);
+ }
+ kobject_put(cma_kobj_root);
+
+ return err;
+}
+subsys_initcall(cma_sysfs_init);
--- a/mm/Kconfig~mm-cma-support-sysfs
+++ a/mm/Kconfig
@@ -518,6 +518,13 @@ config CMA_DEBUGFS
help
Turns on the DebugFS interface for CMA.
+config CMA_SYSFS
+ bool "CMA information through sysfs interface"
+ depends on CMA && SYSFS
+ help
+ This option exposes some sysfs attributes to get information
+ from CMA.
+
config CMA_AREAS
int "Maximum count of the CMA areas"
depends on CMA
--- a/mm/Makefile~mm-cma-support-sysfs
+++ a/mm/Makefile
@@ -109,6 +109,7 @@ obj-$(CONFIG_CMA) += cma.o
obj-$(CONFIG_MEMORY_BALLOON) += balloon_compaction.o
obj-$(CONFIG_PAGE_EXTENSION) += page_ext.o
obj-$(CONFIG_CMA_DEBUGFS) += cma_debug.o
+obj-$(CONFIG_CMA_SYSFS) += cma_sysfs.o
obj-$(CONFIG_USERFAULTFD) += userfaultfd.o
obj-$(CONFIG_IDLE_PAGE_TRACKING) += page_idle.o
obj-$(CONFIG_DEBUG_PAGE_REF) += debug_page_ref.o
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 089/143] mm: cma: add the CMA instance name to cma trace events
2021-05-05 1:32 incoming Andrew Morton
` (87 preceding siblings ...)
2021-05-05 1:37 ` [patch 088/143] mm: cma: support sysfs Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 090/143] mm: use proper type for cma_[alloc|release] Andrew Morton
` (51 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, georgi.djakov, linux-mm, lmark, minchan, mm-commits,
torvalds
From: Minchan Kim <minchan@kernel.org>
Subject: mm: cma: add the CMA instance name to cma trace events
There were missing places to add cma instance name. To identify each CMA
instance, let's add the name for every cma trace. This patch also changes
the existing cma_trace_alloc to cma_trace_finish since we have
cma_alloc_start[1].
[1] https://lore.kernel.org/linux-mm/20210324160740.15901-1-georgi.djakov@linaro.org
Link: https://lkml.kernel.org/r/20210330220237.748899-1-minchan@kernel.org
Signed-off-by: Minchan Kim <minchan@kernel.org>
Cc: Liam Mark <lmark@codeaurora.org>
Cc: Georgi Djakov <georgi.djakov@linaro.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/trace/events/cma.h | 28 +++++++++++++++++-----------
mm/cma.c | 7 ++++---
2 files changed, 21 insertions(+), 14 deletions(-)
--- a/include/trace/events/cma.h~mm-cma-add-the-cma-instance-name-to-cma-trace-events
+++ a/include/trace/events/cma.h
@@ -10,12 +10,13 @@
DECLARE_EVENT_CLASS(cma_alloc_class,
- TP_PROTO(unsigned long pfn, const struct page *page,
+ TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
unsigned int count, unsigned int align),
- TP_ARGS(pfn, page, count, align),
+ TP_ARGS(name, pfn, page, count, align),
TP_STRUCT__entry(
+ __string(name, name)
__field(unsigned long, pfn)
__field(const struct page *, page)
__field(unsigned int, count)
@@ -23,13 +24,15 @@ DECLARE_EVENT_CLASS(cma_alloc_class,
),
TP_fast_assign(
+ __assign_str(name, name);
__entry->pfn = pfn;
__entry->page = page;
__entry->count = count;
__entry->align = align;
),
- TP_printk("pfn=%lx page=%p count=%u align=%u",
+ TP_printk("name=%s pfn=%lx page=%p count=%u align=%u",
+ __get_str(name),
__entry->pfn,
__entry->page,
__entry->count,
@@ -38,24 +41,27 @@ DECLARE_EVENT_CLASS(cma_alloc_class,
TRACE_EVENT(cma_release,
- TP_PROTO(unsigned long pfn, const struct page *page,
+ TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
unsigned int count),
- TP_ARGS(pfn, page, count),
+ TP_ARGS(name, pfn, page, count),
TP_STRUCT__entry(
+ __string(name, name)
__field(unsigned long, pfn)
__field(const struct page *, page)
__field(unsigned int, count)
),
TP_fast_assign(
+ __assign_str(name, name);
__entry->pfn = pfn;
__entry->page = page;
__entry->count = count;
),
- TP_printk("pfn=%lx page=%p count=%u",
+ TP_printk("name=%s pfn=%lx page=%p count=%u",
+ __get_str(name),
__entry->pfn,
__entry->page,
__entry->count)
@@ -85,20 +91,20 @@ TRACE_EVENT(cma_alloc_start,
__entry->align)
);
-DEFINE_EVENT(cma_alloc_class, cma_alloc,
+DEFINE_EVENT(cma_alloc_class, cma_alloc_finish,
- TP_PROTO(unsigned long pfn, const struct page *page,
+ TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
unsigned int count, unsigned int align),
- TP_ARGS(pfn, page, count, align)
+ TP_ARGS(name, pfn, page, count, align)
);
DEFINE_EVENT(cma_alloc_class, cma_alloc_busy_retry,
- TP_PROTO(unsigned long pfn, const struct page *page,
+ TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
unsigned int count, unsigned int align),
- TP_ARGS(pfn, page, count, align)
+ TP_ARGS(name, pfn, page, count, align)
);
#endif /* _TRACE_CMA_H */
--- a/mm/cma.c~mm-cma-add-the-cma-instance-name-to-cma-trace-events
+++ a/mm/cma.c
@@ -486,12 +486,13 @@ struct page *cma_alloc(struct cma *cma,
pr_debug("%s(): memory range at %p is busy, retrying\n",
__func__, pfn_to_page(pfn));
- trace_cma_alloc_busy_retry(pfn, pfn_to_page(pfn), count, align);
+ trace_cma_alloc_busy_retry(cma->name, pfn, pfn_to_page(pfn),
+ count, align);
/* try again with a bit different memory target */
start = bitmap_no + mask + 1;
}
- trace_cma_alloc(pfn, page, count, align);
+ trace_cma_alloc_finish(cma->name, pfn, page, count, align);
/*
* CMA can allocate multiple page blocks, which results in different
@@ -551,7 +552,7 @@ bool cma_release(struct cma *cma, const
free_contig_range(pfn, count);
cma_clear_bitmap(cma, pfn, count);
- trace_cma_release(pfn, pages, count);
+ trace_cma_release(cma->name, pfn, pages, count);
return true;
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 090/143] mm: use proper type for cma_[alloc|release]
2021-05-05 1:32 incoming Andrew Morton
` (88 preceding siblings ...)
2021-05-05 1:37 ` [patch 089/143] mm: cma: add the CMA instance name to cma trace events Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 091/143] ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search() Andrew Morton
` (50 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, david, linux-mm, minchan, mm-commits, torvalds, willy
From: Minchan Kim <minchan@kernel.org>
Subject: mm: use proper type for cma_[alloc|release]
size_t in cma_alloc is confusing since it makes people think it's byte
count, not pages. Change it to unsigned long[1].
The unsigned int in cma_release is also not right so change it. Since we
have unsigned long in cma_release, free_contig_range should also respect
it.
[1] 67a2e213e7e9, mm: cma: fix incorrect type conversion for size during dma allocation
Link: https://lore.kernel.org/linux-mm/20210324043434.GP1719932@casper.infradead.org/
Link: https://lkml.kernel.org/r/20210331164018.710560-1-minchan@kernel.org
Signed-off-by: Minchan Kim <minchan@kernel.org>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: David Hildenbrand <david@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/cma.h | 4 ++--
include/linux/gfp.h | 2 +-
include/trace/events/cma.h | 22 +++++++++++-----------
mm/cma.c | 17 +++++++++--------
mm/page_alloc.c | 6 +++---
5 files changed, 26 insertions(+), 25 deletions(-)
--- a/include/linux/cma.h~mm-use-proper-type-for-cma_
+++ a/include/linux/cma.h
@@ -44,9 +44,9 @@ extern int cma_init_reserved_mem(phys_ad
unsigned int order_per_bit,
const char *name,
struct cma **res_cma);
-extern struct page *cma_alloc(struct cma *cma, size_t count, unsigned int align,
+extern struct page *cma_alloc(struct cma *cma, unsigned long count, unsigned int align,
bool no_warn);
-extern bool cma_release(struct cma *cma, const struct page *pages, unsigned int count);
+extern bool cma_release(struct cma *cma, const struct page *pages, unsigned long count);
extern int cma_for_each_area(int (*it)(struct cma *cma, void *data), void *data);
#endif
--- a/include/linux/gfp.h~mm-use-proper-type-for-cma_
+++ a/include/linux/gfp.h
@@ -657,7 +657,7 @@ extern int alloc_contig_range(unsigned l
extern struct page *alloc_contig_pages(unsigned long nr_pages, gfp_t gfp_mask,
int nid, nodemask_t *nodemask);
#endif
-void free_contig_range(unsigned long pfn, unsigned int nr_pages);
+void free_contig_range(unsigned long pfn, unsigned long nr_pages);
#ifdef CONFIG_CMA
/* CMA stuff */
--- a/include/trace/events/cma.h~mm-use-proper-type-for-cma_
+++ a/include/trace/events/cma.h
@@ -11,7 +11,7 @@
DECLARE_EVENT_CLASS(cma_alloc_class,
TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
- unsigned int count, unsigned int align),
+ unsigned long count, unsigned int align),
TP_ARGS(name, pfn, page, count, align),
@@ -19,7 +19,7 @@ DECLARE_EVENT_CLASS(cma_alloc_class,
__string(name, name)
__field(unsigned long, pfn)
__field(const struct page *, page)
- __field(unsigned int, count)
+ __field(unsigned long, count)
__field(unsigned int, align)
),
@@ -31,7 +31,7 @@ DECLARE_EVENT_CLASS(cma_alloc_class,
__entry->align = align;
),
- TP_printk("name=%s pfn=%lx page=%p count=%u align=%u",
+ TP_printk("name=%s pfn=%lx page=%p count=%lu align=%u",
__get_str(name),
__entry->pfn,
__entry->page,
@@ -42,7 +42,7 @@ DECLARE_EVENT_CLASS(cma_alloc_class,
TRACE_EVENT(cma_release,
TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
- unsigned int count),
+ unsigned long count),
TP_ARGS(name, pfn, page, count),
@@ -50,7 +50,7 @@ TRACE_EVENT(cma_release,
__string(name, name)
__field(unsigned long, pfn)
__field(const struct page *, page)
- __field(unsigned int, count)
+ __field(unsigned long, count)
),
TP_fast_assign(
@@ -60,7 +60,7 @@ TRACE_EVENT(cma_release,
__entry->count = count;
),
- TP_printk("name=%s pfn=%lx page=%p count=%u",
+ TP_printk("name=%s pfn=%lx page=%p count=%lu",
__get_str(name),
__entry->pfn,
__entry->page,
@@ -69,13 +69,13 @@ TRACE_EVENT(cma_release,
TRACE_EVENT(cma_alloc_start,
- TP_PROTO(const char *name, unsigned int count, unsigned int align),
+ TP_PROTO(const char *name, unsigned long count, unsigned int align),
TP_ARGS(name, count, align),
TP_STRUCT__entry(
__string(name, name)
- __field(unsigned int, count)
+ __field(unsigned long, count)
__field(unsigned int, align)
),
@@ -85,7 +85,7 @@ TRACE_EVENT(cma_alloc_start,
__entry->align = align;
),
- TP_printk("name=%s count=%u align=%u",
+ TP_printk("name=%s count=%lu align=%u",
__get_str(name),
__entry->count,
__entry->align)
@@ -94,7 +94,7 @@ TRACE_EVENT(cma_alloc_start,
DEFINE_EVENT(cma_alloc_class, cma_alloc_finish,
TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
- unsigned int count, unsigned int align),
+ unsigned long count, unsigned int align),
TP_ARGS(name, pfn, page, count, align)
);
@@ -102,7 +102,7 @@ DEFINE_EVENT(cma_alloc_class, cma_alloc_
DEFINE_EVENT(cma_alloc_class, cma_alloc_busy_retry,
TP_PROTO(const char *name, unsigned long pfn, const struct page *page,
- unsigned int count, unsigned int align),
+ unsigned long count, unsigned int align),
TP_ARGS(name, pfn, page, count, align)
);
--- a/mm/cma.c~mm-use-proper-type-for-cma_
+++ a/mm/cma.c
@@ -79,7 +79,7 @@ static unsigned long cma_bitmap_pages_to
}
static void cma_clear_bitmap(struct cma *cma, unsigned long pfn,
- unsigned int count)
+ unsigned long count)
{
unsigned long bitmap_no, bitmap_count;
unsigned long flags;
@@ -423,21 +423,21 @@ static inline void cma_debug_show_areas(
* This function allocates part of contiguous memory on specific
* contiguous memory area.
*/
-struct page *cma_alloc(struct cma *cma, size_t count, unsigned int align,
- bool no_warn)
+struct page *cma_alloc(struct cma *cma, unsigned long count,
+ unsigned int align, bool no_warn)
{
unsigned long mask, offset;
unsigned long pfn = -1;
unsigned long start = 0;
unsigned long bitmap_maxno, bitmap_no, bitmap_count;
- size_t i;
+ unsigned long i;
struct page *page = NULL;
int ret = -ENOMEM;
if (!cma || !cma->count || !cma->bitmap)
goto out;
- pr_debug("%s(cma %p, count %zu, align %d)\n", __func__, (void *)cma,
+ pr_debug("%s(cma %p, count %lu, align %d)\n", __func__, (void *)cma,
count, align);
if (!count)
@@ -505,7 +505,7 @@ struct page *cma_alloc(struct cma *cma,
}
if (ret && !no_warn) {
- pr_err_ratelimited("%s: %s: alloc failed, req-size: %zu pages, ret: %d\n",
+ pr_err_ratelimited("%s: %s: alloc failed, req-size: %lu pages, ret: %d\n",
__func__, cma->name, count, ret);
cma_debug_show_areas(cma);
}
@@ -534,14 +534,15 @@ out:
* It returns false when provided pages do not belong to contiguous area and
* true otherwise.
*/
-bool cma_release(struct cma *cma, const struct page *pages, unsigned int count)
+bool cma_release(struct cma *cma, const struct page *pages,
+ unsigned long count)
{
unsigned long pfn;
if (!cma || !pages)
return false;
- pr_debug("%s(page %p, count %u)\n", __func__, (void *)pages, count);
+ pr_debug("%s(page %p, count %lu)\n", __func__, (void *)pages, count);
pfn = page_to_pfn(pages);
--- a/mm/page_alloc.c~mm-use-proper-type-for-cma_
+++ a/mm/page_alloc.c
@@ -8973,9 +8973,9 @@ struct page *alloc_contig_pages(unsigned
}
#endif /* CONFIG_CONTIG_ALLOC */
-void free_contig_range(unsigned long pfn, unsigned int nr_pages)
+void free_contig_range(unsigned long pfn, unsigned long nr_pages)
{
- unsigned int count = 0;
+ unsigned long count = 0;
for (; nr_pages--; pfn++) {
struct page *page = pfn_to_page(pfn);
@@ -8983,7 +8983,7 @@ void free_contig_range(unsigned long pfn
count += page_count(page) != 1;
__free_page(page);
}
- WARN(count != 0, "%d pages are still in use!\n", count);
+ WARN(count != 0, "%lu pages are still in use!\n", count);
}
EXPORT_SYMBOL(free_contig_range);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 091/143] ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search()
2021-05-05 1:32 incoming Andrew Morton
` (89 preceding siblings ...)
2021-05-05 1:37 ` [patch 090/143] mm: use proper type for cma_[alloc|release] Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 092/143] ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree() Andrew Morton
` (49 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, hughd, linmiaohe, linux-mm, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search()
Patch series "Cleanup and fixup for ksm".
This series contains cleanups to remove unnecessary VM_BUG_ON_PAGE and
dedicated macro KSM_FLAG_MASK. Also this fixes potential missing
rmap_item for stable_node which would result in failed rmap_walk_ksm().
More details can be found in the respective changelogs.
This patch (of 4):
The same VM_BUG_ON_PAGE() check is already done in the callee. Remove
these extra caller one to simplify code slightly.
Link: https://lkml.kernel.org/r/20210330140228.45635-1-linmiaohe@huawei.com
Link: https://lkml.kernel.org/r/20210330140228.45635-2-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Hugh Dickins <hughd@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/ksm.c | 2 --
1 file changed, 2 deletions(-)
--- a/mm/ksm.c~ksm-remove-redundant-vm_bug_on_page-on-stable_tree_search
+++ a/mm/ksm.c
@@ -1771,7 +1771,6 @@ chain_append:
* stable_node_dup is the dup to replace.
*/
if (stable_node_dup == stable_node) {
- VM_BUG_ON(is_stable_node_chain(stable_node_dup));
VM_BUG_ON(is_stable_node_dup(stable_node_dup));
/* chain is missing so create it */
stable_node = alloc_stable_node_chain(stable_node_dup,
@@ -1785,7 +1784,6 @@ chain_append:
* of the current nid for this page
* content.
*/
- VM_BUG_ON(!is_stable_node_chain(stable_node));
VM_BUG_ON(!is_stable_node_dup(stable_node_dup));
VM_BUG_ON(page_node->head != &migrate_nodes);
list_del(&page_node->list);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 092/143] ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()
2021-05-05 1:32 incoming Andrew Morton
` (90 preceding siblings ...)
2021-05-05 1:37 ` [patch 091/143] ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search() Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 093/143] ksm: remove dedicated macro KSM_FLAG_MASK Andrew Morton
` (48 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, hughd, linmiaohe, linux-mm, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()
It's unnecessary to lock the page when get ksm page if we're going to
remove the rmap item as page migration is irrelevant in this case. Use
GET_KSM_PAGE_NOLOCK instead to save some page lock cycles.
Link: https://lkml.kernel.org/r/20210330140228.45635-3-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Hugh Dickins <hughd@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/ksm.c | 3 +--
1 file changed, 1 insertion(+), 2 deletions(-)
--- a/mm/ksm.c~ksm-use-get_ksm_page_nolock-to-get-ksm-page-in-remove_rmap_item_from_tree
+++ a/mm/ksm.c
@@ -778,12 +778,11 @@ static void remove_rmap_item_from_tree(s
struct page *page;
stable_node = rmap_item->head;
- page = get_ksm_page(stable_node, GET_KSM_PAGE_LOCK);
+ page = get_ksm_page(stable_node, GET_KSM_PAGE_NOLOCK);
if (!page)
goto out;
hlist_del(&rmap_item->hlist);
- unlock_page(page);
put_page(page);
if (!hlist_empty(&stable_node->hlist))
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 093/143] ksm: remove dedicated macro KSM_FLAG_MASK
2021-05-05 1:32 incoming Andrew Morton
` (91 preceding siblings ...)
2021-05-05 1:37 ` [patch 092/143] ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree() Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 094/143] ksm: fix potential missing rmap_item for stable_node Andrew Morton
` (47 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, hughd, linmiaohe, linux-mm, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: ksm: remove dedicated macro KSM_FLAG_MASK
The macro KSM_FLAG_MASK is used in rmap_walk_ksm() only. So we can
replace ~KSM_FLAG_MASK with PAGE_MASK to remove this dedicated macro and
make code more consistent because PAGE_MASK is used elsewhere in this
file.
Link: https://lkml.kernel.org/r/20210330140228.45635-4-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Hugh Dickins <hughd@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/ksm.c | 4 +---
1 file changed, 1 insertion(+), 3 deletions(-)
--- a/mm/ksm.c~ksm-remove-dedicated-macro-ksm_flag_mask
+++ a/mm/ksm.c
@@ -215,8 +215,6 @@ struct rmap_item {
#define SEQNR_MASK 0x0ff /* low bits of unstable tree seqnr */
#define UNSTABLE_FLAG 0x100 /* is a node of the unstable tree */
#define STABLE_FLAG 0x200 /* is listed from the stable tree */
-#define KSM_FLAG_MASK (SEQNR_MASK|UNSTABLE_FLAG|STABLE_FLAG)
- /* to mask all the flags */
/* The stable and unstable tree heads */
static struct rb_root one_stable_tree[1] = { RB_ROOT };
@@ -2631,7 +2629,7 @@ again:
vma = vmac->vma;
/* Ignore the stable/unstable/sqnr flags */
- addr = rmap_item->address & ~KSM_FLAG_MASK;
+ addr = rmap_item->address & PAGE_MASK;
if (addr < vma->vm_start || addr >= vma->vm_end)
continue;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 094/143] ksm: fix potential missing rmap_item for stable_node
2021-05-05 1:32 incoming Andrew Morton
` (92 preceding siblings ...)
2021-05-05 1:37 ` [patch 093/143] ksm: remove dedicated macro KSM_FLAG_MASK Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 095/143] mm/ksm: remove unused parameter from remove_trailing_rmap_items() Andrew Morton
` (46 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, hughd, linmiaohe, linux-mm, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: ksm: fix potential missing rmap_item for stable_node
When removing rmap_item from stable tree, STABLE_FLAG of rmap_item is
cleared with head reserved. So the following scenario might happen: For
ksm page with rmap_item1:
cmp_and_merge_page
stable_node->head = &migrate_nodes;
remove_rmap_item_from_tree, but head still equal to stable_node;
try_to_merge_with_ksm_page failed;
return;
For the same ksm page with rmap_item2, stable node migration succeed this
time. The stable_node->head does not equal to migrate_nodes now. For ksm
page with rmap_item1 again:
cmp_and_merge_page
stable_node->head != &migrate_nodes && rmap_item->head == stable_node
return;
We would miss the rmap_item for stable_node and might result in failed
rmap_walk_ksm(). Fix this by set rmap_item->head to NULL when rmap_item
is removed from stable tree.
Link: https://lkml.kernel.org/r/20210330140228.45635-5-linmiaohe@huawei.com
Fixes: 4146d2d673e8 ("ksm: make !merge_across_nodes migration safe")
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Hugh Dickins <hughd@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/ksm.c | 1 +
1 file changed, 1 insertion(+)
--- a/mm/ksm.c~ksm-fix-potential-missing-rmap_item-for-stable_node
+++ a/mm/ksm.c
@@ -791,6 +791,7 @@ static void remove_rmap_item_from_tree(s
stable_node->rmap_hlist_len--;
put_anon_vma(rmap_item->anon_vma);
+ rmap_item->head = NULL;
rmap_item->address &= PAGE_MASK;
} else if (rmap_item->address & UNSTABLE_FLAG) {
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 095/143] mm/ksm: remove unused parameter from remove_trailing_rmap_items()
2021-05-05 1:32 incoming Andrew Morton
` (93 preceding siblings ...)
2021-05-05 1:37 ` [patch 094/143] ksm: fix potential missing rmap_item for stable_node Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 096/143] mm: restore node stat checking in /proc/sys/vm/stat_refresh Andrew Morton
` (45 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, cy.fan, david, hughd, linux-mm, mm-commits, torvalds
From: Chengyang Fan <cy.fan@huawei.com>
Subject: mm/ksm: remove unused parameter from remove_trailing_rmap_items()
Since commit 6514d511dbe5 ("ksm: singly-linked rmap_list") was merged,
remove_trailing_rmap_items() doesn't use the 'mm_slot' parameter. So
remove it, and update caller accordingly.
Link: https://lkml.kernel.org/r/20210330121320.1693474-1-cy.fan@huawei.com
Signed-off-by: Chengyang Fan <cy.fan@huawei.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Hugh Dickins <hughd@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/ksm.c | 7 +++----
1 file changed, 3 insertions(+), 4 deletions(-)
--- a/mm/ksm.c~mm-ksm-remove-unused-parameter-from-remove_trailing_rmap_items
+++ a/mm/ksm.c
@@ -815,8 +815,7 @@ out:
cond_resched(); /* we're called from many long loops */
}
-static void remove_trailing_rmap_items(struct mm_slot *mm_slot,
- struct rmap_item **rmap_list)
+static void remove_trailing_rmap_items(struct rmap_item **rmap_list)
{
while (*rmap_list) {
struct rmap_item *rmap_item = *rmap_list;
@@ -987,7 +986,7 @@ static int unmerge_and_remove_all_rmap_i
goto error;
}
- remove_trailing_rmap_items(mm_slot, &mm_slot->rmap_list);
+ remove_trailing_rmap_items(&mm_slot->rmap_list);
mmap_read_unlock(mm);
spin_lock(&ksm_mmlist_lock);
@@ -2333,7 +2332,7 @@ next_mm:
* Nuke all the rmap_items that are above this current rmap:
* because there were no VM_MERGEABLE vmas with such addresses.
*/
- remove_trailing_rmap_items(slot, ksm_scan.rmap_list);
+ remove_trailing_rmap_items(ksm_scan.rmap_list);
spin_lock(&ksm_mmlist_lock);
ksm_scan.mm_slot = list_entry(slot->mm_list.next,
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 096/143] mm: restore node stat checking in /proc/sys/vm/stat_refresh
2021-05-05 1:32 incoming Andrew Morton
` (94 preceding siblings ...)
2021-05-05 1:37 ` [patch 095/143] mm/ksm: remove unused parameter from remove_trailing_rmap_items() Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 097/143] mm: no more EINVAL from /proc/sys/vm/stat_refresh Andrew Morton
` (44 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, guro, hannes, hughd, linux-mm, mhocko, mm-commits, torvalds,
vbabka
From: Hugh Dickins <hughd@google.com>
Subject: mm: restore node stat checking in /proc/sys/vm/stat_refresh
v4.7 52b6f46bc163 ("mm: /proc/sys/vm/stat_refresh to force vmstat update")
introduced vmstat_refresh(), with its vmstat underflow checking; then v4.8
75ef71840539 ("mm, vmstat: add infrastructure for per-node vmstats") split
NR_VM_NODE_STAT_ITEMS out of NR_VM_ZONE_STAT_ITEMS without updating
vmstat_refresh(): so it has been missing out much of the vmstat underflow
checking ever since. Reinstate it. Thanks to Roman Gushchin
<guro@fb.com> for tangentially pointing this out.
Link: https://lkml.kernel.org/r/alpine.LSU.2.11.2102251502240.13363@eggly.anvils
Signed-off-by: Hugh Dickins <hughd@google.com>
Cc: Roman Gushchin <guro@fb.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmstat.c | 8 ++++++++
1 file changed, 8 insertions(+)
--- a/mm/vmstat.c~mm-restore-node-stat-checking-in-proc-sys-vm-stat_refresh
+++ a/mm/vmstat.c
@@ -1875,6 +1875,14 @@ int vmstat_refresh(struct ctl_table *tab
}
}
#endif
+ for (i = 0; i < NR_VM_NODE_STAT_ITEMS; i++) {
+ val = atomic_long_read(&vm_node_stat[i]);
+ if (val < 0) {
+ pr_warn("%s: %s %ld\n",
+ __func__, node_stat_name(i), val);
+ err = -EINVAL;
+ }
+ }
if (err)
return err;
if (write)
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 097/143] mm: no more EINVAL from /proc/sys/vm/stat_refresh
2021-05-05 1:32 incoming Andrew Morton
` (95 preceding siblings ...)
2021-05-05 1:37 ` [patch 096/143] mm: restore node stat checking in /proc/sys/vm/stat_refresh Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:37 ` [patch 098/143] mm: /proc/sys/vm/stat_refresh skip checking known negative stats Andrew Morton
` (43 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, guro, hannes, hughd, linux-mm, mhocko, mm-commits, torvalds,
vbabka
From: Hugh Dickins <hughd@google.com>
Subject: mm: no more EINVAL from /proc/sys/vm/stat_refresh
EINVAL was good for drawing the refresher's attention to a warning in
dmesg, but became very tiresome when running test suites scripted with
"set -e": an underflow from a bug in one feature would cause unrelated
tests much later to fail, just because their /proc/sys/vm/stat_refresh
touch failed with that error. Stop doing that.
Link: https://lkml.kernel.org/r/alpine.LSU.2.11.2102251510410.13363@eggly.anvils
Signed-off-by: Hugh Dickins <hughd@google.com>
Acked-by: Roman Gushchin <guro@fb.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmstat.c | 5 -----
1 file changed, 5 deletions(-)
--- a/mm/vmstat.c~mm-no-more-einval-from-proc-sys-vm-stat_refresh
+++ a/mm/vmstat.c
@@ -1862,7 +1862,6 @@ int vmstat_refresh(struct ctl_table *tab
if (val < 0) {
pr_warn("%s: %s %ld\n",
__func__, zone_stat_name(i), val);
- err = -EINVAL;
}
}
#ifdef CONFIG_NUMA
@@ -1871,7 +1870,6 @@ int vmstat_refresh(struct ctl_table *tab
if (val < 0) {
pr_warn("%s: %s %ld\n",
__func__, numa_stat_name(i), val);
- err = -EINVAL;
}
}
#endif
@@ -1880,11 +1878,8 @@ int vmstat_refresh(struct ctl_table *tab
if (val < 0) {
pr_warn("%s: %s %ld\n",
__func__, node_stat_name(i), val);
- err = -EINVAL;
}
}
- if (err)
- return err;
if (write)
*ppos += *lenp;
else
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 098/143] mm: /proc/sys/vm/stat_refresh skip checking known negative stats
2021-05-05 1:32 incoming Andrew Morton
` (96 preceding siblings ...)
2021-05-05 1:37 ` [patch 097/143] mm: no more EINVAL from /proc/sys/vm/stat_refresh Andrew Morton
@ 2021-05-05 1:37 ` Andrew Morton
2021-05-05 1:38 ` [patch 099/143] mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats Andrew Morton
` (42 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:37 UTC (permalink / raw)
To: akpm, guro, hannes, hughd, linux-mm, mhocko, mm-commits, torvalds,
vbabka
From: Hugh Dickins <hughd@google.com>
Subject: mm: /proc/sys/vm/stat_refresh skip checking known negative stats
vmstat_refresh() can occasionally catch nr_zone_write_pending and
nr_writeback when they are transiently negative. The reason is partly
that the interrupt which decrements them in test_clear_page_writeback()
can come in before __test_set_page_writeback() got to increment them; but
transient negatives are still seen even when that is prevented, and I am
not yet certain why (but see Roman's note below). Those stats are not
buggy, they have never been seen to drift away from 0 permanently: so just
avoid the annoyance of showing a warning on them.
Similarly avoid showing a warning on nr_free_cma: CMA users have seen that
one reported negative from /proc/sys/vm/stat_refresh too, but it does
drift away permanently: I believe that's because its incrementation and
decrementation are decided by page migratetype, but the migratetype of a
pageblock is not guaranteed to be constant.
Roman Gushchin points out:
For performance reasons, vmstat counters are incremented and decremented
using per-cpu batches. vmstat_refresh() flushes the per-cpu batches on
all CPUs, to get values as accurate as possible; but this method is not
atomic, so the resulting value is not always precise. As a consequence,
for those counters whose actual value is close to 0, a small negative
value may occasionally be reported. If the value is small and the state
is transient, it is not an indication of an error.
Link: https://lore.kernel.org/linux-mm/20200714173747.3315771-1-guro@fb.com/
Link: https://lkml.kernel.org/r/alpine.LSU.2.11.2103012158540.7549@eggly.anvils
Signed-off-by: Hugh Dickins <hughd@google.com>
Reported-by: Roman Gushchin <guro@fb.com>
Acked-by: Roman Gushchin <guro@fb.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmstat.c | 15 +++++++++++++++
1 file changed, 15 insertions(+)
--- a/mm/vmstat.c~mm-proc-sys-vm-stat_refresh-skip-checking-known-negative-stats
+++ a/mm/vmstat.c
@@ -1858,6 +1858,14 @@ int vmstat_refresh(struct ctl_table *tab
if (err)
return err;
for (i = 0; i < NR_VM_ZONE_STAT_ITEMS; i++) {
+ /*
+ * Skip checking stats known to go negative occasionally.
+ */
+ switch (i) {
+ case NR_ZONE_WRITE_PENDING:
+ case NR_FREE_CMA_PAGES:
+ continue;
+ }
val = atomic_long_read(&vm_zone_stat[i]);
if (val < 0) {
pr_warn("%s: %s %ld\n",
@@ -1874,6 +1882,13 @@ int vmstat_refresh(struct ctl_table *tab
}
#endif
for (i = 0; i < NR_VM_NODE_STAT_ITEMS; i++) {
+ /*
+ * Skip checking stats known to go negative occasionally.
+ */
+ switch (i) {
+ case NR_WRITEBACK:
+ continue;
+ }
val = atomic_long_read(&vm_node_stat[i]);
if (val < 0) {
pr_warn("%s: %s %ld\n",
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 099/143] mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats
2021-05-05 1:32 incoming Andrew Morton
` (97 preceding siblings ...)
2021-05-05 1:37 ` [patch 098/143] mm: /proc/sys/vm/stat_refresh skip checking known negative stats Andrew Morton
@ 2021-05-05 1:38 ` Andrew Morton
2021-05-05 1:38 ` [patch 100/143] x86/mm: track linear mapping split events Andrew Morton
` (41 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw)
To: akpm, guro, hannes, hughd, linux-mm, mhocko, mm-commits, torvalds,
vbabka
From: Hugh Dickins <hughd@google.com>
Subject: mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats
All of the VM NUMA stats are event counts, incremented never decremented:
it is not very useful for vmstat_refresh() to check them throughout their
first aeon, then warn on them throughout their next.
Link: https://lkml.kernel.org/r/alpine.LSU.2.11.2102251514110.13363@eggly.anvils
Signed-off-by: Hugh Dickins <hughd@google.com>
Acked-by: Roman Gushchin <guro@fb.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmstat.c | 9 ---------
1 file changed, 9 deletions(-)
--- a/mm/vmstat.c~mm-proc-sys-vm-stat_refresh-stop-checking-monotonic-numa-stats
+++ a/mm/vmstat.c
@@ -1872,15 +1872,6 @@ int vmstat_refresh(struct ctl_table *tab
__func__, zone_stat_name(i), val);
}
}
-#ifdef CONFIG_NUMA
- for (i = 0; i < NR_VM_NUMA_STAT_ITEMS; i++) {
- val = atomic_long_read(&vm_numa_stat[i]);
- if (val < 0) {
- pr_warn("%s: %s %ld\n",
- __func__, numa_stat_name(i), val);
- }
- }
-#endif
for (i = 0; i < NR_VM_NODE_STAT_ITEMS; i++) {
/*
* Skip checking stats known to go negative occasionally.
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 100/143] x86/mm: track linear mapping split events
2021-05-05 1:32 incoming Andrew Morton
` (98 preceding siblings ...)
2021-05-05 1:38 ` [patch 099/143] mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats Andrew Morton
@ 2021-05-05 1:38 ` Andrew Morton
2021-05-05 1:38 ` [patch 101/143] mm/mmap.c: don't unlock VMAs in remap_file_pages() Andrew Morton
` (40 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw)
To: akpm, dave.hansen, hannes, linux-mm, mingo, mm-commits,
saravanand, tj, torvalds
From: Saravanan D <saravanand@fb.com>
Subject: x86/mm: track linear mapping split events
To help with debugging the sluggishness caused by TLB miss/reload, we
introduce monotonic hugepage [direct mapped] split event counts since
system state: SYSTEM_RUNNING to be displayed as part of /proc/vmstat in
x86 servers
The lifetime split event information will be displayed at the bottom of
/proc/vmstat
....
swap_ra 0
swap_ra_hit 0
direct_map_level2_splits 94
direct_map_level3_splits 4
nr_unstable 0
....
One of the many lasting sources of direct hugepage splits is kernel
tracing (kprobes, tracepoints).
Note that the kernel's code segment [512 MB] points to the same physical
addresses that have been already mapped in the kernel's direct mapping
range.
Source : Documentation/x86/x86_64/mm.rst
When we enable kernel tracing, the kernel has to modify
attributes/permissions of the text segment hugepages that are direct
mapped causing them to split.
Kernel's direct mapped hugepages do not coalesce back after split and
remain in place for the remainder of the lifetime.
An instance of direct page splits when we turn on dynamic kernel tracing
....
cat /proc/vmstat | grep -i direct_map_level
direct_map_level2_splits 784
direct_map_level3_splits 12
bpftrace -e 'tracepoint:raw_syscalls:sys_enter { @ [pid, comm] =
count(); }'
cat /proc/vmstat | grep -i
direct_map_level
direct_map_level2_splits 789
direct_map_level3_splits 12
....
Link: https://lkml.kernel.org/r/20210218235744.1040634-1-saravanand@fb.com
Signed-off-by: Saravanan D <saravanand@fb.com>
Acked-by: Tejun Heo <tj@kernel.org>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Acked-by: Dave Hansen <dave.hansen@linux.intel.com>
Cc: Ingo Molnar <mingo@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/x86/mm/pat/set_memory.c | 8 ++++++++
include/linux/vm_event_item.h | 4 ++++
mm/vmstat.c | 4 ++++
3 files changed, 16 insertions(+)
--- a/arch/x86/mm/pat/set_memory.c~x86-mm-tracking-linear-mapping-split-events
+++ a/arch/x86/mm/pat/set_memory.c
@@ -16,6 +16,8 @@
#include <linux/pci.h>
#include <linux/vmalloc.h>
#include <linux/libnvdimm.h>
+#include <linux/vmstat.h>
+#include <linux/kernel.h>
#include <asm/e820/api.h>
#include <asm/processor.h>
@@ -91,6 +93,12 @@ static void split_page_count(int level)
return;
direct_pages_count[level]--;
+ if (system_state == SYSTEM_RUNNING) {
+ if (level == PG_LEVEL_2M)
+ count_vm_event(DIRECT_MAP_LEVEL2_SPLIT);
+ else if (level == PG_LEVEL_1G)
+ count_vm_event(DIRECT_MAP_LEVEL3_SPLIT);
+ }
direct_pages_count[level - 1] += PTRS_PER_PTE;
}
--- a/include/linux/vm_event_item.h~x86-mm-tracking-linear-mapping-split-events
+++ a/include/linux/vm_event_item.h
@@ -125,6 +125,10 @@ enum vm_event_item { PGPGIN, PGPGOUT, PS
SWAP_RA,
SWAP_RA_HIT,
#endif
+#ifdef CONFIG_X86
+ DIRECT_MAP_LEVEL2_SPLIT,
+ DIRECT_MAP_LEVEL3_SPLIT,
+#endif
NR_VM_EVENT_ITEMS
};
--- a/mm/vmstat.c~x86-mm-tracking-linear-mapping-split-events
+++ a/mm/vmstat.c
@@ -1369,6 +1369,10 @@ const char * const vmstat_text[] = {
"swap_ra",
"swap_ra_hit",
#endif
+#ifdef CONFIG_X86
+ "direct_map_level2_splits",
+ "direct_map_level3_splits",
+#endif
#endif /* CONFIG_VM_EVENT_COUNTERS || CONFIG_MEMCG */
};
#endif /* CONFIG_PROC_FS || CONFIG_SYSFS || CONFIG_NUMA || CONFIG_MEMCG */
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 101/143] mm/mmap.c: don't unlock VMAs in remap_file_pages()
2021-05-05 1:32 incoming Andrew Morton
` (99 preceding siblings ...)
2021-05-05 1:38 ` [patch 100/143] x86/mm: track linear mapping split events Andrew Morton
@ 2021-05-05 1:38 ` Andrew Morton
2021-05-05 1:38 ` [patch 102/143] mm: generalize ARCH_HAS_CACHE_LINE_SIZE Andrew Morton
` (39 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw)
To: akpm, david, hughd, Liam.Howlett, linux-mm, mm-commits, torvalds,
willy
From: Liam Howlett <liam.howlett@oracle.com>
Subject: mm/mmap.c: don't unlock VMAs in remap_file_pages()
Since this call uses MAP_FIXED, do_mmap() will munlock the necessary
range. There is also an error in the loop test expression which will
evaluate as false and the loop body has never execute.
Link: https://lkml.kernel.org/r/20210223235010.2296915-1-Liam.Howlett@Oracle.com
Signed-off-by: Liam R. Howlett <Liam.Howlett@Oracle.com>
Acked-by: Hugh Dickins <hughd@google.com>
Reviewed-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Reviewed-by: David Hildenbrand <david@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/mmap.c | 18 +-----------------
1 file changed, 1 insertion(+), 17 deletions(-)
--- a/mm/mmap.c~mm-mmap-dont-unlock-vmas-in-remap_file_pages
+++ a/mm/mmap.c
@@ -3029,25 +3029,9 @@ SYSCALL_DEFINE5(remap_file_pages, unsign
flags &= MAP_NONBLOCK;
flags |= MAP_SHARED | MAP_FIXED | MAP_POPULATE;
- if (vma->vm_flags & VM_LOCKED) {
- struct vm_area_struct *tmp;
+ if (vma->vm_flags & VM_LOCKED)
flags |= MAP_LOCKED;
- /* drop PG_Mlocked flag for over-mapped range */
- for (tmp = vma; tmp->vm_start >= start + size;
- tmp = tmp->vm_next) {
- /*
- * Split pmd and munlock page on the border
- * of the range.
- */
- vma_adjust_trans_huge(tmp, start, start + size, 0);
-
- munlock_vma_pages_range(tmp,
- max(tmp->vm_start, start),
- min(tmp->vm_end, start + size));
- }
- }
-
file = get_file(vma->vm_file);
ret = do_mmap(vma->vm_file, start, size,
prot, flags, pgoff, &populate, NULL);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 102/143] mm: generalize ARCH_HAS_CACHE_LINE_SIZE
2021-05-05 1:32 incoming Andrew Morton
` (100 preceding siblings ...)
2021-05-05 1:38 ` [patch 101/143] mm/mmap.c: don't unlock VMAs in remap_file_pages() Andrew Morton
@ 2021-05-05 1:38 ` Andrew Morton
2021-05-05 1:38 ` [patch 104/143] mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] Andrew Morton
` (38 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw)
To: akpm, anshuman.khandual, aou, arnd, benh, borntraeger, bp,
catalin.marinas, dalias, deller, gor, hca, hpa, James.Bottomley,
linux-mm, linux, mingo, mm-commits, mpe, palmerdabbelt,
paul.walmsley, paulus, tglx, torvalds, tsbogend, vgupta, viro,
will, ysato
From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: generalize ARCH_HAS_CACHE_LINE_SIZE
Patch series "mm: some config cleanups", v2.
This series contains config cleanup patches which reduces code duplication
across platforms and also improves maintainability. There is no functional
change intended with this series.
This patch (of 6):
ARCH_HAS_CACHE_LINE_SIZE config has duplicate definitions on platforms
that subscribe it. Instead, just make it a generic option which can be
selected on applicable platforms. This change reduces code duplication
and makes it cleaner.
Link: https://lkml.kernel.org/r/1617259448-22529-1-git-send-email-anshuman.khandual@arm.com
Link: https://lkml.kernel.org/r/1617259448-22529-2-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com> [arm64]
Acked-by: Vineet Gupta <vgupta@synopsys.com> [arc]
Cc: Will Deacon <will@kernel.org>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Borislav Petkov <bp@alien8.de>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: Helge Deller <deller@gmx.de>
Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: Palmer Dabbelt <palmerdabbelt@google.com>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Rich Felker <dalias@libc.org>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/arc/Kconfig | 4 +---
arch/arm64/Kconfig | 4 +---
arch/x86/Kconfig | 4 +---
mm/Kconfig | 3 +++
4 files changed, 6 insertions(+), 9 deletions(-)
--- a/arch/arc/Kconfig~mm-generalize-arch_has_cache_line_size
+++ a/arch/arc/Kconfig
@@ -6,6 +6,7 @@
config ARC
def_bool y
select ARC_TIMERS
+ select ARCH_HAS_CACHE_LINE_SIZE
select ARCH_HAS_DEBUG_VM_PGTABLE
select ARCH_HAS_DMA_PREP_COHERENT
select ARCH_HAS_PTE_SPECIAL
@@ -48,9 +49,6 @@ config ARC
select HAVE_ARCH_JUMP_LABEL if ISA_ARCV2 && !CPU_ENDIAN_BE32
select SET_FS
-config ARCH_HAS_CACHE_LINE_SIZE
- def_bool y
-
config TRACE_IRQFLAGS_SUPPORT
def_bool y
--- a/arch/arm64/Kconfig~mm-generalize-arch_has_cache_line_size
+++ a/arch/arm64/Kconfig
@@ -11,6 +11,7 @@ config ARM64
select ACPI_PPTT if ACPI
select ARCH_HAS_DEBUG_WX
select ARCH_BINFMT_ELF_STATE
+ select ARCH_HAS_CACHE_LINE_SIZE
select ARCH_HAS_DEBUG_VIRTUAL
select ARCH_HAS_DEBUG_VM_PGTABLE
select ARCH_HAS_DMA_PREP_COHERENT
@@ -1074,9 +1075,6 @@ config HW_PERF_EVENTS
config SYS_SUPPORTS_HUGETLBFS
def_bool y
-config ARCH_HAS_CACHE_LINE_SIZE
- def_bool y
-
config ARCH_HAS_FILTER_PGPROT
def_bool y
--- a/arch/x86/Kconfig~mm-generalize-arch_has_cache_line_size
+++ a/arch/x86/Kconfig
@@ -61,6 +61,7 @@ config X86
select ARCH_32BIT_OFF_T if X86_32
select ARCH_CLOCKSOURCE_INIT
select ARCH_HAS_ACPI_TABLE_UPGRADE if ACPI
+ select ARCH_HAS_CACHE_LINE_SIZE
select ARCH_HAS_DEBUG_VIRTUAL
select ARCH_HAS_DEBUG_VM_PGTABLE if !X86_PAE
select ARCH_HAS_DEVMEM_IS_ALLOWED
@@ -316,9 +317,6 @@ config GENERIC_CALIBRATE_DELAY
config ARCH_HAS_CPU_RELAX
def_bool y
-config ARCH_HAS_CACHE_LINE_SIZE
- def_bool y
-
config ARCH_HAS_FILTER_PGPROT
def_bool y
--- a/mm/Kconfig~mm-generalize-arch_has_cache_line_size
+++ a/mm/Kconfig
@@ -772,6 +772,9 @@ config IDLE_PAGE_TRACKING
See Documentation/admin-guide/mm/idle_page_tracking.rst for
more details.
+config ARCH_HAS_CACHE_LINE_SIZE
+ bool
+
config ARCH_HAS_PTE_DEVMAP
bool
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 104/143] mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE]
2021-05-05 1:32 incoming Andrew Morton
` (101 preceding siblings ...)
2021-05-05 1:38 ` [patch 102/143] mm: generalize ARCH_HAS_CACHE_LINE_SIZE Andrew Morton
@ 2021-05-05 1:38 ` Andrew Morton
2021-05-05 1:38 ` [patch 105/143] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION Andrew Morton
` (37 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw)
To: akpm, anshuman.khandual, aou, arnd, benh, borntraeger, bp,
catalin.marinas, dalias, deller, gor, hca, hpa, James.Bottomley,
linux-mm, linux, mingo, mm-commits, mpe, palmerdabbelt,
paul.walmsley, paulus, tglx, torvalds, tsbogend, vgupta, viro,
will, ysato
From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE]
ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] configs have duplicate definitions
on platforms that subscribe them. Instead, just make them generic options
which can be selected on applicable platforms.
Link: https://lkml.kernel.org/r/1617259448-22529-4-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com> [arm64]
Acked-by: Heiko Carstens <hca@linux.ibm.com> [s390]
Cc: Will Deacon <will@kernel.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Cc: Rich Felker <dalias@libc.org>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Helge Deller <deller@gmx.de>
Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com>
Cc: Palmer Dabbelt <palmerdabbelt@google.com>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: Vineet Gupta <vgupta@synopsys.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/arm64/Kconfig | 8 ++------
arch/ia64/Kconfig | 8 ++------
arch/powerpc/Kconfig | 8 ++------
arch/s390/Kconfig | 8 ++------
arch/sh/Kconfig | 2 ++
arch/sh/mm/Kconfig | 8 --------
arch/x86/Kconfig | 10 ++--------
mm/Kconfig | 6 ++++++
8 files changed, 18 insertions(+), 40 deletions(-)
--- a/arch/arm64/Kconfig~mm-generalize-arch_enable_memory_
+++ a/arch/arm64/Kconfig
@@ -11,6 +11,8 @@ config ARM64
select ACPI_PPTT if ACPI
select ARCH_HAS_DEBUG_WX
select ARCH_BINFMT_ELF_STATE
+ select ARCH_ENABLE_MEMORY_HOTPLUG
+ select ARCH_ENABLE_MEMORY_HOTREMOVE
select ARCH_HAS_CACHE_LINE_SIZE
select ARCH_HAS_DEBUG_VIRTUAL
select ARCH_HAS_DEBUG_VM_PGTABLE
@@ -311,12 +313,6 @@ config ZONE_DMA32
bool "Support DMA32 zone" if EXPERT
default y
-config ARCH_ENABLE_MEMORY_HOTPLUG
- def_bool y
-
-config ARCH_ENABLE_MEMORY_HOTREMOVE
- def_bool y
-
config SMP
def_bool y
--- a/arch/ia64/Kconfig~mm-generalize-arch_enable_memory_
+++ a/arch/ia64/Kconfig
@@ -13,6 +13,8 @@ config IA64
select ARCH_MIGHT_HAVE_PC_SERIO
select ACPI
select ACPI_NUMA if NUMA
+ select ARCH_ENABLE_MEMORY_HOTPLUG
+ select ARCH_ENABLE_MEMORY_HOTREMOVE
select ARCH_SUPPORTS_ACPI
select ACPI_SYSTEM_POWER_STATES_SUPPORT if ACPI
select ARCH_MIGHT_HAVE_ACPI_PDC if ACPI
@@ -246,12 +248,6 @@ config HOTPLUG_CPU
can be controlled through /sys/devices/system/cpu/cpu#.
Say N if you want to disable CPU hotplug.
-config ARCH_ENABLE_MEMORY_HOTPLUG
- def_bool y
-
-config ARCH_ENABLE_MEMORY_HOTREMOVE
- def_bool y
-
config SCHED_SMT
bool "SMT scheduler support"
depends on SMP
--- a/arch/powerpc/Kconfig~mm-generalize-arch_enable_memory_
+++ a/arch/powerpc/Kconfig
@@ -118,6 +118,8 @@ config PPC
# Please keep this list sorted alphabetically.
#
select ARCH_32BIT_OFF_T if PPC32
+ select ARCH_ENABLE_MEMORY_HOTPLUG
+ select ARCH_ENABLE_MEMORY_HOTREMOVE
select ARCH_HAS_DEBUG_VIRTUAL
select ARCH_HAS_DEVMEM_IS_ALLOWED
select ARCH_HAS_ELF_RANDOMIZE
@@ -512,12 +514,6 @@ config ARCH_CPU_PROBE_RELEASE
def_bool y
depends on HOTPLUG_CPU
-config ARCH_ENABLE_MEMORY_HOTPLUG
- def_bool y
-
-config ARCH_ENABLE_MEMORY_HOTREMOVE
- def_bool y
-
config PPC64_SUPPORTS_MEMORY_FAILURE
bool "Add support for memory hwpoison"
depends on PPC_BOOK3S_64
--- a/arch/s390/Kconfig~mm-generalize-arch_enable_memory_
+++ a/arch/s390/Kconfig
@@ -60,6 +60,8 @@ config S390
imply IMA_SECURE_AND_OR_TRUSTED_BOOT
select ARCH_32BIT_USTAT_F_TINODE
select ARCH_BINFMT_ELF_STATE
+ select ARCH_ENABLE_MEMORY_HOTPLUG if SPARSEMEM
+ select ARCH_ENABLE_MEMORY_HOTREMOVE
select ARCH_HAS_DEBUG_VM_PGTABLE
select ARCH_HAS_DEBUG_WX
select ARCH_HAS_DEVMEM_IS_ALLOWED
@@ -626,12 +628,6 @@ config ARCH_SPARSEMEM_ENABLE
config ARCH_SPARSEMEM_DEFAULT
def_bool y
-config ARCH_ENABLE_MEMORY_HOTPLUG
- def_bool y if SPARSEMEM
-
-config ARCH_ENABLE_MEMORY_HOTREMOVE
- def_bool y
-
config ARCH_ENABLE_SPLIT_PMD_PTLOCK
def_bool y
--- a/arch/sh/Kconfig~mm-generalize-arch_enable_memory_
+++ a/arch/sh/Kconfig
@@ -2,6 +2,8 @@
config SUPERH
def_bool y
select ARCH_32BIT_OFF_T
+ select ARCH_ENABLE_MEMORY_HOTPLUG if SPARSEMEM && MMU
+ select ARCH_ENABLE_MEMORY_HOTREMOVE if SPARSEMEM && MMU
select ARCH_HAVE_CUSTOM_GPIO_H
select ARCH_HAVE_NMI_SAFE_CMPXCHG if (GUSA_RB || CPU_SH4A)
select ARCH_HAS_BINFMT_FLAT if !MMU
--- a/arch/sh/mm/Kconfig~mm-generalize-arch_enable_memory_
+++ a/arch/sh/mm/Kconfig
@@ -136,14 +136,6 @@ config ARCH_SPARSEMEM_DEFAULT
config ARCH_SELECT_MEMORY_MODEL
def_bool y
-config ARCH_ENABLE_MEMORY_HOTPLUG
- def_bool y
- depends on SPARSEMEM && MMU
-
-config ARCH_ENABLE_MEMORY_HOTREMOVE
- def_bool y
- depends on SPARSEMEM && MMU
-
config ARCH_MEMORY_PROBE
def_bool y
depends on MEMORY_HOTPLUG
--- a/arch/x86/Kconfig~mm-generalize-arch_enable_memory_
+++ a/arch/x86/Kconfig
@@ -60,6 +60,8 @@ config X86
select ACPI_SYSTEM_POWER_STATES_SUPPORT if ACPI
select ARCH_32BIT_OFF_T if X86_32
select ARCH_CLOCKSOURCE_INIT
+ select ARCH_ENABLE_MEMORY_HOTPLUG if X86_64 || (X86_32 && HIGHMEM)
+ select ARCH_ENABLE_MEMORY_HOTREMOVE if MEMORY_HOTPLUG
select ARCH_HAS_ACPI_TABLE_UPGRADE if ACPI
select ARCH_HAS_CACHE_LINE_SIZE
select ARCH_HAS_DEBUG_VIRTUAL
@@ -2427,14 +2429,6 @@ config ARCH_HAS_ADD_PAGES
def_bool y
depends on X86_64 && ARCH_ENABLE_MEMORY_HOTPLUG
-config ARCH_ENABLE_MEMORY_HOTPLUG
- def_bool y
- depends on X86_64 || (X86_32 && HIGHMEM)
-
-config ARCH_ENABLE_MEMORY_HOTREMOVE
- def_bool y
- depends on MEMORY_HOTPLUG
-
config USE_PERCPU_NUMA_NODE_ID
def_bool y
depends on NUMA
--- a/mm/Kconfig~mm-generalize-arch_enable_memory_
+++ a/mm/Kconfig
@@ -148,6 +148,9 @@ config MEMORY_ISOLATION
config HAVE_BOOTMEM_INFO_NODE
def_bool n
+config ARCH_ENABLE_MEMORY_HOTPLUG
+ bool
+
# eventually, we can have this option just 'select SPARSEMEM'
config MEMORY_HOTPLUG
bool "Allow for memory hot-add"
@@ -176,6 +179,9 @@ config MEMORY_HOTPLUG_DEFAULT_ONLINE
Say N here if you want the default policy to keep all hot-plugged
memory blocks in 'offline' state.
+config ARCH_ENABLE_MEMORY_HOTREMOVE
+ bool
+
config MEMORY_HOTREMOVE
bool "Allow for memory hot remove"
select HAVE_BOOTMEM_INFO_NODE if (X86_64 || PPC64)
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 105/143] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION
2021-05-05 1:32 incoming Andrew Morton
` (102 preceding siblings ...)
2021-05-05 1:38 ` [patch 104/143] mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] Andrew Morton
@ 2021-05-05 1:38 ` Andrew Morton
2021-05-05 1:38 ` [patch 108/143] mm/util.c: reduce mem_dump_obj() object size Andrew Morton
` (36 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw)
To: akpm, anshuman.khandual, aou, arnd, benh, borntraeger, bp,
catalin.marinas, dalias, deller, gor, hca, hpa, James.Bottomley,
linux-mm, linux, mingo, mm-commits, mpe, palmerdabbelt,
paul.walmsley, paulus, tglx, torvalds, tsbogend, vgupta, viro,
will, ysato
From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION
ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION configs have duplicate definitions on
platforms that subscribe them. Drop these reduntant definitions and
instead just select them appropriately.
[akpm@linux-foundation.org: s/x86_64/X86_64/, per Oscar]
Link: https://lkml.kernel.org/r/1617259448-22529-5-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com> [arm64]
Cc: Will Deacon <will@kernel.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: Helge Deller <deller@gmx.de>
Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com>
Cc: Palmer Dabbelt <palmerdabbelt@google.com>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Rich Felker <dalias@libc.org>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/arm64/Kconfig | 10 ++--------
arch/powerpc/platforms/Kconfig.cputype | 5 +----
arch/x86/Kconfig | 10 ++--------
3 files changed, 5 insertions(+), 20 deletions(-)
--- a/arch/arm64/Kconfig~mm-drop-redundant-arch_enable__migration
+++ a/arch/arm64/Kconfig
@@ -11,8 +11,10 @@ config ARM64
select ACPI_PPTT if ACPI
select ARCH_HAS_DEBUG_WX
select ARCH_BINFMT_ELF_STATE
+ select ARCH_ENABLE_HUGEPAGE_MIGRATION if HUGETLB_PAGE && MIGRATION
select ARCH_ENABLE_MEMORY_HOTPLUG
select ARCH_ENABLE_MEMORY_HOTREMOVE
+ select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE
select ARCH_HAS_CACHE_LINE_SIZE
select ARCH_HAS_DEBUG_VIRTUAL
select ARCH_HAS_DEBUG_VM_PGTABLE
@@ -1916,14 +1918,6 @@ config SYSVIPC_COMPAT
def_bool y
depends on COMPAT && SYSVIPC
-config ARCH_ENABLE_HUGEPAGE_MIGRATION
- def_bool y
- depends on HUGETLB_PAGE && MIGRATION
-
-config ARCH_ENABLE_THP_MIGRATION
- def_bool y
- depends on TRANSPARENT_HUGEPAGE
-
menu "Power management options"
source "kernel/power/Kconfig"
--- a/arch/powerpc/platforms/Kconfig.cputype~mm-drop-redundant-arch_enable__migration
+++ a/arch/powerpc/platforms/Kconfig.cputype
@@ -96,6 +96,7 @@ config PPC_BOOK3S_64
select PPC_FPU
select PPC_HAVE_PMU_SUPPORT
select HAVE_ARCH_TRANSPARENT_HUGEPAGE
+ select ARCH_ENABLE_HUGEPAGE_MIGRATION if HUGETLB_PAGE && MIGRATION
select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE
select ARCH_SUPPORTS_HUGETLBFS
select ARCH_SUPPORTS_NUMA_BALANCING
@@ -420,10 +421,6 @@ config PPC_PKEY
depends on PPC_BOOK3S_64
depends on PPC_MEM_KEYS || PPC_KUAP || PPC_KUEP
-config ARCH_ENABLE_HUGEPAGE_MIGRATION
- def_bool y
- depends on PPC_BOOK3S_64 && HUGETLB_PAGE && MIGRATION
-
config PPC_MMU_NOHASH
def_bool y
--- a/arch/x86/Kconfig~mm-drop-redundant-arch_enable__migration
+++ a/arch/x86/Kconfig
@@ -60,8 +60,10 @@ config X86
select ACPI_SYSTEM_POWER_STATES_SUPPORT if ACPI
select ARCH_32BIT_OFF_T if X86_32
select ARCH_CLOCKSOURCE_INIT
+ select ARCH_ENABLE_HUGEPAGE_MIGRATION if X86_64 && HUGETLB_PAGE && MIGRATION
select ARCH_ENABLE_MEMORY_HOTPLUG if X86_64 || (X86_32 && HIGHMEM)
select ARCH_ENABLE_MEMORY_HOTREMOVE if MEMORY_HOTPLUG
+ select ARCH_ENABLE_THP_MIGRATION if X86_64 && TRANSPARENT_HUGEPAGE
select ARCH_HAS_ACPI_TABLE_UPGRADE if ACPI
select ARCH_HAS_CACHE_LINE_SIZE
select ARCH_HAS_DEBUG_VIRTUAL
@@ -2437,14 +2439,6 @@ config ARCH_ENABLE_SPLIT_PMD_PTLOCK
def_bool y
depends on X86_64 || X86_PAE
-config ARCH_ENABLE_HUGEPAGE_MIGRATION
- def_bool y
- depends on X86_64 && HUGETLB_PAGE && MIGRATION
-
-config ARCH_ENABLE_THP_MIGRATION
- def_bool y
- depends on X86_64 && TRANSPARENT_HUGEPAGE
-
menu "Power management and ACPI options"
config ARCH_HIBERNATION_HEADER
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 108/143] mm/util.c: reduce mem_dump_obj() object size
2021-05-05 1:32 incoming Andrew Morton
` (103 preceding siblings ...)
2021-05-05 1:38 ` [patch 105/143] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION Andrew Morton
@ 2021-05-05 1:38 ` Andrew Morton
2021-05-05 1:38 ` [patch 109/143] mm/util.c: fix typo Andrew Morton
` (35 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw)
To: akpm, joe, linux-mm, mm-commits, torvalds
From: Joe Perches <joe@perches.com>
Subject: mm/util.c: reduce mem_dump_obj() object size
Simplify the code by using a temporary and reduce the object size by using
a single call to pr_cont(). Reverse a test and unindent a block too.
$ size mm/util.o* (defconfig x86-64)
text data bss dec hex filename
7419 372 40 7831 1e97 mm/util.o.new
7477 372 40 7889 1ed1 mm/util.o.old
Link: https://lkml.kernel.org/r/a6e105886338f68afd35f7a13d73bcf06b0cc732.camel@perches.com
Signed-off-by: Joe Perches <joe@perches.com>
Reviewed-by: Andrew Morton <akpm@linux-foundation.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/util.c | 24 ++++++++++++++----------
1 file changed, 14 insertions(+), 10 deletions(-)
--- a/mm/util.c~mm-reduce-mem_dump_obj-object-size
+++ a/mm/util.c
@@ -987,22 +987,26 @@ int __weak memcmp_pages(struct page *pag
*/
void mem_dump_obj(void *object)
{
+ const char *type;
+
if (kmem_valid_obj(object)) {
kmem_dump_obj(object);
return;
}
+
if (vmalloc_dump_obj(object))
return;
- if (!virt_addr_valid(object)) {
- if (object == NULL)
- pr_cont(" NULL pointer.\n");
- else if (object == ZERO_SIZE_PTR)
- pr_cont(" zero-size pointer.\n");
- else
- pr_cont(" non-paged memory.\n");
- return;
- }
- pr_cont(" non-slab/vmalloc memory.\n");
+
+ if (virt_addr_valid(object))
+ type = "non-slab/vmalloc memory";
+ else if (object == NULL)
+ type = "NULL pointer";
+ else if (object == ZERO_SIZE_PTR)
+ type = "zero-size pointer";
+ else
+ type = "non-paged memory";
+
+ pr_cont(" %s\n", type);
}
EXPORT_SYMBOL_GPL(mem_dump_obj);
#endif
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 109/143] mm/util.c: fix typo
2021-05-05 1:32 incoming Andrew Morton
` (104 preceding siblings ...)
2021-05-05 1:38 ` [patch 108/143] mm/util.c: reduce mem_dump_obj() object size Andrew Morton
@ 2021-05-05 1:38 ` Andrew Morton
2021-05-05 1:38 ` [patch 110/143] mm/gup: don't pin migrated cma pages in movable zone Andrew Morton
` (34 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw)
To: akpm, linux-mm, mm-commits, rdunlap, torvalds, unixbhaskar, willy
From: Bhaskar Chowdhury <unixbhaskar@gmail.com>
Subject: mm/util.c: fix typo
s/condtion/condition/
Link: https://lkml.kernel.org/r/20210317033439.3429411-1-unixbhaskar@gmail.com
Signed-off-by: Bhaskar Chowdhury <unixbhaskar@gmail.com>
Acked-by: Randy Dunlap <rdunlap@infradead.org>
Cc: Matthew Wilcox <willy@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/util.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/util.c~mm-typo-fix-in-the-file-utilc
+++ a/mm/util.c
@@ -765,7 +765,7 @@ int overcommit_policy_handler(struct ctl
* The deviation of sync_overcommit_as could be big with loose policy
* like OVERCOMMIT_ALWAYS/OVERCOMMIT_GUESS. When changing policy to
* strict OVERCOMMIT_NEVER, we need to reduce the deviation to comply
- * with the strict "NEVER", and to avoid possible race condtion (even
+ * with the strict "NEVER", and to avoid possible race condition (even
* though user usually won't too frequently do the switching to policy
* OVERCOMMIT_NEVER), the switch is done in the following order:
* 1. changing the batch
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 110/143] mm/gup: don't pin migrated cma pages in movable zone
2021-05-05 1:32 incoming Andrew Morton
` (105 preceding siblings ...)
2021-05-05 1:38 ` [patch 109/143] mm/util.c: fix typo Andrew Morton
@ 2021-05-05 1:38 ` Andrew Morton
2021-05-05 1:38 ` [patch 111/143] mm/gup: check every subpage of a compound page during isolation Andrew Morton
` (33 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw)
To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
willy
From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: don't pin migrated cma pages in movable zone
Patch series "prohibit pinning pages in ZONE_MOVABLE", v11.
When page is pinned it cannot be moved and its physical address stays
the same until pages is unpinned.
This is useful functionality to allows userland to implementation DMA
access. For example, it is used by vfio in vfio_pin_pages().
However, this functionality breaks memory hotplug/hotremove assumptions
that pages in ZONE_MOVABLE can always be migrated.
This patch series fixes this issue by forcing new allocations during
page pinning to omit ZONE_MOVABLE, and also to migrate any existing
pages from ZONE_MOVABLE during pinning.
It uses the same scheme logic that is currently used by CMA, and extends
the functionality for all allocations.
For more information read the discussion [1] about this problem.
[1] https://lore.kernel.org/lkml/CA+CK2bBffHBxjmb9jmSKacm0fJMinyt3Nhk8Nx6iudcQSj80_w@mail.gmail.com
This patch (of 14):
In order not to fragment CMA the pinned pages are migrated. However, they
are migrated to ZONE_MOVABLE, which also should not have pinned pages.
Remove __GFP_MOVABLE, so pages can be migrated to zones where pinning is
allowed.
Link: https://lkml.kernel.org/r/20210215161349.246722-1-pasha.tatashin@soleen.com
Link: https://lkml.kernel.org/r/20210215161349.246722-2-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Michal Hocko <mhocko@suse.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: David Rientjes <rientjes@google.com>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Michal Hocko <mhocko@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/gup.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/gup.c~mm-gup-dont-pin-migrated-cma-pages-in-movable-zone
+++ a/mm/gup.c
@@ -1616,7 +1616,7 @@ static long check_and_migrate_cma_pages(
long ret = nr_pages;
struct migration_target_control mtc = {
.nid = NUMA_NO_NODE,
- .gfp_mask = GFP_USER | __GFP_MOVABLE | __GFP_NOWARN,
+ .gfp_mask = GFP_USER | __GFP_NOWARN,
};
check_again:
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 111/143] mm/gup: check every subpage of a compound page during isolation
2021-05-05 1:32 incoming Andrew Morton
` (106 preceding siblings ...)
2021-05-05 1:38 ` [patch 110/143] mm/gup: don't pin migrated cma pages in movable zone Andrew Morton
@ 2021-05-05 1:38 ` Andrew Morton
2021-05-05 1:38 ` [patch 112/143] mm/gup: return an error on migration failure Andrew Morton
` (32 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw)
To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
willy
From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: check every subpage of a compound page during isolation
When pages are isolated in check_and_migrate_movable_pages() we skip
compound number of pages at a time. However, as Jason noted, it is not
necessary correct that pages[i] corresponds to the pages that we skipped.
This is because it is possible that the addresses in this range had
split_huge_pmd()/split_huge_pud(), and these functions do not update the
compound page metadata.
The problem can be reproduced if something like this occurs:
1. User faulted huge pages.
2. split_huge_pmd() was called for some reason
3. User has unmapped some sub-pages in the range
4. User tries to longterm pin the addresses.
The resulting pages[i] might end-up having pages which are not compound
size page aligned.
Link: https://lkml.kernel.org/r/20210215161349.246722-3-pasha.tatashin@soleen.com
Fixes: aa712399c1e8 ("mm/gup: speed up check_and_migrate_cma_pages() on huge page")
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reported-by: Jason Gunthorpe <jgg@nvidia.com>
Reviewed-by: Jason Gunthorpe <jgg@nvidia.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/gup.c | 19 +++++++------------
1 file changed, 7 insertions(+), 12 deletions(-)
--- a/mm/gup.c~mm-gup-check-every-subpage-of-a-compound-page-during-isolation
+++ a/mm/gup.c
@@ -1609,26 +1609,23 @@ static long check_and_migrate_cma_pages(
unsigned int gup_flags)
{
unsigned long i;
- unsigned long step;
bool drain_allow = true;
bool migrate_allow = true;
LIST_HEAD(cma_page_list);
long ret = nr_pages;
+ struct page *prev_head, *head;
struct migration_target_control mtc = {
.nid = NUMA_NO_NODE,
.gfp_mask = GFP_USER | __GFP_NOWARN,
};
check_again:
- for (i = 0; i < nr_pages;) {
-
- struct page *head = compound_head(pages[i]);
-
- /*
- * gup may start from a tail page. Advance step by the left
- * part.
- */
- step = compound_nr(head) - (pages[i] - head);
+ prev_head = NULL;
+ for (i = 0; i < nr_pages; i++) {
+ head = compound_head(pages[i]);
+ if (head == prev_head)
+ continue;
+ prev_head = head;
/*
* If we get a page from the CMA zone, since we are going to
* be pinning these entries, we might as well move them out
@@ -1652,8 +1649,6 @@ check_again:
}
}
}
-
- i += step;
}
if (!list_empty(&cma_page_list)) {
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 112/143] mm/gup: return an error on migration failure
2021-05-05 1:32 incoming Andrew Morton
` (107 preceding siblings ...)
2021-05-05 1:38 ` [patch 111/143] mm/gup: check every subpage of a compound page during isolation Andrew Morton
@ 2021-05-05 1:38 ` Andrew Morton
2021-05-05 1:38 ` [patch 113/143] mm/gup: check for isolation errors Andrew Morton
` (31 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw)
To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
willy
From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: return an error on migration failure
When migration failure occurs, we still pin pages, which means
that we may pin CMA movable pages which should never be the case.
Instead return an error without pinning pages when migration failure
happens.
No need to retry migrating, because migrate_pages() already retries
10 times.
Link: https://lkml.kernel.org/r/20210215161349.246722-4-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: Jason Gunthorpe <jgg@nvidia.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/gup.c | 17 +++++++----------
1 file changed, 7 insertions(+), 10 deletions(-)
--- a/mm/gup.c~mm-gup-return-an-error-on-migration-failure
+++ a/mm/gup.c
@@ -1610,7 +1610,6 @@ static long check_and_migrate_cma_pages(
{
unsigned long i;
bool drain_allow = true;
- bool migrate_allow = true;
LIST_HEAD(cma_page_list);
long ret = nr_pages;
struct page *prev_head, *head;
@@ -1661,17 +1660,15 @@ check_again:
for (i = 0; i < nr_pages; i++)
put_page(pages[i]);
- if (migrate_pages(&cma_page_list, alloc_migration_target, NULL,
- (unsigned long)&mtc, MIGRATE_SYNC, MR_CONTIG_RANGE)) {
- /*
- * some of the pages failed migration. Do get_user_pages
- * without migration.
- */
- migrate_allow = false;
-
+ ret = migrate_pages(&cma_page_list, alloc_migration_target,
+ NULL, (unsigned long)&mtc, MIGRATE_SYNC,
+ MR_CONTIG_RANGE);
+ if (ret) {
if (!list_empty(&cma_page_list))
putback_movable_pages(&cma_page_list);
+ return ret > 0 ? -ENOMEM : ret;
}
+
/*
* We did migrate all the pages, Try to get the page references
* again migrating any new CMA pages which we failed to isolate
@@ -1681,7 +1678,7 @@ check_again:
pages, vmas, NULL,
gup_flags);
- if ((ret > 0) && migrate_allow) {
+ if (ret > 0) {
nr_pages = ret;
drain_allow = true;
goto check_again;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 113/143] mm/gup: check for isolation errors
2021-05-05 1:32 incoming Andrew Morton
` (108 preceding siblings ...)
2021-05-05 1:38 ` [patch 112/143] mm/gup: return an error on migration failure Andrew Morton
@ 2021-05-05 1:38 ` Andrew Morton
2021-05-05 1:38 ` [patch 114/143] mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN Andrew Morton
` (30 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw)
To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
willy
From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: check for isolation errors
It is still possible that we pin movable CMA pages if there are isolation
errors and cma_page_list stays empty when we check again.
Check for isolation errors, and return success only when there are no
isolation errors, and cma_page_list is empty after checking.
Because isolation errors are transient, we retry indefinitely.
Link: https://lkml.kernel.org/r/20210215161349.246722-5-pasha.tatashin@soleen.com
Fixes: 9a4e9f3b2d73 ("mm: update get_user_pages_longterm to migrate pages allocated from CMA region")
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: Jason Gunthorpe <jgg@nvidia.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/gup.c | 60 ++++++++++++++++++++++++++++++-----------------------
1 file changed, 34 insertions(+), 26 deletions(-)
--- a/mm/gup.c~mm-gup-check-for-isolation-errors
+++ a/mm/gup.c
@@ -1608,8 +1608,8 @@ static long check_and_migrate_cma_pages(
struct vm_area_struct **vmas,
unsigned int gup_flags)
{
- unsigned long i;
- bool drain_allow = true;
+ unsigned long i, isolation_error_count;
+ bool drain_allow;
LIST_HEAD(cma_page_list);
long ret = nr_pages;
struct page *prev_head, *head;
@@ -1620,6 +1620,8 @@ static long check_and_migrate_cma_pages(
check_again:
prev_head = NULL;
+ isolation_error_count = 0;
+ drain_allow = true;
for (i = 0; i < nr_pages; i++) {
head = compound_head(pages[i]);
if (head == prev_head)
@@ -1631,25 +1633,35 @@ check_again:
* of the CMA zone if possible.
*/
if (is_migrate_cma_page(head)) {
- if (PageHuge(head))
- isolate_huge_page(head, &cma_page_list);
- else {
+ if (PageHuge(head)) {
+ if (!isolate_huge_page(head, &cma_page_list))
+ isolation_error_count++;
+ } else {
if (!PageLRU(head) && drain_allow) {
lru_add_drain_all();
drain_allow = false;
}
- if (!isolate_lru_page(head)) {
- list_add_tail(&head->lru, &cma_page_list);
- mod_node_page_state(page_pgdat(head),
- NR_ISOLATED_ANON +
- page_is_file_lru(head),
- thp_nr_pages(head));
+ if (isolate_lru_page(head)) {
+ isolation_error_count++;
+ continue;
}
+ list_add_tail(&head->lru, &cma_page_list);
+ mod_node_page_state(page_pgdat(head),
+ NR_ISOLATED_ANON +
+ page_is_file_lru(head),
+ thp_nr_pages(head));
}
}
}
+ /*
+ * If list is empty, and no isolation errors, means that all pages are
+ * in the correct zone.
+ */
+ if (list_empty(&cma_page_list) && !isolation_error_count)
+ return ret;
+
if (!list_empty(&cma_page_list)) {
/*
* drop the above get_user_pages reference.
@@ -1669,23 +1681,19 @@ check_again:
return ret > 0 ? -ENOMEM : ret;
}
- /*
- * We did migrate all the pages, Try to get the page references
- * again migrating any new CMA pages which we failed to isolate
- * earlier.
- */
- ret = __get_user_pages_locked(mm, start, nr_pages,
- pages, vmas, NULL,
- gup_flags);
-
- if (ret > 0) {
- nr_pages = ret;
- drain_allow = true;
- goto check_again;
- }
+ /* We unpinned pages before migration, pin them again */
+ ret = __get_user_pages_locked(mm, start, nr_pages, pages, vmas,
+ NULL, gup_flags);
+ if (ret <= 0)
+ return ret;
+ nr_pages = ret;
}
- return ret;
+ /*
+ * check again because pages were unpinned, and we also might have
+ * had isolation errors and need more pages to migrate.
+ */
+ goto check_again;
}
#else
static long check_and_migrate_cma_pages(struct mm_struct *mm,
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 114/143] mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN
2021-05-05 1:32 incoming Andrew Morton
` (109 preceding siblings ...)
2021-05-05 1:38 ` [patch 113/143] mm/gup: check for isolation errors Andrew Morton
@ 2021-05-05 1:38 ` Andrew Morton
2021-05-05 1:38 ` [patch 115/143] mm: apply per-task gfp constraints in fast path Andrew Morton
` (29 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw)
To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
peterz, rientjes, rostedt, rppt, sashal, torvalds, tyhicks,
vbabka, willy
From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN
PF_MEMALLOC_NOCMA is used ot guarantee that the allocator will not return
pages that might belong to CMA region. This is currently used for long
term gup to make sure that such pins are not going to be done on any CMA
pages.
When PF_MEMALLOC_NOCMA has been introduced we haven't realized that it is
focusing on CMA pages too much and that there is larger class of pages
that need the same treatment. MOVABLE zone cannot contain any long term
pins as well so it makes sense to reuse and redefine this flag for that
usecase as well. Rename the flag to PF_MEMALLOC_PIN which defines an
allocation context which can only get pages suitable for long-term pins.
Also rename: memalloc_nocma_save()/memalloc_nocma_restore to
memalloc_pin_save()/memalloc_pin_restore() and make the new functions
common.
[rppt@linux.ibm.com: fix renaming of PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN]
Link: https://lkml.kernel.org/r/20210331163816.11517-1-rppt@kernel.org
Link: https://lkml.kernel.org/r/20210215161349.246722-6-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/sched.h | 2 +-
include/linux/sched/mm.h | 21 +++++----------------
mm/gup.c | 4 ++--
mm/hugetlb.c | 4 ++--
mm/page_alloc.c | 4 ++--
5 files changed, 12 insertions(+), 23 deletions(-)
--- a/include/linux/sched.h~mm-cma-rename-pf_memalloc_nocma-to-pf_memalloc_pin
+++ a/include/linux/sched.h
@@ -1583,7 +1583,7 @@ extern struct pid *cad_pid;
#define PF_SWAPWRITE 0x00800000 /* Allowed to write to swap */
#define PF_NO_SETAFFINITY 0x04000000 /* Userland is not allowed to meddle with cpus_mask */
#define PF_MCE_EARLY 0x08000000 /* Early kill for mce process policy */
-#define PF_MEMALLOC_NOCMA 0x10000000 /* All allocation request will have _GFP_MOVABLE cleared */
+#define PF_MEMALLOC_PIN 0x10000000 /* Allocation context constrained to zones which allow long term pinning. */
#define PF_FREEZER_SKIP 0x40000000 /* Freezer should not count it as freezable */
#define PF_SUSPEND_TASK 0x80000000 /* This thread called freeze_processes() and should not be frozen */
--- a/include/linux/sched/mm.h~mm-cma-rename-pf_memalloc_nocma-to-pf_memalloc_pin
+++ a/include/linux/sched/mm.h
@@ -271,29 +271,18 @@ static inline void memalloc_noreclaim_re
current->flags = (current->flags & ~PF_MEMALLOC) | flags;
}
-#ifdef CONFIG_CMA
-static inline unsigned int memalloc_nocma_save(void)
+static inline unsigned int memalloc_pin_save(void)
{
- unsigned int flags = current->flags & PF_MEMALLOC_NOCMA;
+ unsigned int flags = current->flags & PF_MEMALLOC_PIN;
- current->flags |= PF_MEMALLOC_NOCMA;
+ current->flags |= PF_MEMALLOC_PIN;
return flags;
}
-static inline void memalloc_nocma_restore(unsigned int flags)
+static inline void memalloc_pin_restore(unsigned int flags)
{
- current->flags = (current->flags & ~PF_MEMALLOC_NOCMA) | flags;
+ current->flags = (current->flags & ~PF_MEMALLOC_PIN) | flags;
}
-#else
-static inline unsigned int memalloc_nocma_save(void)
-{
- return 0;
-}
-
-static inline void memalloc_nocma_restore(unsigned int flags)
-{
-}
-#endif
#ifdef CONFIG_MEMCG
DECLARE_PER_CPU(struct mem_cgroup *, int_active_memcg);
--- a/mm/gup.c~mm-cma-rename-pf_memalloc_nocma-to-pf_memalloc_pin
+++ a/mm/gup.c
@@ -1722,7 +1722,7 @@ static long __gup_longterm_locked(struct
long rc;
if (gup_flags & FOLL_LONGTERM)
- flags = memalloc_nocma_save();
+ flags = memalloc_pin_save();
rc = __get_user_pages_locked(mm, start, nr_pages, pages, vmas, NULL,
gup_flags);
@@ -1731,7 +1731,7 @@ static long __gup_longterm_locked(struct
if (rc > 0)
rc = check_and_migrate_cma_pages(mm, start, rc, pages,
vmas, gup_flags);
- memalloc_nocma_restore(flags);
+ memalloc_pin_restore(flags);
}
return rc;
}
--- a/mm/hugetlb.c~mm-cma-rename-pf_memalloc_nocma-to-pf_memalloc_pin
+++ a/mm/hugetlb.c
@@ -1079,11 +1079,11 @@ static void enqueue_huge_page(struct hst
static struct page *dequeue_huge_page_node_exact(struct hstate *h, int nid)
{
struct page *page;
- bool nocma = !!(current->flags & PF_MEMALLOC_NOCMA);
+ bool pin = !!(current->flags & PF_MEMALLOC_PIN);
lockdep_assert_held(&hugetlb_lock);
list_for_each_entry(page, &h->hugepage_freelists[nid], lru) {
- if (nocma && is_migrate_cma_page(page))
+ if (pin && is_migrate_cma_page(page))
continue;
if (PageHWPoison(page))
--- a/mm/page_alloc.c~mm-cma-rename-pf_memalloc_nocma-to-pf_memalloc_pin
+++ a/mm/page_alloc.c
@@ -3865,8 +3865,8 @@ static inline unsigned int current_alloc
#ifdef CONFIG_CMA
unsigned int pflags = current->flags;
- if (!(pflags & PF_MEMALLOC_NOCMA) &&
- gfp_migratetype(gfp_mask) == MIGRATE_MOVABLE)
+ if (!(pflags & PF_MEMALLOC_PIN) &&
+ gfp_migratetype(gfp_mask) == MIGRATE_MOVABLE)
alloc_flags |= ALLOC_CMA;
#endif
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 115/143] mm: apply per-task gfp constraints in fast path
2021-05-05 1:32 incoming Andrew Morton
` (110 preceding siblings ...)
2021-05-05 1:38 ` [patch 114/143] mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN Andrew Morton
@ 2021-05-05 1:38 ` Andrew Morton
2021-05-05 1:39 ` [patch 116/143] mm: honor PF_MEMALLOC_PIN for all movable pages Andrew Morton
` (28 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:38 UTC (permalink / raw)
To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
willy
From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm: apply per-task gfp constraints in fast path
Function current_gfp_context() is called after fast path. However, soon
we will add more constraints which will also limit zones based on context.
Move this call into fast path, and apply the correct constraints for all
allocations.
Also update .reclaim_idx based on value returned by current_gfp_context()
because it soon will modify the allowed zones.
Note:
With this patch we will do one extra current->flags load during fast path,
but we already load current->flags in fast-path:
__alloc_pages()
prepare_alloc_pages()
current_alloc_flags(gfp_mask, *alloc_flags);
Later, when we add the zone constrain logic to current_gfp_context() we
will be able to remove current->flags load from current_alloc_flags, and
therefore return fast-path to the current performance level.
Link: https://lkml.kernel.org/r/20210215161349.246722-7-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Suggested-by: Michal Hocko <mhocko@kernel.org>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_alloc.c | 15 ++++++++-------
1 file changed, 8 insertions(+), 7 deletions(-)
--- a/mm/page_alloc.c~mm-apply-per-task-gfp-constraints-in-fast-path
+++ a/mm/page_alloc.c
@@ -5180,6 +5180,13 @@ struct page *__alloc_pages(gfp_t gfp, un
}
gfp &= gfp_allowed_mask;
+ /*
+ * Apply scoped allocation constraints. This is mainly about GFP_NOFS
+ * resp. GFP_NOIO which has to be inherited for all allocation requests
+ * from a particular context which has been marked by
+ * memalloc_no{fs,io}_{save,restore}.
+ */
+ gfp = current_gfp_context(gfp);
alloc_gfp = gfp;
if (!prepare_alloc_pages(gfp, order, preferred_nid, nodemask, &ac,
&alloc_gfp, &alloc_flags))
@@ -5196,13 +5203,7 @@ struct page *__alloc_pages(gfp_t gfp, un
if (likely(page))
goto out;
- /*
- * Apply scoped allocation constraints. This is mainly about GFP_NOFS
- * resp. GFP_NOIO which has to be inherited for all allocation requests
- * from a particular context which has been marked by
- * memalloc_no{fs,io}_{save,restore}.
- */
- alloc_gfp = current_gfp_context(gfp);
+ alloc_gfp = gfp;
ac.spread_dirty_pages = false;
/*
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 116/143] mm: honor PF_MEMALLOC_PIN for all movable pages
2021-05-05 1:32 incoming Andrew Morton
` (111 preceding siblings ...)
2021-05-05 1:38 ` [patch 115/143] mm: apply per-task gfp constraints in fast path Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 117/143] mm/gup: do not migrate zero page Andrew Morton
` (27 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
willy
From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm: honor PF_MEMALLOC_PIN for all movable pages
PF_MEMALLOC_PIN is only honored for CMA pages, extend this flag to work
for any allocations from ZONE_MOVABLE by removing __GFP_MOVABLE from
gfp_mask when this flag is passed in the current context.
Add is_pinnable_page() to return true if page is in a pinnable page. A
pinnable page is not in ZONE_MOVABLE and not of MIGRATE_CMA type.
Link: https://lkml.kernel.org/r/20210215161349.246722-8-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/mm.h | 18 ++++++++++++++++++
include/linux/sched/mm.h | 6 +++++-
mm/hugetlb.c | 2 +-
mm/page_alloc.c | 20 +++++++++-----------
4 files changed, 33 insertions(+), 13 deletions(-)
--- a/include/linux/mm.h~mm-honor-pf_memalloc_pin-for-all-movable-pages
+++ a/include/linux/mm.h
@@ -1141,6 +1141,11 @@ static inline bool is_zone_device_page(c
}
#endif
+static inline bool is_zone_movable_page(const struct page *page)
+{
+ return page_zonenum(page) == ZONE_MOVABLE;
+}
+
#ifdef CONFIG_DEV_PAGEMAP_OPS
void free_devmap_managed_page(struct page *page);
DECLARE_STATIC_KEY_FALSE(devmap_managed_key);
@@ -1550,6 +1555,19 @@ static inline unsigned long page_to_sect
}
#endif
+/* MIGRATE_CMA and ZONE_MOVABLE do not allow pin pages */
+#ifdef CONFIG_MIGRATION
+static inline bool is_pinnable_page(struct page *page)
+{
+ return !is_zone_movable_page(page) && !is_migrate_cma_page(page);
+}
+#else
+static inline bool is_pinnable_page(struct page *page)
+{
+ return true;
+}
+#endif
+
static inline void set_page_zone(struct page *page, enum zone_type zone)
{
page->flags &= ~(ZONES_MASK << ZONES_PGSHIFT);
--- a/include/linux/sched/mm.h~mm-honor-pf_memalloc_pin-for-all-movable-pages
+++ a/include/linux/sched/mm.h
@@ -151,12 +151,13 @@ static inline bool in_vfork(struct task_
* Applies per-task gfp context to the given allocation flags.
* PF_MEMALLOC_NOIO implies GFP_NOIO
* PF_MEMALLOC_NOFS implies GFP_NOFS
+ * PF_MEMALLOC_PIN implies !GFP_MOVABLE
*/
static inline gfp_t current_gfp_context(gfp_t flags)
{
unsigned int pflags = READ_ONCE(current->flags);
- if (unlikely(pflags & (PF_MEMALLOC_NOIO | PF_MEMALLOC_NOFS))) {
+ if (unlikely(pflags & (PF_MEMALLOC_NOIO | PF_MEMALLOC_NOFS | PF_MEMALLOC_PIN))) {
/*
* NOIO implies both NOIO and NOFS and it is a weaker context
* so always make sure it makes precedence
@@ -165,6 +166,9 @@ static inline gfp_t current_gfp_context(
flags &= ~(__GFP_IO | __GFP_FS);
else if (pflags & PF_MEMALLOC_NOFS)
flags &= ~__GFP_FS;
+
+ if (pflags & PF_MEMALLOC_PIN)
+ flags &= ~__GFP_MOVABLE;
}
return flags;
}
--- a/mm/hugetlb.c~mm-honor-pf_memalloc_pin-for-all-movable-pages
+++ a/mm/hugetlb.c
@@ -1083,7 +1083,7 @@ static struct page *dequeue_huge_page_no
lockdep_assert_held(&hugetlb_lock);
list_for_each_entry(page, &h->hugepage_freelists[nid], lru) {
- if (pin && is_migrate_cma_page(page))
+ if (pin && !is_pinnable_page(page))
continue;
if (PageHWPoison(page))
--- a/mm/page_alloc.c~mm-honor-pf_memalloc_pin-for-all-movable-pages
+++ a/mm/page_alloc.c
@@ -3859,16 +3859,13 @@ alloc_flags_nofragment(struct zone *zone
return alloc_flags;
}
-static inline unsigned int current_alloc_flags(gfp_t gfp_mask,
- unsigned int alloc_flags)
+/* Must be called after current_gfp_context() which can change gfp_mask */
+static inline unsigned int gfp_to_alloc_flags_cma(gfp_t gfp_mask,
+ unsigned int alloc_flags)
{
#ifdef CONFIG_CMA
- unsigned int pflags = current->flags;
-
- if (!(pflags & PF_MEMALLOC_PIN) &&
- gfp_migratetype(gfp_mask) == MIGRATE_MOVABLE)
+ if (gfp_migratetype(gfp_mask) == MIGRATE_MOVABLE)
alloc_flags |= ALLOC_CMA;
-
#endif
return alloc_flags;
}
@@ -4526,7 +4523,7 @@ gfp_to_alloc_flags(gfp_t gfp_mask)
} else if (unlikely(rt_task(current)) && !in_interrupt())
alloc_flags |= ALLOC_HARDER;
- alloc_flags = current_alloc_flags(gfp_mask, alloc_flags);
+ alloc_flags = gfp_to_alloc_flags_cma(gfp_mask, alloc_flags);
return alloc_flags;
}
@@ -4828,7 +4825,7 @@ retry:
reserve_flags = __gfp_pfmemalloc_flags(gfp_mask);
if (reserve_flags)
- alloc_flags = current_alloc_flags(gfp_mask, reserve_flags);
+ alloc_flags = gfp_to_alloc_flags_cma(gfp_mask, reserve_flags);
/*
* Reset the nodemask and zonelist iterators if memory policies can be
@@ -4997,7 +4994,7 @@ static inline bool prepare_alloc_pages(g
if (should_fail_alloc_page(gfp_mask, order))
return false;
- *alloc_flags = current_alloc_flags(gfp_mask, *alloc_flags);
+ *alloc_flags = gfp_to_alloc_flags_cma(gfp_mask, *alloc_flags);
/* Dirty zone balancing only done in the fast path */
ac->spread_dirty_pages = (gfp_mask & __GFP_WRITE);
@@ -5184,7 +5181,8 @@ struct page *__alloc_pages(gfp_t gfp, un
* Apply scoped allocation constraints. This is mainly about GFP_NOFS
* resp. GFP_NOIO which has to be inherited for all allocation requests
* from a particular context which has been marked by
- * memalloc_no{fs,io}_{save,restore}.
+ * memalloc_no{fs,io}_{save,restore}. And PF_MEMALLOC_PIN which ensures
+ * movable zones are not used during allocation.
*/
gfp = current_gfp_context(gfp);
alloc_gfp = gfp;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 117/143] mm/gup: do not migrate zero page
2021-05-05 1:32 incoming Andrew Morton
` (112 preceding siblings ...)
2021-05-05 1:39 ` [patch 116/143] mm: honor PF_MEMALLOC_PIN for all movable pages Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 118/143] mm/gup: migrate pinned pages out of movable zone Andrew Morton
` (26 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
willy
From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: do not migrate zero page
On some platforms ZERO_PAGE(0) might end-up in a movable zone. Do not
migrate zero page in gup during longterm pinning as migration of zero page
is not allowed.
For example, in x86 QEMU with 16G of memory and kernelcore=5G parameter, I
see the following:
Boot#1: zero_pfn 0x48a8d zero_pfn zone: ZONE_DMA32
Boot#2: zero_pfn 0x20168d zero_pfn zone: ZONE_MOVABLE
On x86, empty_zero_page is declared in .bss and depending on the loader
may end up in different physical locations during boots.
Also, move is_zero_pfn() my_zero_pfn() functions under CONFIG_MMU, because
zero_pfn that they are using is declared in memory.c which is compiled
with CONFIG_MMU.
Link: https://lkml.kernel.org/r/20210215161349.246722-9-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/mm.h | 3 ++-
include/linux/mmzone.h | 4 ++++
include/linux/pgtable.h | 12 ++++++++++++
3 files changed, 18 insertions(+), 1 deletion(-)
--- a/include/linux/mm.h~mm-gup-do-not-migrate-zero-page
+++ a/include/linux/mm.h
@@ -1559,7 +1559,8 @@ static inline unsigned long page_to_sect
#ifdef CONFIG_MIGRATION
static inline bool is_pinnable_page(struct page *page)
{
- return !is_zone_movable_page(page) && !is_migrate_cma_page(page);
+ return !(is_zone_movable_page(page) || is_migrate_cma_page(page)) ||
+ is_zero_pfn(page_to_pfn(page));
}
#else
static inline bool is_pinnable_page(struct page *page)
--- a/include/linux/mmzone.h~mm-gup-do-not-migrate-zero-page
+++ a/include/linux/mmzone.h
@@ -427,6 +427,10 @@ enum zone_type {
* techniques might use alloc_contig_range() to hide previously
* exposed pages from the buddy again (e.g., to implement some sort
* of memory unplug in virtio-mem).
+ * 6. ZERO_PAGE(0), kernelcore/movablecore setups might create
+ * situations where ZERO_PAGE(0) which is allocated differently
+ * on different platforms may end up in a movable zone. ZERO_PAGE(0)
+ * cannot be migrated.
*
* In general, no unmovable allocations that degrade memory offlining
* should end up in ZONE_MOVABLE. Allocators (like alloc_contig_range())
--- a/include/linux/pgtable.h~mm-gup-do-not-migrate-zero-page
+++ a/include/linux/pgtable.h
@@ -1111,6 +1111,7 @@ extern void untrack_pfn(struct vm_area_s
extern void untrack_pfn_moved(struct vm_area_struct *vma);
#endif
+#ifdef CONFIG_MMU
#ifdef __HAVE_COLOR_ZERO_PAGE
static inline int is_zero_pfn(unsigned long pfn)
{
@@ -1134,6 +1135,17 @@ static inline unsigned long my_zero_pfn(
return zero_pfn;
}
#endif
+#else
+static inline int is_zero_pfn(unsigned long pfn)
+{
+ return 0;
+}
+
+static inline unsigned long my_zero_pfn(unsigned long addr)
+{
+ return 0;
+}
+#endif /* CONFIG_MMU */
#ifdef CONFIG_MMU
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 118/143] mm/gup: migrate pinned pages out of movable zone
2021-05-05 1:32 incoming Andrew Morton
` (113 preceding siblings ...)
2021-05-05 1:39 ` [patch 117/143] mm/gup: do not migrate zero page Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 119/143] memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning Andrew Morton
` (25 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
willy
From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: migrate pinned pages out of movable zone
We should not pin pages in ZONE_MOVABLE. Currently, we do not pin only
movable CMA pages. Generalize the function that migrates CMA pages to
migrate all movable pages. Use is_pinnable_page() to check which pages
need to be migrated
Link: https://lkml.kernel.org/r/20210215161349.246722-10-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/migrate.h | 1
include/linux/mmzone.h | 9 +++-
include/trace/events/migrate.h | 3 -
mm/gup.c | 67 +++++++++++++++----------------
4 files changed, 44 insertions(+), 36 deletions(-)
--- a/include/linux/migrate.h~mm-gup-migrate-pinned-pages-out-of-movable-zone
+++ a/include/linux/migrate.h
@@ -27,6 +27,7 @@ enum migrate_reason {
MR_MEMPOLICY_MBIND,
MR_NUMA_MISPLACED,
MR_CONTIG_RANGE,
+ MR_LONGTERM_PIN,
MR_TYPES
};
--- a/include/linux/mmzone.h~mm-gup-migrate-pinned-pages-out-of-movable-zone
+++ a/include/linux/mmzone.h
@@ -407,8 +407,13 @@ enum zone_type {
* to increase the number of THP/huge pages. Notable special cases are:
*
* 1. Pinned pages: (long-term) pinning of movable pages might
- * essentially turn such pages unmovable. Memory offlining might
- * retry a long time.
+ * essentially turn such pages unmovable. Therefore, we do not allow
+ * pinning long-term pages in ZONE_MOVABLE. When pages are pinned and
+ * faulted, they come from the right zone right away. However, it is
+ * still possible that address space already has pages in
+ * ZONE_MOVABLE at the time when pages are pinned (i.e. user has
+ * touches that memory before pinning). In such case we migrate them
+ * to a different zone. When migration fails - pinning fails.
* 2. memblock allocations: kernelcore/movablecore setups might create
* situations where ZONE_MOVABLE contains unmovable allocations
* after boot. Memory offlining and allocations fail early.
--- a/include/trace/events/migrate.h~mm-gup-migrate-pinned-pages-out-of-movable-zone
+++ a/include/trace/events/migrate.h
@@ -20,7 +20,8 @@
EM( MR_SYSCALL, "syscall_or_cpuset") \
EM( MR_MEMPOLICY_MBIND, "mempolicy_mbind") \
EM( MR_NUMA_MISPLACED, "numa_misplaced") \
- EMe(MR_CONTIG_RANGE, "contig_range")
+ EM( MR_CONTIG_RANGE, "contig_range") \
+ EMe(MR_LONGTERM_PIN, "longterm_pin")
/*
* First define the enums in the above macros to be exported to userspace
--- a/mm/gup.c~mm-gup-migrate-pinned-pages-out-of-movable-zone
+++ a/mm/gup.c
@@ -87,11 +87,12 @@ __maybe_unused struct page *try_grab_com
int orig_refs = refs;
/*
- * Can't do FOLL_LONGTERM + FOLL_PIN with CMA in the gup fast
- * path, so fail and let the caller fall back to the slow path.
+ * Can't do FOLL_LONGTERM + FOLL_PIN gup fast path if not in a
+ * right zone, so fail and let the caller fall back to the slow
+ * path.
*/
- if (unlikely(flags & FOLL_LONGTERM) &&
- is_migrate_cma_page(page))
+ if (unlikely((flags & FOLL_LONGTERM) &&
+ !is_pinnable_page(page)))
return NULL;
/*
@@ -1600,17 +1601,17 @@ struct page *get_dump_page(unsigned long
}
#endif /* CONFIG_ELF_CORE */
-#ifdef CONFIG_CMA
-static long check_and_migrate_cma_pages(struct mm_struct *mm,
- unsigned long start,
- unsigned long nr_pages,
- struct page **pages,
- struct vm_area_struct **vmas,
- unsigned int gup_flags)
+#ifdef CONFIG_MIGRATION
+static long check_and_migrate_movable_pages(struct mm_struct *mm,
+ unsigned long start,
+ unsigned long nr_pages,
+ struct page **pages,
+ struct vm_area_struct **vmas,
+ unsigned int gup_flags)
{
unsigned long i, isolation_error_count;
bool drain_allow;
- LIST_HEAD(cma_page_list);
+ LIST_HEAD(movable_page_list);
long ret = nr_pages;
struct page *prev_head, *head;
struct migration_target_control mtc = {
@@ -1628,13 +1629,12 @@ check_again:
continue;
prev_head = head;
/*
- * If we get a page from the CMA zone, since we are going to
- * be pinning these entries, we might as well move them out
- * of the CMA zone if possible.
+ * If we get a movable page, since we are going to be pinning
+ * these entries, try to move them out if possible.
*/
- if (is_migrate_cma_page(head)) {
+ if (!is_pinnable_page(head)) {
if (PageHuge(head)) {
- if (!isolate_huge_page(head, &cma_page_list))
+ if (!isolate_huge_page(head, &movable_page_list))
isolation_error_count++;
} else {
if (!PageLRU(head) && drain_allow) {
@@ -1646,7 +1646,7 @@ check_again:
isolation_error_count++;
continue;
}
- list_add_tail(&head->lru, &cma_page_list);
+ list_add_tail(&head->lru, &movable_page_list);
mod_node_page_state(page_pgdat(head),
NR_ISOLATED_ANON +
page_is_file_lru(head),
@@ -1659,10 +1659,10 @@ check_again:
* If list is empty, and no isolation errors, means that all pages are
* in the correct zone.
*/
- if (list_empty(&cma_page_list) && !isolation_error_count)
+ if (list_empty(&movable_page_list) && !isolation_error_count)
return ret;
- if (!list_empty(&cma_page_list)) {
+ if (!list_empty(&movable_page_list)) {
/*
* drop the above get_user_pages reference.
*/
@@ -1672,12 +1672,12 @@ check_again:
for (i = 0; i < nr_pages; i++)
put_page(pages[i]);
- ret = migrate_pages(&cma_page_list, alloc_migration_target,
+ ret = migrate_pages(&movable_page_list, alloc_migration_target,
NULL, (unsigned long)&mtc, MIGRATE_SYNC,
- MR_CONTIG_RANGE);
+ MR_LONGTERM_PIN);
if (ret) {
- if (!list_empty(&cma_page_list))
- putback_movable_pages(&cma_page_list);
+ if (!list_empty(&movable_page_list))
+ putback_movable_pages(&movable_page_list);
return ret > 0 ? -ENOMEM : ret;
}
@@ -1696,16 +1696,16 @@ check_again:
goto check_again;
}
#else
-static long check_and_migrate_cma_pages(struct mm_struct *mm,
- unsigned long start,
- unsigned long nr_pages,
- struct page **pages,
- struct vm_area_struct **vmas,
- unsigned int gup_flags)
+static long check_and_migrate_movable_pages(struct mm_struct *mm,
+ unsigned long start,
+ unsigned long nr_pages,
+ struct page **pages,
+ struct vm_area_struct **vmas,
+ unsigned int gup_flags)
{
return nr_pages;
}
-#endif /* CONFIG_CMA */
+#endif /* CONFIG_MIGRATION */
/*
* __gup_longterm_locked() is a wrapper for __get_user_pages_locked which
@@ -1729,8 +1729,9 @@ static long __gup_longterm_locked(struct
if (gup_flags & FOLL_LONGTERM) {
if (rc > 0)
- rc = check_and_migrate_cma_pages(mm, start, rc, pages,
- vmas, gup_flags);
+ rc = check_and_migrate_movable_pages(mm, start, rc,
+ pages, vmas,
+ gup_flags);
memalloc_pin_restore(flags);
}
return rc;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 119/143] memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning
2021-05-05 1:32 incoming Andrew Morton
` (114 preceding siblings ...)
2021-05-05 1:39 ` [patch 118/143] mm/gup: migrate pinned pages out of movable zone Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 120/143] mm/gup: change index type to long as it counts pages Andrew Morton
` (24 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
willy
From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning
Document the special handling of page pinning when ZONE_MOVABLE present.
Link: https://lkml.kernel.org/r/20210215161349.246722-11-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Suggested-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/admin-guide/mm/memory-hotplug.rst | 9 +++++++++
1 file changed, 9 insertions(+)
--- a/Documentation/admin-guide/mm/memory-hotplug.rst~memory-hotplugrst-add-a-note-about-zone_movable-and-page-pinning
+++ a/Documentation/admin-guide/mm/memory-hotplug.rst
@@ -357,6 +357,15 @@ creates ZONE_MOVABLE as following.
Unfortunately, there is no information to show which memory block belongs
to ZONE_MOVABLE. This is TBD.
+.. note::
+ Techniques that rely on long-term pinnings of memory (especially, RDMA and
+ vfio) are fundamentally problematic with ZONE_MOVABLE and, therefore, memory
+ hot remove. Pinned pages cannot reside on ZONE_MOVABLE, to guarantee that
+ memory can still get hot removed - be aware that pinning can fail even if
+ there is plenty of free memory in ZONE_MOVABLE. In addition, using
+ ZONE_MOVABLE might make page pinning more expensive, because pages have to be
+ migrated off that zone first.
+
.. _memory_hotplug_how_to_offline_memory:
How to offline memory
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 120/143] mm/gup: change index type to long as it counts pages
2021-05-05 1:32 incoming Andrew Morton
` (115 preceding siblings ...)
2021-05-05 1:39 ` [patch 119/143] memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 121/143] mm/gup: longterm pin migration cleanup Andrew Morton
` (23 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
willy
From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: change index type to long as it counts pages
In __get_user_pages_locked() i counts number of pages which should be
long, as long is used in all other places to contain number of pages, and
32-bit becomes increasingly small for handling page count proportional
values.
Link: https://lkml.kernel.org/r/20210215161349.246722-12-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/gup.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/gup.c~mm-gup-change-index-type-to-long-as-it-counts-pages
+++ a/mm/gup.c
@@ -1528,7 +1528,7 @@ static long __get_user_pages_locked(stru
{
struct vm_area_struct *vma;
unsigned long vm_flags;
- int i;
+ long i;
/* calculate required read or write permissions.
* If FOLL_FORCE is set, we only require the "MAY" flags.
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 121/143] mm/gup: longterm pin migration cleanup
2021-05-05 1:32 incoming Andrew Morton
` (116 preceding siblings ...)
2021-05-05 1:39 ` [patch 120/143] mm/gup: change index type to long as it counts pages Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 122/143] selftests/vm: gup_test: fix test flag Andrew Morton
` (22 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
willy
From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: mm/gup: longterm pin migration cleanup
When pages are longterm pinned, we must migrated them out of movable zone.
The function that migrates them has a hidden loop with goto. The loop is
to retry on isolation failures, and after successful migration.
Make this code better by moving this loop to the caller.
Link: https://lkml.kernel.org/r/20210215161349.246722-13-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: Jason Gunthorpe <jgg@nvidia.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/gup.c | 93 +++++++++++++++++++++--------------------------------
1 file changed, 37 insertions(+), 56 deletions(-)
--- a/mm/gup.c~mm-gup-longterm-pin-migration-cleanup
+++ a/mm/gup.c
@@ -1602,27 +1602,28 @@ struct page *get_dump_page(unsigned long
#endif /* CONFIG_ELF_CORE */
#ifdef CONFIG_MIGRATION
-static long check_and_migrate_movable_pages(struct mm_struct *mm,
- unsigned long start,
- unsigned long nr_pages,
+/*
+ * Check whether all pages are pinnable, if so return number of pages. If some
+ * pages are not pinnable, migrate them, and unpin all pages. Return zero if
+ * pages were migrated, or if some pages were not successfully isolated.
+ * Return negative error if migration fails.
+ */
+static long check_and_migrate_movable_pages(unsigned long nr_pages,
struct page **pages,
- struct vm_area_struct **vmas,
unsigned int gup_flags)
{
- unsigned long i, isolation_error_count;
- bool drain_allow;
+ unsigned long i;
+ unsigned long isolation_error_count = 0;
+ bool drain_allow = true;
LIST_HEAD(movable_page_list);
- long ret = nr_pages;
- struct page *prev_head, *head;
+ long ret = 0;
+ struct page *prev_head = NULL;
+ struct page *head;
struct migration_target_control mtc = {
.nid = NUMA_NO_NODE,
.gfp_mask = GFP_USER | __GFP_NOWARN,
};
-check_again:
- prev_head = NULL;
- isolation_error_count = 0;
- drain_allow = true;
for (i = 0; i < nr_pages; i++) {
head = compound_head(pages[i]);
if (head == prev_head)
@@ -1660,47 +1661,27 @@ check_again:
* in the correct zone.
*/
if (list_empty(&movable_page_list) && !isolation_error_count)
- return ret;
+ return nr_pages;
+ if (gup_flags & FOLL_PIN) {
+ unpin_user_pages(pages, nr_pages);
+ } else {
+ for (i = 0; i < nr_pages; i++)
+ put_page(pages[i]);
+ }
if (!list_empty(&movable_page_list)) {
- /*
- * drop the above get_user_pages reference.
- */
- if (gup_flags & FOLL_PIN)
- unpin_user_pages(pages, nr_pages);
- else
- for (i = 0; i < nr_pages; i++)
- put_page(pages[i]);
-
ret = migrate_pages(&movable_page_list, alloc_migration_target,
NULL, (unsigned long)&mtc, MIGRATE_SYNC,
MR_LONGTERM_PIN);
- if (ret) {
- if (!list_empty(&movable_page_list))
- putback_movable_pages(&movable_page_list);
- return ret > 0 ? -ENOMEM : ret;
- }
-
- /* We unpinned pages before migration, pin them again */
- ret = __get_user_pages_locked(mm, start, nr_pages, pages, vmas,
- NULL, gup_flags);
- if (ret <= 0)
- return ret;
- nr_pages = ret;
+ if (ret && !list_empty(&movable_page_list))
+ putback_movable_pages(&movable_page_list);
}
- /*
- * check again because pages were unpinned, and we also might have
- * had isolation errors and need more pages to migrate.
- */
- goto check_again;
+ return ret > 0 ? -ENOMEM : ret;
}
#else
-static long check_and_migrate_movable_pages(struct mm_struct *mm,
- unsigned long start,
- unsigned long nr_pages,
+static long check_and_migrate_movable_pages(unsigned long nr_pages,
struct page **pages,
- struct vm_area_struct **vmas,
unsigned int gup_flags)
{
return nr_pages;
@@ -1718,22 +1699,22 @@ static long __gup_longterm_locked(struct
struct vm_area_struct **vmas,
unsigned int gup_flags)
{
- unsigned long flags = 0;
+ unsigned int flags;
long rc;
- if (gup_flags & FOLL_LONGTERM)
- flags = memalloc_pin_save();
-
- rc = __get_user_pages_locked(mm, start, nr_pages, pages, vmas, NULL,
- gup_flags);
+ if (!(gup_flags & FOLL_LONGTERM))
+ return __get_user_pages_locked(mm, start, nr_pages, pages, vmas,
+ NULL, gup_flags);
+ flags = memalloc_pin_save();
+ do {
+ rc = __get_user_pages_locked(mm, start, nr_pages, pages, vmas,
+ NULL, gup_flags);
+ if (rc <= 0)
+ break;
+ rc = check_and_migrate_movable_pages(rc, pages, gup_flags);
+ } while (!rc);
+ memalloc_pin_restore(flags);
- if (gup_flags & FOLL_LONGTERM) {
- if (rc > 0)
- rc = check_and_migrate_movable_pages(mm, start, rc,
- pages, vmas,
- gup_flags);
- memalloc_pin_restore(flags);
- }
return rc;
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 122/143] selftests/vm: gup_test: fix test flag
2021-05-05 1:32 incoming Andrew Morton
` (117 preceding siblings ...)
2021-05-05 1:39 ` [patch 121/143] mm/gup: longterm pin migration cleanup Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 123/143] selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages Andrew Morton
` (21 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
willy
From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: selftests/vm: gup_test: fix test flag
In gup_test both gup_flags and test_flags use the same flags field. This
is broken.
Farther, in the actual gup_test.c all the passed gup_flags are erased and
unconditionally replaced with FOLL_WRITE.
Which means that test_flags are ignored, and code like this always
performs pin dump test:
155 if (gup->flags & GUP_TEST_FLAG_DUMP_PAGES_USE_PIN)
156 nr = pin_user_pages(addr, nr, gup->flags,
157 pages + i, NULL);
158 else
159 nr = get_user_pages(addr, nr, gup->flags,
160 pages + i, NULL);
161 break;
Add a new test_flags field, to allow raw gup_flags to work. Add a new
subcommand for DUMP_USER_PAGES_TEST to specify that pin test should be
performed.
Remove unconditional overwriting of gup_flags via FOLL_WRITE. But,
preserve the previous behaviour where FOLL_WRITE was the default flag, and
add a new option "-W" to unset FOLL_WRITE.
Rename flags with gup_flags.
With the fix, dump works like this:
root@virtme:/# gup_test -c
---- page #0, starting from user virt addr: 0x7f8acb9e4000
page:00000000d3d2ee27 refcount:2 mapcount:1 mapping:0000000000000000
index:0x0 pfn:0x100bcf
anon flags: 0x300000000080016(referenced|uptodate|lru|swapbacked)
raw: 0300000000080016 ffffd0e204021608 ffffd0e208df2e88 ffff8ea04243ec61
raw: 0000000000000000 0000000000000000 0000000200000000 0000000000000000
page dumped because: gup_test: dump_pages() test
DUMP_USER_PAGES_TEST: done
root@virtme:/# gup_test -c -p
---- page #0, starting from user virt addr: 0x7fd19701b000
page:00000000baed3c7d refcount:1025 mapcount:1 mapping:0000000000000000
index:0x0 pfn:0x108008
anon flags: 0x300000000080014(uptodate|lru|swapbacked)
raw: 0300000000080014 ffffd0e204200188 ffffd0e205e09088 ffff8ea04243ee71
raw: 0000000000000000 0000000000000000 0000040100000000 0000000000000000
page dumped because: gup_test: dump_pages() test
DUMP_USER_PAGES_TEST: done
Refcount shows the difference between pin vs no-pin case.
Also change type of nr from int to long, as it counts number of pages.
Link: https://lkml.kernel.org/r/20210215161349.246722-14-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/gup_test.c | 23 ++++++++++-------------
mm/gup_test.h | 3 ++-
tools/testing/selftests/vm/gup_test.c | 15 +++++++++++----
3 files changed, 23 insertions(+), 18 deletions(-)
--- a/mm/gup_test.c~selftests-vm-gup_test-fix-test-flag
+++ a/mm/gup_test.c
@@ -94,7 +94,7 @@ static int __gup_test_ioctl(unsigned int
{
ktime_t start_time, end_time;
unsigned long i, nr_pages, addr, next;
- int nr;
+ long nr;
struct page **pages;
int ret = 0;
bool needs_mmap_lock =
@@ -126,37 +126,34 @@ static int __gup_test_ioctl(unsigned int
nr = (next - addr) / PAGE_SIZE;
}
- /* Filter out most gup flags: only allow a tiny subset here: */
- gup->flags &= FOLL_WRITE;
-
switch (cmd) {
case GUP_FAST_BENCHMARK:
- nr = get_user_pages_fast(addr, nr, gup->flags,
+ nr = get_user_pages_fast(addr, nr, gup->gup_flags,
pages + i);
break;
case GUP_BASIC_TEST:
- nr = get_user_pages(addr, nr, gup->flags, pages + i,
+ nr = get_user_pages(addr, nr, gup->gup_flags, pages + i,
NULL);
break;
case PIN_FAST_BENCHMARK:
- nr = pin_user_pages_fast(addr, nr, gup->flags,
+ nr = pin_user_pages_fast(addr, nr, gup->gup_flags,
pages + i);
break;
case PIN_BASIC_TEST:
- nr = pin_user_pages(addr, nr, gup->flags, pages + i,
+ nr = pin_user_pages(addr, nr, gup->gup_flags, pages + i,
NULL);
break;
case PIN_LONGTERM_BENCHMARK:
nr = pin_user_pages(addr, nr,
- gup->flags | FOLL_LONGTERM,
+ gup->gup_flags | FOLL_LONGTERM,
pages + i, NULL);
break;
case DUMP_USER_PAGES_TEST:
- if (gup->flags & GUP_TEST_FLAG_DUMP_PAGES_USE_PIN)
- nr = pin_user_pages(addr, nr, gup->flags,
+ if (gup->test_flags & GUP_TEST_FLAG_DUMP_PAGES_USE_PIN)
+ nr = pin_user_pages(addr, nr, gup->gup_flags,
pages + i, NULL);
else
- nr = get_user_pages(addr, nr, gup->flags,
+ nr = get_user_pages(addr, nr, gup->gup_flags,
pages + i, NULL);
break;
default:
@@ -187,7 +184,7 @@ static int __gup_test_ioctl(unsigned int
start_time = ktime_get();
- put_back_pages(cmd, pages, nr_pages, gup->flags);
+ put_back_pages(cmd, pages, nr_pages, gup->test_flags);
end_time = ktime_get();
gup->put_delta_usec = ktime_us_delta(end_time, start_time);
--- a/mm/gup_test.h~selftests-vm-gup_test-fix-test-flag
+++ a/mm/gup_test.h
@@ -21,7 +21,8 @@ struct gup_test {
__u64 addr;
__u64 size;
__u32 nr_pages_per_call;
- __u32 flags;
+ __u32 gup_flags;
+ __u32 test_flags;
/*
* Each non-zero entry is the number of the page (1-based: first page is
* page 1, so that zero entries mean "do nothing") from the .addr base.
--- a/tools/testing/selftests/vm/gup_test.c~selftests-vm-gup_test-fix-test-flag
+++ a/tools/testing/selftests/vm/gup_test.c
@@ -37,13 +37,13 @@ int main(int argc, char **argv)
{
struct gup_test gup = { 0 };
unsigned long size = 128 * MB;
- int i, fd, filed, opt, nr_pages = 1, thp = -1, repeats = 1, write = 0;
+ int i, fd, filed, opt, nr_pages = 1, thp = -1, repeats = 1, write = 1;
unsigned long cmd = GUP_FAST_BENCHMARK;
int flags = MAP_PRIVATE;
char *file = "/dev/zero";
char *p;
- while ((opt = getopt(argc, argv, "m:r:n:F:f:abctTLUuwSH")) != -1) {
+ while ((opt = getopt(argc, argv, "m:r:n:F:f:abctTLUuwWSHp")) != -1) {
switch (opt) {
case 'a':
cmd = PIN_FAST_BENCHMARK;
@@ -65,9 +65,13 @@ int main(int argc, char **argv)
*/
gup.which_pages[0] = 1;
break;
+ case 'p':
+ /* works only with DUMP_USER_PAGES_TEST */
+ gup.test_flags |= GUP_TEST_FLAG_DUMP_PAGES_USE_PIN;
+ break;
case 'F':
/* strtol, so you can pass flags in hex form */
- gup.flags = strtol(optarg, 0, 0);
+ gup.gup_flags = strtol(optarg, 0, 0);
break;
case 'm':
size = atoi(optarg) * MB;
@@ -93,6 +97,9 @@ int main(int argc, char **argv)
case 'w':
write = 1;
break;
+ case 'W':
+ write = 0;
+ break;
case 'f':
file = optarg;
break;
@@ -140,7 +147,7 @@ int main(int argc, char **argv)
gup.nr_pages_per_call = nr_pages;
if (write)
- gup.flags |= FOLL_WRITE;
+ gup.gup_flags |= FOLL_WRITE;
fd = open("/sys/kernel/debug/gup_test", O_RDWR);
if (fd == -1) {
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 123/143] selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages
2021-05-05 1:32 incoming Andrew Morton
` (118 preceding siblings ...)
2021-05-05 1:39 ` [patch 122/143] selftests/vm: gup_test: fix test flag Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 124/143] mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove Andrew Morton
` (20 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, dan.j.williams, david, iamjoonsoo.kim, ira.weiny, jgg, jgg,
jhubbard, jmorris, linux-mm, mgorman, mhocko, mhocko,
mike.kravetz, mingo, mm-commits, osalvador, pasha.tatashin,
peterz, rientjes, rostedt, sashal, torvalds, tyhicks, vbabka,
willy
From: Pavel Tatashin <pasha.tatashin@soleen.com>
Subject: selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages
When pages are pinned they can be faulted in userland and migrated, and
they can be faulted right in kernel without migration.
In either case, the pinned pages must end-up being pinnable (not movable).
Add a new test to gup_test, to help verify that the gup/pup
(get_user_pages() / pin_user_pages()) behavior with respect to pinnable
and movable pages is reasonable and correct. Specifically, provide a way
to:
1) Verify that only "pinnable" pages are pinned. This is checked
automatically for you.
2) Verify that gup/pup performance is reasonable. This requires
comparing benchmarks between doing gup/pup on pages that have been
pre-faulted in from user space, vs. doing gup/pup on pages that are
not faulted in until gup/pup time (via FOLL_TOUCH). This decision is
controlled with the new -z command line option.
Link: https://lkml.kernel.org/r/20210215161349.246722-15-pasha.tatashin@soleen.com
Signed-off-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Ira Weiny <ira.weiny@intel.com>
Cc: James Morris <jmorris@namei.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Sasha Levin <sashal@kernel.org>
Cc: Steven Rostedt (VMware) <rostedt@goodmis.org>
Cc: Tyler Hicks <tyhicks@linux.microsoft.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/gup_test.c | 6 ++++++
tools/testing/selftests/vm/gup_test.c | 23 +++++++++++++++++++----
2 files changed, 25 insertions(+), 4 deletions(-)
--- a/mm/gup_test.c~selftests-vm-gup_test-test-faulting-in-kernel-and-verify-pinnable-pages
+++ a/mm/gup_test.c
@@ -52,6 +52,12 @@ static void verify_dma_pinned(unsigned i
dump_page(page, "gup_test failure");
break;
+ } else if (cmd == PIN_LONGTERM_BENCHMARK &&
+ WARN(!is_pinnable_page(page),
+ "pages[%lu] is NOT pinnable but pinned\n",
+ i)) {
+ dump_page(page, "gup_test failure");
+ break;
}
}
break;
--- a/tools/testing/selftests/vm/gup_test.c~selftests-vm-gup_test-test-faulting-in-kernel-and-verify-pinnable-pages
+++ a/tools/testing/selftests/vm/gup_test.c
@@ -13,6 +13,7 @@
/* Just the flags we need, copied from mm.h: */
#define FOLL_WRITE 0x01 /* check pte is writable */
+#define FOLL_TOUCH 0x02 /* mark page accessed */
static char *cmd_to_str(unsigned long cmd)
{
@@ -39,11 +40,11 @@ int main(int argc, char **argv)
unsigned long size = 128 * MB;
int i, fd, filed, opt, nr_pages = 1, thp = -1, repeats = 1, write = 1;
unsigned long cmd = GUP_FAST_BENCHMARK;
- int flags = MAP_PRIVATE;
+ int flags = MAP_PRIVATE, touch = 0;
char *file = "/dev/zero";
char *p;
- while ((opt = getopt(argc, argv, "m:r:n:F:f:abctTLUuwWSHp")) != -1) {
+ while ((opt = getopt(argc, argv, "m:r:n:F:f:abctTLUuwWSHpz")) != -1) {
switch (opt) {
case 'a':
cmd = PIN_FAST_BENCHMARK;
@@ -110,6 +111,10 @@ int main(int argc, char **argv)
case 'H':
flags |= (MAP_HUGETLB | MAP_ANONYMOUS);
break;
+ case 'z':
+ /* fault pages in gup, do not fault in userland */
+ touch = 1;
+ break;
default:
return -1;
}
@@ -167,8 +172,18 @@ int main(int argc, char **argv)
else if (thp == 0)
madvise(p, size, MADV_NOHUGEPAGE);
- for (; (unsigned long)p < gup.addr + size; p += PAGE_SIZE)
- p[0] = 0;
+ /*
+ * FOLL_TOUCH, in gup_test, is used as an either/or case: either
+ * fault pages in from the kernel via FOLL_TOUCH, or fault them
+ * in here, from user space. This allows comparison of performance
+ * between those two cases.
+ */
+ if (touch) {
+ gup.gup_flags |= FOLL_TOUCH;
+ } else {
+ for (; (unsigned long)p < gup.addr + size; p += PAGE_SIZE)
+ p[0] = 0;
+ }
/* Only report timing information on the *_BENCHMARK commands: */
if ((cmd == PIN_FAST_BENCHMARK) || (cmd == GUP_FAST_BENCHMARK) ||
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 124/143] mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove
2021-05-05 1:32 incoming Andrew Morton
` (119 preceding siblings ...)
2021-05-05 1:39 ` [patch 123/143] selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 125/143] drivers/base/memory: introduce memory_block_{online,offline} Andrew Morton
` (19 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, alexander.h.duyck, david, linux-mm, mgorman, mhocko,
minchan, mm-commits, mst, osalvador, torvalds, vbabka
From: Mel Gorman <mgorman@techsingularity.net>
Subject: mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove
zone_pcp_reset allegedly protects against a race with drain_pages using
local_irq_save but this is bogus. local_irq_save only operates on the
local CPU. If memory hotplug is running on CPU A and drain_pages is
running on CPU B, disabling IRQs on CPU A does not affect CPU B and offers
no protection.
This patch deletes IRQ disable/enable on the grounds that IRQs protect
nothing and assumes the existing hotplug paths guarantees the PCP cannot
be used after zone_pcp_enable(). That should be the case already because
all the pages have been freed and there is no page to put on the PCP
lists.
Link: https://lkml.kernel.org/r/20210412090346.GQ3697@techsingularity.net
Signed-off-by: Mel Gorman <mgorman@techsingularity.net>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Cc: "Michael S. Tsirkin" <mst@redhat.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Alexander Duyck <alexander.h.duyck@linux.intel.com>
Cc: Minchan Kim <minchan@kernel.org>
Cc: David Hildenbrand <david@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_alloc.c | 4 ----
1 file changed, 4 deletions(-)
--- a/mm/page_alloc.c~mm-memory_hotplug-make-unpopulated-zones-pcp-structures-unreachable-during-hot-remove
+++ a/mm/page_alloc.c
@@ -9020,12 +9020,9 @@ void zone_pcp_enable(struct zone *zone)
void zone_pcp_reset(struct zone *zone)
{
- unsigned long flags;
int cpu;
struct per_cpu_pageset *pset;
- /* avoid races with drain_pages() */
- local_irq_save(flags);
if (zone->pageset != &boot_pageset) {
for_each_online_cpu(cpu) {
pset = per_cpu_ptr(zone->pageset, cpu);
@@ -9034,7 +9031,6 @@ void zone_pcp_reset(struct zone *zone)
free_percpu(zone->pageset);
zone->pageset = &boot_pageset;
}
- local_irq_restore(flags);
}
#ifdef CONFIG_MEMORY_HOTREMOVE
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 125/143] drivers/base/memory: introduce memory_block_{online,offline}
2021-05-05 1:32 incoming Andrew Morton
` (120 preceding siblings ...)
2021-05-05 1:39 ` [patch 124/143] mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 126/143] mm,memory_hotplug: relax fully spanned sections check Andrew Morton
` (18 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
osalvador, pasha.tatashin, torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: drivers/base/memory: introduce memory_block_{online,offline}
Patch series "Allocate memmap from hotadded memory (per device)", v10.
The primary goal of this patchset is to reduce memory overhead of the
hot-added memory (at least for SPARSEMEM_VMEMMAP memory model). The
current way we use to populate memmap (struct page array) has two main
drawbacks:
a) it consumes an additional memory until the hotadded memory itself is
onlined and
b) memmap might end up on a different numa node which is especially
true for movable_node configuration.
c) due to fragmentation we might end up populating memmap with base
pages
One way to mitigate all these issues is to simply allocate memmap array
(which is the largest memory footprint of the physical memory hotplug)
from the hot-added memory itself. SPARSEMEM_VMEMMAP memory model allows
us to map any pfn range so the memory doesn't need to be online to be
usable for the array. See patch 4 for more details. This feature is only
usable when CONFIG_SPARSEMEM_VMEMMAP is set.
[Overall design]:
Implementation wise we reuse vmem_altmap infrastructure to override the
default allocator used by vmemap_populate. memory_block structure gains a
new field called nr_vmemmap_pages, which accounts for the number of
vmemmap pages used by that memory_block. E.g: On x86_64, that is 512
vmemmap pages on small memory bloks and 4096 on large memory blocks (1GB)
We also introduce new two functions: memory_block_{online,offline}. These
functions take care of initializing/unitializing vmemmap pages prior to
calling {online,offline}_pages, so the latter functions can remain totally
untouched.
More details can be found in the respective changelogs.
This patch (of 8):
This is a preparatory patch that introduces two new functions:
memory_block_online() and memory_block_offline().
For now, these functions will only call online_pages() and offline_pages()
respectively, but they will be later in charge of preparing the vmemmap
pages, carrying out the initialization and proper accounting of such
pages.
Since memory_block struct contains all the information, pass this struct
down the chain till the end functions.
Link: https://lkml.kernel.org/r/20210421102701.25051-1-osalvador@suse.de
Link: https://lkml.kernel.org/r/20210421102701.25051-2-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/base/memory.c | 33 +++++++++++++++++++++------------
1 file changed, 21 insertions(+), 12 deletions(-)
--- a/drivers/base/memory.c~drivers-base-memory-introduce-memory_block_onlineoffline
+++ a/drivers/base/memory.c
@@ -169,30 +169,41 @@ int memory_notify(unsigned long val, voi
return blocking_notifier_call_chain(&memory_chain, val, v);
}
+static int memory_block_online(struct memory_block *mem)
+{
+ unsigned long start_pfn = section_nr_to_pfn(mem->start_section_nr);
+ unsigned long nr_pages = PAGES_PER_SECTION * sections_per_block;
+
+ return online_pages(start_pfn, nr_pages, mem->online_type, mem->nid);
+}
+
+static int memory_block_offline(struct memory_block *mem)
+{
+ unsigned long start_pfn = section_nr_to_pfn(mem->start_section_nr);
+ unsigned long nr_pages = PAGES_PER_SECTION * sections_per_block;
+
+ return offline_pages(start_pfn, nr_pages);
+}
+
/*
* MEMORY_HOTPLUG depends on SPARSEMEM in mm/Kconfig, so it is
* OK to have direct references to sparsemem variables in here.
*/
static int
-memory_block_action(unsigned long start_section_nr, unsigned long action,
- int online_type, int nid)
+memory_block_action(struct memory_block *mem, unsigned long action)
{
- unsigned long start_pfn;
- unsigned long nr_pages = PAGES_PER_SECTION * sections_per_block;
int ret;
- start_pfn = section_nr_to_pfn(start_section_nr);
-
switch (action) {
case MEM_ONLINE:
- ret = online_pages(start_pfn, nr_pages, online_type, nid);
+ ret = memory_block_online(mem);
break;
case MEM_OFFLINE:
- ret = offline_pages(start_pfn, nr_pages);
+ ret = memory_block_offline(mem);
break;
default:
WARN(1, KERN_WARNING "%s(%ld, %ld) unknown action: "
- "%ld\n", __func__, start_section_nr, action, action);
+ "%ld\n", __func__, mem->start_section_nr, action, action);
ret = -EINVAL;
}
@@ -210,9 +221,7 @@ static int memory_block_change_state(str
if (to_state == MEM_OFFLINE)
mem->state = MEM_GOING_OFFLINE;
- ret = memory_block_action(mem->start_section_nr, to_state,
- mem->online_type, mem->nid);
-
+ ret = memory_block_action(mem, to_state);
mem->state = ret ? from_state_req : to_state;
return ret;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 126/143] mm,memory_hotplug: relax fully spanned sections check
2021-05-05 1:32 incoming Andrew Morton
` (121 preceding siblings ...)
2021-05-05 1:39 ` [patch 125/143] drivers/base/memory: introduce memory_block_{online,offline} Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 127/143] mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count() Andrew Morton
` (17 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
osalvador, pasha.tatashin, torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,memory_hotplug: relax fully spanned sections check
We want {online,offline}_pages to operate on whole memblocks, but
memmap_on_memory will poke pageblock_nr_pages aligned holes in the
beginning, which is a special case we want to allow. Relax the check to
account for that case.
Link: https://lkml.kernel.org/r/20210421102701.25051-3-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memory_hotplug.c | 22 ++++++++++++++++++----
1 file changed, 18 insertions(+), 4 deletions(-)
--- a/mm/memory_hotplug.c~mmmemory_hotplug-relax-fully-spanned-sections-check
+++ a/mm/memory_hotplug.c
@@ -838,9 +838,16 @@ int __ref online_pages(unsigned long pfn
int ret;
struct memory_notify arg;
- /* We can only online full sections (e.g., SECTION_IS_ONLINE) */
+ /*
+ * {on,off}lining is constrained to full memory sections (or more
+ * precisly to memory blocks from the user space POV).
+ * memmap_on_memory is an exception because it reserves initial part
+ * of the physical memory space for vmemmaps. That space is pageblock
+ * aligned.
+ */
if (WARN_ON_ONCE(!nr_pages ||
- !IS_ALIGNED(pfn | nr_pages, PAGES_PER_SECTION)))
+ !IS_ALIGNED(pfn, pageblock_nr_pages) ||
+ !IS_ALIGNED(pfn + nr_pages, PAGES_PER_SECTION)))
return -EINVAL;
mem_hotplug_begin();
@@ -1573,9 +1580,16 @@ int __ref offline_pages(unsigned long st
int ret, node;
char *reason;
- /* We can only offline full sections (e.g., SECTION_IS_ONLINE) */
+ /*
+ * {on,off}lining is constrained to full memory sections (or more
+ * precisly to memory blocks from the user space POV).
+ * memmap_on_memory is an exception because it reserves initial part
+ * of the physical memory space for vmemmaps. That space is pageblock
+ * aligned.
+ */
if (WARN_ON_ONCE(!nr_pages ||
- !IS_ALIGNED(start_pfn | nr_pages, PAGES_PER_SECTION)))
+ !IS_ALIGNED(start_pfn, pageblock_nr_pages) ||
+ !IS_ALIGNED(start_pfn + nr_pages, PAGES_PER_SECTION)))
return -EINVAL;
mem_hotplug_begin();
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 127/143] mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count()
2021-05-05 1:32 incoming Andrew Morton
` (122 preceding siblings ...)
2021-05-05 1:39 ` [patch 126/143] mm,memory_hotplug: relax fully spanned sections check Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 128/143] mm,memory_hotplug: allocate memmap from the added memory range Andrew Morton
` (16 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
osalvador, pasha.tatashin, torvalds, vbabka
From: David Hildenbrand <david@redhat.com>
Subject: mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count()
Let's have a single place (inspired by adjust_managed_page_count()) where
we adjust present pages. In contrast to adjust_managed_page_count(), only
memory onlining/offlining is allowed to modify the number of present
pages.
Link: https://lkml.kernel.org/r/20210421102701.25051-4-osalvador@suse.de
Signed-off-by: David Hildenbrand <david@redhat.com>
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memory_hotplug.c | 22 ++++++++++++----------
1 file changed, 12 insertions(+), 10 deletions(-)
--- a/mm/memory_hotplug.c~mmmemory_hotplug-factor-out-adjusting-present-pages-into-adjust_present_page_count
+++ a/mm/memory_hotplug.c
@@ -829,6 +829,16 @@ struct zone * zone_for_pfn_range(int onl
return default_zone_for_pfn(nid, start_pfn, nr_pages);
}
+static void adjust_present_page_count(struct zone *zone, long nr_pages)
+{
+ unsigned long flags;
+
+ zone->present_pages += nr_pages;
+ pgdat_resize_lock(zone->zone_pgdat, &flags);
+ zone->zone_pgdat->node_present_pages += nr_pages;
+ pgdat_resize_unlock(zone->zone_pgdat, &flags);
+}
+
int __ref online_pages(unsigned long pfn, unsigned long nr_pages,
int online_type, int nid)
{
@@ -884,11 +894,7 @@ int __ref online_pages(unsigned long pfn
}
online_pages_range(pfn, nr_pages);
- zone->present_pages += nr_pages;
-
- pgdat_resize_lock(zone->zone_pgdat, &flags);
- zone->zone_pgdat->node_present_pages += nr_pages;
- pgdat_resize_unlock(zone->zone_pgdat, &flags);
+ adjust_present_page_count(zone, nr_pages);
node_states_set_node(nid, &arg);
if (need_zonelists_rebuild)
@@ -1706,11 +1712,7 @@ int __ref offline_pages(unsigned long st
/* removal success */
adjust_managed_page_count(pfn_to_page(start_pfn), -nr_pages);
- zone->present_pages -= nr_pages;
-
- pgdat_resize_lock(zone->zone_pgdat, &flags);
- zone->zone_pgdat->node_present_pages -= nr_pages;
- pgdat_resize_unlock(zone->zone_pgdat, &flags);
+ adjust_present_page_count(zone, -nr_pages);
init_per_zone_wmark_min();
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 128/143] mm,memory_hotplug: allocate memmap from the added memory range
2021-05-05 1:32 incoming Andrew Morton
` (123 preceding siblings ...)
2021-05-05 1:39 ` [patch 127/143] mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count() Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 129/143] acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported Andrew Morton
` (15 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
osalvador, pasha.tatashin, torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,memory_hotplug: allocate memmap from the added memory range
Physical memory hotadd has to allocate a memmap (struct page array) for
the newly added memory section. Currently, alloc_pages_node() is used for
those allocations.
This has some disadvantages:
a) an existing memory is consumed for that purpose
(eg: ~2MB per 128MB memory section on x86_64)
This can even lead to extreme cases where system goes OOM because
the physically hotplugged memory depletes the available memory before
it is onlined.
b) if the whole node is movable then we have off-node struct pages
which has performance drawbacks.
c) It might be there are no PMD_ALIGNED chunks so memmap array gets
populated with base pages.
This can be improved when CONFIG_SPARSEMEM_VMEMMAP is enabled.
Vmemap page tables can map arbitrary memory. That means that we can
reserve a part of the physically hotadded memory to back vmemmap page
tables. This implementation uses the beginning of the hotplugged memory
for that purpose.
There are some non-obviously things to consider though. Vmemmap pages are
allocated/freed during the memory hotplug events (add_memory_resource(),
try_remove_memory()) when the memory is added/removed. This means that
the reserved physical range is not online although it is used. The most
obvious side effect is that pfn_to_online_page() returns NULL for those
pfns. The current design expects that this should be OK as the hotplugged
memory is considered a garbage until it is onlined. For example
hibernation wouldn't save the content of those vmmemmaps into the image so
it wouldn't be restored on resume but this should be OK as there no real
content to recover anyway while metadata is reachable from other data
structures (e.g. vmemmap page tables).
The reserved space is therefore (de)initialized during the {on,off}line
events (mhp_{de}init_memmap_on_memory). That is done by extracting page
allocator independent initialization from the regular onlining path. The
primary reason to handle the reserved space outside of {on,off}line_pages
is to make each initialization specific to the purpose rather than special
case them in a single function.
As per above, the functions that are introduced are:
- mhp_init_memmap_on_memory:
Initializes vmemmap pages by calling move_pfn_range_to_zone(), calls
kasan_add_zero_shadow(), and onlines as many sections as vmemmap pages
fully span.
- mhp_deinit_memmap_on_memory:
Offlines as many sections as vmemmap pages fully span, removes the
range from zhe zone by remove_pfn_range_from_zone(), and calls
kasan_remove_zero_shadow() for the range.
The new function memory_block_online() calls mhp_init_memmap_on_memory()
before doing the actual online_pages(). Should online_pages() fail, we
clean up by calling mhp_deinit_memmap_on_memory(). Adjusting of
present_pages is done at the end once we know that online_pages()
succedeed.
On offline, memory_block_offline() needs to unaccount vmemmap pages from
present_pages() before calling offline_pages(). This is necessary because
offline_pages() tears down some structures based on the fact whether the
node or the zone become empty. If offline_pages() fails, we account back
vmemmap pages. If it succeeds, we call mhp_deinit_memmap_on_memory().
Hot-remove:
We need to be careful when removing memory, as adding and
removing memory needs to be done with the same granularity.
To check that this assumption is not violated, we check the
memory range we want to remove and if a) any memory block has
vmemmap pages and b) the range spans more than a single memory
block, we scream out loud and refuse to proceed.
If all is good and the range was using memmap on memory (aka vmemmap pages),
we construct an altmap structure so free_hugepage_table does the right
thing and calls vmem_altmap_free instead of free_pagetable.
Link: https://lkml.kernel.org/r/20210421102701.25051-5-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/base/memory.c | 72 ++++++++++++-
include/linux/memory.h | 8 +
include/linux/memory_hotplug.h | 15 ++
include/linux/memremap.h | 2
include/linux/mmzone.h | 7 -
mm/Kconfig | 5
mm/memory_hotplug.c | 161 +++++++++++++++++++++++++++++--
mm/sparse.c | 2
8 files changed, 250 insertions(+), 22 deletions(-)
--- a/drivers/base/memory.c~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/drivers/base/memory.c
@@ -173,16 +173,73 @@ static int memory_block_online(struct me
{
unsigned long start_pfn = section_nr_to_pfn(mem->start_section_nr);
unsigned long nr_pages = PAGES_PER_SECTION * sections_per_block;
+ unsigned long nr_vmemmap_pages = mem->nr_vmemmap_pages;
+ struct zone *zone;
+ int ret;
+
+ zone = zone_for_pfn_range(mem->online_type, mem->nid, start_pfn, nr_pages);
+
+ /*
+ * Although vmemmap pages have a different lifecycle than the pages
+ * they describe (they remain until the memory is unplugged), doing
+ * their initialization and accounting at memory onlining/offlining
+ * stage helps to keep accounting easier to follow - e.g vmemmaps
+ * belong to the same zone as the memory they backed.
+ */
+ if (nr_vmemmap_pages) {
+ ret = mhp_init_memmap_on_memory(start_pfn, nr_vmemmap_pages, zone);
+ if (ret)
+ return ret;
+ }
+
+ ret = online_pages(start_pfn + nr_vmemmap_pages,
+ nr_pages - nr_vmemmap_pages, zone);
+ if (ret) {
+ if (nr_vmemmap_pages)
+ mhp_deinit_memmap_on_memory(start_pfn, nr_vmemmap_pages);
+ return ret;
+ }
+
+ /*
+ * Account once onlining succeeded. If the zone was unpopulated, it is
+ * now already properly populated.
+ */
+ if (nr_vmemmap_pages)
+ adjust_present_page_count(zone, nr_vmemmap_pages);
- return online_pages(start_pfn, nr_pages, mem->online_type, mem->nid);
+ return ret;
}
static int memory_block_offline(struct memory_block *mem)
{
unsigned long start_pfn = section_nr_to_pfn(mem->start_section_nr);
unsigned long nr_pages = PAGES_PER_SECTION * sections_per_block;
+ unsigned long nr_vmemmap_pages = mem->nr_vmemmap_pages;
+ struct zone *zone;
+ int ret;
+
+ zone = page_zone(pfn_to_page(start_pfn));
+
+ /*
+ * Unaccount before offlining, such that unpopulated zone and kthreads
+ * can properly be torn down in offline_pages().
+ */
+ if (nr_vmemmap_pages)
+ adjust_present_page_count(zone, -nr_vmemmap_pages);
- return offline_pages(start_pfn, nr_pages);
+ ret = offline_pages(start_pfn + nr_vmemmap_pages,
+ nr_pages - nr_vmemmap_pages);
+ if (ret) {
+ /* offline_pages() failed. Account back. */
+ if (nr_vmemmap_pages)
+ adjust_present_page_count(zone, nr_vmemmap_pages);
+ return ret;
+ }
+
+ if (nr_vmemmap_pages)
+ mhp_deinit_memmap_on_memory(start_pfn, nr_vmemmap_pages);
+
+ return ret;
}
/*
@@ -576,7 +633,8 @@ int register_memory(struct memory_block
return ret;
}
-static int init_memory_block(unsigned long block_id, unsigned long state)
+static int init_memory_block(unsigned long block_id, unsigned long state,
+ unsigned long nr_vmemmap_pages)
{
struct memory_block *mem;
int ret = 0;
@@ -593,6 +651,7 @@ static int init_memory_block(unsigned lo
mem->start_section_nr = block_id * sections_per_block;
mem->state = state;
mem->nid = NUMA_NO_NODE;
+ mem->nr_vmemmap_pages = nr_vmemmap_pages;
ret = register_memory(mem);
@@ -612,7 +671,7 @@ static int add_memory_block(unsigned lon
if (section_count == 0)
return 0;
return init_memory_block(memory_block_id(base_section_nr),
- MEM_ONLINE);
+ MEM_ONLINE, 0);
}
static void unregister_memory(struct memory_block *memory)
@@ -634,7 +693,8 @@ static void unregister_memory(struct mem
*
* Called under device_hotplug_lock.
*/
-int create_memory_block_devices(unsigned long start, unsigned long size)
+int create_memory_block_devices(unsigned long start, unsigned long size,
+ unsigned long vmemmap_pages)
{
const unsigned long start_block_id = pfn_to_block_id(PFN_DOWN(start));
unsigned long end_block_id = pfn_to_block_id(PFN_DOWN(start + size));
@@ -647,7 +707,7 @@ int create_memory_block_devices(unsigned
return -EINVAL;
for (block_id = start_block_id; block_id != end_block_id; block_id++) {
- ret = init_memory_block(block_id, MEM_OFFLINE);
+ ret = init_memory_block(block_id, MEM_OFFLINE, vmemmap_pages);
if (ret)
break;
}
--- a/include/linux/memory.h~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/include/linux/memory.h
@@ -29,6 +29,11 @@ struct memory_block {
int online_type; /* for passing data to online routine */
int nid; /* NID for this memory block */
struct device dev;
+ /*
+ * Number of vmemmap pages. These pages
+ * lay at the beginning of the memory block.
+ */
+ unsigned long nr_vmemmap_pages;
};
int arch_get_memory_phys_device(unsigned long start_pfn);
@@ -80,7 +85,8 @@ static inline int memory_notify(unsigned
#else
extern int register_memory_notifier(struct notifier_block *nb);
extern void unregister_memory_notifier(struct notifier_block *nb);
-int create_memory_block_devices(unsigned long start, unsigned long size);
+int create_memory_block_devices(unsigned long start, unsigned long size,
+ unsigned long vmemmap_pages);
void remove_memory_block_devices(unsigned long start, unsigned long size);
extern void memory_dev_init(void);
extern int memory_notify(unsigned long val, void *v);
--- a/include/linux/memory_hotplug.h~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/include/linux/memory_hotplug.h
@@ -56,6 +56,14 @@ typedef int __bitwise mhp_t;
#define MHP_MERGE_RESOURCE ((__force mhp_t)BIT(0))
/*
+ * We want memmap (struct page array) to be self contained.
+ * To do so, we will use the beginning of the hot-added range to build
+ * the page tables for the memmap array that describes the entire range.
+ * Only selected architectures support it with SPARSE_VMEMMAP.
+ */
+#define MHP_MEMMAP_ON_MEMORY ((__force mhp_t)BIT(1))
+
+/*
* Extended parameters for memory hotplug:
* altmap: alternative allocator for memmap array (optional)
* pgprot: page protection flags to apply to newly created page tables
@@ -99,9 +107,13 @@ static inline void zone_seqlock_init(str
extern int zone_grow_free_lists(struct zone *zone, unsigned long new_nr_pages);
extern int zone_grow_waitqueues(struct zone *zone, unsigned long nr_pages);
extern int add_one_highpage(struct page *page, int pfn, int bad_ppro);
+extern void adjust_present_page_count(struct zone *zone, long nr_pages);
/* VM interface that may be used by firmware interface */
+extern int mhp_init_memmap_on_memory(unsigned long pfn, unsigned long nr_pages,
+ struct zone *zone);
+extern void mhp_deinit_memmap_on_memory(unsigned long pfn, unsigned long nr_pages);
extern int online_pages(unsigned long pfn, unsigned long nr_pages,
- int online_type, int nid);
+ struct zone *zone);
extern struct zone *test_pages_in_a_zone(unsigned long start_pfn,
unsigned long end_pfn);
extern void __offline_isolated_pages(unsigned long start_pfn,
@@ -359,6 +371,7 @@ extern struct zone *zone_for_pfn_range(i
extern int arch_create_linear_mapping(int nid, u64 start, u64 size,
struct mhp_params *params);
void arch_remove_linear_mapping(u64 start, u64 size);
+extern bool mhp_supports_memmap_on_memory(unsigned long size);
#endif /* CONFIG_MEMORY_HOTPLUG */
#endif /* __LINUX_MEMORY_HOTPLUG_H */
--- a/include/linux/memremap.h~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/include/linux/memremap.h
@@ -17,7 +17,7 @@ struct device;
* @alloc: track pages consumed, private to vmemmap_populate()
*/
struct vmem_altmap {
- const unsigned long base_pfn;
+ unsigned long base_pfn;
const unsigned long end_pfn;
const unsigned long reserve;
unsigned long free;
--- a/include/linux/mmzone.h~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/include/linux/mmzone.h
@@ -436,6 +436,11 @@ enum zone_type {
* situations where ZERO_PAGE(0) which is allocated differently
* on different platforms may end up in a movable zone. ZERO_PAGE(0)
* cannot be migrated.
+ * 7. Memory-hotplug: when using memmap_on_memory and onlining the
+ * memory to the MOVABLE zone, the vmemmap pages are also placed in
+ * such zone. Such pages cannot be really moved around as they are
+ * self-stored in the range, but they are treated as movable when
+ * the range they describe is about to be offlined.
*
* In general, no unmovable allocations that degrade memory offlining
* should end up in ZONE_MOVABLE. Allocators (like alloc_contig_range())
@@ -1392,10 +1397,8 @@ static inline int online_section_nr(unsi
#ifdef CONFIG_MEMORY_HOTPLUG
void online_mem_sections(unsigned long start_pfn, unsigned long end_pfn);
-#ifdef CONFIG_MEMORY_HOTREMOVE
void offline_mem_sections(unsigned long start_pfn, unsigned long end_pfn);
#endif
-#endif
static inline struct mem_section *__pfn_to_section(unsigned long pfn)
{
--- a/mm/Kconfig~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/mm/Kconfig
@@ -188,6 +188,11 @@ config MEMORY_HOTREMOVE
depends on MEMORY_HOTPLUG && ARCH_ENABLE_MEMORY_HOTREMOVE
depends on MIGRATION
+config MHP_MEMMAP_ON_MEMORY
+ def_bool y
+ depends on MEMORY_HOTPLUG && SPARSEMEM_VMEMMAP
+ depends on ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
+
# Heavily threaded applications may benefit from splitting the mm-wide
# page_table_lock, so that faults on different parts of the user address
# space can be handled with less contention: split it at this NR_CPUS.
--- a/mm/memory_hotplug.c~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/mm/memory_hotplug.c
@@ -42,6 +42,8 @@
#include "internal.h"
#include "shuffle.h"
+static bool memmap_on_memory;
+
/*
* online_page_callback contains pointer to current page onlining function.
* Initially it is generic_online_page(). If it is required it could be
@@ -648,9 +650,16 @@ static void online_pages_range(unsigned
* decide to not expose all pages to the buddy (e.g., expose them
* later). We account all pages as being online and belonging to this
* zone ("present").
+ * When using memmap_on_memory, the range might not be aligned to
+ * MAX_ORDER_NR_PAGES - 1, but pageblock aligned. __ffs() will detect
+ * this and the first chunk to online will be pageblock_nr_pages.
*/
- for (pfn = start_pfn; pfn < end_pfn; pfn += MAX_ORDER_NR_PAGES)
- (*online_page_callback)(pfn_to_page(pfn), MAX_ORDER - 1);
+ for (pfn = start_pfn; pfn < end_pfn;) {
+ int order = min(MAX_ORDER - 1UL, __ffs(pfn));
+
+ (*online_page_callback)(pfn_to_page(pfn), order);
+ pfn += (1UL << order);
+ }
/* mark all involved sections as online */
online_mem_sections(start_pfn, end_pfn);
@@ -829,7 +838,11 @@ struct zone * zone_for_pfn_range(int onl
return default_zone_for_pfn(nid, start_pfn, nr_pages);
}
-static void adjust_present_page_count(struct zone *zone, long nr_pages)
+/*
+ * This function should only be called by memory_block_{online,offline},
+ * and {online,offline}_pages.
+ */
+void adjust_present_page_count(struct zone *zone, long nr_pages)
{
unsigned long flags;
@@ -839,12 +852,54 @@ static void adjust_present_page_count(st
pgdat_resize_unlock(zone->zone_pgdat, &flags);
}
-int __ref online_pages(unsigned long pfn, unsigned long nr_pages,
- int online_type, int nid)
+int mhp_init_memmap_on_memory(unsigned long pfn, unsigned long nr_pages,
+ struct zone *zone)
+{
+ unsigned long end_pfn = pfn + nr_pages;
+ int ret;
+
+ ret = kasan_add_zero_shadow(__va(PFN_PHYS(pfn)), PFN_PHYS(nr_pages));
+ if (ret)
+ return ret;
+
+ move_pfn_range_to_zone(zone, pfn, nr_pages, NULL, MIGRATE_UNMOVABLE);
+
+ /*
+ * It might be that the vmemmap_pages fully span sections. If that is
+ * the case, mark those sections online here as otherwise they will be
+ * left offline.
+ */
+ if (nr_pages >= PAGES_PER_SECTION)
+ online_mem_sections(pfn, ALIGN_DOWN(end_pfn, PAGES_PER_SECTION));
+
+ return ret;
+}
+
+void mhp_deinit_memmap_on_memory(unsigned long pfn, unsigned long nr_pages)
+{
+ unsigned long end_pfn = pfn + nr_pages;
+
+ /*
+ * It might be that the vmemmap_pages fully span sections. If that is
+ * the case, mark those sections offline here as otherwise they will be
+ * left online.
+ */
+ if (nr_pages >= PAGES_PER_SECTION)
+ offline_mem_sections(pfn, ALIGN_DOWN(end_pfn, PAGES_PER_SECTION));
+
+ /*
+ * The pages associated with this vmemmap have been offlined, so
+ * we can reset its state here.
+ */
+ remove_pfn_range_from_zone(page_zone(pfn_to_page(pfn)), pfn, nr_pages);
+ kasan_remove_zero_shadow(__va(PFN_PHYS(pfn)), PFN_PHYS(nr_pages));
+}
+
+int __ref online_pages(unsigned long pfn, unsigned long nr_pages, struct zone *zone)
{
unsigned long flags;
- struct zone *zone;
int need_zonelists_rebuild = 0;
+ const int nid = zone_to_nid(zone);
int ret;
struct memory_notify arg;
@@ -863,7 +918,6 @@ int __ref online_pages(unsigned long pfn
mem_hotplug_begin();
/* associate pfn range with the zone */
- zone = zone_for_pfn_range(online_type, nid, pfn, nr_pages);
move_pfn_range_to_zone(zone, pfn, nr_pages, NULL, MIGRATE_ISOLATE);
arg.start_pfn = pfn;
@@ -1077,6 +1131,45 @@ static int online_memory_block(struct me
return device_online(&mem->dev);
}
+bool mhp_supports_memmap_on_memory(unsigned long size)
+{
+ unsigned long nr_vmemmap_pages = size / PAGE_SIZE;
+ unsigned long vmemmap_size = nr_vmemmap_pages * sizeof(struct page);
+ unsigned long remaining_size = size - vmemmap_size;
+
+ /*
+ * Besides having arch support and the feature enabled at runtime, we
+ * need a few more assumptions to hold true:
+ *
+ * a) We span a single memory block: memory onlining/offlinin;g happens
+ * in memory block granularity. We don't want the vmemmap of online
+ * memory blocks to reside on offline memory blocks. In the future,
+ * we might want to support variable-sized memory blocks to make the
+ * feature more versatile.
+ *
+ * b) The vmemmap pages span complete PMDs: We don't want vmemmap code
+ * to populate memory from the altmap for unrelated parts (i.e.,
+ * other memory blocks)
+ *
+ * c) The vmemmap pages (and thereby the pages that will be exposed to
+ * the buddy) have to cover full pageblocks: memory onlining/offlining
+ * code requires applicable ranges to be page-aligned, for example, to
+ * set the migratetypes properly.
+ *
+ * TODO: Although we have a check here to make sure that vmemmap pages
+ * fully populate a PMD, it is not the right place to check for
+ * this. A much better solution involves improving vmemmap code
+ * to fallback to base pages when trying to populate vmemmap using
+ * altmap as an alternative source of memory, and we do not exactly
+ * populate a single PMD.
+ */
+ return memmap_on_memory &&
+ IS_ENABLED(CONFIG_MHP_MEMMAP_ON_MEMORY) &&
+ size == memory_block_size_bytes() &&
+ IS_ALIGNED(vmemmap_size, PMD_SIZE) &&
+ IS_ALIGNED(remaining_size, (pageblock_nr_pages << PAGE_SHIFT));
+}
+
/*
* NOTE: The caller must call lock_device_hotplug() to serialize hotplug
* and online/offline operations (triggered e.g. by sysfs).
@@ -1086,6 +1179,7 @@ static int online_memory_block(struct me
int __ref add_memory_resource(int nid, struct resource *res, mhp_t mhp_flags)
{
struct mhp_params params = { .pgprot = pgprot_mhp(PAGE_KERNEL) };
+ struct vmem_altmap mhp_altmap = {};
u64 start, size;
bool new_node = false;
int ret;
@@ -1112,13 +1206,26 @@ int __ref add_memory_resource(int nid, s
goto error;
new_node = ret;
+ /*
+ * Self hosted memmap array
+ */
+ if (mhp_flags & MHP_MEMMAP_ON_MEMORY) {
+ if (!mhp_supports_memmap_on_memory(size)) {
+ ret = -EINVAL;
+ goto error;
+ }
+ mhp_altmap.free = PHYS_PFN(size);
+ mhp_altmap.base_pfn = PHYS_PFN(start);
+ params.altmap = &mhp_altmap;
+ }
+
/* call arch's memory hotadd */
ret = arch_add_memory(nid, start, size, ¶ms);
if (ret < 0)
goto error;
/* create memory block devices after memory was added */
- ret = create_memory_block_devices(start, size);
+ ret = create_memory_block_devices(start, size, mhp_altmap.alloc);
if (ret) {
arch_remove_memory(nid, start, size, NULL);
goto error;
@@ -1767,6 +1874,14 @@ static int check_memblock_offlined_cb(st
return 0;
}
+static int get_nr_vmemmap_pages_cb(struct memory_block *mem, void *arg)
+{
+ /*
+ * If not set, continue with the next block.
+ */
+ return mem->nr_vmemmap_pages;
+}
+
static int check_cpu_on_node(pg_data_t *pgdat)
{
int cpu;
@@ -1841,6 +1956,9 @@ EXPORT_SYMBOL(try_offline_node);
static int __ref try_remove_memory(int nid, u64 start, u64 size)
{
int rc = 0;
+ struct vmem_altmap mhp_altmap = {};
+ struct vmem_altmap *altmap = NULL;
+ unsigned long nr_vmemmap_pages;
BUG_ON(check_hotplug_memory_range(start, size));
@@ -1853,6 +1971,31 @@ static int __ref try_remove_memory(int n
if (rc)
return rc;
+ /*
+ * We only support removing memory added with MHP_MEMMAP_ON_MEMORY in
+ * the same granularity it was added - a single memory block.
+ */
+ if (memmap_on_memory) {
+ nr_vmemmap_pages = walk_memory_blocks(start, size, NULL,
+ get_nr_vmemmap_pages_cb);
+ if (nr_vmemmap_pages) {
+ if (size != memory_block_size_bytes()) {
+ pr_warn("Refuse to remove %#llx - %#llx,"
+ "wrong granularity\n",
+ start, start + size);
+ return -EINVAL;
+ }
+
+ /*
+ * Let remove_pmd_table->free_hugepage_table do the
+ * right thing if we used vmem_altmap when hot-adding
+ * the range.
+ */
+ mhp_altmap.alloc = nr_vmemmap_pages;
+ altmap = &mhp_altmap;
+ }
+ }
+
/* remove memmap entry */
firmware_map_remove(start, start + size, "System RAM");
@@ -1864,7 +2007,7 @@ static int __ref try_remove_memory(int n
mem_hotplug_begin();
- arch_remove_memory(nid, start, size, NULL);
+ arch_remove_memory(nid, start, size, altmap);
if (IS_ENABLED(CONFIG_ARCH_KEEP_MEMBLOCK)) {
memblock_free(start, size);
--- a/mm/sparse.c~mmmemory_hotplug-allocate-memmap-from-the-added-memory-range
+++ a/mm/sparse.c
@@ -624,7 +624,6 @@ void online_mem_sections(unsigned long s
}
}
-#ifdef CONFIG_MEMORY_HOTREMOVE
/* Mark all memory sections within the pfn range as offline */
void offline_mem_sections(unsigned long start_pfn, unsigned long end_pfn)
{
@@ -645,7 +644,6 @@ void offline_mem_sections(unsigned long
ms->section_mem_map &= ~SECTION_IS_ONLINE;
}
}
-#endif
#ifdef CONFIG_SPARSEMEM_VMEMMAP
static struct page * __meminit populate_section_memmap(unsigned long pfn,
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 129/143] acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported
2021-05-05 1:32 incoming Andrew Morton
` (124 preceding siblings ...)
2021-05-05 1:39 ` [patch 128/143] mm,memory_hotplug: allocate memmap from the added memory range Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 130/143] mm,memory_hotplug: add kernel boot option to enable memmap_on_memory Andrew Morton
` (14 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
osalvador, pasha.tatashin, torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported
Let the caller check whether it can pass MHP_MEMMAP_ON_MEMORY by checking
mhp_supports_memmap_on_memory(). MHP_MEMMAP_ON_MEMORY can only be set in
case ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE is enabled, the architecture
supports altmap, and the range to be added spans a single memory block.
Link: https://lkml.kernel.org/r/20210421102701.25051-6-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/acpi/acpi_memhotplug.c | 5 ++++-
1 file changed, 4 insertions(+), 1 deletion(-)
--- a/drivers/acpi/acpi_memhotplug.c~acpimemhotplug-enable-mhp_memmap_on_memory-when-supported
+++ a/drivers/acpi/acpi_memhotplug.c
@@ -171,6 +171,7 @@ static int acpi_memory_enable_device(str
acpi_handle handle = mem_device->device->handle;
int result, num_enabled = 0;
struct acpi_memory_info *info;
+ mhp_t mhp_flags = MHP_NONE;
int node;
node = acpi_get_node(handle);
@@ -194,8 +195,10 @@ static int acpi_memory_enable_device(str
if (node < 0)
node = memory_add_physaddr_to_nid(info->start_addr);
+ if (mhp_supports_memmap_on_memory(info->length))
+ mhp_flags |= MHP_MEMMAP_ON_MEMORY;
result = __add_memory(node, info->start_addr, info->length,
- MHP_NONE);
+ mhp_flags);
/*
* If the memory block has been used by the kernel, add_memory()
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 130/143] mm,memory_hotplug: add kernel boot option to enable memmap_on_memory
2021-05-05 1:32 incoming Andrew Morton
` (125 preceding siblings ...)
2021-05-05 1:39 ` [patch 129/143] acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 131/143] x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE Andrew Morton
` (13 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
osalvador, pasha.tatashin, torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,memory_hotplug: add kernel boot option to enable memmap_on_memory
Self stored memmap leads to a sparse memory situation which is unsuitable
for workloads that requires large contiguous memory chunks, so make this
an opt-in which needs to be explicitly enabled.
To control this, let memory_hotplug have its own memory space, as
suggested by David, so we can add memory_hotplug.memmap_on_memory
parameter.
Link: https://lkml.kernel.org/r/20210421102701.25051-7-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/admin-guide/kernel-parameters.txt | 17 ++++++++++++++
mm/Makefile | 5 +++-
mm/memory_hotplug.c | 10 +++++++-
3 files changed, 30 insertions(+), 2 deletions(-)
--- a/Documentation/admin-guide/kernel-parameters.txt~mmmemory_hotplug-add-kernel-boot-option-to-enable-memmap_on_memory
+++ a/Documentation/admin-guide/kernel-parameters.txt
@@ -2801,6 +2801,23 @@
seconds. Use this parameter to check at some
other rate. 0 disables periodic checking.
+ memory_hotplug.memmap_on_memory
+ [KNL,X86,ARM] Boolean flag to enable this feature.
+ Format: {on | off (default)}
+ When enabled, runtime hotplugged memory will
+ allocate its internal metadata (struct pages)
+ from the hotadded memory which will allow to
+ hotadd a lot of memory without requiring
+ additional memory to do so.
+ This feature is disabled by default because it
+ has some implication on large (e.g. GB)
+ allocations in some configurations (e.g. small
+ memory blocks).
+ The state of the flag can be read in
+ /sys/module/memory_hotplug/parameters/memmap_on_memory.
+ Note that even when enabled, there are a few cases where
+ the feature is not effective.
+
memtest= [KNL,X86,ARM,PPC] Enable memtest
Format: <integer>
default : 0 <disable>
--- a/mm/Makefile~mmmemory_hotplug-add-kernel-boot-option-to-enable-memmap_on_memory
+++ a/mm/Makefile
@@ -58,9 +58,13 @@ obj-y := filemap.o mempool.o oom_kill.
page-alloc-y := page_alloc.o
page-alloc-$(CONFIG_SHUFFLE_PAGE_ALLOCATOR) += shuffle.o
+# Give 'memory_hotplug' its own module-parameter namespace
+memory-hotplug-$(CONFIG_MEMORY_HOTPLUG) += memory_hotplug.o
+
obj-y += page-alloc.o
obj-y += init-mm.o
obj-y += memblock.o
+obj-y += $(memory-hotplug-y)
ifdef CONFIG_MMU
obj-$(CONFIG_ADVISE_SYSCALLS) += madvise.o
@@ -83,7 +87,6 @@ obj-$(CONFIG_SLUB) += slub.o
obj-$(CONFIG_KASAN) += kasan/
obj-$(CONFIG_KFENCE) += kfence/
obj-$(CONFIG_FAILSLAB) += failslab.o
-obj-$(CONFIG_MEMORY_HOTPLUG) += memory_hotplug.o
obj-$(CONFIG_MEMTEST) += memtest.o
obj-$(CONFIG_MIGRATION) += migrate.o
obj-$(CONFIG_TRANSPARENT_HUGEPAGE) += huge_memory.o khugepaged.o
--- a/mm/memory_hotplug.c~mmmemory_hotplug-add-kernel-boot-option-to-enable-memmap_on_memory
+++ a/mm/memory_hotplug.c
@@ -42,7 +42,15 @@
#include "internal.h"
#include "shuffle.h"
-static bool memmap_on_memory;
+
+/*
+ * memory_hotplug.memmap_on_memory parameter
+ */
+static bool memmap_on_memory __ro_after_init;
+#ifdef CONFIG_MHP_MEMMAP_ON_MEMORY
+module_param(memmap_on_memory, bool, 0444);
+MODULE_PARM_DESC(memmap_on_memory, "Enable memmap on memory for memory hotplug");
+#endif
/*
* online_page_callback contains pointer to current page onlining function.
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 131/143] x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
2021-05-05 1:32 incoming Andrew Morton
` (126 preceding siblings ...)
2021-05-05 1:39 ` [patch 130/143] mm,memory_hotplug: add kernel boot option to enable memmap_on_memory Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 132/143] arm64/Kconfig: " Andrew Morton
` (12 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
osalvador, pasha.tatashin, torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
Enable x86_64 platform to use the MHP_MEMMAP_ON_MEMORY feature.
Link: https://lkml.kernel.org/r/20210421102701.25051-8-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/x86/Kconfig | 3 +++
1 file changed, 3 insertions(+)
--- a/arch/x86/Kconfig~x86-kconfig-introduce-arch_mhp_memmap_on_memory_enable
+++ a/arch/x86/Kconfig
@@ -2432,6 +2432,9 @@ config ARCH_HAS_ADD_PAGES
def_bool y
depends on X86_64 && ARCH_ENABLE_MEMORY_HOTPLUG
+config ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
+ def_bool y
+
config USE_PERCPU_NUMA_NODE_ID
def_bool y
depends on NUMA
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 132/143] arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
2021-05-05 1:32 incoming Andrew Morton
` (127 preceding siblings ...)
2021-05-05 1:39 ` [patch 131/143] x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:39 ` [patch 133/143] mm/zswap.c: switch from strlcpy to strscpy Andrew Morton
` (11 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, anshuman.khandual, david, linux-mm, mhocko, mm-commits,
osalvador, pasha.tatashin, torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
Enable arm64 platform to use the MHP_MEMMAP_ON_MEMORY feature.
Link: https://lkml.kernel.org/r/20210421102701.25051-9-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/arm64/Kconfig | 3 +++
1 file changed, 3 insertions(+)
--- a/arch/arm64/Kconfig~arm64-kconfig-introduce-arch_mhp_memmap_on_memory_enable
+++ a/arch/arm64/Kconfig
@@ -316,6 +316,9 @@ config ZONE_DMA32
bool "Support DMA32 zone" if EXPERT
default y
+config ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
+ def_bool y
+
config SMP
def_bool y
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 133/143] mm/zswap.c: switch from strlcpy to strscpy
2021-05-05 1:32 incoming Andrew Morton
` (128 preceding siblings ...)
2021-05-05 1:39 ` [patch 132/143] arm64/Kconfig: " Andrew Morton
@ 2021-05-05 1:39 ` Andrew Morton
2021-05-05 1:40 ` [patch 134/143] mm/zsmalloc: use BUG_ON instead of if condition followed by BUG Andrew Morton
` (10 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:39 UTC (permalink / raw)
To: akpm, daizhiyuan, ddstreet, linux-mm, mm-commits, sjenning,
torvalds, vitaly.wool
From: Zhiyuan Dai <daizhiyuan@phytium.com.cn>
Subject: mm/zswap.c: switch from strlcpy to strscpy
strlcpy is marked as deprecated in Documentation/process/deprecated.rst,
and there is no functional difference when the caller expects truncation
(when not checking the return value). strscpy is relatively better as it
also avoids scanning the whole source string.
Link: https://lkml.kernel.org/r/1614227981-20367-1-git-send-email-daizhiyuan@phytium.com.cn
Signed-off-by: Zhiyuan Dai <daizhiyuan@phytium.com.cn>
Cc: Seth Jennings <sjenning@redhat.com>
Cc: Dan Streetman <ddstreet@ieee.org>
Cc: Vitaly Wool <vitaly.wool@konsulko.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/zswap.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/zswap.c~mm-zswap-switch-from-strlcpy-to-strscpy
+++ a/mm/zswap.c
@@ -614,7 +614,7 @@ static struct zswap_pool *zswap_pool_cre
}
pr_debug("using %s zpool\n", zpool_get_type(pool->zpool));
- strlcpy(pool->tfm_name, compressor, sizeof(pool->tfm_name));
+ strscpy(pool->tfm_name, compressor, sizeof(pool->tfm_name));
pool->acomp_ctx = alloc_percpu(*pool->acomp_ctx);
if (!pool->acomp_ctx) {
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 134/143] mm/zsmalloc: use BUG_ON instead of if condition followed by BUG.
2021-05-05 1:32 incoming Andrew Morton
` (129 preceding siblings ...)
2021-05-05 1:39 ` [patch 133/143] mm/zswap.c: switch from strlcpy to strscpy Andrew Morton
@ 2021-05-05 1:40 ` Andrew Morton
2021-05-05 1:40 ` [patch 135/143] iov_iter: lift memzero_page() to highmem.h Andrew Morton
` (9 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw)
To: akpm, linux-mm, minchan, mm-commits, sergey.senozhatsky.work,
torvalds, zhouchuangao
From: zhouchuangao <zhouchuangao@vivo.com>
Subject: mm/zsmalloc: use BUG_ON instead of if condition followed by BUG.
It can be optimized at compile time.
Link: https://lkml.kernel.org/r/1616727798-9110-1-git-send-email-zhouchuangao@vivo.com
Signed-off-by: zhouchuangao <zhouchuangao@vivo.com>
Cc: Minchan Kim <minchan@kernel.org>
Cc: Sergey Senozhatsky <sergey.senozhatsky.work@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/zsmalloc.c | 6 ++----
1 file changed, 2 insertions(+), 4 deletions(-)
--- a/mm/zsmalloc.c~mm-zsmalloc-use-bug_on-instead-of-if-condition-followed-by-bug
+++ a/mm/zsmalloc.c
@@ -1987,8 +1987,7 @@ static int zs_page_migrate(struct addres
head = obj_to_head(page, addr);
if (head & OBJ_ALLOCATED_TAG) {
handle = head & ~OBJ_ALLOCATED_TAG;
- if (!testpin_tag(handle))
- BUG();
+ BUG_ON(!testpin_tag(handle));
old_obj = handle_to_obj(handle);
obj_to_location(old_obj, &dummy, &obj_idx);
@@ -2035,8 +2034,7 @@ unpin_objects:
head = obj_to_head(page, addr);
if (head & OBJ_ALLOCATED_TAG) {
handle = head & ~OBJ_ALLOCATED_TAG;
- if (!testpin_tag(handle))
- BUG();
+ BUG_ON(!testpin_tag(handle));
unpin_tag(handle);
}
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 135/143] iov_iter: lift memzero_page() to highmem.h
2021-05-05 1:32 incoming Andrew Morton
` (130 preceding siblings ...)
2021-05-05 1:40 ` [patch 134/143] mm/zsmalloc: use BUG_ON instead of if condition followed by BUG Andrew Morton
@ 2021-05-05 1:40 ` Andrew Morton
2021-05-05 1:40 ` [patch 136/143] btrfs: use memzero_page() instead of open coded kmap pattern Andrew Morton
` (8 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw)
To: akpm, chaitanya.kulkarni, clm, dsterba, ira.weiny, josef,
linux-mm, mm-commits, torvalds, viro
From: Ira Weiny <ira.weiny@intel.com>
Subject: iov_iter: lift memzero_page() to highmem.h
Patch series "btrfs: Convert kmap/memset/kunmap to memzero_user()".
Lifting memzero_user(), convert it to kmap_local_page() and then use it in
btrfs.
This patch (of 3):
memzero_page() can replace the kmap/memset/kunmap pattern in other places
in the code. While zero_user() has the same interface it is not the same
call and its use should be limited and some of those calls may be better
converted from zero_user() to memzero_page().[1] But that is not addressed
in this series.
Lift memzero_page() to highmem.
[1] https://lore.kernel.org/lkml/CAHk-=wijdojzo56FzYqE5TOYw2Vws7ik3LEMGj9SPQaJJ+Z73Q@mail.gmail.com/
Link: https://lkml.kernel.org/r/20210309212137.2610186-1-ira.weiny@intel.com
Link: https://lkml.kernel.org/r/20210309212137.2610186-2-ira.weiny@intel.com
Signed-off-by: Ira Weiny <ira.weiny@intel.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: David Sterba <dsterba@suse.com>
Cc: Chris Mason <clm@fb.com>
Cc: Josef Bacik <josef@toxicpanda.com>
Cc: Chaitanya Kulkarni <chaitanya.kulkarni@wdc.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/highmem.h | 7 +++++++
lib/iov_iter.c | 8 +-------
2 files changed, 8 insertions(+), 7 deletions(-)
--- a/include/linux/highmem.h~iov_iter-lift-memzero_page-to-highmemh
+++ a/include/linux/highmem.h
@@ -332,4 +332,11 @@ static inline void memcpy_to_page(struct
kunmap_local(to);
}
+static inline void memzero_page(struct page *page, size_t offset, size_t len)
+{
+ char *addr = kmap_atomic(page);
+ memset(addr + offset, 0, len);
+ kunmap_atomic(addr);
+}
+
#endif /* _LINUX_HIGHMEM_H */
--- a/lib/iov_iter.c~iov_iter-lift-memzero_page-to-highmemh
+++ a/lib/iov_iter.c
@@ -5,6 +5,7 @@
#include <linux/fault-inject-usercopy.h>
#include <linux/uio.h>
#include <linux/pagemap.h>
+#include <linux/highmem.h>
#include <linux/slab.h>
#include <linux/vmalloc.h>
#include <linux/splice.h>
@@ -507,13 +508,6 @@ void iov_iter_init(struct iov_iter *i, u
}
EXPORT_SYMBOL(iov_iter_init);
-static void memzero_page(struct page *page, size_t offset, size_t len)
-{
- char *addr = kmap_atomic(page);
- memset(addr + offset, 0, len);
- kunmap_atomic(addr);
-}
-
static inline bool allocated(struct pipe_buffer *buf)
{
return buf->ops == &default_pipe_buf_ops;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 136/143] btrfs: use memzero_page() instead of open coded kmap pattern
2021-05-05 1:32 incoming Andrew Morton
` (131 preceding siblings ...)
2021-05-05 1:40 ` [patch 135/143] iov_iter: lift memzero_page() to highmem.h Andrew Morton
@ 2021-05-05 1:40 ` Andrew Morton
2021-05-05 1:40 ` [patch 137/143] mm/highmem.c: fix coding style issue Andrew Morton
` (7 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw)
To: akpm, chaitanya.kulkarni, clm, dsterba, ira.weiny, josef,
linux-mm, mm-commits, torvalds, viro
From: Ira Weiny <ira.weiny@intel.com>
Subject: btrfs: use memzero_page() instead of open coded kmap pattern
There are many places where kmap/memset/kunmap patterns occur.
Use the newly lifted memzero_page() to eliminate direct uses of kmap and
leverage the new core functions use of kmap_local_page().
The development of this patch was aided by the following coccinelle
script:
// <smpl>
// SPDX-License-Identifier: GPL-2.0-only
// Find kmap/memset/kunmap pattern and replace with memset*page calls
//
// NOTE: Offsets and other expressions may be more complex than what the script
// will automatically generate. Therefore a catchall rule is provided to find
// the pattern which then must be evaluated by hand.
//
// Confidence: Low
// Copyright: (C) 2021 Intel Corporation
// URL: http://coccinelle.lip6.fr/
// Comments:
// Options:
//
// Then the memset pattern
//
@ memset_rule1 @
expression page, V, L, Off;
identifier ptr;
type VP;
@@
(
-VP ptr = kmap(page);
|
-ptr = kmap(page);
|
-VP ptr = kmap_atomic(page);
|
-ptr = kmap_atomic(page);
)
<+...
(
-memset(ptr, 0, L);
+memzero_page(page, 0, L);
|
-memset(ptr + Off, 0, L);
+memzero_page(page, Off, L);
|
-memset(ptr, V, L);
+memset_page(page, V, 0, L);
|
-memset(ptr + Off, V, L);
+memset_page(page, V, Off, L);
)
...+>
(
-kunmap(page);
|
-kunmap_atomic(ptr);
)
// Remove any pointers left unused
@
depends on memset_rule1
@
identifier memset_rule1.ptr;
type VP, VP1;
@@
-VP ptr;
... when != ptr;
? VP1 ptr;
//
// Catch all
//
@ memset_rule2 @
expression page;
identifier ptr;
expression GenTo, GenSize, GenValue;
type VP;
@@
(
-VP ptr = kmap(page);
|
-ptr = kmap(page);
|
-VP ptr = kmap_atomic(page);
|
-ptr = kmap_atomic(page);
)
<+...
(
//
// Some call sites have complex expressions within the memset/memcpy
// The follow are catch alls which need to be evaluated by hand.
//
-memset(GenTo, 0, GenSize);
+memzero_pageExtra(page, GenTo, GenSize);
|
-memset(GenTo, GenValue, GenSize);
+memset_pageExtra(page, GenValue, GenTo, GenSize);
)
...+>
(
-kunmap(page);
|
-kunmap_atomic(ptr);
)
// Remove any pointers left unused
@
depends on memset_rule2
@
identifier memset_rule2.ptr;
type VP, VP1;
@@
-VP ptr;
... when != ptr;
? VP1 ptr;
// </smpl>
Link: https://lkml.kernel.org/r/20210309212137.2610186-4-ira.weiny@intel.com
Signed-off-by: Ira Weiny <ira.weiny@intel.com>
Reviewed-by: David Sterba <dsterba@suse.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Chaitanya Kulkarni <chaitanya.kulkarni@wdc.com>
Cc: Chris Mason <clm@fb.com>
Cc: Josef Bacik <josef@toxicpanda.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/btrfs/compression.c | 5 +----
fs/btrfs/extent_io.c | 22 ++++------------------
fs/btrfs/inode.c | 33 ++++++++++-----------------------
fs/btrfs/reflink.c | 6 +-----
fs/btrfs/zlib.c | 5 +----
fs/btrfs/zstd.c | 5 +----
6 files changed, 18 insertions(+), 58 deletions(-)
--- a/fs/btrfs/compression.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern
+++ a/fs/btrfs/compression.c
@@ -591,16 +591,13 @@ static noinline int add_ra_bio_pages(str
free_extent_map(em);
if (page->index == end_index) {
- char *userpage;
size_t zero_offset = offset_in_page(isize);
if (zero_offset) {
int zeros;
zeros = PAGE_SIZE - zero_offset;
- userpage = kmap_atomic(page);
- memset(userpage + zero_offset, 0, zeros);
+ memzero_page(page, zero_offset, zeros);
flush_dcache_page(page);
- kunmap_atomic(userpage);
}
}
--- a/fs/btrfs/extent_io.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern
+++ a/fs/btrfs/extent_io.c
@@ -3421,15 +3421,12 @@ int btrfs_do_readpage(struct page *page,
}
if (page->index == last_byte >> PAGE_SHIFT) {
- char *userpage;
size_t zero_offset = offset_in_page(last_byte);
if (zero_offset) {
iosize = PAGE_SIZE - zero_offset;
- userpage = kmap_atomic(page);
- memset(userpage + zero_offset, 0, iosize);
+ memzero_page(page, zero_offset, iosize);
flush_dcache_page(page);
- kunmap_atomic(userpage);
}
}
begin_page_read(fs_info, page);
@@ -3438,14 +3435,11 @@ int btrfs_do_readpage(struct page *page,
u64 disk_bytenr;
if (cur >= last_byte) {
- char *userpage;
struct extent_state *cached = NULL;
iosize = PAGE_SIZE - pg_offset;
- userpage = kmap_atomic(page);
- memset(userpage + pg_offset, 0, iosize);
+ memzero_page(page, pg_offset, iosize);
flush_dcache_page(page);
- kunmap_atomic(userpage);
set_extent_uptodate(tree, cur, cur + iosize - 1,
&cached, GFP_NOFS);
unlock_extent_cached(tree, cur,
@@ -3528,13 +3522,10 @@ int btrfs_do_readpage(struct page *page,
/* we've found a hole, just zero and go on */
if (block_start == EXTENT_MAP_HOLE) {
- char *userpage;
struct extent_state *cached = NULL;
- userpage = kmap_atomic(page);
- memset(userpage + pg_offset, 0, iosize);
+ memzero_page(page, pg_offset, iosize);
flush_dcache_page(page);
- kunmap_atomic(userpage);
set_extent_uptodate(tree, cur, cur + iosize - 1,
&cached, GFP_NOFS);
@@ -3845,12 +3836,7 @@ static int __extent_writepage(struct pag
}
if (page->index == end_index) {
- char *userpage;
-
- userpage = kmap_atomic(page);
- memset(userpage + pg_offset, 0,
- PAGE_SIZE - pg_offset);
- kunmap_atomic(userpage);
+ memzero_page(page, pg_offset, PAGE_SIZE - pg_offset);
flush_dcache_page(page);
}
--- a/fs/btrfs/inode.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern
+++ a/fs/btrfs/inode.c
@@ -646,17 +646,12 @@ again:
if (!ret) {
unsigned long offset = offset_in_page(total_compressed);
struct page *page = pages[nr_pages - 1];
- char *kaddr;
/* zero the tail end of the last page, we might be
* sending it down to disk
*/
- if (offset) {
- kaddr = kmap_atomic(page);
- memset(kaddr + offset, 0,
- PAGE_SIZE - offset);
- kunmap_atomic(kaddr);
- }
+ if (offset)
+ memzero_page(page, offset, PAGE_SIZE - offset);
will_compress = 1;
}
}
@@ -4833,7 +4828,6 @@ int btrfs_truncate_block(struct btrfs_in
struct btrfs_ordered_extent *ordered;
struct extent_state *cached_state = NULL;
struct extent_changeset *data_reserved = NULL;
- char *kaddr;
bool only_release_metadata = false;
u32 blocksize = fs_info->sectorsize;
pgoff_t index = from >> PAGE_SHIFT;
@@ -4925,15 +4919,13 @@ again:
if (offset != blocksize) {
if (!len)
len = blocksize - offset;
- kaddr = kmap(page);
if (front)
- memset(kaddr + (block_start - page_offset(page)),
- 0, offset);
+ memzero_page(page, (block_start - page_offset(page)),
+ offset);
else
- memset(kaddr + (block_start - page_offset(page)) + offset,
- 0, len);
+ memzero_page(page, (block_start - page_offset(page)) + offset,
+ len);
flush_dcache_page(page);
- kunmap(page);
}
ClearPageChecked(page);
set_page_dirty(page);
@@ -6832,11 +6824,9 @@ static noinline int uncompress_inline(st
* cover that region here.
*/
- if (max_size + pg_offset < PAGE_SIZE) {
- char *map = kmap(page);
- memset(map + pg_offset + max_size, 0, PAGE_SIZE - max_size - pg_offset);
- kunmap(page);
- }
+ if (max_size + pg_offset < PAGE_SIZE)
+ memzero_page(page, pg_offset + max_size,
+ PAGE_SIZE - max_size - pg_offset);
kfree(tmp);
return ret;
}
@@ -8506,7 +8496,6 @@ vm_fault_t btrfs_page_mkwrite(struct vm_
struct btrfs_ordered_extent *ordered;
struct extent_state *cached_state = NULL;
struct extent_changeset *data_reserved = NULL;
- char *kaddr;
unsigned long zero_start;
loff_t size;
vm_fault_t ret;
@@ -8620,10 +8609,8 @@ again:
zero_start = PAGE_SIZE;
if (zero_start != PAGE_SIZE) {
- kaddr = kmap(page);
- memset(kaddr + zero_start, 0, PAGE_SIZE - zero_start);
+ memzero_page(page, zero_start, PAGE_SIZE - zero_start);
flush_dcache_page(page);
- kunmap(page);
}
ClearPageChecked(page);
set_page_dirty(page);
--- a/fs/btrfs/reflink.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern
+++ a/fs/btrfs/reflink.c
@@ -129,12 +129,8 @@ static int copy_inline_to_page(struct bt
* So what's in the range [500, 4095] corresponds to zeroes.
*/
if (datal < block_size) {
- char *map;
-
- map = kmap(page);
- memset(map + datal, 0, block_size - datal);
+ memzero_page(page, datal, block_size - datal);
flush_dcache_page(page);
- kunmap(page);
}
SetPageUptodate(page);
--- a/fs/btrfs/zlib.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern
+++ a/fs/btrfs/zlib.c
@@ -375,7 +375,6 @@ int zlib_decompress(struct list_head *ws
unsigned long bytes_left;
unsigned long total_out = 0;
unsigned long pg_offset = 0;
- char *kaddr;
destlen = min_t(unsigned long, destlen, PAGE_SIZE);
bytes_left = destlen;
@@ -455,9 +454,7 @@ next:
* end of the inline extent (destlen) to the end of the page
*/
if (pg_offset < destlen) {
- kaddr = kmap_atomic(dest_page);
- memset(kaddr + pg_offset, 0, destlen - pg_offset);
- kunmap_atomic(kaddr);
+ memzero_page(dest_page, pg_offset, destlen - pg_offset);
}
return ret;
}
--- a/fs/btrfs/zstd.c~btrfs-use-memzero_page-instead-of-open-coded-kmap-pattern
+++ a/fs/btrfs/zstd.c
@@ -631,7 +631,6 @@ int zstd_decompress(struct list_head *ws
size_t ret2;
unsigned long total_out = 0;
unsigned long pg_offset = 0;
- char *kaddr;
stream = ZSTD_initDStream(
ZSTD_BTRFS_MAX_INPUT, workspace->mem, workspace->size);
@@ -696,9 +695,7 @@ int zstd_decompress(struct list_head *ws
ret = 0;
finish:
if (pg_offset < destlen) {
- kaddr = kmap_atomic(dest_page);
- memset(kaddr + pg_offset, 0, destlen - pg_offset);
- kunmap_atomic(kaddr);
+ memzero_page(dest_page, pg_offset, destlen - pg_offset);
}
return ret;
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 137/143] mm/highmem.c: fix coding style issue
2021-05-05 1:32 incoming Andrew Morton
` (132 preceding siblings ...)
2021-05-05 1:40 ` [patch 136/143] btrfs: use memzero_page() instead of open coded kmap pattern Andrew Morton
@ 2021-05-05 1:40 ` Andrew Morton
2021-05-05 1:40 ` [patch 138/143] mm/mempool: minor coding style tweaks Andrew Morton
` (6 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw)
To: akpm, david, linux-mm, mm-commits, songqiang, torvalds
From: songqiang <songqiang@uniontech.com>
Subject: mm/highmem.c: fix coding style issue
Delete/add some blank lines and some blank spaces
Link: https://lkml.kernel.org/r/20210311095015.14277-1-songqiang@uniontech.com
Signed-off-by: songqiang <songqiang@uniontech.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/highmem.c | 11 +++++------
1 file changed, 5 insertions(+), 6 deletions(-)
--- a/mm/highmem.c~mm-highmemc-fix-coding-style-issue
+++ a/mm/highmem.c
@@ -104,7 +104,7 @@ static inline wait_queue_head_t *get_pkm
atomic_long_t _totalhigh_pages __read_mostly;
EXPORT_SYMBOL(_totalhigh_pages);
-unsigned int __nr_free_highpages (void)
+unsigned int __nr_free_highpages(void)
{
struct zone *zone;
unsigned int pages = 0;
@@ -120,7 +120,7 @@ unsigned int __nr_free_highpages (void)
static int pkmap_count[LAST_PKMAP];
static __cacheline_aligned_in_smp DEFINE_SPINLOCK(kmap_lock);
-pte_t * pkmap_page_table;
+pte_t *pkmap_page_table;
/*
* Most architectures have no use for kmap_high_get(), so let's abstract
@@ -147,6 +147,7 @@ struct page *__kmap_to_page(void *vaddr)
if (addr >= PKMAP_ADDR(0) && addr < PKMAP_ADDR(LAST_PKMAP)) {
int i = PKMAP_NR(addr);
+
return pte_page(pkmap_page_table[i]);
}
@@ -278,9 +279,8 @@ void *kmap_high(struct page *page)
pkmap_count[PKMAP_NR(vaddr)]++;
BUG_ON(pkmap_count[PKMAP_NR(vaddr)] < 2);
unlock_kmap();
- return (void*) vaddr;
+ return (void *) vaddr;
}
-
EXPORT_SYMBOL(kmap_high);
#ifdef ARCH_NEEDS_KMAP_HIGH_GET
@@ -305,7 +305,7 @@ void *kmap_high_get(struct page *page)
pkmap_count[PKMAP_NR(vaddr)]++;
}
unlock_kmap_any(flags);
- return (void*) vaddr;
+ return (void *) vaddr;
}
#endif
@@ -737,7 +737,6 @@ done:
spin_unlock_irqrestore(&pas->lock, flags);
return ret;
}
-
EXPORT_SYMBOL(page_address);
/**
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 138/143] mm/mempool: minor coding style tweaks
2021-05-05 1:32 incoming Andrew Morton
` (133 preceding siblings ...)
2021-05-05 1:40 ` [patch 137/143] mm/highmem.c: fix coding style issue Andrew Morton
@ 2021-05-05 1:40 ` Andrew Morton
2021-05-05 1:40 ` [patch 139/143] mm/process_vm_access.c: remove duplicate include Andrew Morton
` (5 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw)
To: akpm, daizhiyuan, linux-mm, mm-commits, torvalds
From: Zhiyuan Dai <daizhiyuan@phytium.com.cn>
Subject: mm/mempool: minor coding style tweaks
Various coding style tweaks to various files under mm/
[daizhiyuan@phytium.com.cn: mm/swapfile: minor coding style tweaks]
Link: https://lkml.kernel.org/r/1614223624-16055-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/sparse: minor coding style tweaks]
Link: https://lkml.kernel.org/r/1614227288-19363-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/vmscan: minor coding style tweaks]
Link: https://lkml.kernel.org/r/1614227649-19853-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/compaction: minor coding style tweaks]
Link: https://lkml.kernel.org/r/1614228218-20770-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/oom_kill: minor coding style tweaks]
Link: https://lkml.kernel.org/r/1614228360-21168-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/shmem: minor coding style tweaks]
Link: https://lkml.kernel.org/r/1614228504-21491-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/page_alloc: minor coding style tweaks]
Link: https://lkml.kernel.org/r/1614228613-21754-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/filemap: minor coding style tweaks]
Link: https://lkml.kernel.org/r/1614228936-22337-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/mlock: minor coding style tweaks]
Link: https://lkml.kernel.org/r/1613956588-2453-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/frontswap: minor coding style tweaks]
Link: https://lkml.kernel.org/r/1613962668-15045-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/vmalloc: minor coding style tweaks]
Link: https://lkml.kernel.org/r/1613963379-15988-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/memory_hotplug: minor coding style tweaks]
Link: https://lkml.kernel.org/r/1613971784-24878-1-git-send-email-daizhiyuan@phytium.com.cn
[daizhiyuan@phytium.com.cn: mm/mempolicy: minor coding style tweaks]
Link: https://lkml.kernel.org/r/1613972228-25501-1-git-send-email-daizhiyuan@phytium.com.cn
Link: https://lkml.kernel.org/r/1614222374-13805-1-git-send-email-daizhiyuan@phytium.com.cn
Signed-off-by: Zhiyuan Dai <daizhiyuan@phytium.com.cn>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/compaction.c | 2 +-
mm/filemap.c | 8 ++++----
mm/frontswap.c | 12 ++++++++----
mm/memory_hotplug.c | 2 +-
mm/mempolicy.c | 4 ++--
mm/mempool.c | 2 +-
mm/mlock.c | 4 ++--
mm/oom_kill.c | 2 +-
mm/page_alloc.c | 2 +-
mm/shmem.c | 2 +-
mm/sparse.c | 2 +-
mm/swapfile.c | 4 ++--
mm/vmalloc.c | 2 +-
mm/vmscan.c | 2 +-
14 files changed, 27 insertions(+), 23 deletions(-)
--- a/mm/compaction.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/compaction.c
@@ -2885,7 +2885,7 @@ void wakeup_kcompactd(pg_data_t *pgdat,
*/
static int kcompactd(void *p)
{
- pg_data_t *pgdat = (pg_data_t*)p;
+ pg_data_t *pgdat = (pg_data_t *)p;
struct task_struct *tsk = current;
unsigned int proactive_defer = 0;
--- a/mm/filemap.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/filemap.c
@@ -3267,7 +3267,7 @@ const struct vm_operations_struct generi
/* This is used for a general mmap of a disk file */
-int generic_file_mmap(struct file * file, struct vm_area_struct * vma)
+int generic_file_mmap(struct file *file, struct vm_area_struct *vma)
{
struct address_space *mapping = file->f_mapping;
@@ -3292,11 +3292,11 @@ vm_fault_t filemap_page_mkwrite(struct v
{
return VM_FAULT_SIGBUS;
}
-int generic_file_mmap(struct file * file, struct vm_area_struct * vma)
+int generic_file_mmap(struct file *file, struct vm_area_struct *vma)
{
return -ENOSYS;
}
-int generic_file_readonly_mmap(struct file * file, struct vm_area_struct * vma)
+int generic_file_readonly_mmap(struct file *file, struct vm_area_struct *vma)
{
return -ENOSYS;
}
@@ -3724,7 +3724,7 @@ EXPORT_SYMBOL(generic_perform_write);
ssize_t __generic_file_write_iter(struct kiocb *iocb, struct iov_iter *from)
{
struct file *file = iocb->ki_filp;
- struct address_space * mapping = file->f_mapping;
+ struct address_space *mapping = file->f_mapping;
struct inode *inode = mapping->host;
ssize_t written = 0;
ssize_t err;
--- a/mm/frontswap.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/frontswap.c
@@ -60,16 +60,20 @@ static u64 frontswap_succ_stores;
static u64 frontswap_failed_stores;
static u64 frontswap_invalidates;
-static inline void inc_frontswap_loads(void) {
+static inline void inc_frontswap_loads(void)
+{
data_race(frontswap_loads++);
}
-static inline void inc_frontswap_succ_stores(void) {
+static inline void inc_frontswap_succ_stores(void)
+{
data_race(frontswap_succ_stores++);
}
-static inline void inc_frontswap_failed_stores(void) {
+static inline void inc_frontswap_failed_stores(void)
+{
data_race(frontswap_failed_stores++);
}
-static inline void inc_frontswap_invalidates(void) {
+static inline void inc_frontswap_invalidates(void)
+{
data_race(frontswap_invalidates++);
}
#else
--- a/mm/memory_hotplug.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/memory_hotplug.c
@@ -834,7 +834,7 @@ static inline struct zone *default_zone_
return movable_node_enabled ? movable_zone : kernel_zone;
}
-struct zone * zone_for_pfn_range(int online_type, int nid, unsigned start_pfn,
+struct zone *zone_for_pfn_range(int online_type, int nid, unsigned start_pfn,
unsigned long nr_pages)
{
if (online_type == MMOP_ONLINE_KERNEL)
--- a/mm/mempolicy.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/mempolicy.c
@@ -330,7 +330,7 @@ static void mpol_rebind_nodemask(struct
else if (pol->flags & MPOL_F_RELATIVE_NODES)
mpol_relative_nodemask(&tmp, &pol->w.user_nodemask, nodes);
else {
- nodes_remap(tmp, pol->v.nodes,pol->w.cpuset_mems_allowed,
+ nodes_remap(tmp, pol->v.nodes, pol->w.cpuset_mems_allowed,
*nodes);
pol->w.cpuset_mems_allowed = *nodes;
}
@@ -1161,7 +1161,7 @@ int do_migrate_pages(struct mm_struct *m
tmp = *from;
while (!nodes_empty(tmp)) {
- int s,d;
+ int s, d;
int source = NUMA_NO_NODE;
int dest = 0;
--- a/mm/mempool.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/mempool.c
@@ -251,7 +251,7 @@ EXPORT_SYMBOL(mempool_init);
mempool_t *mempool_create(int min_nr, mempool_alloc_t *alloc_fn,
mempool_free_t *free_fn, void *pool_data)
{
- return mempool_create_node(min_nr,alloc_fn,free_fn, pool_data,
+ return mempool_create_node(min_nr, alloc_fn, free_fn, pool_data,
GFP_KERNEL, NUMA_NO_NODE);
}
EXPORT_SYMBOL(mempool_create);
--- a/mm/mlock.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/mlock.c
@@ -559,7 +559,7 @@ static int apply_vma_lock_flags(unsigned
vm_flags_t flags)
{
unsigned long nstart, end, tmp;
- struct vm_area_struct * vma, * prev;
+ struct vm_area_struct *vma, *prev;
int error;
VM_BUG_ON(offset_in_page(start));
@@ -737,7 +737,7 @@ SYSCALL_DEFINE2(munlock, unsigned long,
*/
static int apply_mlockall_flags(int flags)
{
- struct vm_area_struct * vma, * prev = NULL;
+ struct vm_area_struct *vma, *prev = NULL;
vm_flags_t to_add = 0;
current->mm->def_flags &= VM_LOCKED_CLEAR_MASK;
--- a/mm/oom_kill.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/oom_kill.c
@@ -993,7 +993,7 @@ static void oom_kill_process(struct oom_
if (oom_group) {
mem_cgroup_print_oom_group(oom_group);
mem_cgroup_scan_tasks(oom_group, oom_kill_memcg_member,
- (void*)message);
+ (void *)message);
mem_cgroup_put(oom_group);
}
}
--- a/mm/page_alloc.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/page_alloc.c
@@ -8808,7 +8808,7 @@ int alloc_contig_range(unsigned long sta
ret = __alloc_contig_migrate_range(&cc, start, end);
if (ret && ret != -EBUSY)
goto done;
- ret =0;
+ ret = 0;
/*
* Pages from [start, end) are within a MAX_ORDER_NR_PAGES
--- a/mm/shmem.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/shmem.c
@@ -3508,7 +3508,7 @@ static int shmem_parse_options(struct fs
}
}
if (*this_char) {
- char *value = strchr(this_char,'=');
+ char *value = strchr(this_char, '=');
size_t len = 0;
int err;
--- a/mm/sparse.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/sparse.c
@@ -257,7 +257,7 @@ static void __init memory_present(int ni
if (unlikely(!mem_section)) {
unsigned long size, align;
- size = sizeof(struct mem_section*) * NR_SECTION_ROOTS;
+ size = sizeof(struct mem_section *) * NR_SECTION_ROOTS;
align = 1 << (INTERNODE_CACHE_SHIFT);
mem_section = memblock_alloc(size, align);
if (!mem_section)
--- a/mm/swapfile.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/swapfile.c
@@ -2780,7 +2780,7 @@ static int swap_show(struct seq_file *sw
unsigned int bytes, inuse;
if (si == SEQ_START_TOKEN) {
- seq_puts(swap,"Filename\t\t\t\tType\t\tSize\t\tUsed\t\tPriority\n");
+ seq_puts(swap, "Filename\t\t\t\tType\t\tSize\t\tUsed\t\tPriority\n");
return 0;
}
@@ -3284,7 +3284,7 @@ SYSCALL_DEFINE2(swapon, const char __use
sizeof(long),
GFP_KERNEL);
- if (p->bdev &&(swap_flags & SWAP_FLAG_DISCARD) && swap_discardable(p)) {
+ if (p->bdev && (swap_flags & SWAP_FLAG_DISCARD) && swap_discardable(p)) {
/*
* When discard is enabled for swap with no particular
* policy flagged, we set all swap discard flags here in
--- a/mm/vmalloc.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/vmalloc.c
@@ -3083,7 +3083,7 @@ EXPORT_SYMBOL(vzalloc_node);
* 64b systems should always have either DMA or DMA32 zones. For others
* GFP_DMA32 should do the right thing and use the normal zone.
*/
-#define GFP_VMALLOC32 GFP_DMA32 | GFP_KERNEL
+#define GFP_VMALLOC32 (GFP_DMA32 | GFP_KERNEL)
#endif
/**
--- a/mm/vmscan.c~mm-mempool-minor-coding-style-tweaks
+++ a/mm/vmscan.c
@@ -4059,7 +4059,7 @@ static int kswapd(void *p)
{
unsigned int alloc_order, reclaim_order;
unsigned int highest_zoneidx = MAX_NR_ZONES - 1;
- pg_data_t *pgdat = (pg_data_t*)p;
+ pg_data_t *pgdat = (pg_data_t *)p;
struct task_struct *tsk = current;
const struct cpumask *cpumask = cpumask_of_node(pgdat->node_id);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 139/143] mm/process_vm_access.c: remove duplicate include
2021-05-05 1:32 incoming Andrew Morton
` (134 preceding siblings ...)
2021-05-05 1:40 ` [patch 138/143] mm/mempool: minor coding style tweaks Andrew Morton
@ 2021-05-05 1:40 ` Andrew Morton
2021-05-05 1:40 ` [patch 140/143] kfence: zero guard page after out-of-bounds access Andrew Morton
` (4 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw)
To: akpm, linux-mm, mm-commits, torvalds, zhang.yunkai
From: Zhang Yunkai <zhang.yunkai@zte.com.cn>
Subject: mm/process_vm_access.c: remove duplicate include
'linux/compat.h' included in 'process_vm_access.c' is duplicated.
Link: https://lkml.kernel.org/r/20210306132122.220431-1-zhang.yunkai@zte.com.cn
Signed-off-by: Zhang Yunkai <zhang.yunkai@zte.com.cn>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/process_vm_access.c | 1 -
1 file changed, 1 deletion(-)
--- a/mm/process_vm_access.c~mm-process_vm_access-remove-duplicate-include
+++ a/mm/process_vm_access.c
@@ -9,7 +9,6 @@
#include <linux/mm.h>
#include <linux/uio.h>
#include <linux/sched.h>
-#include <linux/compat.h>
#include <linux/sched/mm.h>
#include <linux/highmem.h>
#include <linux/ptrace.h>
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 140/143] kfence: zero guard page after out-of-bounds access
2021-05-05 1:32 incoming Andrew Morton
` (135 preceding siblings ...)
2021-05-05 1:40 ` [patch 139/143] mm/process_vm_access.c: remove duplicate include Andrew Morton
@ 2021-05-05 1:40 ` Andrew Morton
2021-05-05 1:40 ` [patch 141/143] kfence: await for allocation using wait_event Andrew Morton
` (3 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw)
To: akpm, andreyknvl, dvyukov, elver, glider, jannh, linux-mm,
mm-commits, torvalds
From: Marco Elver <elver@google.com>
Subject: kfence: zero guard page after out-of-bounds access
After an out-of-bounds accesses, zero the guard page before re-protecting
in kfence_guarded_free(). On one hand this helps make the failure mode of
subsequent out-of-bounds accesses more deterministic, but could also
prevent certain information leaks.
Link: https://lkml.kernel.org/r/20210312121653.348518-1-elver@google.com
Signed-off-by: Marco Elver <elver@google.com>
Acked-by: Alexander Potapenko <glider@google.com>
Cc: Dmitry Vyukov <dvyukov@google.com>
Cc: Andrey Konovalov <andreyknvl@google.com>
Cc: Jann Horn <jannh@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/kfence/core.c | 1 +
1 file changed, 1 insertion(+)
--- a/mm/kfence/core.c~kfence-zero-guard-page-after-out-of-bounds-access
+++ a/mm/kfence/core.c
@@ -372,6 +372,7 @@ static void kfence_guarded_free(void *ad
/* Restore page protection if there was an OOB access. */
if (meta->unprotected_page) {
+ memzero_explicit((void *)ALIGN_DOWN(meta->unprotected_page, PAGE_SIZE), PAGE_SIZE);
kfence_protect(meta->unprotected_page);
meta->unprotected_page = 0;
}
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 141/143] kfence: await for allocation using wait_event
2021-05-05 1:32 incoming Andrew Morton
` (136 preceding siblings ...)
2021-05-05 1:40 ` [patch 140/143] kfence: zero guard page after out-of-bounds access Andrew Morton
@ 2021-05-05 1:40 ` Andrew Morton
2021-05-05 1:40 ` [patch 142/143] kfence: maximize allocation wait timeout duration Andrew Morton
` (2 subsequent siblings)
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw)
To: akpm, dvyukov, elver, glider, hdanton, jannh, linux-mm,
mark.rutland, mm-commits, torvalds
From: Marco Elver <elver@google.com>
Subject: kfence: await for allocation using wait_event
Patch series "kfence: optimize timer scheduling", v2.
We have observed that mostly-idle systems with KFENCE enabled wake up
otherwise idle CPUs, preventing such to enter a lower power state.
Debugging revealed that KFENCE spends too much active time in
toggle_allocation_gate().
While the first version of KFENCE was using all the right bits to be
scheduling optimal, and thus power efficient, by simply using wait_event()
+ wake_up(), that code was unfortunately removed.
As KFENCE was exposed to various different configs and tests, the
scheduling optimal code slowly disappeared. First because of hung task
warnings, and finally because of deadlocks when an allocation is made by
timer code with debug objects enabled. Clearly, the "fixes" were not too
friendly for devices that want to be power efficient.
Therefore, let's try a little harder to fix the hung task and deadlock
problems that we have with wait_event() + wake_up(), while remaining as
scheduling friendly and power efficient as possible.
Crucially, we need to defer the wake_up() to an irq_work, avoiding any
potential for deadlock.
The result with this series is that on the devices where we observed a
power regression, power usage returns back to baseline levels.
This patch (of 3):
On mostly-idle systems, we have observed that toggle_allocation_gate() is
a cause of frequent wake-ups, preventing an otherwise idle CPU to go into
a lower power state.
A late change in KFENCE's development, due to a potential deadlock [1],
required changing the scheduling-friendly wait_event_timeout() and
wake_up() to an open-coded wait-loop using schedule_timeout(). [1]
https://lkml.kernel.org/r/000000000000c0645805b7f982e4@google.com
To avoid unnecessary wake-ups, switch to using wait_event_timeout().
Unfortunately, we still cannot use a version with direct wake_up() in
__kfence_alloc() due to the same potential for deadlock as in [1].
Instead, add a level of indirection via an irq_work that is scheduled if
we determine that the kfence_timer requires a wake_up().
Link: https://lkml.kernel.org/r/20210421105132.3965998-1-elver@google.com
Link: https://lkml.kernel.org/r/20210421105132.3965998-2-elver@google.com
Fixes: 0ce20dd84089 ("mm: add Kernel Electric-Fence infrastructure")
Signed-off-by: Marco Elver <elver@google.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Dmitry Vyukov <dvyukov@google.com>
Cc: Jann Horn <jannh@google.com>
Cc: Mark Rutland <mark.rutland@arm.com>
Cc: Hillf Danton <hdanton@sina.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
lib/Kconfig.kfence | 1 +
mm/kfence/core.c | 43 ++++++++++++++++++++++++++++---------------
2 files changed, 29 insertions(+), 15 deletions(-)
--- a/lib/Kconfig.kfence~kfence-await-for-allocation-using-wait_event
+++ a/lib/Kconfig.kfence
@@ -7,6 +7,7 @@ menuconfig KFENCE
bool "KFENCE: low-overhead sampling-based memory safety error detector"
depends on HAVE_ARCH_KFENCE && (SLAB || SLUB)
select STACKTRACE
+ select IRQ_WORK
help
KFENCE is a low-overhead sampling-based detector of heap out-of-bounds
access, use-after-free, and invalid-free errors. KFENCE is designed
--- a/mm/kfence/core.c~kfence-await-for-allocation-using-wait_event
+++ a/mm/kfence/core.c
@@ -10,6 +10,7 @@
#include <linux/atomic.h>
#include <linux/bug.h>
#include <linux/debugfs.h>
+#include <linux/irq_work.h>
#include <linux/kcsan-checks.h>
#include <linux/kfence.h>
#include <linux/kmemleak.h>
@@ -587,6 +588,17 @@ late_initcall(kfence_debugfs_init);
/* === Allocation Gate Timer ================================================ */
+#ifdef CONFIG_KFENCE_STATIC_KEYS
+/* Wait queue to wake up allocation-gate timer task. */
+static DECLARE_WAIT_QUEUE_HEAD(allocation_wait);
+
+static void wake_up_kfence_timer(struct irq_work *work)
+{
+ wake_up(&allocation_wait);
+}
+static DEFINE_IRQ_WORK(wake_up_kfence_timer_work, wake_up_kfence_timer);
+#endif
+
/*
* Set up delayed work, which will enable and disable the static key. We need to
* use a work queue (rather than a simple timer), since enabling and disabling a
@@ -604,25 +616,13 @@ static void toggle_allocation_gate(struc
if (!READ_ONCE(kfence_enabled))
return;
- /* Enable static key, and await allocation to happen. */
atomic_set(&kfence_allocation_gate, 0);
#ifdef CONFIG_KFENCE_STATIC_KEYS
+ /* Enable static key, and await allocation to happen. */
static_branch_enable(&kfence_allocation_key);
- /*
- * Await an allocation. Timeout after 1 second, in case the kernel stops
- * doing allocations, to avoid stalling this worker task for too long.
- */
- {
- unsigned long end_wait = jiffies + HZ;
- do {
- set_current_state(TASK_UNINTERRUPTIBLE);
- if (atomic_read(&kfence_allocation_gate) != 0)
- break;
- schedule_timeout(1);
- } while (time_before(jiffies, end_wait));
- __set_current_state(TASK_RUNNING);
- }
+ wait_event_timeout(allocation_wait, atomic_read(&kfence_allocation_gate), HZ);
+
/* Disable static key and reset timer. */
static_branch_disable(&kfence_allocation_key);
#endif
@@ -729,6 +729,19 @@ void *__kfence_alloc(struct kmem_cache *
*/
if (atomic_read(&kfence_allocation_gate) || atomic_inc_return(&kfence_allocation_gate) > 1)
return NULL;
+#ifdef CONFIG_KFENCE_STATIC_KEYS
+ /*
+ * waitqueue_active() is fully ordered after the update of
+ * kfence_allocation_gate per atomic_inc_return().
+ */
+ if (waitqueue_active(&allocation_wait)) {
+ /*
+ * Calling wake_up() here may deadlock when allocations happen
+ * from within timer code. Use an irq_work to defer it.
+ */
+ irq_work_queue(&wake_up_kfence_timer_work);
+ }
+#endif
if (!READ_ONCE(kfence_enabled))
return NULL;
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 142/143] kfence: maximize allocation wait timeout duration
2021-05-05 1:32 incoming Andrew Morton
` (137 preceding siblings ...)
2021-05-05 1:40 ` [patch 141/143] kfence: await for allocation using wait_event Andrew Morton
@ 2021-05-05 1:40 ` Andrew Morton
2021-05-05 1:40 ` [patch 143/143] kfence: use power-efficient work queue to run delayed work Andrew Morton
2021-05-05 1:47 ` incoming Linus Torvalds
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw)
To: akpm, dvyukov, elver, glider, hdanton, jannh, linux-mm,
mark.rutland, mm-commits, torvalds
From: Marco Elver <elver@google.com>
Subject: kfence: maximize allocation wait timeout duration
The allocation wait timeout was initially added because of warnings due to
CONFIG_DETECT_HUNG_TASK=y [1]. While the 1 sec timeout is sufficient to
resolve the warnings (given the hung task timeout must be 1 sec or larger)
it may cause unnecessary wake-ups if the system is idle. [1]
https://lkml.kernel.org/r/CADYN=9J0DQhizAGB0-jz4HOBBh+05kMBXb4c0cXMS7Qi5NAJiw@mail.gmail.com
Fix it by computing the timeout duration in terms of the current
sysctl_hung_task_timeout_secs value.
Link: https://lkml.kernel.org/r/20210421105132.3965998-3-elver@google.com
Signed-off-by: Marco Elver <elver@google.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Dmitry Vyukov <dvyukov@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: Jann Horn <jannh@google.com>
Cc: Mark Rutland <mark.rutland@arm.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/kfence/core.c | 12 +++++++++++-
1 file changed, 11 insertions(+), 1 deletion(-)
--- a/mm/kfence/core.c~kfence-maximize-allocation-wait-timeout-duration
+++ a/mm/kfence/core.c
@@ -20,6 +20,7 @@
#include <linux/moduleparam.h>
#include <linux/random.h>
#include <linux/rcupdate.h>
+#include <linux/sched/sysctl.h>
#include <linux/seq_file.h>
#include <linux/slab.h>
#include <linux/spinlock.h>
@@ -621,7 +622,16 @@ static void toggle_allocation_gate(struc
/* Enable static key, and await allocation to happen. */
static_branch_enable(&kfence_allocation_key);
- wait_event_timeout(allocation_wait, atomic_read(&kfence_allocation_gate), HZ);
+ if (sysctl_hung_task_timeout_secs) {
+ /*
+ * During low activity with no allocations we might wait a
+ * while; let's avoid the hung task warning.
+ */
+ wait_event_timeout(allocation_wait, atomic_read(&kfence_allocation_gate),
+ sysctl_hung_task_timeout_secs * HZ / 2);
+ } else {
+ wait_event(allocation_wait, atomic_read(&kfence_allocation_gate));
+ }
/* Disable static key and reset timer. */
static_branch_disable(&kfence_allocation_key);
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* [patch 143/143] kfence: use power-efficient work queue to run delayed work
2021-05-05 1:32 incoming Andrew Morton
` (138 preceding siblings ...)
2021-05-05 1:40 ` [patch 142/143] kfence: maximize allocation wait timeout duration Andrew Morton
@ 2021-05-05 1:40 ` Andrew Morton
2021-05-05 1:47 ` incoming Linus Torvalds
140 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 1:40 UTC (permalink / raw)
To: akpm, dvyukov, elver, glider, hdanton, jannh, linux-mm,
mark.rutland, mm-commits, torvalds
From: Marco Elver <elver@google.com>
Subject: kfence: use power-efficient work queue to run delayed work
Use the power-efficient work queue, to avoid the pathological case where
we keep pinning ourselves on the same possibly idle CPU on systems that
want to be power-efficient (https://lwn.net/Articles/731052/).
Link: https://lkml.kernel.org/r/20210421105132.3965998-4-elver@google.com
Signed-off-by: Marco Elver <elver@google.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Dmitry Vyukov <dvyukov@google.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: Jann Horn <jannh@google.com>
Cc: Mark Rutland <mark.rutland@arm.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/kfence/core.c | 5 +++--
1 file changed, 3 insertions(+), 2 deletions(-)
--- a/mm/kfence/core.c~kfence-use-power-efficient-work-queue-to-run-delayed-work
+++ a/mm/kfence/core.c
@@ -636,7 +636,8 @@ static void toggle_allocation_gate(struc
/* Disable static key and reset timer. */
static_branch_disable(&kfence_allocation_key);
#endif
- schedule_delayed_work(&kfence_timer, msecs_to_jiffies(kfence_sample_interval));
+ queue_delayed_work(system_power_efficient_wq, &kfence_timer,
+ msecs_to_jiffies(kfence_sample_interval));
}
static DECLARE_DELAYED_WORK(kfence_timer, toggle_allocation_gate);
@@ -665,7 +666,7 @@ void __init kfence_init(void)
}
WRITE_ONCE(kfence_enabled, true);
- schedule_delayed_work(&kfence_timer, 0);
+ queue_delayed_work(system_power_efficient_wq, &kfence_timer, 0);
pr_info("initialized - using %lu bytes for %d objects at 0x%p-0x%p\n", KFENCE_POOL_SIZE,
CONFIG_KFENCE_NUM_OBJECTS, (void *)__kfence_pool,
(void *)(__kfence_pool + KFENCE_POOL_SIZE));
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-05-05 1:32 incoming Andrew Morton
` (139 preceding siblings ...)
2021-05-05 1:40 ` [patch 143/143] kfence: use power-efficient work queue to run delayed work Andrew Morton
@ 2021-05-05 1:47 ` Linus Torvalds
2021-05-05 3:16 ` incoming Andrew Morton
140 siblings, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2021-05-05 1:47 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 143 patches
Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.
Maybe just some mail delay? But at least right now
https://lore.kernel.org/mm-commits/
doesn't show them (and thus 'b4' doesn't work).
I'll check again later.
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-05-05 1:47 ` incoming Linus Torvalds
@ 2021-05-05 3:16 ` Andrew Morton
2021-05-05 17:10 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 3:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Linux-MM, mm-commits
On Tue, 4 May 2021 18:47:19 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 143 patches
>
> Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.
>
> Maybe just some mail delay? But at least right now
>
> https://lore.kernel.org/mm-commits/
>
> doesn't show them (and thus 'b4' doesn't work).
>
> I'll check again later.
>
Well that's strange. I see all three via cc:me, but not on linux-mm or
mm-commits.
Let me resend right now with the same in-reply-to. Hopefully they will
land in the correct place.
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-05-05 3:16 ` incoming Andrew Morton
@ 2021-05-05 17:10 ` Linus Torvalds
2021-05-05 17:44 ` incoming Andrew Morton
0 siblings, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2021-05-05 17:10 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits
On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> Let me resend right now with the same in-reply-to. Hopefully they will
> land in the correct place.
Well, you re-sent it twice, and I have three copies in my own mailbox,
bot they still don't show up on the mm-commits mailing list.
So the list hates them for some odd reason.
I've picked them up locally, but adding Konstantin to the participants
to see if he can see what's up.
Konstantin: patches 103/106/107 are missing on lore out of Andrew's
series of 143. Odd.
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-05-05 17:10 ` incoming Linus Torvalds
@ 2021-05-05 17:44 ` Andrew Morton
2021-05-06 3:19 ` incoming Anshuman Khandual
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2021-05-05 17:44 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits
[-- Attachment #1: Type: text/plain, Size: 1387 bytes --]
On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > Let me resend right now with the same in-reply-to. Hopefully they will
> > land in the correct place.
>
> Well, you re-sent it twice, and I have three copies in my own mailbox,
> bot they still don't show up on the mm-commits mailing list.
>
> So the list hates them for some odd reason.
>
> I've picked them up locally, but adding Konstantin to the participants
> to see if he can see what's up.
>
> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
> series of 143. Odd.
It's weird. They don't turn up on linux-mm either, and that's running
at kvack.org, also majordomo. They don't get through when sent with
either heirloom-mailx or with sylpheed.
Also, it seems that when Anshuman originally sent the patch, linux-mm
and linux-kernel didn't send it back out. So perhaps a spam filter
triggered?
I'm seeing
https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/
which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
server massacred that patch series. Searching
https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
email series.
One of the emails (as sent my me) is attached, if that helps.
[-- Attachment #2: x.txt --]
[-- Type: text/plain, Size: 21048 bytes --]
Return-Path: <akpm@linux-foundation.org>
X-Spam-Checker-Version: SpamAssassin 3.4.1 (2015-04-28) on y
X-Spam-Level: (none)
X-Spam-Status: No, score=-101.5 required=2.5 tests=BAYES_00,T_DKIM_INVALID,
USER_IN_WHITELIST autolearn=ham autolearn_force=no version=3.4.1
Received: from localhost.localdomain (localhost.localdomain [127.0.0.1])
by localhost.localdomain (8.15.2/8.15.2/Debian-8ubuntu1) with ESMTP id 1453H2fk032202
for <akpm@localhost>; Tue, 4 May 2021 20:17:03 -0700
Received: from imap.fastmail.com [66.111.4.135]
by localhost.localdomain with IMAP (fetchmail-6.3.26)
for <akpm@localhost> (single-drop); Tue, 04 May 2021 20:17:03 -0700 (PDT)
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
by sloti11d1t06 (Cyrus 3.5.0-alpha0-442-g5daca166b9-fm-20210428.001-g5daca166) with LMTPA;
Tue, 04 May 2021 23:16:31 -0400
X-Cyrus-Session-Id: sloti11d1t06-1620184591-1699471-2-6359664467419938249
X-Sieve: CMU Sieve 3.0
X-Resolved-to: akpm@mbx.kernel.org
X-Delivered-to: akpm@mbx.kernel.org
X-Mail-from: akpm@linux-foundation.org
Received: from mx6 ([10.202.2.205])
by compute1.internal (LMTPProxy); Tue, 04 May 2021 23:16:31 -0400
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
by mailmx.nyi.internal (Postfix) with ESMTP id 40796C800E1
for <akpm@mbx.kernel.org>; Tue, 4 May 2021 23:16:31 -0400 (EDT)
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
by mx6.messagingengine.com (Authentication Milter) with ESMTP
id 14870833D7F;
Tue, 4 May 2021 23:16:31 -0400
ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=messagingengine.com; s=fm2; t=
1620184591; b=FBo7Gf3JFN+4QYg5Byan0oNm6RESv+sIf5HcaslVNsUd9SOTGS
yI0+IsXr1CUpGH783hE6fmgEq9SyfOwQVZjdikLaJS1+7u0JtfAYQFU3RORCtXlr
djJWrScfjVa8nAHX4rQCtzvtPYuzx5w7cTgGgeILgoJMxgLj7EC9xcT8BIf68+9W
Lw+ohAmcuiKhL2ez+de4SMuwdh3dh2FwAIHQOsSjEU1/NV+WGxMLwYbxWgTrqQGH
RQIzFNdq30qslW9huK47+e80uHOX2tXwxtshwbThFEn458bdV5LL6Y8Oh4ZWMbv1
tFgTt515DVedonZknxc07XsXtAjaJyB8bfHw==
ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d=
messagingengine.com; h=date:from:to:subject:message-id
:in-reply-to; s=fm2; t=1620184591; bh=LuH7mbm3+zp863vKBEqKeoZtnp
uFxYpIb5oTVwf56Es=; b=m5E1fbz2b+an/X406oY3BuG0Zm4/W05vWAki8Lsnud
gPCc1LfPUFSuXaMppcEDPbLKprp4hH3T52itK4pivXMQCLEOyme7kVStaLMVTiky
Xxqh5ZdhOWvygBfda/GjfuLBSbbj2gfm8HPKpbL7CA5foelknIBhJHDzGkJyxetZ
YagZfVvtdo2OEwnC1mmjUCpKPO5+m5kaZO0ol6rPdl+TV0MKGhjLg+/i6Ia+0nFp
zDwV4VeACvVcGb2xY7KG5Z+BtqVxeVFn+w5JcqpWUtxEKoSBR4bWARzjwHg6eouh
7psOOKPTt/NzDKk+3f49lso5KlPiTF2xEU/+5SIttCkQ==
ARC-Authentication-Results: i=2; mx6.messagingengine.com;
arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
smtp.remote-ip=209.85.215.198;
bimi=skipped (DMARC did not pass);
dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
header.s=korg x-bits=1024;
dmarc=none policy.published-domain-policy=none
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,d=none,d.eval=none) policy.policy-from=p
header.from=linux-foundation.org;
iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
spf=pass smtp.mailfrom=akpm@linux-foundation.org
smtp.helo=mail-pg1-f198.google.com;
x-aligned-from=pass (Address match);
x-arc-spf=pass
(google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
x-arc-domain=google.com (Trusted from aar.1.google.com);
x-csa=none;
x-google-dkim=fail (message has been altered, 2048-bit rsa key)
header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
x-me-sender=none;
x-ptr=pass smtp.helo=mail-pg1-f198.google.com
policy.ptr=mail-pg1-f198.google.com;
x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
(MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
(MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
smtp.bits=256/256;
x-vs=clean score=40 state=0
Authentication-Results: mx6.messagingengine.com;
arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
smtp.remote-ip=209.85.215.198;
bimi=skipped (DMARC did not pass);
dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
header.s=korg x-bits=1024;
dmarc=none policy.published-domain-policy=none
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,d=none,d.eval=none) policy.policy-from=p
header.from=linux-foundation.org;
iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
spf=pass smtp.mailfrom=akpm@linux-foundation.org
smtp.helo=mail-pg1-f198.google.com;
x-aligned-from=pass (Address match);
x-arc-spf=pass
(google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
x-arc-domain=google.com (Trusted from aar.1.google.com);
x-csa=none;
x-google-dkim=fail (message has been altered, 2048-bit rsa key)
header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
x-me-sender=none;
x-ptr=pass smtp.helo=mail-pg1-f198.google.com
policy.ptr=mail-pg1-f198.google.com;
x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
(MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
(MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
smtp.bits=256/256;
x-vs=clean score=40 state=0
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrvdefjedgieegucetufdoteggodetrfdotf
fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu
rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucgoufhorhhtvggutfgvtg
hiphdvucdlgedtmdenucfjughrpeffhffvuffkjggfsedttdertddtredtnecuhfhrohhm
peetnhgurhgvficuofhorhhtohhnuceorghkphhmsehlihhnuhigqdhfohhunhgurghtih
honhdrohhrgheqnecuggftrfgrthhtvghrnhepjeevfeduveffvddvudetkefhgeduveeu
geevvdfhhfevhfekkedtieefgfduheeinecuffhomhgrihhnpehkvghrnhgvlhdrohhrgh
enucfkphepvddtledrkeehrddvudehrdduleekpdduleekrddugeehrddvledrleelnecu
uegrugftvghpuhhtkfhppeduleekrddugeehrddvledrleelnecuvehluhhsthgvrhfuih
iivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudehrdduleekpdhhvghl
ohepmhgrihhlqdhpghduqdhfudelkedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomh
epoegrkhhpmheslhhinhhugidqfhhouhhnuggrthhiohhnrdhorhhgqe
X-ME-VSScore: 40
X-ME-VSCategory: clean
X-ME-CSA: none
Received-SPF: pass
(linux-foundation.org: Sender is authorized to use 'akpm@linux-foundation.org' in 'mfrom' identity (mechanism 'include:_spf.google.com' matched))
receiver=mx6.messagingengine.com;
identity=mailfrom;
envelope-from="akpm@linux-foundation.org";
helo=mail-pg1-f198.google.com;
client-ip=209.85.215.198
Received: from mail-pg1-f198.google.com (mail-pg1-f198.google.com [209.85.215.198])
(using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)
key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256)
(No client certificate requested)
by mx6.messagingengine.com (Postfix) with ESMTPS
for <akpm@mbx.kernel.org>; Tue, 4 May 2021 23:16:31 -0400 (EDT)
Received: by mail-pg1-f198.google.com with SMTP id g5-20020a63f4050000b02901f6c7b9a6d0so593624pgi.5
for <akpm@mbx.kernel.org>; Tue, 04 May 2021 20:16:30 -0700 (PDT)
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=1e100.net; s=20161025;
h=x-gm-message-state:dkim-signature:date:from:to:subject:message-id
:in-reply-to:user-agent;
bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
b=VZuDOxUfeHXJz1/CiFfcxuMVHkmW5RznvqYS+Py8Ub6nHHXprQJGE9Ze3WgH+1ylSe
NJLEC7xgv15SR9A+e/MT4RTj3OVOwtd1Zi2vPav39a9K4tP+2uL2Ei+5d7FtT3LLZsjo
feek/DqCGSkJ/EC5woLyU9BBkfLUuQ9/2HiDCk10BMetEfWdor69Slb39NOXES8br02X
25Btabu9ZCWroyjQj7W5gwGr5Z6Hs2nbnnfAb+e92FalcUD/4ql77lNzRcWGi4/9TT8s
ntqI2g46Xv+k5LURaRH5CRBpxkkKgzcrioRPYFUHkEgOEWy1hPzg9QPk8ZO35Xm9R9d2
vl3Q==
X-Gm-Message-State: AOAM531IlYUTVWcMrsTunnxZWB7SKeeOmoZj5mZ1A5tl7N/JlZUueN8L
tvyRKnvxHr6a5mDaGHN9Tb1N/iCzT0U5oQgRVTxTnj1qFGibRa9+leLQNKX0aGlNg9JiaMfromb
xyOlCUpVXOlVvchuwTUSTn7rXum+Hh3PWQZm5II/EX+0AkzKqez62Z8U=
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203271pjq.53.1620184589161;
Tue, 04 May 2021 20:16:29 -0700 (PDT)
X-Google-Smtp-Source: ABdhPJxffoGdRqAjUagWoMVD5p/Lk1KTEDftEhkWh8ewatgDmZLlxh0lO1hxYIdYYwoO5dsJ/i0z
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203198pjq.53.1620184588109;
Tue, 04 May 2021 20:16:28 -0700 (PDT)
ARC-Seal: i=1; a=rsa-sha256; t=1620184588; cv=none;
d=google.com; s=arc-20160816;
b=Fr2b2AMXJr6OeNpSql45tq1korkuDOunp7t+DpARuEBnwvQnKfagyipQ93jywsRf/c
/i/mP2eTmJwOLWNORClh1MGF/0VfBx1ULoB9W4CI3LpVgGFXGGFis8LTcvUYD5yvhlsV
50rm2j34iS9lyo04FB/hbhGkwLtUhz2PGkLGuqHspTd+pUpUCf5SLxGJbZC5uCcUEsbO
8WSDBWyvaCPjFzJQZK60gK70ticKW+fCG1xHtOG4qsFCbqEpFKBy8eVK83OBazo/dQDr
DOheWNWyw2o/WMP4GpZMvZuj30dx3j8xnBahIpnMIQJaog6wLMcVX9pkQ8UJym3/PGNm
pO/g==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816;
h=user-agent:in-reply-to:message-id:subject:to:from:date
:dkim-signature;
bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
b=vVN16NPMKjoxSJQ6b36VXFCkZqnmG7wABfilgE069txZqmHpEMyZb8lRStkHy557LM
Kn7UfJFP3xwsP8ZTCipVDZ6tpFW/hYFU9o4th9G8asWs+MOf9xpWX2LQZ1FTmaao2Fg5
uCHypz39cnAh0Z1EJfNsTcaTGIrkbBd6zje+mtBgs8hnfH8HcWBYTPCHCCx950Z928tb
XOPd/Igs7yzD1ioBiGXZj/ciwPbWVTaZXBg4JOZSApxkDMfuMyfyLLOs++EVkyxJHUme
TmgwvLkixcwEtKF7gIeqEhwvOUSVvilLuJLFVaLumwTcjJ1amVfGcJhBE7LIM9C3SMpA
rOOg==
ARC-Authentication-Results: i=1; mx.google.com;
dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: from mail.kernel.org (mail.kernel.org. [198.145.29.99])
by mx.google.com with ESMTPS id c85si20173199pfb.8.2021.05.04.20.16.27
(version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128);
Tue, 04 May 2021 20:16:28 -0700 (PDT)
Received-SPF: pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) client-ip=198.145.29.99;
Authentication-Results: mx.google.com;
dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: by mail.kernel.org (Postfix) with ESMTPSA id A4DB4610D2;
Wed, 5 May 2021 03:16:26 +0000 (UTC)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=linux-foundation.org;
s=korg; t=1620184587;
bh=TxN4wgKcKf2UUem+5pL09m9GL/7U592mEalo2U6vwAU=;
h=Date:From:To:Subject:In-Reply-To:From;
b=Gdz/3wY9ktH3hOmn2DAOkfh0JXwPdMJ8xsNQFa9eI25K39Z3iHdRGo9jX3QtMDtog
D4Zakt52CQCYsV91c9oCai8KnCTkkAjJq/Ez7p8UHpz97Go3yYYxqg6DDl6d8HCQvN
H47dTaZAgeH2sw29bjB9fRzNuTx7k4RAPlqZIpiE=
Date: Tue, 04 May 2021 20:16:26 -0700
From: Andrew Morton <akpm@linux-foundation.org>
To: akpm@linux-foundation.org, anshuman.khandual@arm.com, aou@eecs.berkeley.edu, arnd@arndb.de, benh@kernel.crashing.org, borntraeger@de.ibm.com, bp@alien8.de, catalin.marinas@arm.com, dalias@libc.org, deller@gmx.de, gor@linux.ibm.com, hca@linux.ibm.com, hpa@zytor.com, James.Bottomley@HansenPartnership.com, linux-mm@kvack.org, linux@armlinux.org.uk, mingo@redhat.com, mm-commits@vger.kernel.org, mpe@ellerman.id.au, palmerdabbelt@google.com, paul.walmsley@sifive.com, paulus@samba.org, tglx@linutronix.de, torvalds@linux-foundation.org, tsbogend@alpha.franken.de, vgupta@synopsys.com, viro@zeniv.linux.org.uk, will@kernel.org, ysato@users.osdn.me
Subject: [patch 103/143] mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
Message-ID: <20210505031626.c8o4WL7KE%akpm@linux-foundation.org>
In-Reply-To: <20210504183219.a3cc46aee4013d77402276c5@linux-foundation.org>
User-Agent: s-nail v14.8.16
X-Gm-Original-To: akpm@linux-foundation.org
From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
SYS_SUPPORTS_HUGETLBFS config has duplicate definitions on platforms that
subscribe it. Instead, just make it a generic option which can be
selected on applicable platforms. Also rename it as
ARCH_SUPPORTS_HUGETLBFS instead. This reduces code duplication and makes
it cleaner.
Link: https://lkml.kernel.org/r/1617259448-22529-3-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com> [arm64]
Acked-by: Palmer Dabbelt <palmerdabbelt@google.com> [riscv]
Acked-by: Michael Ellerman <mpe@ellerman.id.au> [powerpc]
Cc: Russell King <linux@armlinux.org.uk>
Cc: Will Deacon <will@kernel.org>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com>
Cc: Helge Deller <deller@gmx.de>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Cc: Rich Felker <dalias@libc.org>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/arm/Kconfig | 5 +----
arch/arm64/Kconfig | 4 +---
arch/mips/Kconfig | 6 +-----
arch/parisc/Kconfig | 5 +----
arch/powerpc/Kconfig | 3 ---
arch/powerpc/platforms/Kconfig.cputype | 6 +++---
arch/riscv/Kconfig | 5 +----
arch/sh/Kconfig | 5 +----
fs/Kconfig | 5 ++++-
9 files changed, 13 insertions(+), 31 deletions(-)
--- a/arch/arm64/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm64/Kconfig
@@ -73,6 +73,7 @@ config ARM64
select ARCH_USE_QUEUED_SPINLOCKS
select ARCH_USE_SYM_ANNOTATIONS
select ARCH_SUPPORTS_DEBUG_PAGEALLOC
+ select ARCH_SUPPORTS_HUGETLBFS
select ARCH_SUPPORTS_MEMORY_FAILURE
select ARCH_SUPPORTS_SHADOW_CALL_STACK if CC_HAVE_SHADOW_CALL_STACK
select ARCH_SUPPORTS_LTO_CLANG if CPU_LITTLE_ENDIAN
@@ -1072,9 +1073,6 @@ config HW_PERF_EVENTS
def_bool y
depends on ARM_PMU
-config SYS_SUPPORTS_HUGETLBFS
- def_bool y
-
config ARCH_HAS_FILTER_PGPROT
def_bool y
--- a/arch/arm/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm/Kconfig
@@ -31,6 +31,7 @@ config ARM
select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT if CPU_V7
select ARCH_SUPPORTS_ATOMIC_RMW
+ select ARCH_SUPPORTS_HUGETLBFS if ARM_LPAE
select ARCH_USE_BUILTIN_BSWAP
select ARCH_USE_CMPXCHG_LOCKREF
select ARCH_USE_MEMTEST
@@ -1511,10 +1512,6 @@ config HW_PERF_EVENTS
def_bool y
depends on ARM_PMU
-config SYS_SUPPORTS_HUGETLBFS
- def_bool y
- depends on ARM_LPAE
-
config HAVE_ARCH_TRANSPARENT_HUGEPAGE
def_bool y
depends on ARM_LPAE
--- a/arch/mips/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/mips/Kconfig
@@ -19,6 +19,7 @@ config MIPS
select ARCH_USE_MEMTEST
select ARCH_USE_QUEUED_RWLOCKS
select ARCH_USE_QUEUED_SPINLOCKS
+ select ARCH_SUPPORTS_HUGETLBFS if CPU_SUPPORTS_HUGEPAGES
select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
select ARCH_WANT_IPC_PARSE_VERSION
select ARCH_WANT_LD_ORPHAN_WARN
@@ -1287,11 +1288,6 @@ config SYS_SUPPORTS_BIG_ENDIAN
config SYS_SUPPORTS_LITTLE_ENDIAN
bool
-config SYS_SUPPORTS_HUGETLBFS
- bool
- depends on CPU_SUPPORTS_HUGEPAGES
- default y
-
config MIPS_HUGE_TLB_SUPPORT
def_bool HUGETLB_PAGE || TRANSPARENT_HUGEPAGE
--- a/arch/parisc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/parisc/Kconfig
@@ -12,6 +12,7 @@ config PARISC
select ARCH_HAS_STRICT_KERNEL_RWX
select ARCH_HAS_UBSAN_SANITIZE_ALL
select ARCH_NO_SG_CHAIN
+ select ARCH_SUPPORTS_HUGETLBFS if PA20
select ARCH_SUPPORTS_MEMORY_FAILURE
select DMA_OPS
select RTC_CLASS
@@ -138,10 +139,6 @@ config PGTABLE_LEVELS
default 3 if 64BIT && PARISC_PAGE_SIZE_4KB
default 2
-config SYS_SUPPORTS_HUGETLBFS
- def_bool y if PA20
-
-
menu "Processor type and features"
choice
--- a/arch/powerpc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/Kconfig
@@ -697,9 +697,6 @@ config ARCH_SPARSEMEM_DEFAULT
def_bool y
depends on PPC_BOOK3S_64
-config SYS_SUPPORTS_HUGETLBFS
- bool
-
config ILLEGAL_POINTER_VALUE
hex
# This is roughly half way between the top of user space and the bottom
--- a/arch/powerpc/platforms/Kconfig.cputype~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/platforms/Kconfig.cputype
@@ -40,8 +40,8 @@ config PPC_85xx
config PPC_8xx
bool "Freescale 8xx"
+ select ARCH_SUPPORTS_HUGETLBFS
select FSL_SOC
- select SYS_SUPPORTS_HUGETLBFS
select PPC_HAVE_KUEP
select PPC_HAVE_KUAP
select HAVE_ARCH_VMAP_STACK
@@ -95,9 +95,9 @@ config PPC_BOOK3S_64
bool "Server processors"
select PPC_FPU
select PPC_HAVE_PMU_SUPPORT
- select SYS_SUPPORTS_HUGETLBFS
select HAVE_ARCH_TRANSPARENT_HUGEPAGE
select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE
+ select ARCH_SUPPORTS_HUGETLBFS
select ARCH_SUPPORTS_NUMA_BALANCING
select IRQ_WORK
select PPC_MM_SLICES
@@ -278,9 +278,9 @@ config FSL_BOOKE
# this is for common code between PPC32 & PPC64 FSL BOOKE
config PPC_FSL_BOOK3E
bool
+ select ARCH_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
select FSL_EMB_PERFMON
select PPC_SMP_MUXED_IPI
- select SYS_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
select PPC_DOORBELL
default y if FSL_BOOKE
--- a/arch/riscv/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/riscv/Kconfig
@@ -30,6 +30,7 @@ config RISCV
select ARCH_HAS_STRICT_KERNEL_RWX if MMU
select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT
+ select ARCH_SUPPORTS_HUGETLBFS if MMU
select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
select ARCH_WANT_FRAME_POINTERS
select ARCH_WANT_HUGE_PMD_SHARE if 64BIT
@@ -165,10 +166,6 @@ config ARCH_WANT_GENERAL_HUGETLB
config ARCH_SUPPORTS_UPROBES
def_bool y
-config SYS_SUPPORTS_HUGETLBFS
- depends on MMU
- def_bool y
-
config STACKTRACE_SUPPORT
def_bool y
--- a/arch/sh/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/sh/Kconfig
@@ -101,9 +101,6 @@ config SYS_SUPPORTS_APM_EMULATION
bool
select ARCH_SUSPEND_POSSIBLE
-config SYS_SUPPORTS_HUGETLBFS
- bool
-
config SYS_SUPPORTS_SMP
bool
@@ -175,12 +172,12 @@ config CPU_SH3
config CPU_SH4
bool
+ select ARCH_SUPPORTS_HUGETLBFS if MMU
select CPU_HAS_INTEVT
select CPU_HAS_SR_RB
select CPU_HAS_FPU if !CPU_SH4AL_DSP
select SH_INTC
select SYS_SUPPORTS_SH_TMU
- select SYS_SUPPORTS_HUGETLBFS if MMU
config CPU_SH4A
bool
--- a/fs/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/fs/Kconfig
@@ -223,10 +223,13 @@ config TMPFS_INODE64
If unsure, say N.
+config ARCH_SUPPORTS_HUGETLBFS
+ def_bool n
+
config HUGETLBFS
bool "HugeTLB file system support"
depends on X86 || IA64 || SPARC64 || (S390 && 64BIT) || \
- SYS_SUPPORTS_HUGETLBFS || BROKEN
+ ARCH_SUPPORTS_HUGETLBFS || BROKEN
help
hugetlbfs is a filesystem backing for HugeTLB pages, based on
ramfs. For architectures that support it, say Y here and read
_
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-05-05 17:44 ` incoming Andrew Morton
@ 2021-05-06 3:19 ` Anshuman Khandual
0 siblings, 0 replies; 348+ messages in thread
From: Anshuman Khandual @ 2021-05-06 3:19 UTC (permalink / raw)
To: Andrew Morton, Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits
On 5/5/21 11:14 PM, Andrew Morton wrote:
> On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
>
>> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>>> Let me resend right now with the same in-reply-to. Hopefully they will
>>> land in the correct place.
>> Well, you re-sent it twice, and I have three copies in my own mailbox,
>> bot they still don't show up on the mm-commits mailing list.
>>
>> So the list hates them for some odd reason.
>>
>> I've picked them up locally, but adding Konstantin to the participants
>> to see if he can see what's up.
>>
>> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
>> series of 143. Odd.
> It's weird. They don't turn up on linux-mm either, and that's running
> at kvack.org, also majordomo. They don't get through when sent with
> either heirloom-mailx or with sylpheed.
>
> Also, it seems that when Anshuman originally sent the patch, linux-mm
> and linux-kernel didn't send it back out. So perhaps a spam filter
> triggered?
>
> I'm seeing
>
> https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/
>
> which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
> server massacred that patch series. Searching
> https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
> email series.
Yeah these patches faced problem from the very beginning getting
into the MM/LKML list for some strange reason.
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-05-07 1:01 Andrew Morton
2021-05-07 7:12 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2021-05-07 1:01 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
This is everything else from -mm for this merge window, with the
possible exception of Mike Rapoport's "secretmem" syscall patch series
(https://lkml.kernel.org/r/20210303162209.8609-1-rppt@kernel.org).
I've been wobbly about the secretmem patches due to doubts about
whether the feature is sufficiently useful to justify inclusion, but
developers are now weighing in with helpful information and I've asked Mike
for an extensively updated [0/n] changelog. This will take a few days
to play out so it is possible that I will prevail upon you for a post-rc1
merge. If that's a problem, there's always 5.13-rc1.
91 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus
previously sent patches.
Thanks.
Subsystems affected by this patch series:
alpha
procfs
sysctl
misc
core-kernel
bitmap
lib
compat
checkpatch
epoll
isofs
nilfs2
hpfs
exit
fork
kexec
gcov
panic
delayacct
gdb
resource
selftests
async
initramfs
ipc
mm/cleanups
drivers/char
mm/slub
spelling
Subsystem: alpha
Randy Dunlap <rdunlap@infradead.org>:
alpha: eliminate old-style function definitions
alpha: csum_partial_copy.c: add function prototypes from <net/checksum.h>
Subsystem: procfs
Colin Ian King <colin.king@canonical.com>:
fs/proc/generic.c: fix incorrect pde_is_permanent check
Alexey Dobriyan <adobriyan@gmail.com>:
proc: save LOC in __xlate_proc_name()
proc: mandate ->proc_lseek in "struct proc_ops"
proc: delete redundant subset=pid check
selftests: proc: test subset=pid
Subsystem: sysctl
zhouchuangao <zhouchuangao@vivo.com>:
proc/sysctl: fix function name error in comments
Subsystem: misc
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
include: remove pagemap.h from blkdev.h
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: drop inclusion in bitmap.h
Wan Jiabing <wanjiabing@vivo.com>:
linux/profile.h: remove unnecessary declaration
Subsystem: core-kernel
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
kernel/async.c: fix pr_debug statement
kernel/cred.c: make init_groups static
Subsystem: bitmap
Yury Norov <yury.norov@gmail.com>:
Patch series "lib/find_bit: fast path for small bitmaps", v6:
tools: disable -Wno-type-limits
tools: bitmap: sync function declarations with the kernel
tools: sync BITMAP_LAST_WORD_MASK() macro with the kernel
arch: rearrange headers inclusion order in asm/bitops for m68k, sh and h8300
lib: extend the scope of small_const_nbits() macro
tools: sync small_const_nbits() macro with the kernel
lib: inline _find_next_bit() wrappers
tools: sync find_next_bit implementation
lib: add fast path for find_next_*_bit()
lib: add fast path for find_first_*_bit() and find_last_bit()
tools: sync lib/find_bit implementation
MAINTAINERS: add entry for the bitmap API
Subsystem: lib
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
lib/bch.c: fix a typo in the file bch.c
Wang Qing <wangqing@vivo.com>:
lib: fix inconsistent indenting in process_bit1()
ToastC <mrtoastcheng@gmail.com>:
lib/list_sort.c: fix typo in function description
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
lib/genalloc.c: Fix a typo
Richard Fitzgerald <rf@opensource.cirrus.com>:
lib: crc8: pointer to data block should be const
Zqiang <qiang.zhang@windriver.com>:
lib: stackdepot: turn depot_lock spinlock to raw_spinlock
Alex Shi <alexs@kernel.org>:
lib/percpu_counter: tame kernel-doc compile warning
lib/genalloc: add parameter description to fix doc compile warning
Randy Dunlap <rdunlap@infradead.org>:
lib: parser: clean up kernel-doc
Subsystem: compat
Masahiro Yamada <masahiroy@kernel.org>:
include/linux/compat.h: remove unneeded declaration from COMPAT_SYSCALL_DEFINEx()
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: warn when missing newline in return sysfs_emit() formats
Vincent Mailhol <mailhol.vincent@wanadoo.fr>:
checkpatch: exclude four preprocessor sub-expressions from MACRO_ARG_REUSE
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
checkpatch: improve ALLOC_ARRAY_ARGS test
Subsystem: epoll
Davidlohr Bueso <dave@stgolabs.net>:
Patch series "fs/epoll: restore user-visible behavior upon event ready":
kselftest: introduce new epoll test case
fs/epoll: restore waking from ep_done_scan()
Subsystem: isofs
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
isofs: fix fall-through warnings for Clang
Subsystem: nilfs2
Liu xuzhi <liu.xuzhi@zte.com.cn>:
fs/nilfs2: fix misspellings using codespell tool
Lu Jialin <lujialin4@huawei.com>:
nilfs2: fix typos in comments
Subsystem: hpfs
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
hpfs: replace one-element array with flexible-array member
Subsystem: exit
Jim Newsome <jnewsome@torproject.org>:
do_wait: make PIDTYPE_PID case O(1) instead of O(n)
Subsystem: fork
Rolf Eike Beer <eb@emlix.com>:
kernel/fork.c: simplify copy_mm()
Xiaofeng Cao <cxfcosmos@gmail.com>:
kernel/fork.c: fix typos
Subsystem: kexec
Saeed Mirzamohammadi <saeed.mirzamohammadi@oracle.com>:
kernel/crash_core: add crashkernel=auto for vmcore creation
Joe LeVeque <jolevequ@microsoft.com>:
kexec: Add kexec reboot string
Jia-Ju Bai <baijiaju1990@gmail.com>:
kernel: kexec_file: fix error return code of kexec_calculate_store_digests()
Pavel Tatashin <pasha.tatashin@soleen.com>:
kexec: dump kmessage before machine_kexec
Subsystem: gcov
Johannes Berg <johannes.berg@intel.com>:
gcov: combine common code
gcov: simplify buffer allocation
gcov: use kvmalloc()
Nick Desaulniers <ndesaulniers@google.com>:
gcov: clang: drop support for clang-10 and older
Subsystem: panic
He Ying <heying24@huawei.com>:
smp: kernel/panic.c - silence warnings
Subsystem: delayacct
Yafang Shao <laoar.shao@gmail.com>:
delayacct: clear right task's flag after blkio completes
Subsystem: gdb
Johannes Berg <johannes.berg@intel.com>:
gdb: lx-symbols: store the abspath()
Barry Song <song.bao.hua@hisilicon.com>:
Patch series "scripts/gdb: clarify the platforms supporting lx_current and add arm64 support", v2:
scripts/gdb: document lx_current is only supported by x86
scripts/gdb: add lx_current support for arm64
Subsystem: resource
David Hildenbrand <david@redhat.com>:
Patch series "kernel/resource: make walk_system_ram_res() and walk_mem_res() search the whole tree", v2:
kernel/resource: make walk_system_ram_res() find all busy IORESOURCE_SYSTEM_RAM resources
kernel/resource: make walk_mem_res() find all busy IORESOURCE_MEM resources
kernel/resource: remove first_lvl / siblings_only logic
Alistair Popple <apopple@nvidia.com>:
kernel/resource: allow region_intersects users to hold resource_lock
kernel/resource: refactor __request_region to allow external locking
kernel/resource: fix locking in request_free_mem_region
Subsystem: selftests
Zhang Yunkai <zhang.yunkai@zte.com.cn>:
selftests: remove duplicate include
Subsystem: async
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
kernel/async.c: stop guarding pr_debug() statements
kernel/async.c: remove async_unregister_domain()
Subsystem: initramfs
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
Patch series "background initramfs unpacking, and CONFIG_MODPROBE_PATH", v3:
init/initramfs.c: do unpacking asynchronously
modules: add CONFIG_MODPROBE_PATH
Subsystem: ipc
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
ipc/sem.c: mundane typo fixes
Subsystem: mm/cleanups
Shijie Luo <luoshijie1@huawei.com>:
mm: fix some typos and code style problems
Subsystem: drivers/char
David Hildenbrand <david@redhat.com>:
Patch series "drivers/char: remove /dev/kmem for good":
drivers/char: remove /dev/kmem for good
mm: remove xlate_dev_kmem_ptr()
mm/vmalloc: remove vwrite()
Subsystem: mm/slub
Maninder Singh <maninder1.s@samsung.com>:
arm: print alloc free paths for address in registers
Subsystem: spelling
Drew Fustini <drew@beagleboard.org>:
scripts/spelling.txt: add "overlfow"
zuoqilin <zuoqilin@yulong.com>:
scripts/spelling.txt: Add "diabled" typo
Drew Fustini <drew@beagleboard.org>:
scripts/spelling.txt: add "overflw"
Colin Ian King <colin.king@canonical.com>:
mm/slab.c: fix spelling mistake "disired" -> "desired"
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
include/linux/pgtable.h: few spelling fixes
zhouchuangao <zhouchuangao@vivo.com>:
kernel/umh.c: fix some spelling mistakes
Xiaofeng Cao <cxfcosmos@gmail.com>:
kernel/user_namespace.c: fix typos
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
kernel/up.c: fix typo
Xiaofeng Cao <caoxiaofeng@yulong.com>:
kernel/sys.c: fix typo
dingsenjie <dingsenjie@yulong.com>:
fs: fat: fix spelling typo of values
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
ipc/sem.c: spelling fix
Masahiro Yamada <masahiroy@kernel.org>:
treewide: remove editor modelines and cruft
Ingo Molnar <mingo@kernel.org>:
mm: fix typos in comments
Lu Jialin <lujialin4@huawei.com>:
mm: fix typos in comments
Documentation/admin-guide/devices.txt | 2
Documentation/admin-guide/kdump/kdump.rst | 3
Documentation/admin-guide/kernel-parameters.txt | 18
Documentation/dev-tools/gdb-kernel-debugging.rst | 4
MAINTAINERS | 16
arch/Kconfig | 20
arch/alpha/include/asm/io.h | 5
arch/alpha/kernel/pc873xx.c | 4
arch/alpha/lib/csum_partial_copy.c | 1
arch/arm/configs/dove_defconfig | 1
arch/arm/configs/magician_defconfig | 1
arch/arm/configs/moxart_defconfig | 1
arch/arm/configs/mps2_defconfig | 1
arch/arm/configs/mvebu_v5_defconfig | 1
arch/arm/configs/xcep_defconfig | 1
arch/arm/include/asm/bug.h | 1
arch/arm/include/asm/io.h | 5
arch/arm/kernel/process.c | 11
arch/arm/kernel/traps.c | 1
arch/h8300/include/asm/bitops.h | 8
arch/hexagon/configs/comet_defconfig | 1
arch/hexagon/include/asm/io.h | 1
arch/ia64/include/asm/io.h | 1
arch/ia64/include/asm/uaccess.h | 18
arch/m68k/atari/time.c | 7
arch/m68k/configs/amcore_defconfig | 1
arch/m68k/include/asm/bitops.h | 6
arch/m68k/include/asm/io_mm.h | 5
arch/mips/include/asm/io.h | 5
arch/openrisc/configs/or1ksim_defconfig | 1
arch/parisc/include/asm/io.h | 5
arch/parisc/include/asm/pdc_chassis.h | 1
arch/powerpc/include/asm/io.h | 5
arch/s390/include/asm/io.h | 5
arch/sh/configs/edosk7705_defconfig | 1
arch/sh/configs/se7206_defconfig | 1
arch/sh/configs/sh2007_defconfig | 1
arch/sh/configs/sh7724_generic_defconfig | 1
arch/sh/configs/sh7770_generic_defconfig | 1
arch/sh/configs/sh7785lcr_32bit_defconfig | 1
arch/sh/include/asm/bitops.h | 5
arch/sh/include/asm/io.h | 5
arch/sparc/configs/sparc64_defconfig | 1
arch/sparc/include/asm/io_64.h | 5
arch/um/drivers/cow.h | 7
arch/xtensa/configs/xip_kc705_defconfig | 1
block/blk-settings.c | 1
drivers/auxdisplay/panel.c | 7
drivers/base/firmware_loader/main.c | 2
drivers/block/brd.c | 1
drivers/block/loop.c | 1
drivers/char/Kconfig | 10
drivers/char/mem.c | 231 --------
drivers/gpu/drm/qxl/qxl_drv.c | 1
drivers/isdn/capi/kcapi_proc.c | 1
drivers/md/bcache/super.c | 1
drivers/media/usb/pwc/pwc-uncompress.c | 3
drivers/net/ethernet/adaptec/starfire.c | 8
drivers/net/ethernet/amd/atarilance.c | 8
drivers/net/ethernet/amd/pcnet32.c | 7
drivers/net/wireless/intersil/hostap/hostap_proc.c | 1
drivers/net/wireless/intersil/orinoco/orinoco_nortel.c | 8
drivers/net/wireless/intersil/orinoco/orinoco_pci.c | 8
drivers/net/wireless/intersil/orinoco/orinoco_plx.c | 8
drivers/net/wireless/intersil/orinoco/orinoco_tmd.c | 8
drivers/nvdimm/btt.c | 1
drivers/nvdimm/pmem.c | 1
drivers/parport/parport_ip32.c | 12
drivers/platform/x86/dell/dell_rbu.c | 3
drivers/scsi/53c700.c | 1
drivers/scsi/53c700.h | 1
drivers/scsi/ch.c | 6
drivers/scsi/esas2r/esas2r_main.c | 1
drivers/scsi/ips.c | 20
drivers/scsi/ips.h | 20
drivers/scsi/lasi700.c | 1
drivers/scsi/megaraid/mbox_defs.h | 2
drivers/scsi/megaraid/mega_common.h | 2
drivers/scsi/megaraid/megaraid_mbox.c | 2
drivers/scsi/megaraid/megaraid_mbox.h | 2
drivers/scsi/qla1280.c | 12
drivers/scsi/scsicam.c | 1
drivers/scsi/sni_53c710.c | 1
drivers/video/fbdev/matrox/matroxfb_base.c | 9
drivers/video/fbdev/vga16fb.c | 10
fs/configfs/configfs_internal.h | 4
fs/configfs/dir.c | 4
fs/configfs/file.c | 4
fs/configfs/inode.c | 4
fs/configfs/item.c | 4
fs/configfs/mount.c | 4
fs/configfs/symlink.c | 4
fs/eventpoll.c | 6
fs/fat/fatent.c | 2
fs/hpfs/hpfs.h | 3
fs/isofs/rock.c | 1
fs/nfs/dir.c | 7
fs/nfs/nfs4proc.c | 6
fs/nfs/nfs4renewd.c | 6
fs/nfs/nfs4state.c | 6
fs/nfs/nfs4xdr.c | 6
fs/nfsd/nfs4proc.c | 6
fs/nfsd/nfs4xdr.c | 6
fs/nfsd/xdr4.h | 6
fs/nilfs2/cpfile.c | 2
fs/nilfs2/ioctl.c | 4
fs/nilfs2/segment.c | 4
fs/nilfs2/the_nilfs.c | 2
fs/ocfs2/acl.c | 4
fs/ocfs2/acl.h | 4
fs/ocfs2/alloc.c | 4
fs/ocfs2/alloc.h | 4
fs/ocfs2/aops.c | 4
fs/ocfs2/aops.h | 4
fs/ocfs2/blockcheck.c | 4
fs/ocfs2/blockcheck.h | 4
fs/ocfs2/buffer_head_io.c | 4
fs/ocfs2/buffer_head_io.h | 4
fs/ocfs2/cluster/heartbeat.c | 4
fs/ocfs2/cluster/heartbeat.h | 4
fs/ocfs2/cluster/masklog.c | 4
fs/ocfs2/cluster/masklog.h | 4
fs/ocfs2/cluster/netdebug.c | 4
fs/ocfs2/cluster/nodemanager.c | 4
fs/ocfs2/cluster/nodemanager.h | 4
fs/ocfs2/cluster/ocfs2_heartbeat.h | 4
fs/ocfs2/cluster/ocfs2_nodemanager.h | 4
fs/ocfs2/cluster/quorum.c | 4
fs/ocfs2/cluster/quorum.h | 4
fs/ocfs2/cluster/sys.c | 4
fs/ocfs2/cluster/sys.h | 4
fs/ocfs2/cluster/tcp.c | 4
fs/ocfs2/cluster/tcp.h | 4
fs/ocfs2/cluster/tcp_internal.h | 4
fs/ocfs2/dcache.c | 4
fs/ocfs2/dcache.h | 4
fs/ocfs2/dir.c | 4
fs/ocfs2/dir.h | 4
fs/ocfs2/dlm/dlmapi.h | 4
fs/ocfs2/dlm/dlmast.c | 4
fs/ocfs2/dlm/dlmcommon.h | 4
fs/ocfs2/dlm/dlmconvert.c | 4
fs/ocfs2/dlm/dlmconvert.h | 4
fs/ocfs2/dlm/dlmdebug.c | 4
fs/ocfs2/dlm/dlmdebug.h | 4
fs/ocfs2/dlm/dlmdomain.c | 4
fs/ocfs2/dlm/dlmdomain.h | 4
fs/ocfs2/dlm/dlmlock.c | 4
fs/ocfs2/dlm/dlmmaster.c | 4
fs/ocfs2/dlm/dlmrecovery.c | 4
fs/ocfs2/dlm/dlmthread.c | 4
fs/ocfs2/dlm/dlmunlock.c | 4
fs/ocfs2/dlmfs/dlmfs.c | 4
fs/ocfs2/dlmfs/userdlm.c | 4
fs/ocfs2/dlmfs/userdlm.h | 4
fs/ocfs2/dlmglue.c | 4
fs/ocfs2/dlmglue.h | 4
fs/ocfs2/export.c | 4
fs/ocfs2/export.h | 4
fs/ocfs2/extent_map.c | 4
fs/ocfs2/extent_map.h | 4
fs/ocfs2/file.c | 4
fs/ocfs2/file.h | 4
fs/ocfs2/filecheck.c | 4
fs/ocfs2/filecheck.h | 4
fs/ocfs2/heartbeat.c | 4
fs/ocfs2/heartbeat.h | 4
fs/ocfs2/inode.c | 4
fs/ocfs2/inode.h | 4
fs/ocfs2/journal.c | 4
fs/ocfs2/journal.h | 4
fs/ocfs2/localalloc.c | 4
fs/ocfs2/localalloc.h | 4
fs/ocfs2/locks.c | 4
fs/ocfs2/locks.h | 4
fs/ocfs2/mmap.c | 4
fs/ocfs2/move_extents.c | 4
fs/ocfs2/move_extents.h | 4
fs/ocfs2/namei.c | 4
fs/ocfs2/namei.h | 4
fs/ocfs2/ocfs1_fs_compat.h | 4
fs/ocfs2/ocfs2.h | 4
fs/ocfs2/ocfs2_fs.h | 4
fs/ocfs2/ocfs2_ioctl.h | 4
fs/ocfs2/ocfs2_lockid.h | 4
fs/ocfs2/ocfs2_lockingver.h | 4
fs/ocfs2/refcounttree.c | 4
fs/ocfs2/refcounttree.h | 4
fs/ocfs2/reservations.c | 4
fs/ocfs2/reservations.h | 4
fs/ocfs2/resize.c | 4
fs/ocfs2/resize.h | 4
fs/ocfs2/slot_map.c | 4
fs/ocfs2/slot_map.h | 4
fs/ocfs2/stack_o2cb.c | 4
fs/ocfs2/stack_user.c | 4
fs/ocfs2/stackglue.c | 4
fs/ocfs2/stackglue.h | 4
fs/ocfs2/suballoc.c | 4
fs/ocfs2/suballoc.h | 4
fs/ocfs2/super.c | 4
fs/ocfs2/super.h | 4
fs/ocfs2/symlink.c | 4
fs/ocfs2/symlink.h | 4
fs/ocfs2/sysfile.c | 4
fs/ocfs2/sysfile.h | 4
fs/ocfs2/uptodate.c | 4
fs/ocfs2/uptodate.h | 4
fs/ocfs2/xattr.c | 4
fs/ocfs2/xattr.h | 4
fs/proc/generic.c | 13
fs/proc/inode.c | 18
fs/proc/proc_sysctl.c | 2
fs/reiserfs/procfs.c | 10
include/asm-generic/bitops/find.h | 108 +++
include/asm-generic/bitops/le.h | 38 +
include/asm-generic/bitsperlong.h | 12
include/asm-generic/io.h | 11
include/linux/align.h | 15
include/linux/async.h | 1
include/linux/bitmap.h | 11
include/linux/bitops.h | 12
include/linux/blkdev.h | 1
include/linux/compat.h | 1
include/linux/configfs.h | 4
include/linux/crc8.h | 2
include/linux/cred.h | 1
include/linux/delayacct.h | 20
include/linux/fs.h | 2
include/linux/genl_magic_func.h | 1
include/linux/genl_magic_struct.h | 1
include/linux/gfp.h | 2
include/linux/init_task.h | 1
include/linux/initrd.h | 2
include/linux/kernel.h | 9
include/linux/mm.h | 2
include/linux/mmzone.h | 2
include/linux/pgtable.h | 10
include/linux/proc_fs.h | 1
include/linux/profile.h | 3
include/linux/smp.h | 8
include/linux/swap.h | 1
include/linux/vmalloc.h | 7
include/uapi/linux/if_bonding.h | 11
include/uapi/linux/nfs4.h | 6
include/xen/interface/elfnote.h | 10
include/xen/interface/hvm/hvm_vcpu.h | 10
include/xen/interface/io/xenbus.h | 10
init/Kconfig | 12
init/initramfs.c | 38 +
init/main.c | 1
ipc/sem.c | 12
kernel/async.c | 68 --
kernel/configs/android-base.config | 1
kernel/crash_core.c | 7
kernel/cred.c | 2
kernel/exit.c | 67 ++
kernel/fork.c | 23
kernel/gcov/Kconfig | 1
kernel/gcov/base.c | 49 +
kernel/gcov/clang.c | 282 ----------
kernel/gcov/fs.c | 146 ++++-
kernel/gcov/gcc_4_7.c | 173 ------
kernel/gcov/gcov.h | 14
kernel/kexec_core.c | 4
kernel/kexec_file.c | 4
kernel/kmod.c | 2
kernel/resource.c | 198 ++++---
kernel/sys.c | 14
kernel/umh.c | 8
kernel/up.c | 2
kernel/user_namespace.c | 6
lib/bch.c | 2
lib/crc8.c | 2
lib/decompress_unlzma.c | 2
lib/find_bit.c | 68 --
lib/genalloc.c | 7
lib/list_sort.c | 2
lib/parser.c | 61 +-
lib/percpu_counter.c | 2
lib/stackdepot.c | 6
mm/balloon_compaction.c | 4
mm/compaction.c | 4
mm/filemap.c | 2
mm/gup.c | 2
mm/highmem.c | 2
mm/huge_memory.c | 6
mm/hugetlb.c | 6
mm/internal.h | 2
mm/kasan/kasan.h | 8
mm/kasan/quarantine.c | 4
mm/kasan/shadow.c | 4
mm/kfence/report.c | 2
mm/khugepaged.c | 2
mm/ksm.c | 6
mm/madvise.c | 4
mm/memcontrol.c | 18
mm/memory-failure.c | 2
mm/memory.c | 18
mm/mempolicy.c | 6
mm/migrate.c | 8
mm/mmap.c | 4
mm/mprotect.c | 2
mm/mremap.c | 2
mm/nommu.c | 10
mm/oom_kill.c | 2
mm/page-writeback.c | 4
mm/page_alloc.c | 16
mm/page_owner.c | 2
mm/page_vma_mapped.c | 2
mm/percpu-internal.h | 2
mm/percpu.c | 2
mm/pgalloc-track.h | 6
mm/rmap.c | 2
mm/slab.c | 8
mm/slub.c | 2
mm/swap.c | 4
mm/swap_slots.c | 2
mm/swap_state.c | 2
mm/vmalloc.c | 124 ----
mm/vmstat.c | 2
mm/z3fold.c | 2
mm/zpool.c | 2
mm/zsmalloc.c | 6
samples/configfs/configfs_sample.c | 2
scripts/checkpatch.pl | 15
scripts/gdb/linux/cpus.py | 23
scripts/gdb/linux/symbols.py | 3
scripts/spelling.txt | 3
tools/include/asm-generic/bitops/find.h | 85 ++-
tools/include/asm-generic/bitsperlong.h | 3
tools/include/linux/bitmap.h | 18
tools/lib/bitmap.c | 4
tools/lib/find_bit.c | 56 -
tools/scripts/Makefile.include | 1
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 44 +
tools/testing/selftests/kvm/lib/sparsebit.c | 1
tools/testing/selftests/mincore/mincore_selftest.c | 1
tools/testing/selftests/powerpc/mm/tlbie_test.c | 1
tools/testing/selftests/proc/Makefile | 1
tools/testing/selftests/proc/proc-subset-pid.c | 121 ++++
tools/testing/selftests/proc/read.c | 4
tools/usb/hcd-tests.sh | 2
343 files changed, 1383 insertions(+), 2119 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-05-07 1:01 incoming Andrew Morton
@ 2021-05-07 7:12 ` Linus Torvalds
0 siblings, 0 replies; 348+ messages in thread
From: Linus Torvalds @ 2021-05-07 7:12 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Thu, May 6, 2021 at 6:01 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> I've been wobbly about the secretmem patches due to doubts about
> whether the feature is sufficiently useful to justify inclusion, but
> developers are now weighing in with helpful information and I've asked Mike
> for an extensively updated [0/n] changelog. This will take a few days
> to play out so it is possible that I will prevail upon you for a post-rc1
> merge.
Oh, much too late for this release by now.
> If that's a problem, there's always 5.13-rc1.
5.13-rc1 is two days from now, it would be for 5.14-rc1.. How time -
and version numbers - fly.
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-05-15 0:26 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-15 0:26 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
13 patches, based on bd3c9cdb21a2674dd0db70199df884828e37abd4.
Subsystems affected by this patch series:
mm/hugetlb
mm/slub
resource
squashfs
mm/userfaultfd
mm/ksm
mm/pagealloc
mm/kasan
mm/pagemap
hfsplus
modprobe
mm/ioremap
Subsystem: mm/hugetlb
Peter Xu <peterx@redhat.com>:
Patch series "mm/hugetlb: Fix issues on file sealing and fork", v2:
mm/hugetlb: fix F_SEAL_FUTURE_WRITE
mm/hugetlb: fix cow where page writtable in child
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: move slub_debug static key enabling outside slab_mutex
Subsystem: resource
Alistair Popple <apopple@nvidia.com>:
kernel/resource: fix return code check in __request_free_mem_region
Subsystem: squashfs
Phillip Lougher <phillip@squashfs.org.uk>:
squashfs: fix divide error in calculate_skip()
Subsystem: mm/userfaultfd
Axel Rasmussen <axelrasmussen@google.com>:
userfaultfd: release page in error path to avoid BUG_ON
Subsystem: mm/ksm
Hugh Dickins <hughd@google.com>:
ksm: revert "use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()"
Subsystem: mm/pagealloc
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: fix struct page layout on 32-bit systems
Subsystem: mm/kasan
Peter Collingbourne <pcc@google.com>:
kasan: fix unit tests with CONFIG_UBSAN_LOCAL_BOUNDS enabled
Subsystem: mm/pagemap
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap: fix readahead return types
Subsystem: hfsplus
Jouni Roivas <jouni.roivas@tuxera.com>:
hfsplus: prevent corruption in shrinking truncate
Subsystem: modprobe
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
docs: admin-guide: update description for kernel.modprobe sysctl
Subsystem: mm/ioremap
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm/ioremap: fix iomap_max_page_shift
Documentation/admin-guide/sysctl/kernel.rst | 9 ++++---
fs/hfsplus/extents.c | 7 +++--
fs/hugetlbfs/inode.c | 5 ++++
fs/iomap/buffered-io.c | 4 +--
fs/squashfs/file.c | 6 ++--
include/linux/mm.h | 32 ++++++++++++++++++++++++++
include/linux/mm_types.h | 4 +--
include/linux/pagemap.h | 6 ++--
include/net/page_pool.h | 12 +++++++++
kernel/resource.c | 2 -
lib/test_kasan.c | 29 ++++++++++++++++++-----
mm/hugetlb.c | 1
mm/ioremap.c | 6 ++--
mm/ksm.c | 3 +-
mm/shmem.c | 34 ++++++++++++----------------
mm/slab_common.c | 10 ++++++++
mm/slub.c | 9 -------
net/core/page_pool.c | 12 +++++----
18 files changed, 129 insertions(+), 62 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-05-23 0:41 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-05-23 0:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
10 patches, based on 4ff2473bdb4cf2bb7d208ccf4418d3d7e6b1652c.
Subsystems affected by this patch series:
mm/pagealloc
mm/gup
ipc
selftests
mm/kasan
kernel/watchdog
bitmap
procfs
lib
mm/userfaultfd
Subsystem: mm/pagealloc
Arnd Bergmann <arnd@arndb.de>:
mm/shuffle: fix section mismatch warning
Subsystem: mm/gup
Michal Hocko <mhocko@suse.com>:
Revert "mm/gup: check page posion status for coredump."
Subsystem: ipc
Varad Gautam <varad.gautam@suse.com>:
ipc/mqueue, msg, sem: avoid relying on a stack reference past its expiry
Subsystem: selftests
Yang Yingliang <yangyingliang@huawei.com>:
tools/testing/selftests/exec: fix link error
Subsystem: mm/kasan
Alexander Potapenko <glider@google.com>:
kasan: slab: always reset the tag in get_freepointer_safe()
Subsystem: kernel/watchdog
Petr Mladek <pmladek@suse.com>:
watchdog: reliable handling of timestamps
Subsystem: bitmap
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
linux/bits.h: fix compilation error with GENMASK
Subsystem: procfs
Alexey Dobriyan <adobriyan@gmail.com>:
proc: remove Alexey from MAINTAINERS
Subsystem: lib
Zhen Lei <thunder.leizhen@huawei.com>:
lib: kunit: suppress a compilation warning of frame size
Subsystem: mm/userfaultfd
Mike Kravetz <mike.kravetz@oracle.com>:
userfaultfd: hugetlbfs: fix new flag usage in error path
MAINTAINERS | 1 -
fs/hugetlbfs/inode.c | 2 +-
include/linux/bits.h | 2 +-
include/linux/const.h | 8 ++++++++
include/linux/minmax.h | 10 ++--------
ipc/mqueue.c | 6 ++++--
ipc/msg.c | 6 ++++--
ipc/sem.c | 6 ++++--
kernel/watchdog.c | 34 ++++++++++++++++++++--------------
lib/Makefile | 1 +
mm/gup.c | 4 ----
mm/internal.h | 20 --------------------
mm/shuffle.h | 4 ++--
mm/slub.c | 1 +
mm/userfaultfd.c | 28 ++++++++++++++--------------
tools/include/linux/bits.h | 2 +-
tools/include/linux/const.h | 8 ++++++++
tools/testing/selftests/exec/Makefile | 6 +++---
18 files changed, 74 insertions(+), 75 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-06-05 3:00 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-06-05 3:00 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
13 patches, based on 16f0596fc1d78a1f3ae4628cff962bb297dc908c.
Subsystems affected by this patch series:
mips
mm/kfence
init
mm/debug
mm/pagealloc
mm/memory-hotplug
mm/hugetlb
proc
mm/kasan
mm/hugetlb
lib
ocfs2
mailmap
Subsystem: mips
Thomas Bogendoerfer <tsbogend@alpha.franken.de>:
Revert "MIPS: make userspace mapping young by default"
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: use TASK_IDLE when awaiting allocation
Subsystem: init
Mark Rutland <mark.rutland@arm.com>:
pid: take a reference when initializing `cad_pid`
Subsystem: mm/debug
Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
mm/debug_vm_pgtable: fix alignment for pmd/pud_advanced_tests()
Subsystem: mm/pagealloc
Ding Hui <dinghui@sangfor.com.cn>:
mm/page_alloc: fix counting of free pages after take off from buddy
Subsystem: mm/memory-hotplug
David Hildenbrand <david@redhat.com>:
drivers/base/memory: fix trying offlining memory blocks with memory holes on aarch64
Subsystem: mm/hugetlb
Naoya Horiguchi <naoya.horiguchi@nec.com>:
hugetlb: pass head page to remove_hugetlb_page()
Subsystem: proc
David Matlack <dmatlack@google.com>:
proc: add .gitignore for proc-subset-pid selftest
Subsystem: mm/kasan
Yu Kuai <yukuai3@huawei.com>:
mm/kasan/init.c: fix doc warning
Subsystem: mm/hugetlb
Mina Almasry <almasrymina@google.com>:
mm, hugetlb: fix simple resv_huge_pages underflow on UFFDIO_COPY
Subsystem: lib
YueHaibing <yuehaibing@huawei.com>:
lib: crc64: fix kernel-doc warning
Subsystem: ocfs2
Junxiao Bi <junxiao.bi@oracle.com>:
ocfs2: fix data corruption by fallocate
Subsystem: mailmap
Michel Lespinasse <michel@lespinasse.org>:
mailmap: use private address for Michel Lespinasse
.mailmap | 3 +
arch/mips/mm/cache.c | 30 ++++++++---------
drivers/base/memory.c | 6 +--
fs/ocfs2/file.c | 55 +++++++++++++++++++++++++++++---
include/linux/pgtable.h | 8 ++++
init/main.c | 2 -
lib/crc64.c | 2 -
mm/debug_vm_pgtable.c | 4 +-
mm/hugetlb.c | 16 +++++++--
mm/kasan/init.c | 4 +-
mm/kfence/core.c | 6 +--
mm/memory.c | 4 ++
mm/page_alloc.c | 2 +
tools/testing/selftests/proc/.gitignore | 1
14 files changed, 107 insertions(+), 36 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-06-16 1:22 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-06-16 1:22 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
18 patches, based on 94f0b2d4a1d0c52035aef425da5e022bd2cb1c71.
Subsystems affected by this patch series:
mm/memory-failure
mm/swap
mm/slub
mm/hugetlb
mm/memory-failure
coredump
mm/slub
mm/thp
mm/sparsemem
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm,hwpoison: fix race with hugetlb page allocation
Subsystem: mm/swap
Peter Xu <peterx@redhat.com>:
mm/swap: fix pte_same_as_swp() not removing uffd-wp bit when compare
Subsystem: mm/slub
Kees Cook <keescook@chromium.org>:
Patch series "Actually fix freelist pointer vs redzoning", v4:
mm/slub: clarify verification reporting
mm/slub: fix redzoning for small allocations
mm/slub: actually fix freelist pointer vs redzoning
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
mm/hugetlb: expand restore_reserve_on_error functionality
Subsystem: mm/memory-failure
yangerkun <yangerkun@huawei.com>:
mm/memory-failure: make sure wait for page writeback in memory_failure
Subsystem: coredump
Pingfan Liu <kernelfans@gmail.com>:
crash_core, vmcoreinfo: append 'SECTION_SIZE_BITS' to vmcoreinfo
Subsystem: mm/slub
Andrew Morton <akpm@linux-foundation.org>:
mm/slub.c: include swab.h
Subsystem: mm/thp
Xu Yu <xuyu@linux.alibaba.com>:
mm, thp: use head page in __migration_entry_wait()
Hugh Dickins <hughd@google.com>:
Patch series "mm/thp: fix THP splitting unmap BUGs and related", v10:
mm/thp: fix __split_huge_pmd_locked() on shmem migration entry
mm/thp: make is_huge_zero_pmd() safe and quicker
mm/thp: try_to_unmap() use TTU_SYNC for safe splitting
mm/thp: fix vma_address() if virtual address below file offset
Jue Wang <juew@google.com>:
mm/thp: fix page_address_in_vma() on file THP tails
Hugh Dickins <hughd@google.com>:
mm/thp: unmap_mapping_page() to fix THP truncate_cleanup_page()
Yang Shi <shy828301@gmail.com>:
mm: thp: replace DEBUG_VM BUG with VM_WARN when unmap fails for split
Subsystem: mm/sparsemem
Miles Chen <miles.chen@mediatek.com>:
mm/sparse: fix check_usemap_section_nr warnings
Documentation/vm/slub.rst | 10 +--
fs/hugetlbfs/inode.c | 1
include/linux/huge_mm.h | 8 ++
include/linux/hugetlb.h | 8 ++
include/linux/mm.h | 3 +
include/linux/rmap.h | 1
include/linux/swapops.h | 15 +++--
kernel/crash_core.c | 1
mm/huge_memory.c | 58 ++++++++++---------
mm/hugetlb.c | 137 +++++++++++++++++++++++++++++++++++++---------
mm/internal.h | 51 ++++++++++++-----
mm/memory-failure.c | 36 +++++++++++-
mm/memory.c | 41 +++++++++++++
mm/migrate.c | 1
mm/page_vma_mapped.c | 27 +++++----
mm/pgtable-generic.c | 5 -
mm/rmap.c | 41 +++++++++----
mm/slab_common.c | 3 -
mm/slub.c | 37 +++++-------
mm/sparse.c | 13 +++-
mm/swapfile.c | 2
mm/truncate.c | 43 ++++++--------
22 files changed, 388 insertions(+), 154 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-06-25 1:38 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-06-25 1:38 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
24 patches, based on 4a09d388f2ab382f217a764e6a152b3f614246f6.
Subsystems affected by this patch series:
mm/thp
nilfs2
mm/vmalloc
kthread
mm/hugetlb
mm/memory-failure
mm/pagealloc
MAINTAINERS
mailmap
Subsystem: mm/thp
Hugh Dickins <hughd@google.com>:
Patch series "mm: page_vma_mapped_walk() cleanup and THP fixes":
mm: page_vma_mapped_walk(): use page for pvmw->page
mm: page_vma_mapped_walk(): settle PageHuge on entry
mm: page_vma_mapped_walk(): use pmde for *pvmw->pmd
mm: page_vma_mapped_walk(): prettify PVMW_MIGRATION block
mm: page_vma_mapped_walk(): crossing page table boundary
mm: page_vma_mapped_walk(): add a level of indentation
mm: page_vma_mapped_walk(): use goto instead of while (1)
mm: page_vma_mapped_walk(): get vma_address_end() earlier
mm/thp: fix page_vma_mapped_walk() if THP mapped by ptes
mm/thp: another PVMW_SYNC fix in page_vma_mapped_walk()
Subsystem: nilfs2
Pavel Skripkin <paskripkin@gmail.com>:
nilfs2: fix memory leak in nilfs_sysfs_delete_device_group
Subsystem: mm/vmalloc
Claudio Imbrenda <imbrenda@linux.ibm.com>:
Patch series "mm: add vmalloc_no_huge and use it", v4:
mm/vmalloc: add vmalloc_no_huge
KVM: s390: prepare for hugepage vmalloc
Daniel Axtens <dja@axtens.net>:
mm/vmalloc: unbreak kasan vmalloc support
Subsystem: kthread
Petr Mladek <pmladek@suse.com>:
Patch series "kthread_worker: Fix race between kthread_mod_delayed_work():
kthread_worker: split code for canceling the delayed work timer
kthread: prevent deadlock when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync()
Subsystem: mm/hugetlb
Hugh Dickins <hughd@google.com>:
mm, futex: fix shared futex pgoff on shmem huge page
Subsystem: mm/memory-failure
Tony Luck <tony.luck@intel.com>:
Patch series "mm,hwpoison: fix sending SIGBUS for Action Required MCE", v5:
mm/memory-failure: use a mutex to avoid memory_failure() races
Aili Yao <yaoaili@kingsoft.com>:
mm,hwpoison: return -EHWPOISON to denote that the page has already been poisoned
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/hwpoison: do not lock page again when me_huge_page() successfully recovers
Subsystem: mm/pagealloc
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
mm/page_alloc: __alloc_pages_bulk(): do bounds check before accessing array
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: do bulk array bounds check after checking populated elements
Subsystem: MAINTAINERS
Marek Behún <kabel@kernel.org>:
MAINTAINERS: fix Marek's identity again
Subsystem: mailmap
Marek Behún <kabel@kernel.org>:
mailmap: add Marek's other e-mail address and identity without diacritics
.mailmap | 2
MAINTAINERS | 4
arch/s390/kvm/pv.c | 7 +
fs/nilfs2/sysfs.c | 1
include/linux/hugetlb.h | 16 ---
include/linux/pagemap.h | 13 +-
include/linux/vmalloc.h | 1
kernel/futex.c | 3
kernel/kthread.c | 81 ++++++++++------
mm/hugetlb.c | 5 -
mm/memory-failure.c | 83 +++++++++++------
mm/page_alloc.c | 6 +
mm/page_vma_mapped.c | 233 +++++++++++++++++++++++++++---------------------
mm/vmalloc.c | 41 ++++++--
14 files changed, 297 insertions(+), 199 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-06-29 2:32 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-06-29 2:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2.
Subsystems affected by this patch series:
mm/gup
mm/pagealloc
kthread
ia64
scripts
ntfs
squashfs
ocfs2
z
kernel/watchdog
mm/slab
mm/slub
mm/kmemleak
mm/dax
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/mprotect
mm/bootmem
mm/dma
mm/tracing
mm/vmalloc
mm/kasan
mm/initialization
mm/pagealloc
mm/memory-failure
Subsystem: mm/gup
Jann Horn <jannh@google.com>:
mm/gup: fix try_grab_compound_head() race with split_huge_page()
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
mm/page_alloc: fix memory map initialization for descending nodes
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: correct return value of populated elements if bulk array is populated
Subsystem: kthread
Jonathan Neuschäfer <j.neuschaefer@gmx.net>:
kthread: switch to new kerneldoc syntax for named variable macro argument
Petr Mladek <pmladek@suse.com>:
kthread_worker: fix return value when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync()
Subsystem: ia64
Randy Dunlap <rdunlap@infradead.org>:
ia64: headers: drop duplicated words
Arnd Bergmann <arnd@arndb.de>:
ia64: mca_drv: fix incorrect array size calculation
Subsystem: scripts
"Steven Rostedt (VMware)" <rostedt@goodmis.org>:
Patch series "streamline_config.pl: Fix Perl spacing":
streamline_config.pl: make spacing consistent
streamline_config.pl: add softtabstop=4 for vim users
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ntfs
Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>:
ntfs: fix validity check for file name attribute
Subsystem: squashfs
Vincent Whitchurch <vincent.whitchurch@axis.com>:
squashfs: add option to panic on errors
Subsystem: ocfs2
Yang Yingliang <yangyingliang@huawei.com>:
ocfs2: remove unnecessary INIT_LIST_HEAD()
Subsystem: z
Dan Carpenter <dan.carpenter@oracle.com>:
ocfs2: fix snprintf() checking
Colin Ian King <colin.king@canonical.com>:
ocfs2: remove redundant assignment to pointer queue
Wan Jiabing <wanjiabing@vivo.com>:
ocfs2: remove repeated uptodate check for buffer
Chen Huang <chenhuang5@huawei.com>:
ocfs2: replace simple_strtoull() with kstrtoull()
Colin Ian King <colin.king@canonical.com>:
ocfs2: remove redundant initialization of variable ret
Subsystem: kernel/watchdog
Wang Qing <wangqing@vivo.com>:
kernel: watchdog: modify the explanation related to watchdog thread
doc: watchdog: modify the explanation related to watchdog thread
doc: watchdog: modify the doc related to "watchdog/%u"
Subsystem: mm/slab
gumingtao <gumingtao1225@gmail.com>:
slab: use __func__ to trace function name
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
kunit: make test->lock irq safe
Oliver Glitta <glittao@gmail.com>:
mm/slub, kunit: add a KUnit test for SLUB debugging functionality
slub: remove resiliency_test() function
Hyeonggon Yoo <42.hyeyoo@gmail.com>:
mm, slub: change run-time assertion in kmalloc_index() to compile-time
Stephen Boyd <swboyd@chromium.org>:
slub: restore slub_debug=- behavior
slub: actually use 'message' in restore_bytes()
Joe Perches <joe@perches.com>:
slub: indicate slab_fix() uses printf formats
Stephen Boyd <swboyd@chromium.org>:
slub: force on no_hash_pointers when slub_debug is enabled
Faiyaz Mohammed <faiyazm@codeaurora.org>:
mm: slub: move sysfs slab alloc/free interfaces to debugfs
Georgi Djakov <quic_c_gdjako@quicinc.com>:
mm/slub: add taint after the errors are printed
Subsystem: mm/kmemleak
Yanfei Xu <yanfei.xu@windriver.com>:
mm/kmemleak: fix possible wrong memory scanning period
Subsystem: mm/dax
Jan Kara <jack@suse.cz>:
dax: fix ENOMEM handling in grab_mapping_entry()
Subsystem: mm/debug
Tang Bin <tangbin@cmss.chinamobile.com>:
tools/vm/page_owner_sort.c: check malloc() return
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/debug_vm_pgtable: ensure THP availability via has_transparent_hugepage()
Nicolas Saenz Julienne <nsaenzju@redhat.com>:
mm: mmap_lock: use local locks instead of disabling preemption
Gavin Shan <gshan@redhat.com>:
Patch series "mm/page_reporting: Make page reporting work on arm64 with 64KB page size", v4:
mm/page_reporting: fix code style in __page_reporting_request()
mm/page_reporting: export reporting order as module parameter
mm/page_reporting: allow driver to specify reporting order
virtio_balloon: specify page reporting order if needed
Subsystem: mm/pagecache
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: page-writeback: kill get_writeback_state() comments
Chi Wu <wuchi.zero@gmail.com>:
mm/page-writeback: Fix performance when BDI's share of ratio is 0.
mm/page-writeback: update the comment of Dirty position control
mm/page-writeback: use __this_cpu_inc() in account_page_dirtied()
Roman Gushchin <guro@fb.com>:
Patch series "cgroup, blkcg: prevent dirty inodes to pin dying memory cgroups", v9:
writeback, cgroup: do not switch inodes with I_WILL_FREE flag
writeback, cgroup: add smp_mb() to cgroup_writeback_umount()
writeback, cgroup: increment isw_nr_in_flight before grabbing an inode
writeback, cgroup: switch to rcu_work API in inode_switch_wbs()
writeback, cgroup: keep list of inodes attached to bdi_writeback
writeback, cgroup: split out the functional part of inode_switch_wbs_work_fn()
writeback, cgroup: support switching multiple inodes at once
writeback, cgroup: release dying cgwbs by switching attached inodes
Christoph Hellwig <hch@lst.de>:
Patch series "remove the implicit .set_page_dirty default":
fs: unexport __set_page_dirty
fs: move ramfs_aops to libfs
mm: require ->set_page_dirty to be explicitly wired up
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Further set_page_dirty cleanups":
mm/writeback: move __set_page_dirty() to core mm
mm/writeback: use __set_page_dirty in __set_page_dirty_nobuffers
iomap: use __set_page_dirty_nobuffers
fs: remove anon_set_page_dirty()
fs: remove noop_set_page_dirty()
mm: move page dirtying prototypes from mm.h
Subsystem: mm/gup
Peter Xu <peterx@redhat.com>:
Patch series "mm/gup: Fix pin page write cache bouncing on has_pinned", v2:
mm/gup_benchmark: support threading
Andrea Arcangeli <aarcange@redhat.com>:
mm: gup: allow FOLL_PIN to scale in SMP
mm: gup: pack has_pinned in MMF_HAS_PINNED
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm: pagewalk: fix walk for hugepage tables
Subsystem: mm/swap
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "close various race windows for swap", v6:
mm/swapfile: use percpu_ref to serialize against concurrent swapoff
swap: fix do_swap_page() race with swapoff
mm/swap: remove confusing checking for non_swap_entry() in swap_ra_info()
mm/shmem: fix shmem_swapin() race with swapoff
Patch series "Cleanups for swap", v2:
mm/swapfile: move get_swap_page_of_type() under CONFIG_HIBERNATION
mm/swap: remove unused local variable nr_shadows
mm/swap_slots.c: delete meaningless forward declarations
Huang Ying <ying.huang@intel.com>:
mm, swap: remove unnecessary smp_rmb() in swap_type_to_swap_info()
mm: free idle swap cache page after COW
swap: check mapping_empty() for swap cache before being freed
Subsystem: mm/memcg
Waiman Long <longman@redhat.com>:
Patch series "mm/memcg: Reduce kmemcache memory accounting overhead", v6:
mm/memcg: move mod_objcg_state() to memcontrol.c
mm/memcg: cache vmstat data in percpu memcg_stock_pcp
mm/memcg: improve refill_obj_stock() performance
mm/memcg: optimize user context object stock access
Patch series "mm: memcg/slab: Fix objcg pointer array handling problem", v4:
mm: memcg/slab: properly set up gfp flags for objcg pointer array
mm: memcg/slab: create a new set of kmalloc-cg-<n> caches
mm: memcg/slab: disable cache merging for KMALLOC_NORMAL caches
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: fix root_mem_cgroup charging
Patch series "memcontrol code cleanup and simplification", v3:
mm: memcontrol: fix page charging in page replacement
mm: memcontrol: bail out early when !mm in get_mem_cgroup_from_mm
mm: memcontrol: remove the pgdata parameter of mem_cgroup_page_lruvec
mm: memcontrol: simplify lruvec_holds_page_lru_lock
mm: memcontrol: rename lruvec_holds_page_lru_lock to page_matches_lruvec
mm: memcontrol: simplify the logic of objcg pinning memcg
mm: memcontrol: move obj_cgroup_uncharge_pages() out of css_set_lock
mm: vmscan: remove noinline_for_stack
wenhuizhang <wenhui@gwmail.gwu.edu>:
memcontrol: use flexible-array member
Dan Schatzberg <schatzberg.dan@gmail.com>:
Patch series "Charge loop device i/o to issuing cgroup", v14:
loop: use worker per cgroup instead of kworker
mm: charge active memcg when no mm is set
loop: charge i/o to mem and blk cg
Huilong Deng <denghuilong@cdjrlc.com>:
mm: memcontrol: remove trailing semicolon in macros
Subsystem: mm/pagemap
David Hildenbrand <david@redhat.com>:
Patch series "perf/binfmt/mm: remove in-tree usage of MAP_EXECUTABLE":
perf: MAP_EXECUTABLE does not indicate VM_MAYEXEC
binfmt: remove in-tree usage of MAP_EXECUTABLE
mm: ignore MAP_EXECUTABLE in ksys_mmap_pgoff()
Gonzalo Matias Juarez Tello <gmjuareztello@gmail.com>:
mm/mmap.c: logic of find_vma_intersection repeated in __do_munmap
Liam Howlett <liam.howlett@oracle.com>:
mm/mmap: introduce unlock_range() for code cleanup
mm/mmap: use find_vma_intersection() in do_mmap() for overlap
Liu Xiang <liu.xiang@zlingsmart.com>:
mm/memory.c: fix comment of finish_mkwrite_fault()
Liam Howlett <liam.howlett@oracle.com>:
Patch series "mm: Add vma_lookup()", v2:
mm: add vma_lookup(), update find_vma_intersection() comments
drm/i915/selftests: use vma_lookup() in __igt_mmap()
arch/arc/kernel/troubleshoot: use vma_lookup() instead of find_vma()
arch/arm64/kvm: use vma_lookup() instead of find_vma_intersection()
arch/powerpc/kvm/book3s_hv_uvmem: use vma_lookup() instead of find_vma_intersection()
arch/powerpc/kvm/book3s: use vma_lookup() in kvmppc_hv_setup_htab_rma()
arch/mips/kernel/traps: use vma_lookup() instead of find_vma()
arch/m68k/kernel/sys_m68k: use vma_lookup() in sys_cacheflush()
x86/sgx: use vma_lookup() in sgx_encl_find()
virt/kvm: use vma_lookup() instead of find_vma_intersection()
vfio: use vma_lookup() instead of find_vma_intersection()
net/ipv5/tcp: use vma_lookup() in tcp_zerocopy_receive()
drm/amdgpu: use vma_lookup() in amdgpu_ttm_tt_get_user_pages()
media: videobuf2: use vma_lookup() in get_vaddr_frames()
misc/sgi-gru/grufault: use vma_lookup() in gru_find_vma()
kernel/events/uprobes: use vma_lookup() in find_active_uprobe()
lib/test_hmm: use vma_lookup() in dmirror_migrate()
mm/ksm: use vma_lookup() in find_mergeable_vma()
mm/migrate: use vma_lookup() in do_pages_stat_array()
mm/mremap: use vma_lookup() in vma_to_resize()
mm/memory.c: use vma_lookup() in __access_remote_vm()
mm/mempolicy: use vma_lookup() in __access_remote_vm()
Chen Li <chenli@uniontech.com>:
mm: update legacy flush_tlb_* to use vma
Subsystem: mm/mprotect
Peter Collingbourne <pcc@google.com>:
mm: improve mprotect(R|W) efficiency on pages referenced once
Subsystem: mm/bootmem
Souptick Joarder <jrdr.linux@gmail.com>:
h8300: remove unused variable
Subsystem: mm/dma
YueHaibing <yuehaibing@huawei.com>:
mm/dmapool: use DEVICE_ATTR_RO macro
Subsystem: mm/tracing
Vincent Whitchurch <vincent.whitchurch@axis.com>:
mm, tracing: unify PFN format strings
Subsystem: mm/vmalloc
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
Patch series "vmalloc() vs bulk allocator", v2:
mm/page_alloc: add an alloc_pages_bulk_array_node() helper
mm/vmalloc: switch to bulk allocator in __vmalloc_area_node()
mm/vmalloc: print a warning message first on failure
mm/vmalloc: remove quoted strings split across lines
Uladzislau Rezki <urezki@gmail.com>:
mm/vmalloc: fallback to a single page allocator
Rafael Aquini <aquini@redhat.com>:
mm: vmalloc: add cond_resched() in __vunmap()
Subsystem: mm/kasan
Alexander Potapenko <glider@google.com>:
printk: introduce dump_stack_lvl()
kasan: use dump_stack_lvl(KERN_ERR) to print stacks
David Gow <davidgow@google.com>:
kasan: test: improve failure message in KUNIT_EXPECT_KASAN_FAIL()
Daniel Axtens <dja@axtens.net>:
Patch series "KASAN core changes for ppc64 radix KASAN", v16:
kasan: allow an architecture to disable inline instrumentation
kasan: allow architectures to provide an outline readiness check
mm: define default MAX_PTRS_PER_* in include/pgtable.h
kasan: use MAX_PTRS_PER_* for early shadow tables
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
Patch series "kasan: add memory corruption identification support for hw tag-based kasan", v4:
kasan: rename CONFIG_KASAN_SW_TAGS_IDENTIFY to CONFIG_KASAN_TAGS_IDENTIFY
kasan: integrate the common part of two KASAN tag-based modes
kasan: add memory corruption identification support for hardware tag-based mode
Subsystem: mm/initialization
Jungseung Lee <js07.lee@samsung.com>:
mm: report which part of mem is being freed on initmem case
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
mm/mmzone.h: simplify is_highmem_idx()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Constify struct page arguments":
mm: make __dump_page static
Aaron Tomlin <atomlin@redhat.com>:
mm/page_alloc: bail out on fatal signal during reclaim/compaction retry attempt
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/debug: factor PagePoisoned out of __dump_page
mm/page_owner: constify dump_page_owner
mm: make compound_head const-preserving
mm: constify get_pfnblock_flags_mask and get_pfnblock_migratetype
mm: constify page_count and page_ref_count
mm: optimise nth_page for contiguous memmap
Heiner Kallweit <hkallweit1@gmail.com>:
mm/page_alloc: switch to pr_debug
Andrii Nakryiko <andrii@kernel.org>:
kbuild: skip per-CPU BTF generation for pahole v1.18-v1.21
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: split per cpu page lists and zone stats
mm/page_alloc: convert per-cpu list protection to local_lock
mm/vmstat: convert NUMA statistics to basic NUMA counters
mm/vmstat: inline NUMA event counter updates
mm/page_alloc: batch the accounting updates in the bulk allocator
mm/page_alloc: reduce duration that IRQs are disabled for VM counters
mm/page_alloc: explicitly acquire the zone lock in __free_pages_ok
mm/page_alloc: avoid conflating IRQs disabled with zone->lock
mm/page_alloc: update PGFREE outside the zone lock in __free_pages_ok
Minchan Kim <minchan@kernel.org>:
mm: page_alloc: dump migrate-failed pages only at -EBUSY
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Calculate pcp->high based on zone sizes and active CPUs", v2:
mm/page_alloc: delete vm.percpu_pagelist_fraction
mm/page_alloc: disassociate the pcp->high from pcp->batch
mm/page_alloc: adjust pcp->high after CPU hotplug events
mm/page_alloc: scale the number of pages that are batch freed
mm/page_alloc: limit the number of pages on PCP lists when reclaim is active
mm/page_alloc: introduce vm.percpu_pagelist_high_fraction
Dong Aisheng <aisheng.dong@nxp.com>:
mm: drop SECTION_SHIFT in code comments
mm/page_alloc: improve memmap_pages dbg msg
Liu Shixin <liushixin2@huawei.com>:
mm/page_alloc: fix counting of managed_pages
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Allow high order pages to be stored on PCP", v2:
mm/page_alloc: move free_the_page
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "Remove DISCONTIGMEM memory model", v3:
alpha: remove DISCONTIGMEM and NUMA
arc: update comment about HIGHMEM implementation
arc: remove support for DISCONTIGMEM
m68k: remove support for DISCONTIGMEM
mm: remove CONFIG_DISCONTIGMEM
arch, mm: remove stale mentions of DISCONIGMEM
docs: remove description of DISCONTIGMEM
mm: replace CONFIG_NEED_MULTIPLE_NODES with CONFIG_NUMA
mm: replace CONFIG_FLAT_NODE_MEM_MAP with CONFIG_FLATMEM
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: allow high-order pages to be stored on the per-cpu lists
mm/page_alloc: split pcp->high across all online CPUs for cpuless nodes
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm,hwpoison: send SIGBUS with error virutal address
mm,hwpoison: make get_hwpoison_page() call get_any_page()
Documentation/admin-guide/kernel-parameters.txt | 6
Documentation/admin-guide/lockup-watchdogs.rst | 4
Documentation/admin-guide/sysctl/kernel.rst | 10
Documentation/admin-guide/sysctl/vm.rst | 52 -
Documentation/dev-tools/kasan.rst | 9
Documentation/vm/memory-model.rst | 45
arch/alpha/Kconfig | 22
arch/alpha/include/asm/machvec.h | 6
arch/alpha/include/asm/mmzone.h | 100 --
arch/alpha/include/asm/pgtable.h | 4
arch/alpha/include/asm/topology.h | 39
arch/alpha/kernel/core_marvel.c | 53 -
arch/alpha/kernel/core_wildfire.c | 29
arch/alpha/kernel/pci_iommu.c | 29
arch/alpha/kernel/proto.h | 8
arch/alpha/kernel/setup.c | 16
arch/alpha/kernel/sys_marvel.c | 5
arch/alpha/kernel/sys_wildfire.c | 5
arch/alpha/mm/Makefile | 2
arch/alpha/mm/init.c | 3
arch/alpha/mm/numa.c | 223 ----
arch/arc/Kconfig | 13
arch/arc/include/asm/mmzone.h | 40
arch/arc/kernel/troubleshoot.c | 8
arch/arc/mm/init.c | 21
arch/arm/include/asm/tlbflush.h | 13
arch/arm/mm/tlb-v6.S | 2
arch/arm/mm/tlb-v7.S | 2
arch/arm64/Kconfig | 2
arch/arm64/kvm/mmu.c | 2
arch/h8300/kernel/setup.c | 2
arch/ia64/Kconfig | 2
arch/ia64/include/asm/pal.h | 2
arch/ia64/include/asm/spinlock.h | 2
arch/ia64/include/asm/uv/uv_hub.h | 2
arch/ia64/kernel/efi_stub.S | 2
arch/ia64/kernel/mca_drv.c | 2
arch/ia64/kernel/topology.c | 5
arch/ia64/mm/numa.c | 5
arch/m68k/Kconfig.cpu | 10
arch/m68k/include/asm/mmzone.h | 10
arch/m68k/include/asm/page.h | 2
arch/m68k/include/asm/page_mm.h | 35
arch/m68k/include/asm/tlbflush.h | 2
arch/m68k/kernel/sys_m68k.c | 4
arch/m68k/mm/init.c | 20
arch/mips/Kconfig | 2
arch/mips/include/asm/mmzone.h | 8
arch/mips/include/asm/page.h | 2
arch/mips/kernel/traps.c | 4
arch/mips/mm/init.c | 7
arch/nds32/include/asm/memory.h | 6
arch/openrisc/include/asm/tlbflush.h | 2
arch/powerpc/Kconfig | 2
arch/powerpc/include/asm/mmzone.h | 4
arch/powerpc/kernel/setup_64.c | 2
arch/powerpc/kernel/smp.c | 2
arch/powerpc/kexec/core.c | 4
arch/powerpc/kvm/book3s_hv.c | 4
arch/powerpc/kvm/book3s_hv_uvmem.c | 2
arch/powerpc/mm/Makefile | 2
arch/powerpc/mm/mem.c | 4
arch/riscv/Kconfig | 2
arch/s390/Kconfig | 2
arch/s390/include/asm/pgtable.h | 2
arch/sh/include/asm/mmzone.h | 4
arch/sh/kernel/topology.c | 2
arch/sh/mm/Kconfig | 2
arch/sh/mm/init.c | 2
arch/sparc/Kconfig | 2
arch/sparc/include/asm/mmzone.h | 4
arch/sparc/kernel/smp_64.c | 2
arch/sparc/mm/init_64.c | 12
arch/x86/Kconfig | 2
arch/x86/ia32/ia32_aout.c | 4
arch/x86/kernel/cpu/mce/core.c | 13
arch/x86/kernel/cpu/sgx/encl.h | 4
arch/x86/kernel/setup_percpu.c | 6
arch/x86/mm/init_32.c | 4
arch/xtensa/include/asm/page.h | 4
arch/xtensa/include/asm/tlbflush.h | 4
drivers/base/node.c | 18
drivers/block/loop.c | 270 ++++-
drivers/block/loop.h | 15
drivers/dax/device.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c | 4
drivers/gpu/drm/i915/gem/selftests/i915_gem_mman.c | 2
drivers/media/common/videobuf2/frame_vector.c | 2
drivers/misc/sgi-gru/grufault.c | 4
drivers/vfio/vfio_iommu_type1.c | 2
drivers/virtio/virtio_balloon.c | 17
fs/adfs/inode.c | 1
fs/affs/file.c | 2
fs/bfs/file.c | 1
fs/binfmt_aout.c | 4
fs/binfmt_elf.c | 2
fs/binfmt_elf_fdpic.c | 11
fs/binfmt_flat.c | 2
fs/block_dev.c | 1
fs/buffer.c | 25
fs/configfs/inode.c | 8
fs/dax.c | 3
fs/ecryptfs/mmap.c | 13
fs/exfat/inode.c | 1
fs/ext2/inode.c | 4
fs/ext4/inode.c | 2
fs/fat/inode.c | 1
fs/fs-writeback.c | 366 +++++---
fs/fuse/dax.c | 3
fs/gfs2/aops.c | 2
fs/gfs2/meta_io.c | 2
fs/hfs/inode.c | 2
fs/hfsplus/inode.c | 2
fs/hpfs/file.c | 1
fs/iomap/buffered-io.c | 27
fs/jfs/inode.c | 1
fs/kernfs/inode.c | 8
fs/libfs.c | 44
fs/minix/inode.c | 1
fs/nilfs2/mdt.c | 1
fs/ntfs/inode.c | 2
fs/ocfs2/aops.c | 4
fs/ocfs2/cluster/heartbeat.c | 7
fs/ocfs2/cluster/nodemanager.c | 2
fs/ocfs2/dlm/dlmmaster.c | 2
fs/ocfs2/filecheck.c | 6
fs/ocfs2/stackglue.c | 8
fs/omfs/file.c | 1
fs/proc/task_mmu.c | 2
fs/ramfs/inode.c | 9
fs/squashfs/block.c | 5
fs/squashfs/squashfs_fs_sb.h | 1
fs/squashfs/super.c | 86 +
fs/sysv/itree.c | 1
fs/udf/file.c | 1
fs/udf/inode.c | 1
fs/ufs/inode.c | 1
fs/xfs/xfs_aops.c | 4
fs/zonefs/super.c | 4
include/asm-generic/memory_model.h | 37
include/asm-generic/pgtable-nop4d.h | 1
include/asm-generic/topology.h | 2
include/kunit/test.h | 5
include/linux/backing-dev-defs.h | 20
include/linux/cpuhotplug.h | 2
include/linux/fs.h | 6
include/linux/gfp.h | 13
include/linux/iomap.h | 1
include/linux/kasan.h | 7
include/linux/kernel.h | 2
include/linux/kthread.h | 2
include/linux/memblock.h | 6
include/linux/memcontrol.h | 60 -
include/linux/mm.h | 53 -
include/linux/mm_types.h | 10
include/linux/mman.h | 2
include/linux/mmdebug.h | 3
include/linux/mmzone.h | 96 +-
include/linux/page-flags.h | 10
include/linux/page_owner.h | 6
include/linux/page_ref.h | 4
include/linux/page_reporting.h | 3
include/linux/pageblock-flags.h | 2
include/linux/pagemap.h | 4
include/linux/pgtable.h | 22
include/linux/printk.h | 5
include/linux/sched/coredump.h | 8
include/linux/slab.h | 59 +
include/linux/swap.h | 19
include/linux/swapops.h | 5
include/linux/vmstat.h | 69 -
include/linux/writeback.h | 1
include/trace/events/cma.h | 4
include/trace/events/filemap.h | 2
include/trace/events/kmem.h | 12
include/trace/events/page_pool.h | 4
include/trace/events/pagemap.h | 4
include/trace/events/vmscan.h | 2
kernel/cgroup/cgroup.c | 1
kernel/crash_core.c | 4
kernel/events/core.c | 2
kernel/events/uprobes.c | 4
kernel/fork.c | 1
kernel/kthread.c | 19
kernel/sysctl.c | 16
kernel/watchdog.c | 12
lib/Kconfig.debug | 15
lib/Kconfig.kasan | 16
lib/Makefile | 1
lib/dump_stack.c | 20
lib/kunit/test.c | 18
lib/slub_kunit.c | 152 +++
lib/test_hmm.c | 5
lib/test_kasan.c | 11
lib/vsprintf.c | 2
mm/Kconfig | 38
mm/backing-dev.c | 66 +
mm/compaction.c | 2
mm/debug.c | 27
mm/debug_vm_pgtable.c | 63 +
mm/dmapool.c | 5
mm/filemap.c | 2
mm/gup.c | 81 +
mm/hugetlb.c | 2
mm/internal.h | 9
mm/kasan/Makefile | 4
mm/kasan/common.c | 6
mm/kasan/generic.c | 3
mm/kasan/hw_tags.c | 22
mm/kasan/init.c | 6
mm/kasan/kasan.h | 12
mm/kasan/report.c | 6
mm/kasan/report_hw_tags.c | 5
mm/kasan/report_sw_tags.c | 45
mm/kasan/report_tags.c | 51 +
mm/kasan/shadow.c | 6
mm/kasan/sw_tags.c | 45
mm/kasan/tags.c | 59 +
mm/kfence/kfence_test.c | 5
mm/kmemleak.c | 18
mm/ksm.c | 6
mm/memblock.c | 8
mm/memcontrol.c | 385 ++++++--
mm/memory-failure.c | 344 +++++--
mm/memory.c | 22
mm/memory_hotplug.c | 6
mm/mempolicy.c | 4
mm/migrate.c | 4
mm/mmap.c | 54 -
mm/mmap_lock.c | 33
mm/mprotect.c | 52 +
mm/mremap.c | 5
mm/nommu.c | 2
mm/page-writeback.c | 89 +
mm/page_alloc.c | 950 +++++++++++++--------
mm/page_ext.c | 2
mm/page_owner.c | 2
mm/page_reporting.c | 19
mm/page_reporting.h | 5
mm/pagewalk.c | 58 +
mm/shmem.c | 18
mm/slab.h | 24
mm/slab_common.c | 60 -
mm/slub.c | 420 +++++----
mm/sparse.c | 2
mm/swap.c | 4
mm/swap_slots.c | 2
mm/swap_state.c | 20
mm/swapfile.c | 177 +--
mm/vmalloc.c | 181 ++--
mm/vmscan.c | 43
mm/vmstat.c | 282 ++----
mm/workingset.c | 2
net/ipv4/tcp.c | 4
scripts/kconfig/streamline_config.pl | 76 -
scripts/link-vmlinux.sh | 4
scripts/spelling.txt | 16
tools/testing/selftests/vm/gup_test.c | 96 +-
tools/vm/page_owner_sort.c | 4
virt/kvm/kvm_main.c | 2
260 files changed, 3989 insertions(+), 2996 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-07-01 1:46 Andrew Morton
2021-07-03 0:28 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2021-07-01 1:46 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
This is the rest of the -mm tree, less 66 patches which are dependent on
things which are (or were recently) in linux-next. I'll trickle that
material over next week.
192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2 plus the
June 28 sendings.
Subsystems affected by this patch series:
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/kconfig
mm/proc
mm/z3fold
mm/zbud
mm/ras
mm/mempolicy
mm/memblock
mm/migration
mm/thp
mm/nommu
mm/kconfig
mm/madvise
mm/memory-hotplug
mm/zswap
mm/zsmalloc
mm/zram
mm/cleanups
mm/kfence
mm/hmm
procfs
sysctl
misc
core-kernel
lib
lz4
checkpatch
init
kprobes
nilfs2
hfs
signals
exec
kcov
selftests
compress/decompress
ipc
Subsystem: mm/hugetlb
Muchun Song <songmuchun@bytedance.com>:
Patch series "Free some vmemmap pages of HugeTLB page", v23:
mm: memory_hotplug: factor out bootmem core functions to bootmem_info.c
mm: hugetlb: introduce a new config HUGETLB_PAGE_FREE_VMEMMAP
mm: hugetlb: gather discrete indexes of tail page
mm: hugetlb: free the vmemmap pages associated with each HugeTLB page
mm: hugetlb: defer freeing of HugeTLB pages
mm: hugetlb: alloc the vmemmap pages associated with each HugeTLB page
mm: hugetlb: add a kernel parameter hugetlb_free_vmemmap
mm: memory_hotplug: disable memmap_on_memory when hugetlb_free_vmemmap enabled
mm: hugetlb: introduce nr_free_vmemmap_pages in the struct hstate
Shixin Liu <liushixin2@huawei.com>:
mm/debug_vm_pgtable: move {pmd/pud}_huge_tests out of CONFIG_TRANSPARENT_HUGEPAGE
mm/debug_vm_pgtable: remove redundant pfn_{pmd/pte}() and fix one comment mistake
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for huge_memory:, v3:
mm/huge_memory.c: remove dedicated macro HPAGE_CACHE_INDEX_MASK
mm/huge_memory.c: use page->deferred_list
mm/huge_memory.c: add missing read-only THP checking in transparent_hugepage_enabled()
mm/huge_memory.c: remove unnecessary tlb_remove_page_size() for huge zero pmd
mm/huge_memory.c: don't discard hugepage if other processes are mapping it
Christophe Leroy <christophe.leroy@csgroup.eu>:
Patch series "Subject: [PATCH v2 0/5] Implement huge VMAP and VMALLOC on powerpc 8xx", v2:
mm/hugetlb: change parameters of arch_make_huge_pte()
mm/pgtable: add stubs for {pmd/pub}_{set/clear}_huge
mm/vmalloc: enable mapping of huge pages at pte level in vmap
mm/vmalloc: enable mapping of huge pages at pte level in vmalloc
powerpc/8xx: add support for huge pages on VMAP and VMALLOC
Nanyong Sun <sunnanyong@huawei.com>:
khugepaged: selftests: remove debug_cow
Mina Almasry <almasrymina@google.com>:
mm, hugetlb: fix racy resv_huge_pages underflow on UFFDIO_COPY
Muchun Song <songmuchun@bytedance.com>:
Patch series "Split huge PMD mapping of vmemmap pages", v4:
mm: sparsemem: split the huge PMD mapping of vmemmap pages
mm: sparsemem: use huge PMD mapping for vmemmap pages
mm: hugetlb: introduce CONFIG_HUGETLB_PAGE_FREE_VMEMMAP_DEFAULT_ON
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "Fix prep_compound_gigantic_page ref count adjustment":
hugetlb: remove prep_compound_huge_page cleanup
hugetlb: address ref count racing in prep_compound_gigantic_page
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/hwpoison: disable pcp for page_handle_poison()
Subsystem: mm/userfaultfd
Peter Xu <peterx@redhat.com>:
Patch series "userfaultfd/selftests: A few cleanups", v2:
userfaultfd/selftests: use user mode only
userfaultfd/selftests: remove the time() check on delayed uffd
userfaultfd/selftests: dropping VERIFY check in locking_thread
userfaultfd/selftests: only dump counts if mode enabled
userfaultfd/selftests: unify error handling
Patch series "mm/uffd: Misc fix for uffd-wp and one more test":
mm/thp: simplify copying of huge zero page pmd when fork
mm/userfaultfd: fix uffd-wp special cases for fork()
mm/userfaultfd: fail uffd-wp registration if not supported
mm/pagemap: export uffd-wp protection information
userfaultfd/selftests: add pagemap uffd-wp test
Axel Rasmussen <axelrasmussen@google.com>:
Patch series "userfaultfd: add minor fault handling for shmem", v6:
userfaultfd/shmem: combine shmem_{mcopy_atomic,mfill_zeropage}_pte
userfaultfd/shmem: support minor fault registration for shmem
userfaultfd/shmem: support UFFDIO_CONTINUE for shmem
userfaultfd/shmem: advertise shmem minor fault support
userfaultfd/shmem: modify shmem_mfill_atomic_pte to use install_pte()
userfaultfd/selftests: use memfd_create for shmem test type
userfaultfd/selftests: create alias mappings in the shmem test
userfaultfd/selftests: reinitialize test context in each test
userfaultfd/selftests: exercise minor fault handling shmem support
Subsystem: mm/vmscan
Yu Zhao <yuzhao@google.com>:
mm/vmscan.c: fix potential deadlock in reclaim_pages()
include/trace/events/vmscan.h: remove mm_vmscan_inactive_list_is_low
Miaohe Lin <linmiaohe@huawei.com>:
mm: workingset: define macro WORKINGSET_SHIFT
Subsystem: mm/kconfig
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm/kconfig: move HOLES_IN_ZONE into mm
Subsystem: mm/proc
Mike Rapoport <rppt@linux.ibm.com>:
docs: proc.rst: meminfo: briefly describe gaps in memory accounting
David Hildenbrand <david@redhat.com>:
Patch series "fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages", v3:
fs/proc/kcore: drop KCORE_REMAP and KCORE_OTHER
fs/proc/kcore: pfn_is_ram check only applies to KCORE_RAM
fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages
mm: introduce page_offline_(begin|end|freeze|thaw) to synchronize setting PageOffline()
virtio-mem: use page_offline_(start|end) when setting PageOffline()
fs/proc/kcore: use page_offline_(freeze|thaw)
Subsystem: mm/z3fold
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for z3fold":
mm/z3fold: define macro NCHUNKS as TOTAL_CHUNKS - ZHDR_CHUNKS
mm/z3fold: avoid possible underflow in z3fold_alloc()
mm/z3fold: remove magic number in z3fold_create_pool()
mm/z3fold: remove unused function handle_to_z3fold_header()
mm/z3fold: fix potential memory leak in z3fold_destroy_pool()
mm/z3fold: use release_z3fold_page_locked() to release locked z3fold page
Subsystem: mm/zbud
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups for zbud", v2:
mm/zbud: reuse unbuddied[0] as buddied in zbud_pool
mm/zbud: don't export any zbud API
Subsystem: mm/ras
YueHaibing <yuehaibing@huawei.com>:
mm/compaction: use DEVICE_ATTR_WO macro
Liu Xiang <liu.xiang@zlingsmart.com>:
mm: compaction: remove duplicate !list_empty(&sublist) check
Wonhyuk Yang <vvghjk1234@gmail.com>:
mm/compaction: fix 'limit' in fast_isolate_freepages
Subsystem: mm/mempolicy
Feng Tang <feng.tang@intel.com>:
Patch series "mm/mempolicy: some fix and semantics cleanup", v4:
mm/mempolicy: cleanup nodemask intersection check for oom
mm/mempolicy: don't handle MPOL_LOCAL like a fake MPOL_PREFERRED policy
mm/mempolicy: unify the parameter sanity check for mbind and set_mempolicy
Yang Shi <shy828301@gmail.com>:
mm: mempolicy: don't have to split pmd for huge zero page
Ben Widawsky <ben.widawsky@intel.com>:
mm/mempolicy: use unified 'nodes' for bind/interleave/prefer policies
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "arm64: drop pfn_valid_within() and simplify pfn_valid()", v4:
include/linux/mmzone.h: add documentation for pfn_valid()
memblock: update initialization of reserved pages
arm64: decouple check whether pfn is in linear map from pfn_valid()
arm64: drop pfn_valid_within() and simplify pfn_valid()
Anshuman Khandual <anshuman.khandual@arm.com>:
arm64/mm: drop HAVE_ARCH_PFN_VALID
Subsystem: mm/migration
Muchun Song <songmuchun@bytedance.com>:
mm: migrate: fix missing update page_private to hugetlb_page_subpool
Subsystem: mm/thp
Collin Fijalkovich <cfijalkovich@google.com>:
mm, thp: relax the VM_DENYWRITE constraint on file-backed THPs
Yang Shi <shy828301@gmail.com>:
mm: memory: add orig_pmd to struct vm_fault
mm: memory: make numa_migrate_prep() non-static
mm: thp: refactor NUMA fault handling
mm: migrate: account THP NUMA migration counters correctly
mm: migrate: don't split THP for misplaced NUMA page
mm: migrate: check mapcount for THP instead of refcount
mm: thp: skip make PMD PROT_NONE if THP migration is not supported
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/thp: make ARCH_ENABLE_SPLIT_PMD_PTLOCK dependent on PGTABLE_LEVELS > 2
Yang Shi <shy828301@gmail.com>:
mm: rmap: make try_to_unmap() void function
Hugh Dickins <hughd@google.com>:
mm/thp: remap_page() is only needed on anonymous THP
mm: hwpoison_user_mappings() try_to_unmap() with TTU_SYNC
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/thp: fix strncpy warning
Subsystem: mm/nommu
Chen Li <chenli@uniontech.com>:
nommu: remove __GFP_HIGHMEM in vmalloc/vzalloc
Liam Howlett <liam.howlett@oracle.com>:
mm/nommu: unexport do_munmap()
Subsystem: mm/kconfig
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: generalize ZONE_[DMA|DMA32]
Subsystem: mm/madvise
David Hildenbrand <david@redhat.com>:
Patch series "mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables", v2:
mm: make variable names for populate_vma_page_range() consistent
mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables
MAINTAINERS: add tools/testing/selftests/vm/ to MEMORY MANAGEMENT
selftests/vm: add protection_keys_32 / protection_keys_64 to gitignore
selftests/vm: add test for MADV_POPULATE_(READ|WRITE)
Subsystem: mm/memory-hotplug
Liam Mark <lmark@codeaurora.org>:
mm/memory_hotplug: rate limit page migration warnings
Oscar Salvador <osalvador@suse.de>:
mm,memory_hotplug: drop unneeded locking
Subsystem: mm/zswap
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for zswap":
mm/zswap.c: remove unused function zswap_debugfs_exit()
mm/zswap.c: avoid unnecessary copy-in at map time
mm/zswap.c: fix two bugs in zswap_writeback_entry()
Subsystem: mm/zsmalloc
Zhaoyang Huang <zhaoyang.huang@unisoc.com>:
mm: zram: amend SLAB_RECLAIM_ACCOUNT on zspage_cachep
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup for zsmalloc":
mm/zsmalloc.c: remove confusing code in obj_free()
mm/zsmalloc.c: improve readability for async_free_zspage()
Subsystem: mm/zram
Yue Hu <huyue2@yulong.com>:
zram: move backing_dev under macro CONFIG_ZRAM_WRITEBACK
Subsystem: mm/cleanups
Hyeonggon Yoo <42.hyeyoo@gmail.com>:
mm: fix typos and grammar error in comments
Anshuman Khandual <anshuman.khandual@arm.com>:
mm: define default value for FIRST_USER_ADDRESS
Zhen Lei <thunder.leizhen@huawei.com>:
mm: fix spelling mistakes
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Clean W=1 build warnings for mm/":
mm/vmscan: remove kerneldoc-like comment from isolate_lru_pages
mm/vmalloc: include header for prototype of set_iounmap_nonlazy
mm/page_alloc: make should_fail_alloc_page() static
mm/mapping_dirty_helpers: remove double Note in kerneldoc
mm/memcontrol.c: fix kerneldoc comment for mem_cgroup_calculate_protection
mm/memory_hotplug: fix kerneldoc comment for __try_online_node
mm/memory_hotplug: fix kerneldoc comment for __remove_memory
mm/zbud: add kerneldoc fields for zbud_pool
mm/z3fold: add kerneldoc fields for z3fold_pool
mm/swap: make swap_address_space an inline function
mm/mmap_lock: remove dead code for !CONFIG_TRACING configurations
mm/page_alloc: move prototype for find_suitable_fallback
mm/swap: make NODE_DATA an inline function on CONFIG_FLATMEM
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/thp: define default pmd_pgtable()
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: unconditionally use unbound work queue
Subsystem: mm/hmm
Alistair Popple <apopple@nvidia.com>:
Patch series "Add support for SVM atomics in Nouveau", v11:
mm: remove special swap entry functions
mm/swapops: rework swap entry manipulation code
mm/rmap: split try_to_munlock from try_to_unmap
mm/rmap: split migration into its own function
mm: rename migrate_pgmap_owner
mm/memory.c: allow different return codes for copy_nonpresent_pte()
mm: device exclusive memory access
mm: selftests for exclusive device memory
nouveau/svm: refactor nouveau_range_fault
nouveau/svm: implement atomic SVM access
Subsystem: procfs
Marcelo Henrique Cerri <marcelo.cerri@canonical.com>:
proc: Avoid mixing integer types in mem_rw()
ZHOUFENG <zhoufeng.zf@bytedance.com>:
fs/proc/kcore.c: add mmap interface
Kalesh Singh <kaleshsingh@google.com>:
procfs: allow reading fdinfo with PTRACE_MODE_READ
procfs/dmabuf: add inode number to /proc/*/fdinfo
Subsystem: sysctl
Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
sysctl: remove redundant assignment to first
Subsystem: misc
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
drm: include only needed headers in ascii85.h
Subsystem: core-kernel
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: split out panic and oops helpers
Subsystem: lib
Zhen Lei <thunder.leizhen@huawei.com>:
lib: decompress_bunzip2: remove an unneeded semicolon
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
Patch series "lib/string_helpers: get rid of ugly *_escape_mem_ascii()", v3:
lib/string_helpers: switch to use BIT() macro
lib/string_helpers: move ESCAPE_NP check inside 'else' branch in a loop
lib/string_helpers: drop indentation level in string_escape_mem()
lib/string_helpers: introduce ESCAPE_NA for escaping non-ASCII
lib/string_helpers: introduce ESCAPE_NAP to escape non-ASCII and non-printable
lib/string_helpers: allow to append additional characters to be escaped
lib/test-string_helpers: print flags in hexadecimal format
lib/test-string_helpers: get rid of trailing comma in terminators
lib/test-string_helpers: add test cases for new features
MAINTAINERS: add myself as designated reviewer for generic string library
seq_file: introduce seq_escape_mem()
seq_file: add seq_escape_str() as replica of string_escape_str()
seq_file: convert seq_escape() to use seq_escape_str()
nfsd: avoid non-flexible API in seq_quote_mem()
seq_file: drop unused *_escape_mem_ascii()
Trent Piepho <tpiepho@gmail.com>:
lib/math/rational.c: fix divide by zero
lib/math/rational: add Kunit test cases
Zhen Lei <thunder.leizhen@huawei.com>:
lib/decompressors: fix spelling mistakes
lib/mpi: fix spelling mistakes
Alexey Dobriyan <adobriyan@gmail.com>:
lib: memscan() fixlet
lib: uninline simple_strtoull()
Matteo Croce <mcroce@microsoft.com>:
lib/test_string.c: allow module removal
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: split out kstrtox() and simple_strtox() to a separate header
Subsystem: lz4
Rajat Asthana <thisisrast7@gmail.com>:
lz4_decompress: declare LZ4_decompress_safe_withPrefix64k static
Dimitri John Ledkov <dimitri.ledkov@canonical.com>:
lib/decompress_unlz4.c: correctly handle zero-padding around initrds.
Subsystem: checkpatch
Guenter Roeck <linux@roeck-us.net>:
checkpatch: scripts/spdxcheck.py now requires python3
Joe Perches <joe@perches.com>:
checkpatch: improve the indented label test
Guenter Roeck <linux@roeck-us.net>:
checkpatch: do not complain about positive return values starting with EPOLL
Subsystem: init
Andrew Halaney <ahalaney@redhat.com>:
init: print out unknown kernel parameters
Subsystem: kprobes
Barry Song <song.bao.hua@hisilicon.com>:
kprobes: remove duplicated strong free_insn_page in x86 and s390
Subsystem: nilfs2
Colin Ian King <colin.king@canonical.com>:
nilfs2: remove redundant continue statement in a while-loop
Subsystem: hfs
Zhen Lei <thunder.leizhen@huawei.com>:
hfsplus: remove unnecessary oom message
Chung-Chiang Cheng <shepjeng@gmail.com>:
hfsplus: report create_date to kstat.btime
Subsystem: signals
Al Viro <viro@zeniv.linux.org.uk>:
x86: signal: don't do sas_ss_reset() until we are certain that sigframe won't be abandoned
Subsystem: exec
Alexey Dobriyan <adobriyan@gmail.com>:
exec: remove checks in __register_bimfmt()
Subsystem: kcov
Marco Elver <elver@google.com>:
kcov: add __no_sanitize_coverage to fix noinstr for all architectures
Subsystem: selftests
Dave Hansen <dave.hansen@linux.intel.com>:
Patch series "selftests/vm/pkeys: Bug fixes and a new test":
selftests/vm/pkeys: fix alloc_random_pkey() to make it really, really random
selftests/vm/pkeys: handle negative sys_pkey_alloc() return code
selftests/vm/pkeys: refill shadow register after implicit kernel write
selftests/vm/pkeys: exercise x86 XSAVE init state
Subsystem: compress/decompress
Yu Kuai <yukuai3@huawei.com>:
lib/decompressors: remove set but not used variabled 'level'
Subsystem: ipc
Vasily Averin <vvs@virtuozzo.com>:
Patch series "ipc: allocations cleanup", v2:
ipc sem: use kvmalloc for sem_undo allocation
ipc: use kmalloc for msg_queue and shmid_kernel
Manfred Spraul <manfred@colorfullife.com>:
ipc/sem.c: use READ_ONCE()/WRITE_ONCE() for use_global_lock
ipc/util.c: use binary search for max_idx
Documentation/admin-guide/kernel-parameters.txt | 35
Documentation/admin-guide/mm/hugetlbpage.rst | 11
Documentation/admin-guide/mm/memory-hotplug.rst | 13
Documentation/admin-guide/mm/pagemap.rst | 2
Documentation/admin-guide/mm/userfaultfd.rst | 3
Documentation/core-api/kernel-api.rst | 7
Documentation/filesystems/proc.rst | 48
Documentation/vm/hmm.rst | 19
Documentation/vm/unevictable-lru.rst | 33
MAINTAINERS | 10
arch/alpha/Kconfig | 5
arch/alpha/include/asm/pgalloc.h | 1
arch/alpha/include/asm/pgtable.h | 1
arch/alpha/include/uapi/asm/mman.h | 3
arch/alpha/kernel/setup.c | 2
arch/arc/include/asm/pgalloc.h | 2
arch/arc/include/asm/pgtable.h | 8
arch/arm/Kconfig | 3
arch/arm/include/asm/pgalloc.h | 1
arch/arm64/Kconfig | 15
arch/arm64/include/asm/hugetlb.h | 3
arch/arm64/include/asm/memory.h | 2
arch/arm64/include/asm/page.h | 4
arch/arm64/include/asm/pgalloc.h | 1
arch/arm64/include/asm/pgtable.h | 2
arch/arm64/kernel/setup.c | 1
arch/arm64/kvm/mmu.c | 2
arch/arm64/mm/hugetlbpage.c | 5
arch/arm64/mm/init.c | 51
arch/arm64/mm/ioremap.c | 4
arch/arm64/mm/mmu.c | 22
arch/csky/include/asm/pgalloc.h | 2
arch/csky/include/asm/pgtable.h | 1
arch/hexagon/include/asm/pgtable.h | 4
arch/ia64/Kconfig | 7
arch/ia64/include/asm/pal.h | 1
arch/ia64/include/asm/pgalloc.h | 1
arch/ia64/include/asm/pgtable.h | 1
arch/m68k/Kconfig | 5
arch/m68k/include/asm/mcf_pgalloc.h | 2
arch/m68k/include/asm/mcf_pgtable.h | 2
arch/m68k/include/asm/motorola_pgalloc.h | 1
arch/m68k/include/asm/motorola_pgtable.h | 2
arch/m68k/include/asm/pgtable_mm.h | 1
arch/m68k/include/asm/sun3_pgalloc.h | 1
arch/microblaze/Kconfig | 4
arch/microblaze/include/asm/pgalloc.h | 2
arch/microblaze/include/asm/pgtable.h | 2
arch/mips/Kconfig | 10
arch/mips/include/asm/pgalloc.h | 1
arch/mips/include/asm/pgtable-32.h | 1
arch/mips/include/asm/pgtable-64.h | 1
arch/mips/include/uapi/asm/mman.h | 3
arch/mips/kernel/relocate.c | 1
arch/mips/sgi-ip22/ip22-reset.c | 1
arch/mips/sgi-ip32/ip32-reset.c | 1
arch/nds32/include/asm/pgalloc.h | 5
arch/nios2/include/asm/pgalloc.h | 1
arch/nios2/include/asm/pgtable.h | 2
arch/openrisc/include/asm/pgalloc.h | 2
arch/openrisc/include/asm/pgtable.h | 1
arch/parisc/include/asm/pgalloc.h | 1
arch/parisc/include/asm/pgtable.h | 2
arch/parisc/include/uapi/asm/mman.h | 3
arch/parisc/kernel/pdc_chassis.c | 1
arch/powerpc/Kconfig | 6
arch/powerpc/include/asm/book3s/pgtable.h | 1
arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h | 5
arch/powerpc/include/asm/nohash/32/mmu-8xx.h | 43
arch/powerpc/include/asm/nohash/32/pgtable.h | 1
arch/powerpc/include/asm/nohash/64/pgtable.h | 2
arch/powerpc/include/asm/pgalloc.h | 5
arch/powerpc/include/asm/pgtable.h | 6
arch/powerpc/kernel/setup-common.c | 1
arch/powerpc/platforms/Kconfig.cputype | 1
arch/riscv/Kconfig | 5
arch/riscv/include/asm/pgalloc.h | 2
arch/riscv/include/asm/pgtable.h | 2
arch/s390/Kconfig | 6
arch/s390/include/asm/pgalloc.h | 3
arch/s390/include/asm/pgtable.h | 5
arch/s390/kernel/ipl.c | 1
arch/s390/kernel/kprobes.c | 5
arch/s390/mm/pgtable.c | 2
arch/sh/include/asm/pgalloc.h | 1
arch/sh/include/asm/pgtable.h | 2
arch/sparc/Kconfig | 5
arch/sparc/include/asm/pgalloc_32.h | 1
arch/sparc/include/asm/pgalloc_64.h | 1
arch/sparc/include/asm/pgtable_32.h | 3
arch/sparc/include/asm/pgtable_64.h | 8
arch/sparc/kernel/sstate.c | 1
arch/sparc/mm/hugetlbpage.c | 6
arch/sparc/mm/init_64.c | 1
arch/um/drivers/mconsole_kern.c | 1
arch/um/include/asm/pgalloc.h | 1
arch/um/include/asm/pgtable-2level.h | 1
arch/um/include/asm/pgtable-3level.h | 1
arch/um/kernel/um_arch.c | 1
arch/x86/Kconfig | 17
arch/x86/include/asm/desc.h | 1
arch/x86/include/asm/pgalloc.h | 2
arch/x86/include/asm/pgtable_types.h | 2
arch/x86/kernel/cpu/mshyperv.c | 1
arch/x86/kernel/kprobes/core.c | 6
arch/x86/kernel/setup.c | 1
arch/x86/mm/init_64.c | 21
arch/x86/mm/pgtable.c | 34
arch/x86/purgatory/purgatory.c | 2
arch/x86/xen/enlighten.c | 1
arch/xtensa/include/asm/pgalloc.h | 2
arch/xtensa/include/asm/pgtable.h | 1
arch/xtensa/include/uapi/asm/mman.h | 3
arch/xtensa/platforms/iss/setup.c | 1
drivers/block/zram/zram_drv.h | 2
drivers/bus/brcmstb_gisb.c | 1
drivers/char/ipmi/ipmi_msghandler.c | 1
drivers/clk/analogbits/wrpll-cln28hpc.c | 4
drivers/edac/altera_edac.c | 1
drivers/firmware/google/gsmi.c | 1
drivers/gpu/drm/nouveau/include/nvif/if000c.h | 1
drivers/gpu/drm/nouveau/nouveau_svm.c | 162 ++-
drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmm.h | 1
drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmmgp100.c | 6
drivers/hv/vmbus_drv.c | 1
drivers/hwtracing/coresight/coresight-cpu-debug.c | 1
drivers/leds/trigger/ledtrig-activity.c | 1
drivers/leds/trigger/ledtrig-heartbeat.c | 1
drivers/leds/trigger/ledtrig-panic.c | 1
drivers/misc/bcm-vk/bcm_vk_dev.c | 1
drivers/misc/ibmasm/heartbeat.c | 1
drivers/misc/pvpanic/pvpanic.c | 1
drivers/net/ipa/ipa_smp2p.c | 1
drivers/parisc/power.c | 1
drivers/power/reset/ltc2952-poweroff.c | 1
drivers/remoteproc/remoteproc_core.c | 1
drivers/s390/char/con3215.c | 1
drivers/s390/char/con3270.c | 1
drivers/s390/char/sclp.c | 1
drivers/s390/char/sclp_con.c | 1
drivers/s390/char/sclp_vt220.c | 1
drivers/s390/char/zcore.c | 1
drivers/soc/bcm/brcmstb/pm/pm-arm.c | 1
drivers/staging/olpc_dcon/olpc_dcon.c | 1
drivers/video/fbdev/hyperv_fb.c | 1
drivers/virtio/virtio_mem.c | 2
fs/Kconfig | 15
fs/exec.c | 3
fs/hfsplus/inode.c | 5
fs/hfsplus/xattr.c | 1
fs/nfsd/nfs4state.c | 2
fs/nilfs2/btree.c | 1
fs/open.c | 13
fs/proc/base.c | 6
fs/proc/fd.c | 20
fs/proc/kcore.c | 136 ++
fs/proc/task_mmu.c | 34
fs/seq_file.c | 43
fs/userfaultfd.c | 15
include/asm-generic/bug.h | 3
include/linux/ascii85.h | 3
include/linux/bootmem_info.h | 68 +
include/linux/compat.h | 2
include/linux/compiler-clang.h | 17
include/linux/compiler-gcc.h | 6
include/linux/compiler_types.h | 2
include/linux/huge_mm.h | 74 -
include/linux/hugetlb.h | 80 +
include/linux/hugetlb_cgroup.h | 19
include/linux/kcore.h | 3
include/linux/kernel.h | 227 ----
include/linux/kprobes.h | 1
include/linux/kstrtox.h | 155 ++
include/linux/memblock.h | 4
include/linux/memory_hotplug.h | 27
include/linux/mempolicy.h | 9
include/linux/memremap.h | 2
include/linux/migrate.h | 27
include/linux/mm.h | 18
include/linux/mm_types.h | 2
include/linux/mmu_notifier.h | 26
include/linux/mmzone.h | 27
include/linux/mpi.h | 4
include/linux/page-flags.h | 22
include/linux/panic.h | 98 +
include/linux/panic_notifier.h | 12
include/linux/pgtable.h | 44
include/linux/rmap.h | 13
include/linux/seq_file.h | 10
include/linux/shmem_fs.h | 19
include/linux/signal.h | 2
include/linux/string.h | 7
include/linux/string_helpers.h | 31
include/linux/sunrpc/cache.h | 1
include/linux/swap.h | 19
include/linux/swapops.h | 171 +--
include/linux/thread_info.h | 1
include/linux/userfaultfd_k.h | 5
include/linux/vmalloc.h | 15
include/linux/zbud.h | 23
include/trace/events/vmscan.h | 41
include/uapi/asm-generic/mman-common.h | 3
include/uapi/linux/mempolicy.h | 1
include/uapi/linux/userfaultfd.h | 7
init/main.c | 42
ipc/msg.c | 6
ipc/sem.c | 25
ipc/shm.c | 6
ipc/util.c | 44
ipc/util.h | 3
kernel/hung_task.c | 1
kernel/kexec_core.c | 1
kernel/kprobes.c | 2
kernel/panic.c | 1
kernel/rcu/tree.c | 2
kernel/signal.c | 14
kernel/sysctl.c | 4
kernel/trace/trace.c | 1
lib/Kconfig.debug | 12
lib/decompress_bunzip2.c | 6
lib/decompress_unlz4.c | 8
lib/decompress_unlzo.c | 3
lib/decompress_unxz.c | 2
lib/decompress_unzstd.c | 4
lib/kstrtox.c | 5
lib/lz4/lz4_decompress.c | 2
lib/math/Makefile | 1
lib/math/rational-test.c | 56 +
lib/math/rational.c | 16
lib/mpi/longlong.h | 4
lib/mpi/mpicoder.c | 6
lib/mpi/mpiutil.c | 2
lib/parser.c | 1
lib/string.c | 2
lib/string_helpers.c | 142 +-
lib/test-string_helpers.c | 157 ++-
lib/test_hmm.c | 127 ++
lib/test_hmm_uapi.h | 2
lib/test_string.c | 5
lib/vsprintf.c | 1
lib/xz/xz_dec_bcj.c | 2
lib/xz/xz_dec_lzma2.c | 8
lib/zlib_inflate/inffast.c | 2
lib/zstd/huf.h | 2
mm/Kconfig | 16
mm/Makefile | 2
mm/bootmem_info.c | 127 ++
mm/compaction.c | 20
mm/debug_vm_pgtable.c | 109 --
mm/gup.c | 58 +
mm/hmm.c | 12
mm/huge_memory.c | 269 ++---
mm/hugetlb.c | 369 +++++--
mm/hugetlb_vmemmap.c | 332 ++++++
mm/hugetlb_vmemmap.h | 53 -
mm/internal.h | 29
mm/kfence/core.c | 4
mm/khugepaged.c | 20
mm/madvise.c | 66 +
mm/mapping_dirty_helpers.c | 2
mm/memblock.c | 28
mm/memcontrol.c | 4
mm/memory-failure.c | 38
mm/memory.c | 239 +++-
mm/memory_hotplug.c | 161 ---
mm/mempolicy.c | 323 ++----
mm/migrate.c | 268 +----
mm/mlock.c | 12
mm/mmap_lock.c | 59 -
mm/mprotect.c | 18
mm/nommu.c | 5
mm/oom_kill.c | 2
mm/page_alloc.c | 5
mm/page_vma_mapped.c | 15
mm/rmap.c | 644 +++++++++---
mm/shmem.c | 125 --
mm/sparse-vmemmap.c | 432 +++++++-
mm/sparse.c | 1
mm/swap.c | 2
mm/swapfile.c | 2
mm/userfaultfd.c | 249 ++--
mm/util.c | 40
mm/vmalloc.c | 37
mm/vmscan.c | 20
mm/workingset.c | 10
mm/z3fold.c | 39
mm/zbud.c | 235 ++--
mm/zsmalloc.c | 5
mm/zswap.c | 26
scripts/checkpatch.pl | 16
tools/testing/selftests/vm/.gitignore | 3
tools/testing/selftests/vm/Makefile | 5
tools/testing/selftests/vm/hmm-tests.c | 158 +++
tools/testing/selftests/vm/khugepaged.c | 4
tools/testing/selftests/vm/madv_populate.c | 342 ++++++
tools/testing/selftests/vm/pkey-x86.h | 1
tools/testing/selftests/vm/protection_keys.c | 85 +
tools/testing/selftests/vm/run_vmtests.sh | 16
tools/testing/selftests/vm/userfaultfd.c | 1094 ++++++++++-----------
299 files changed, 6277 insertions(+), 3183 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-07-01 1:46 incoming Andrew Morton
@ 2021-07-03 0:28 ` Linus Torvalds
2021-07-03 1:06 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2021-07-03 0:28 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Wed, Jun 30, 2021 at 6:46 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> This is the rest of the -mm tree, less 66 patches which are dependent on
> things which are (or were recently) in linux-next. I'll trickle that
> material over next week.
I haven't bisected this yet, but with the current -git I'm getting
watchdog: BUG: soft lockup - CPU#41 stuck for 49s!
and the common call chain seems to be in flush_tlb_mm_range ->
on_each_cpu_cond_mask.
Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking
at the pulls and merges I've done since, this -mm series looks like
the obvious culprit.
I'll go start bisection, but I thought I'd give a heads-up in case
somebody else has seen TLB-flush-related lockups and already figured
out the guilty party..
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-07-03 0:28 ` incoming Linus Torvalds
@ 2021-07-03 1:06 ` Linus Torvalds
0 siblings, 0 replies; 348+ messages in thread
From: Linus Torvalds @ 2021-07-03 1:06 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Fri, Jul 2, 2021 at 5:28 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking
> at the pulls and merges I've done since, this -mm series looks like
> the obvious culprit.
No, unless my bisection is wrong, the -mm branch is innocent, and was
discarded from the suspects on the very first bisection trial.
So never mind.
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-07-08 0:59 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-07-08 0:59 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
54 patches, based on a931dd33d370896a683236bba67c0d6f3d01144d.
Subsystems affected by this patch series:
lib
mm/slub
mm/secretmem
mm/cleanups
mm/init
debug
mm/pagemap
mm/mremap
Subsystem: lib
Zhen Lei <thunder.leizhen@huawei.com>:
lib/test: fix spelling mistakes
lib: fix spelling mistakes
lib: fix spelling mistakes in header files
Subsystem: mm/slub
Nathan Chancellor <nathan@kernel.org>:
Patch series "hexagon: Fix build error with CONFIG_STACKDEPOT and select CONFIG_ARCH_WANT_LD_ORPHAN_WARN":
hexagon: handle {,SOFT}IRQENTRY_TEXT in linker script
hexagon: use common DISCARDS macro
hexagon: select ARCH_WANT_LD_ORPHAN_WARN
Oliver Glitta <glittao@gmail.com>:
mm/slub: use stackdepot to save stack trace in objects
Subsystem: mm/secretmem
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: introduce memfd_secret system call to create "secret" memory areas", v20:
mmap: make mlock_future_check() global
riscv/Kconfig: make direct map manipulation options depend on MMU
set_memory: allow querying whether set_direct_map_*() is actually enabled
mm: introduce memfd_secret system call to create "secret" memory areas
PM: hibernate: disable when there are active secretmem users
arch, mm: wire up memfd_secret system call where relevant
secretmem: test: add basic selftest for memfd_secret(2)
Subsystem: mm/cleanups
Zhen Lei <thunder.leizhen@huawei.com>:
mm: fix spelling mistakes in header files
Subsystem: mm/init
Kefeng Wang <wangkefeng.wang@huawei.com>:
Patch series "init_mm: cleanup ARCH's text/data/brk setup code", v3:
mm: add setup_initial_init_mm() helper
arc: convert to setup_initial_init_mm()
arm: convert to setup_initial_init_mm()
arm64: convert to setup_initial_init_mm()
csky: convert to setup_initial_init_mm()
h8300: convert to setup_initial_init_mm()
m68k: convert to setup_initial_init_mm()
nds32: convert to setup_initial_init_mm()
nios2: convert to setup_initial_init_mm()
openrisc: convert to setup_initial_init_mm()
powerpc: convert to setup_initial_init_mm()
riscv: convert to setup_initial_init_mm()
s390: convert to setup_initial_init_mm()
sh: convert to setup_initial_init_mm()
x86: convert to setup_initial_init_mm()
Subsystem: debug
Stephen Boyd <swboyd@chromium.org>:
Patch series "Add build ID to stacktraces", v6:
buildid: only consider GNU notes for build ID parsing
buildid: add API to parse build ID out of buffer
buildid: stash away kernels build ID on init
dump_stack: add vmlinux build ID to stack traces
module: add printk formats to add module build ID to stacktraces
arm64: stacktrace: use %pSb for backtrace printing
x86/dumpstack: use %pSb/%pBb for backtrace printing
scripts/decode_stacktrace.sh: support debuginfod
scripts/decode_stacktrace.sh: silence stderr messages from addr2line/nm
scripts/decode_stacktrace.sh: indicate 'auto' can be used for base path
buildid: mark some arguments const
buildid: fix kernel-doc notation
kdump: use vmlinux_build_id to simplify
Subsystem: mm/pagemap
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm: rename pud_page_vaddr to pud_pgtable and make it return pmd_t *
mm: rename p4d_page_vaddr to p4d_pgtable and make it return pud_t *
Subsystem: mm/mremap
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "mrermap fixes", v2:
selftest/mremap_test: update the test to handle pagesize other than 4K
selftest/mremap_test: avoid crash with static build
mm/mremap: convert huge PUD move to separate helper
mm/mremap: don't enable optimized PUD move if page table levels is 2
mm/mremap: use pmd/pud_poplulate to update page table entries
mm/mremap: hold the rmap lock in write mode when moving page table entries.
Patch series "Speedup mremap on ppc64", v8:
mm/mremap: allow arch runtime override
powerpc/book3s64/mm: update flush_tlb_range to flush page walk cache
powerpc/mm: enable HAVE_MOVE_PMD support
Documentation/core-api/printk-formats.rst | 11
arch/alpha/include/asm/pgtable.h | 8
arch/arc/mm/init.c | 5
arch/arm/include/asm/pgtable-3level.h | 2
arch/arm/kernel/setup.c | 5
arch/arm64/include/asm/Kbuild | 1
arch/arm64/include/asm/cacheflush.h | 6
arch/arm64/include/asm/kfence.h | 2
arch/arm64/include/asm/pgtable.h | 8
arch/arm64/include/asm/set_memory.h | 17 +
arch/arm64/include/uapi/asm/unistd.h | 1
arch/arm64/kernel/machine_kexec.c | 1
arch/arm64/kernel/setup.c | 5
arch/arm64/kernel/stacktrace.c | 2
arch/arm64/mm/mmu.c | 7
arch/arm64/mm/pageattr.c | 13
arch/csky/kernel/setup.c | 5
arch/h8300/kernel/setup.c | 5
arch/hexagon/Kconfig | 1
arch/hexagon/kernel/vmlinux.lds.S | 9
arch/ia64/include/asm/pgtable.h | 4
arch/m68k/include/asm/motorola_pgtable.h | 2
arch/m68k/kernel/setup_mm.c | 5
arch/m68k/kernel/setup_no.c | 5
arch/mips/include/asm/pgtable-64.h | 8
arch/nds32/kernel/setup.c | 5
arch/nios2/kernel/setup.c | 5
arch/openrisc/kernel/setup.c | 5
arch/parisc/include/asm/pgtable.h | 4
arch/powerpc/include/asm/book3s/64/pgtable.h | 11
arch/powerpc/include/asm/book3s/64/tlbflush-radix.h | 2
arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 6
arch/powerpc/include/asm/nohash/64/pgtable.h | 6
arch/powerpc/include/asm/tlb.h | 6
arch/powerpc/kernel/setup-common.c | 5
arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 8
arch/powerpc/mm/book3s64/radix_pgtable.c | 6
arch/powerpc/mm/book3s64/radix_tlb.c | 44 +-
arch/powerpc/mm/pgtable_64.c | 4
arch/powerpc/platforms/Kconfig.cputype | 2
arch/riscv/Kconfig | 4
arch/riscv/include/asm/pgtable-64.h | 4
arch/riscv/include/asm/unistd.h | 1
arch/riscv/kernel/setup.c | 5
arch/s390/kernel/setup.c | 5
arch/sh/include/asm/pgtable-3level.h | 4
arch/sh/kernel/setup.c | 5
arch/sparc/include/asm/pgtable_32.h | 6
arch/sparc/include/asm/pgtable_64.h | 10
arch/um/include/asm/pgtable-3level.h | 2
arch/x86/entry/syscalls/syscall_32.tbl | 1
arch/x86/entry/syscalls/syscall_64.tbl | 1
arch/x86/include/asm/pgtable.h | 8
arch/x86/kernel/dumpstack.c | 2
arch/x86/kernel/setup.c | 5
arch/x86/mm/init_64.c | 4
arch/x86/mm/pat/set_memory.c | 4
arch/x86/mm/pgtable.c | 2
include/asm-generic/pgtable-nop4d.h | 2
include/asm-generic/pgtable-nopmd.h | 2
include/asm-generic/pgtable-nopud.h | 4
include/linux/bootconfig.h | 4
include/linux/buildid.h | 10
include/linux/compaction.h | 4
include/linux/cpumask.h | 2
include/linux/crash_core.h | 12
include/linux/debugobjects.h | 2
include/linux/hmm.h | 2
include/linux/hugetlb.h | 6
include/linux/kallsyms.h | 21 +
include/linux/list_lru.h | 4
include/linux/lru_cache.h | 8
include/linux/mm.h | 3
include/linux/mmu_notifier.h | 8
include/linux/module.h | 9
include/linux/nodemask.h | 6
include/linux/percpu-defs.h | 2
include/linux/percpu-refcount.h | 2
include/linux/pgtable.h | 4
include/linux/scatterlist.h | 2
include/linux/secretmem.h | 54 +++
include/linux/set_memory.h | 12
include/linux/shrinker.h | 2
include/linux/syscalls.h | 1
include/linux/vmalloc.h | 4
include/uapi/asm-generic/unistd.h | 7
include/uapi/linux/magic.h | 1
init/Kconfig | 1
init/main.c | 2
kernel/crash_core.c | 50 ---
kernel/kallsyms.c | 104 +++++--
kernel/module.c | 42 ++
kernel/power/hibernate.c | 5
kernel/sys_ni.c | 2
lib/Kconfig.debug | 17 -
lib/asn1_encoder.c | 2
lib/buildid.c | 80 ++++-
lib/devres.c | 2
lib/dump_stack.c | 13
lib/dynamic_debug.c | 2
lib/fonts/font_pearl_8x8.c | 2
lib/kfifo.c | 2
lib/list_sort.c | 2
lib/nlattr.c | 4
lib/oid_registry.c | 2
lib/pldmfw/pldmfw.c | 2
lib/reed_solomon/test_rslib.c | 2
lib/refcount.c | 2
lib/rhashtable.c | 2
lib/sbitmap.c | 2
lib/scatterlist.c | 4
lib/seq_buf.c | 2
lib/sort.c | 2
lib/stackdepot.c | 2
lib/test_bitops.c | 2
lib/test_bpf.c | 2
lib/test_kasan.c | 2
lib/test_kmod.c | 6
lib/test_scanf.c | 2
lib/vsprintf.c | 10
mm/Kconfig | 4
mm/Makefile | 1
mm/gup.c | 12
mm/init-mm.c | 9
mm/internal.h | 3
mm/mlock.c | 3
mm/mmap.c | 5
mm/mremap.c | 108 ++++++-
mm/secretmem.c | 254 +++++++++++++++++
mm/slub.c | 79 +++--
scripts/checksyscalls.sh | 4
scripts/decode_stacktrace.sh | 89 +++++-
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 3
tools/testing/selftests/vm/memfd_secret.c | 296 ++++++++++++++++++++
tools/testing/selftests/vm/mremap_test.c | 116 ++++---
tools/testing/selftests/vm/run_vmtests.sh | 17 +
137 files changed, 1470 insertions(+), 442 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-07-15 4:26 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-07-15 4:26 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
13 patches, based on 40226a3d96ef8ab8980f032681c8bfd46d63874e.
Subsystems affected by this patch series:
mm/kasan
mm/pagealloc
mm/rmap
mm/hmm
hfs
mm/hugetlb
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
mm: move helper to check slub_debug_enabled
Yee Lee <yee.lee@mediatek.com>:
kasan: add memzero init for unaligned size at DEBUG
Marco Elver <elver@google.com>:
kasan: fix build by including kernel.h
Subsystem: mm/pagealloc
Matteo Croce <mcroce@microsoft.com>:
Revert "mm/page_alloc: make should_fail_alloc_page() static"
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: avoid page allocator recursion with pagesets.lock held
Yanfei Xu <yanfei.xu@windriver.com>:
mm/page_alloc: correct return value when failing at preparing
Chuck Lever <chuck.lever@oracle.com>:
mm/page_alloc: further fix __alloc_pages_bulk() return value
Subsystem: mm/rmap
Christoph Hellwig <hch@lst.de>:
mm: fix the try_to_unmap prototype for !CONFIG_MMU
Subsystem: mm/hmm
Alistair Popple <apopple@nvidia.com>:
lib/test_hmm: remove set but unused page variable
Subsystem: hfs
Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>:
Patch series "hfs: fix various errors", v2:
hfs: add missing clean-up in hfs_fill_super
hfs: fix high memory mapping in hfs_bnode_read
hfs: add lock nesting notation to hfs_find_init
Subsystem: mm/hugetlb
Joao Martins <joao.m.martins@oracle.com>:
mm/hugetlb: fix refs calculation from unaligned @vaddr
fs/hfs/bfind.c | 14 +++++++++++++-
fs/hfs/bnode.c | 25 ++++++++++++++++++++-----
fs/hfs/btree.h | 7 +++++++
fs/hfs/super.c | 10 +++++-----
include/linux/kasan.h | 1 +
include/linux/rmap.h | 4 +++-
lib/test_hmm.c | 2 --
mm/hugetlb.c | 5 +++--
mm/kasan/kasan.h | 12 ++++++++++++
mm/page_alloc.c | 30 ++++++++++++++++++++++--------
mm/slab.h | 15 +++++++++++----
mm/slub.c | 14 --------------
12 files changed, 97 insertions(+), 42 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-07-23 22:49 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-07-23 22:49 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
15 patches, based on 704f4cba43d4ed31ef4beb422313f1263d87bc55.
Subsystems affected by this patch series:
mm/userfaultfd
mm/kfence
mm/highmem
mm/pagealloc
mm/memblock
mm/pagecache
mm/secretmem
mm/pagemap
mm/hugetlbfs
Subsystem: mm/userfaultfd
Peter Collingbourne <pcc@google.com>:
Patch series "userfaultfd: do not untag user pointers", v5:
userfaultfd: do not untag user pointers
selftest: use mmap instead of posix_memalign to allocate memory
Subsystem: mm/kfence
Weizhao Ouyang <o451686892@gmail.com>:
kfence: defer kfence_test_init to ensure that kunit debugfs is created
Alexander Potapenko <glider@google.com>:
kfence: move the size check to the beginning of __kfence_alloc()
kfence: skip all GFP_ZONEMASK allocations
Subsystem: mm/highmem
Christoph Hellwig <hch@lst.de>:
mm: call flush_dcache_page() in memcpy_to_page() and memzero_page()
mm: use kmap_local_page in memzero_page
Subsystem: mm/pagealloc
Sergei Trofimovich <slyfox@gentoo.org>:
mm: page_alloc: fix page_poison=1 / INIT_ON_ALLOC_DEFAULT_ON interaction
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
memblock: make for_each_mem_range() traverse MEMBLOCK_HOTPLUG regions
Subsystem: mm/pagecache
Roman Gushchin <guro@fb.com>:
writeback, cgroup: remove wb from offline list before releasing refcnt
writeback, cgroup: do not reparent dax inodes
Subsystem: mm/secretmem
Mike Rapoport <rppt@linux.ibm.com>:
mm/secretmem: wire up ->set_page_dirty
Subsystem: mm/pagemap
Muchun Song <songmuchun@bytedance.com>:
mm: mmap_lock: fix disabling preemption directly
Qi Zheng <zhengqi.arch@bytedance.com>:
mm: fix the deadlock in finish_fault()
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlbfs: fix mount mode command line processing
Documentation/arm64/tagged-address-abi.rst | 26 ++++++++++++++++++--------
fs/fs-writeback.c | 3 +++
fs/hugetlbfs/inode.c | 2 +-
fs/userfaultfd.c | 26 ++++++++++++--------------
include/linux/highmem.h | 6 ++++--
include/linux/memblock.h | 4 ++--
mm/backing-dev.c | 2 +-
mm/kfence/core.c | 19 ++++++++++++++++---
mm/kfence/kfence_test.c | 2 +-
mm/memblock.c | 3 ++-
mm/memory.c | 11 ++++++++++-
mm/mmap_lock.c | 4 ++--
mm/page_alloc.c | 29 ++++++++++++++++-------------
mm/secretmem.c | 1 +
tools/testing/selftests/vm/userfaultfd.c | 6 ++++--
15 files changed, 93 insertions(+), 51 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-07-29 21:52 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-07-29 21:52 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
7 patches, based on 7e96bf476270aecea66740a083e51b38c1371cd2.
Subsystems affected by this patch series:
lib
ocfs2
mm/memcg
mm/migration
mm/slub
mm/memcg
Subsystem: lib
Matteo Croce <mcroce@microsoft.com>:
lib/test_string.c: move string selftest in the Runtime Testing menu
Subsystem: ocfs2
Junxiao Bi <junxiao.bi@oracle.com>:
ocfs2: fix zero out valid data
ocfs2: issue zeroout to EOF blocks
Subsystem: mm/memcg
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: fix blocking rstat function called from atomic cgroup1 thresholding code
Subsystem: mm/migration
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/migrate: fix NR_ISOLATED corruption on 64-bit
Subsystem: mm/slub
Shakeel Butt <shakeelb@google.com>:
slub: fix unreclaimable slab stat for bulk free
Subsystem: mm/memcg
Wang Hai <wanghai38@huawei.com>:
mm/memcg: fix NULL pointer dereference in memcg_slab_free_hook()
fs/ocfs2/file.c | 103 ++++++++++++++++++++++++++++++++----------------------
lib/Kconfig | 3 -
lib/Kconfig.debug | 3 +
mm/memcontrol.c | 3 +
mm/migrate.c | 2 -
mm/slab.h | 2 -
mm/slub.c | 22 ++++++-----
7 files changed, 81 insertions(+), 57 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-08-13 23:53 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-08-13 23:53 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
7 patches, based on f8e6dfc64f6135d1b6c5215c14cd30b9b60a0008.
Subsystems affected by this patch series:
mm/kasan
mm/slub
mm/madvise
mm/memcg
lib
Subsystem: mm/kasan
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
Patch series "kasan, slub: reset tag when printing address", v3:
kasan, kmemleak: reset tags when scanning block
kasan, slub: reset tag when printing address
Subsystem: mm/slub
Shakeel Butt <shakeelb@google.com>:
slub: fix kmalloc_pagealloc_invalid_free unit test
Vlastimil Babka <vbabka@suse.cz>:
mm: slub: fix slub_debug disabling for list of slabs
Subsystem: mm/madvise
David Hildenbrand <david@redhat.com>:
mm/madvise: report SIGBUS as -EFAULT for MADV_POPULATE_(READ|WRITE)
Subsystem: mm/memcg
Waiman Long <longman@redhat.com>:
mm/memcg: fix incorrect flushing of lruvec data in obj_stock
Subsystem: lib
Liang Wang <wangliang101@huawei.com>:
lib: use PFN_PHYS() in devmem_is_allowed()
lib/devmem_is_allowed.c | 2 +-
mm/gup.c | 7 +++++--
mm/kmemleak.c | 6 +++---
mm/madvise.c | 4 +++-
mm/memcontrol.c | 6 ++++--
mm/slub.c | 25 ++++++++++++++-----------
6 files changed, 30 insertions(+), 20 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-08-20 2:03 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-08-20 2:03 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
10 patches, based on 614cb2751d3150850d459bee596c397f344a7936.
Subsystems affected by this patch series:
mm/shmem
mm/pagealloc
mm/tracing
MAINTAINERS
mm/memcg
mm/memory-failure
mm/vmscan
mm/kfence
mm/hugetlb
Subsystem: mm/shmem
Yang Shi <shy828301@gmail.com>:
Revert "mm/shmem: fix shmem_swapin() race with swapoff"
Revert "mm: swap: check if swap backing device is congested or not"
Subsystem: mm/pagealloc
Doug Berger <opendmb@gmail.com>:
mm/page_alloc: don't corrupt pcppage_migratetype
Subsystem: mm/tracing
Mike Rapoport <rppt@linux.ibm.com>:
mmflags.h: add missing __GFP_ZEROTAGS and __GFP_SKIP_KASAN_POISON names
Subsystem: MAINTAINERS
Nathan Chancellor <nathan@kernel.org>:
MAINTAINERS: update ClangBuiltLinux IRC chat
Subsystem: mm/memcg
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: fix occasional OOMs due to proportional memory.low reclaim
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/hwpoison: retry with shake_page() for unhandlable pages
Subsystem: mm/vmscan
Johannes Weiner <hannes@cmpxchg.org>:
mm: vmscan: fix missing psi annotation for node_reclaim()
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: fix is_kfence_address() for addresses below KFENCE_POOL_SIZE
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: don't pass page cache pages to restore_reserve_on_error
MAINTAINERS | 2 +-
include/linux/kfence.h | 7 ++++---
include/linux/memcontrol.h | 29 +++++++++++++++--------------
include/trace/events/mmflags.h | 4 +++-
mm/hugetlb.c | 19 ++++++++++++++-----
mm/memory-failure.c | 12 +++++++++---
mm/page_alloc.c | 25 ++++++++++++-------------
mm/shmem.c | 14 +-------------
mm/swap_state.c | 7 -------
mm/vmscan.c | 30 ++++++++++++++++++++++--------
10 files changed, 81 insertions(+), 68 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-08-25 19:17 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-08-25 19:17 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
2 patches, based on 6e764bcd1cf72a2846c0e53d3975a09b242c04c9.
Subsystems affected by this patch series:
mm/memory-hotplug
MAINTAINERS
Subsystem: mm/memory-hotplug
Miaohe Lin <linmiaohe@huawei.com>:
mm/memory_hotplug: fix potential permanent lru cache disable
Subsystem: MAINTAINERS
Namjae Jeon <namjae.jeon@samsung.com>:
MAINTAINERS: exfat: update my email address
MAINTAINERS | 2 +-
mm/memory_hotplug.c | 1 +
2 files changed, 2 insertions(+), 1 deletion(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-09-02 21:48 Andrew Morton
2021-09-02 21:49 ` incoming Andrew Morton
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2021-09-02 21:48 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b.
Subsystems affected by this patch series:
ia64
ocfs2
block
mm/slub
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/shmem
mm/memcg
mm/selftests
mm/pagemap
mm/mremap
mm/bootmem
mm/sparsemem
mm/vmalloc
mm/kasan
mm/pagealloc
mm/memory-failure
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/compaction
mm/mempolicy
mm/memblock
mm/oom-kill
mm/migration
mm/ksm
mm/percpu
mm/vmstat
mm/madvise
Subsystem: ia64
Jason Wang <wangborong@cdjrlc.com>:
ia64: fix typo in a comment
Geert Uytterhoeven <geert+renesas@glider.be>:
Patch series "ia64: Miscellaneous fixes and cleanups":
ia64: fix #endif comment for reserve_elfcorehdr()
ia64: make reserve_elfcorehdr() static
ia64: make num_rsvd_regions static
Subsystem: ocfs2
Dan Carpenter <dan.carpenter@oracle.com>:
ocfs2: remove an unnecessary condition
Tuo Li <islituo@gmail.com>:
ocfs2: quota_local: fix possible uninitialized-variable access in ocfs2_local_read_info()
Gang He <ghe@suse.com>:
ocfs2: ocfs2_downconvert_lock failure results in deadlock
Subsystem: block
kernel test robot <lkp@intel.com>:
arch/csky/kernel/probes/kprobes.c: fix bugon.cocci warnings
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v4:
mm, slub: don't call flush_all() from slab_debug_trace_open()
mm, slub: allocate private object map for debugfs listings
mm, slub: allocate private object map for validate_slab_cache()
mm, slub: don't disable irq for debug_check_no_locks_freed()
mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
mm, slub: unify cmpxchg_double_slab() and __cmpxchg_double_slab()
mm, slub: extract get_partial() from new_slab_objects()
mm, slub: dissolve new_slab_objects() into ___slab_alloc()
mm, slub: return slab page from get_partial() and set c->page afterwards
mm, slub: restructure new page checks in ___slab_alloc()
mm, slub: simplify kmem_cache_cpu and tid setup
mm, slub: move disabling/enabling irqs to ___slab_alloc()
mm, slub: do initial checks in ___slab_alloc() with irqs enabled
mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
mm, slub: restore irqs around calling new_slab()
mm, slub: validate slab from partial list or page allocator before making it cpu slab
mm, slub: check new pages with restored irqs
mm, slub: stop disabling irqs around get_partial()
mm, slub: move reset of c->page and freelist out of deactivate_slab()
mm, slub: make locking in deactivate_slab() irq-safe
mm, slub: call deactivate_slab() without disabling irqs
mm, slub: move irq control into unfreeze_partials()
mm, slub: discard slabs in unfreeze_partials() without irqs disabled
mm, slub: detach whole partial list at once in unfreeze_partials()
mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
mm, slub: only disable irq with spin_lock in __unfreeze_partials()
mm, slub: don't disable irqs in slub_cpu_dead()
mm, slab: make flush_slab() possible to call with irqs enabled
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
mm: slub: make object_map_lock a raw_spinlock_t
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: optionally save/restore irqs in slab_[un]lock()/
mm, slub: make slab_lock() disable irqs with PREEMPT_RT
mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
mm, slub: use migrate_disable() on PREEMPT_RT
mm, slub: convert kmem_cpu_slab protection to local_lock
Subsystem: mm/debug
Gavin Shan <gshan@redhat.com>:
Patch series "mm/debug_vm_pgtable: Enhancements", v6:
mm/debug_vm_pgtable: introduce struct pgtable_debug_args
mm/debug_vm_pgtable: use struct pgtable_debug_args in basic tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in leaf and savewrite tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in protnone and devmap tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in soft_dirty and swap tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in migration and thp tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in PTE modifying tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in PMD modifying tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in PUD modifying tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in PGD and P4D modifying tests
mm/debug_vm_pgtable: remove unused code
mm/debug_vm_pgtable: fix corrupted page flag
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: report a more useful address for reclaim acquisition
liuhailong <liuhailong@oppo.com>:
mm: add kernel_misc_reclaimable in show_free_areas
Subsystem: mm/pagecache
Jan Kara <jack@suse.cz>:
Patch series "writeback: Fix bandwidth estimates", v4:
writeback: track number of inodes under writeback
writeback: reliably update bandwidth estimation
writeback: fix bandwidth estimate for spiky workload
writeback: rename domain_update_bandwidth()
writeback: use READ_ONCE for unlocked reads of writeback stats
Johannes Weiner <hannes@cmpxchg.org>:
mm: remove irqsave/restore locking from contexts with irqs enabled
fs: drop_caches: fix skipping over shadow cache inodes
fs: inode: count invalidated shadow pages in pginodesteal
Shakeel Butt <shakeelb@google.com>:
writeback: memcg: simplify cgroup_writeback_by_id
Jing Yangyang <jing.yangyang@zte.com.cn>:
include/linux/buffer_head.h: fix boolreturn.cocci warnings
Subsystem: mm/gup
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups and fixup for gup":
mm: gup: remove set but unused local variable major
mm: gup: remove unneed local variable orig_refs
mm: gup: remove useless BUG_ON in __get_user_pages()
mm: gup: fix potential pgmap refcnt leak in __gup_device_huge()
mm: gup: use helper PAGE_ALIGNED in populate_vma_page_range()
John Hubbard <jhubbard@nvidia.com>:
Patch series "A few gup refactorings and documentation updates", v3:
mm/gup: documentation corrections for gup/pup
mm/gup: small refactoring: simplify try_grab_page()
mm/gup: remove try_get_page(), call try_get_compound_head() directly
Subsystem: mm/swap
Hugh Dickins <hughd@google.com>:
fs, mm: fix race in unlinking swapfile
John Hubbard <jhubbard@nvidia.com>:
mm: delete unused get_kernel_page()
Subsystem: mm/shmem
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
shmem: use raw_spinlock_t for ->stat_lock
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups for shmem":
shmem: remove unneeded variable ret
shmem: remove unneeded header file
shmem: remove unneeded function forward declaration
shmem: include header file to declare swap_info
Hugh Dickins <hughd@google.com>:
Patch series "huge tmpfs: shmem_is_huge() fixes and cleanups":
huge tmpfs: fix fallocate(vanilla) advance over huge pages
huge tmpfs: fix split_huge_page() after FALLOC_FL_KEEP_SIZE
huge tmpfs: remove shrinklist addition from shmem_setattr()
huge tmpfs: revert shmem's use of transhuge_vma_enabled()
huge tmpfs: move shmem_huge_enabled() upwards
huge tmpfs: SGP_NOALLOC to stop collapse_file() on race
huge tmpfs: shmem_is_huge(vma, inode, index)
huge tmpfs: decide stat.st_blksize by shmem_is_huge()
shmem: shmem_writepage() split unlikely i915 THP
Subsystem: mm/memcg
Suren Baghdasaryan <surenb@google.com>:
mm, memcg: add mem_cgroup_disabled checks in vmpressure and swap-related functions
mm, memcg: inline mem_cgroup_{charge/uncharge} to improve disabled memcg config
mm, memcg: inline swap-related functions to improve disabled memcg config
Vasily Averin <vvs@virtuozzo.com>:
memcg: enable accounting for pids in nested pid namespaces
Shakeel Butt <shakeelb@google.com>:
memcg: switch lruvec stats to rstat
memcg: infrastructure to flush memcg stats
Yutian Yang <nglaive@gmail.com>:
memcg: charge fs_context and legacy_fs_context
Vasily Averin <vvs@virtuozzo.com>:
Patch series "memcg accounting from OpenVZ", v7:
memcg: enable accounting for mnt_cache entries
memcg: enable accounting for pollfd and select bits arrays
memcg: enable accounting for file lock caches
memcg: enable accounting for fasync_cache
memcg: enable accounting for new namesapces and struct nsproxy
memcg: enable accounting of ipc resources
memcg: enable accounting for signals
memcg: enable accounting for posix_timers_cache slab
memcg: enable accounting for ldt_struct objects
Shakeel Butt <shakeelb@google.com>:
memcg: cleanup racy sum avoidance code
Vasily Averin <vvs@virtuozzo.com>:
memcg: replace in_interrupt() by !in_task() in active_memcg()
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: memcontrol: set the correct memcg swappiness restriction
Miaohe Lin <linmiaohe@huawei.com>:
mm, memcg: remove unused functions
mm, memcg: save some atomic ops when flush is already true
Michal Hocko <mhocko@suse.com>:
memcg: fix up drain_local_stock comment
Shakeel Butt <shakeelb@google.com>:
memcg: make memcg->event_list_lock irqsafe
Subsystem: mm/selftests
Po-Hsu Lin <po-hsu.lin@canonical.com>:
selftests/vm: use kselftest skip code for skipped tests
Colin Ian King <colin.king@canonical.com>:
selftests: Fix spelling mistake "cann't" -> "cannot"
Subsystem: mm/pagemap
Nicholas Piggin <npiggin@gmail.com>:
Patch series "shoot lazy tlbs", v4:
lazy tlb: introduce lazy mm refcount helper functions
lazy tlb: allow lazy tlb mm refcounting to be configurable
lazy tlb: shoot lazies, a non-refcounting lazy tlb option
powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN
Christoph Hellwig <hch@lst.de>:
Patch series "_kernel_dcache_page fixes and removal":
mmc: JZ4740: remove the flush_kernel_dcache_page call in jz4740_mmc_read_data
mmc: mmc_spi: replace flush_kernel_dcache_page with flush_dcache_page
scatterlist: replace flush_kernel_dcache_page with flush_dcache_page
mm: remove flush_kernel_dcache_page
Huang Ying <ying.huang@intel.com>:
mm,do_huge_pmd_numa_page: remove unnecessary TLB flushing code
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
mm: change fault_in_pages_* to have an unsigned size parameter
Luigi Rizzo <lrizzo@google.com>:
mm/pagemap: add mmap_assert_locked() annotations to find_vma*()
"Liam R. Howlett" <Liam.Howlett@Oracle.com>:
remap_file_pages: Use vma_lookup() instead of find_vma()
Subsystem: mm/mremap
Chen Wandun <chenwandun@huawei.com>:
mm/mremap: fix memory account on do_munmap() failure
Subsystem: mm/bootmem
Muchun Song <songmuchun@bytedance.com>:
mm/bootmem_info.c: mark __init on register_page_bootmem_info_section
Subsystem: mm/sparsemem
Ohhoon Kwon <ohoono.kwon@samsung.com>:
Patch series "mm: sparse: remove __section_nr() function", v4:
mm: sparse: pass section_nr to section_mark_present
mm: sparse: pass section_nr to find_memory_block
mm: sparse: remove __section_nr() function
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/sparse: set SECTION_NID_SHIFT to 6
Matthew Wilcox <willy@infradead.org>:
include/linux/mmzone.h: avoid a warning in sparse memory support
Miles Chen <miles.chen@mediatek.com>:
mm/sparse: clarify pgdat_to_phys
Subsystem: mm/vmalloc
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: use batched page requests in bulk-allocator
mm/vmalloc: remove gfpflags_allow_blocking() check
lib/test_vmalloc.c: add a new 'nr_pages' parameter
Chen Wandun <chenwandun@huawei.com>:
mm/vmalloc: fix wrong behavior in vread
Subsystem: mm/kasan
Woody Lin <woodylin@google.com>:
mm/kasan: move kasan.fault to mm/kasan/report.c
Andrey Konovalov <andreyknvl@gmail.com>:
Patch series "kasan: test: avoid crashing the kernel with HW_TAGS", v2:
kasan: test: rework kmalloc_oob_right
kasan: test: avoid writing invalid memory
kasan: test: avoid corrupting memory via memset
kasan: test: disable kmalloc_memmove_invalid_size for HW_TAGS
kasan: test: only do kmalloc_uaf_memset for generic mode
kasan: test: clean up ksize_uaf
kasan: test: avoid corrupting memory in copy_user_test
kasan: test: avoid corrupting memory in kasan_rcu_uaf
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: ensure consistency of memory map poisoning":
mm/page_alloc: always initialize memory map for the holes
microblaze: simplify pte_alloc_one_kernel()
mm: introduce memmap_alloc() to unify memory map allocation
memblock: stop poisoning raw allocations
Nico Pache <npache@redhat.com>:
mm/page_alloc.c: fix 'zone_id' may be used uninitialized in this function warning
Mike Rapoport <rppt@linux.ibm.com>:
mm/page_alloc: make alloc_node_mem_map() __init rather than __ref
Vasily Averin <vvs@virtuozzo.com>:
mm/page_alloc.c: use in_task()
"George G. Davis" <davis.george@siemens.com>:
mm/page_isolation: tracing: trace all test_pages_isolated failures
Subsystem: mm/memory-failure
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups and fixup for hwpoison":
mm/hwpoison: remove unneeded variable unmap_success
mm/hwpoison: fix potential pte_unmap_unlock pte error
mm/hwpoison: change argument struct page **hpagep to *hpage
mm/hwpoison: fix some obsolete comments
Yang Shi <shy828301@gmail.com>:
mm: hwpoison: don't drop slab caches for offlining non-LRU page
doc: hwpoison: correct the support for hugepage
mm: hwpoison: dump page for unhandlable page
Michael Wang <yun.wang@linux.alibaba.com>:
mm: fix panic caused by __page_handle_poison()
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: simplify prep_compound_gigantic_page ref count racing code
hugetlb: drop ref count earlier after page allocation
hugetlb: before freeing hugetlb page set dtor to appropriate value
hugetlb: fix hugetlb cgroup refcounting during vma split
Subsystem: mm/userfaultfd
Nadav Amit <namit@vmware.com>:
Patch series "userfaultfd: minor bug fixes":
userfaultfd: change mmap_changing to atomic
userfaultfd: prevent concurrent API initialization
selftests/vm/userfaultfd: wake after copy failure
Subsystem: mm/vmscan
Dave Hansen <dave.hansen@linux.intel.com>:
Patch series "Migrate Pages in lieu of discard", v11:
mm/numa: automatically generate node migration order
mm/migrate: update node demotion order on hotplug events
Yang Shi <yang.shi@linux.alibaba.com>:
mm/migrate: enable returning precise migrate_pages() success count
Dave Hansen <dave.hansen@linux.intel.com>:
mm/migrate: demote pages during reclaim
Yang Shi <yang.shi@linux.alibaba.com>:
mm/vmscan: add page demotion counter
Dave Hansen <dave.hansen@linux.intel.com>:
mm/vmscan: add helper for querying ability to age anonymous pages
Keith Busch <kbusch@kernel.org>:
mm/vmscan: Consider anonymous pages without swap
Dave Hansen <dave.hansen@linux.intel.com>:
mm/vmscan: never demote for memcg reclaim
Huang Ying <ying.huang@intel.com>:
mm/migrate: add sysfs interface to enable reclaim migration
Hui Su <suhui@zeku.com>:
mm/vmpressure: replace vmpressure_to_css() with vmpressure_to_memcg()
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups for vmscan", v2:
mm/vmscan: remove the PageDirty check after MADV_FREE pages are page_ref_freezed
mm/vmscan: remove misleading setting to sc->priority
mm/vmscan: remove unneeded return value of kswapd_run()
mm/vmscan: add 'else' to remove check_pending label
Vlastimil Babka <vbabka@suse.cz>:
mm, vmscan: guarantee drop_slab_node() termination
Subsystem: mm/compaction
Charan Teja Reddy <charante@codeaurora.org>:
mm: compaction: optimize proactive compaction deferrals
mm: compaction: support triggering of proactive compaction by user
Subsystem: mm/mempolicy
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm/mempolicy: use readable NUMA_NO_NODE macro instead of magic number
Dave Hansen <dave.hansen@linux.intel.com>:
Patch series "Introduce multi-preference mempolicy", v7:
mm/mempolicy: add MPOL_PREFERRED_MANY for multiple preferred nodes
Feng Tang <feng.tang@intel.com>:
mm/memplicy: add page allocation function for MPOL_PREFERRED_MANY policy
Ben Widawsky <ben.widawsky@intel.com>:
mm/hugetlb: add support for mempolicy MPOL_PREFERRED_MANY
mm/mempolicy: advertise new MPOL_PREFERRED_MANY
Feng Tang <feng.tang@intel.com>:
mm/mempolicy: unify the create() func for bind/interleave/prefer-many policies
Vasily Averin <vvs@virtuozzo.com>:
mm/mempolicy.c: use in_task() in mempolicy_slab_node()
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
memblock: make memblock_find_in_range method private
Subsystem: mm/oom-kill
Suren Baghdasaryan <surenb@google.com>:
mm: introduce process_mrelease system call
mm: wire up syscall process_mrelease
Subsystem: mm/migration
Randy Dunlap <rdunlap@infradead.org>:
mm/migrate: correct kernel-doc notation
Subsystem: mm/ksm
Zhansaya Bagdauletkyzy <zhansayabagdaulet@gmail.com>:
Patch series "add KSM selftests":
selftests: vm: add KSM merge test
selftests: vm: add KSM unmerge test
selftests: vm: add KSM zero page merging test
selftests: vm: add KSM merging across nodes test
mm: KSM: fix data type
Patch series "add KSM performance tests", v3:
selftests: vm: add KSM merging time test
selftests: vm: add COW time test for KSM pages
Subsystem: mm/percpu
Jing Xiangfeng <jingxiangfeng@huawei.com>:
mm/percpu,c: remove obsolete comments of pcpu_chunk_populated()
Subsystem: mm/vmstat
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup for vmstat":
mm/vmstat: correct some wrong comments
mm/vmstat: simplify the array size calculation
mm/vmstat: remove unneeded return value
Subsystem: mm/madvise
zhangkui <zhangkui@oppo.com>:
mm/madvise: add MADV_WILLNEED to process_madvise()
Documentation/ABI/testing/sysfs-kernel-mm-numa | 24
Documentation/admin-guide/mm/numa_memory_policy.rst | 15
Documentation/admin-guide/sysctl/vm.rst | 3
Documentation/core-api/cachetlb.rst | 86 -
Documentation/dev-tools/kasan.rst | 13
Documentation/translations/zh_CN/core-api/cachetlb.rst | 9
Documentation/vm/hwpoison.rst | 1
arch/Kconfig | 28
arch/alpha/kernel/syscalls/syscall.tbl | 2
arch/arm/include/asm/cacheflush.h | 4
arch/arm/kernel/setup.c | 20
arch/arm/mach-rpc/ecard.c | 2
arch/arm/mm/flush.c | 33
arch/arm/mm/nommu.c | 6
arch/arm/tools/syscall.tbl | 2
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 2
arch/arm64/kvm/hyp/reserved_mem.c | 9
arch/arm64/mm/init.c | 38
arch/csky/abiv1/cacheflush.c | 11
arch/csky/abiv1/inc/abi/cacheflush.h | 4
arch/csky/kernel/probes/kprobes.c | 3
arch/ia64/include/asm/meminit.h | 2
arch/ia64/kernel/acpi.c | 2
arch/ia64/kernel/setup.c | 55
arch/ia64/kernel/syscalls/syscall.tbl | 2
arch/m68k/kernel/syscalls/syscall.tbl | 2
arch/microblaze/include/asm/page.h | 3
arch/microblaze/include/asm/pgtable.h | 2
arch/microblaze/kernel/syscalls/syscall.tbl | 2
arch/microblaze/mm/init.c | 12
arch/microblaze/mm/pgtable.c | 17
arch/mips/include/asm/cacheflush.h | 8
arch/mips/kernel/setup.c | 14
arch/mips/kernel/syscalls/syscall_n32.tbl | 2
arch/mips/kernel/syscalls/syscall_n64.tbl | 2
arch/mips/kernel/syscalls/syscall_o32.tbl | 2
arch/nds32/include/asm/cacheflush.h | 3
arch/nds32/mm/cacheflush.c | 9
arch/parisc/include/asm/cacheflush.h | 8
arch/parisc/kernel/cache.c | 3
arch/parisc/kernel/syscalls/syscall.tbl | 2
arch/powerpc/Kconfig | 1
arch/powerpc/kernel/smp.c | 2
arch/powerpc/kernel/syscalls/syscall.tbl | 2
arch/powerpc/mm/book3s64/radix_tlb.c | 4
arch/powerpc/platforms/pseries/hotplug-memory.c | 4
arch/riscv/mm/init.c | 44
arch/s390/kernel/setup.c | 9
arch/s390/kernel/syscalls/syscall.tbl | 2
arch/s390/mm/fault.c | 2
arch/sh/include/asm/cacheflush.h | 8
arch/sh/kernel/syscalls/syscall.tbl | 2
arch/sparc/kernel/syscalls/syscall.tbl | 2
arch/x86/entry/syscalls/syscall_32.tbl | 1
arch/x86/entry/syscalls/syscall_64.tbl | 1
arch/x86/kernel/aperture_64.c | 5
arch/x86/kernel/ldt.c | 6
arch/x86/mm/init.c | 23
arch/x86/mm/numa.c | 5
arch/x86/mm/numa_emulation.c | 5
arch/x86/realmode/init.c | 2
arch/xtensa/kernel/syscalls/syscall.tbl | 2
block/blk-map.c | 2
drivers/acpi/tables.c | 5
drivers/base/arch_numa.c | 5
drivers/base/memory.c | 4
drivers/mmc/host/jz4740_mmc.c | 4
drivers/mmc/host/mmc_spi.c | 2
drivers/of/of_reserved_mem.c | 12
fs/drop_caches.c | 3
fs/exec.c | 12
fs/fcntl.c | 3
fs/fs-writeback.c | 28
fs/fs_context.c | 4
fs/inode.c | 2
fs/locks.c | 6
fs/namei.c | 8
fs/namespace.c | 7
fs/ocfs2/dlmglue.c | 14
fs/ocfs2/quota_global.c | 1
fs/ocfs2/quota_local.c | 2
fs/pipe.c | 2
fs/select.c | 4
fs/userfaultfd.c | 116 -
include/linux/backing-dev-defs.h | 2
include/linux/backing-dev.h | 19
include/linux/buffer_head.h | 2
include/linux/compaction.h | 2
include/linux/highmem.h | 5
include/linux/hugetlb_cgroup.h | 12
include/linux/memblock.h | 2
include/linux/memcontrol.h | 118 +
include/linux/memory.h | 2
include/linux/mempolicy.h | 16
include/linux/migrate.h | 14
include/linux/mm.h | 17
include/linux/mmzone.h | 4
include/linux/page-flags.h | 9
include/linux/pagemap.h | 4
include/linux/sched/mm.h | 35
include/linux/shmem_fs.h | 25
include/linux/slub_def.h | 6
include/linux/swap.h | 28
include/linux/syscalls.h | 1
include/linux/userfaultfd_k.h | 8
include/linux/vm_event_item.h | 2
include/linux/vmpressure.h | 2
include/linux/writeback.h | 4
include/trace/events/migrate.h | 3
include/uapi/asm-generic/unistd.h | 4
include/uapi/linux/mempolicy.h | 1
ipc/msg.c | 2
ipc/namespace.c | 2
ipc/sem.c | 9
ipc/shm.c | 2
kernel/cgroup/namespace.c | 2
kernel/cpu.c | 2
kernel/exit.c | 2
kernel/fork.c | 51
kernel/kthread.c | 21
kernel/nsproxy.c | 2
kernel/pid_namespace.c | 5
kernel/sched/core.c | 37
kernel/sched/sched.h | 4
kernel/signal.c | 2
kernel/sys_ni.c | 1
kernel/sysctl.c | 2
kernel/time/namespace.c | 4
kernel/time/posix-timers.c | 4
kernel/user_namespace.c | 2
lib/scatterlist.c | 5
lib/test_kasan.c | 80 -
lib/test_kasan_module.c | 20
lib/test_vmalloc.c | 5
mm/backing-dev.c | 11
mm/bootmem_info.c | 4
mm/compaction.c | 69 -
mm/debug_vm_pgtable.c | 982 +++++++++------
mm/filemap.c | 15
mm/gup.c | 109 -
mm/huge_memory.c | 32
mm/hugetlb.c | 173 ++
mm/hwpoison-inject.c | 2
mm/internal.h | 9
mm/kasan/hw_tags.c | 43
mm/kasan/kasan.h | 1
mm/kasan/report.c | 29
mm/khugepaged.c | 2
mm/ksm.c | 8
mm/madvise.c | 1
mm/memblock.c | 22
mm/memcontrol.c | 234 +--
mm/memory-failure.c | 53
mm/memory_hotplug.c | 2
mm/mempolicy.c | 207 ++-
mm/migrate.c | 319 ++++
mm/mmap.c | 7
mm/mremap.c | 2
mm/oom_kill.c | 70 +
mm/page-writeback.c | 133 +-
mm/page_alloc.c | 62
mm/page_isolation.c | 13
mm/percpu.c | 3
mm/shmem.c | 309 ++--
mm/slab_common.c | 2
mm/slub.c | 1085 ++++++++++-------
mm/sparse.c | 46
mm/swap.c | 22
mm/swapfile.c | 14
mm/truncate.c | 28
mm/userfaultfd.c | 15
mm/vmalloc.c | 79 -
mm/vmpressure.c | 10
mm/vmscan.c | 220 ++-
mm/vmstat.c | 25
security/tomoyo/domain.c | 13
tools/testing/scatterlist/linux/mm.h | 1
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 3
tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 5
tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 5
tools/testing/selftests/vm/ksm_tests.c | 696 ++++++++++
tools/testing/selftests/vm/mlock-random-test.c | 2
tools/testing/selftests/vm/run_vmtests.sh | 98 +
tools/testing/selftests/vm/userfaultfd.c | 13
186 files changed, 4488 insertions(+), 2281 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-09-02 21:48 incoming Andrew Morton
@ 2021-09-02 21:49 ` Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-09-02 21:49 UTC (permalink / raw)
To: Linus Torvalds, linux-mm, mm-commits
On Thu, 2 Sep 2021 14:48:20 -0700 Andrew Morton <akpm@linux-foundation.org> wrote:
> 212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b.
Make that "based on 7d2a07b769330c34b4deabeed939325c77a7ec2f".
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-09-08 2:52 Andrew Morton
2021-09-08 8:57 ` incoming Vlastimil Babka
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2021-09-08 2:52 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
147 patches, based on 7d2a07b769330c34b4deabeed939325c77a7ec2f.
Subsystems affected by this patch series:
mm/slub
mm/memory-hotplug
mm/rmap
mm/ioremap
mm/highmem
mm/cleanups
mm/secretmem
mm/kfence
mm/damon
alpha
percpu
procfs
misc
core-kernel
MAINTAINERS
lib
bitops
checkpatch
epoll
init
nilfs2
coredump
fork
pids
criu
kconfig
selftests
ipc
mm/vmscan
scripts
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6:
mm, slub: don't call flush_all() from slab_debug_trace_open()
mm, slub: allocate private object map for debugfs listings
mm, slub: allocate private object map for validate_slab_cache()
mm, slub: don't disable irq for debug_check_no_locks_freed()
mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
mm, slub: extract get_partial() from new_slab_objects()
mm, slub: dissolve new_slab_objects() into ___slab_alloc()
mm, slub: return slab page from get_partial() and set c->page afterwards
mm, slub: restructure new page checks in ___slab_alloc()
mm, slub: simplify kmem_cache_cpu and tid setup
mm, slub: move disabling/enabling irqs to ___slab_alloc()
mm, slub: do initial checks in ___slab_alloc() with irqs enabled
mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
mm, slub: restore irqs around calling new_slab()
mm, slub: validate slab from partial list or page allocator before making it cpu slab
mm, slub: check new pages with restored irqs
mm, slub: stop disabling irqs around get_partial()
mm, slub: move reset of c->page and freelist out of deactivate_slab()
mm, slub: make locking in deactivate_slab() irq-safe
mm, slub: call deactivate_slab() without disabling irqs
mm, slub: move irq control into unfreeze_partials()
mm, slub: discard slabs in unfreeze_partials() without irqs disabled
mm, slub: detach whole partial list at once in unfreeze_partials()
mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
mm, slub: only disable irq with spin_lock in __unfreeze_partials()
mm, slub: don't disable irqs in slub_cpu_dead()
mm, slab: split out the cpu offline variant of flush_slab()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
mm: slub: make object_map_lock a raw_spinlock_t
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: make slab_lock() disable irqs with PREEMPT_RT
mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
mm, slub: use migrate_disable() on PREEMPT_RT
mm, slub: convert kmem_cpu_slab protection to local_lock
Subsystem: mm/memory-hotplug
David Hildenbrand <david@redhat.com>:
Patch series "memory-hotplug.rst: complete admin-guide overhaul", v3:
memory-hotplug.rst: remove locking details from admin-guide
memory-hotplug.rst: complete admin-guide overhaul
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE":
mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE
mm: memory_hotplug: cleanup after removal of pfn_valid_within()
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: preparatory patches for new online policy and memory":
mm/memory_hotplug: use "unsigned long" for PFN in zone_for_pfn_range()
mm/memory_hotplug: remove nid parameter from arch_remove_memory()
mm/memory_hotplug: remove nid parameter from remove_memory() and friends
ACPI: memhotplug: memory resources cannot be enabled yet
Patch series "mm/memory_hotplug: "auto-movable" online policy and memory groups", v3:
mm: track present early pages per zone
mm/memory_hotplug: introduce "auto-movable" online policy
drivers/base/memory: introduce "memory groups" to logically group memory blocks
mm/memory_hotplug: track present pages in memory groups
ACPI: memhotplug: use a single static memory group for a single memory device
dax/kmem: use a single static memory group for a single probed unit
virtio-mem: use a single dynamic memory group for a single virtio-mem device
mm/memory_hotplug: memory group aware "auto-movable" online policy
mm/memory_hotplug: improved dynamic memory group aware "auto-movable" online policy
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixups for memory hotplug":
mm/memory_hotplug: use helper zone_is_zone_device() to simplify the code
Subsystem: mm/rmap
Muchun Song <songmuchun@bytedance.com>:
mm: remove redundant compound_head() calling
Subsystem: mm/ioremap
Christoph Hellwig <hch@lst.de>:
riscv: only select GENERIC_IOREMAP if MMU support is enabled
Patch series "small ioremap cleanups":
mm: move ioremap_page_range to vmalloc.c
mm: don't allow executable ioremap mappings
Weizhao Ouyang <o451686892@gmail.com>:
mm/early_ioremap.c: remove redundant early_ioremap_shutdown()
Subsystem: mm/highmem
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
highmem: don't disable preemption on RT in kmap_atomic()
Subsystem: mm/cleanups
Changbin Du <changbin.du@gmail.com>:
mm: in_irq() cleanup
Muchun Song <songmuchun@bytedance.com>:
mm: introduce PAGEFLAGS_MASK to replace ((1UL << NR_PAGEFLAGS) - 1)
Subsystem: mm/secretmem
Jordy Zomer <jordy@jordyzomer.github.io>:
mm/secretmem: use refcount_t instead of atomic_t
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: show cpu and timestamp in alloc/free info
kfence: test: fail fast if disabled at boot
Subsystem: mm/damon
SeongJae Park <sjpark@amazon.de>:
Patch series "Introduce Data Access MONitor (DAMON)", v34:
mm: introduce Data Access MONitor (DAMON)
mm/damon/core: implement region-based sampling
mm/damon: adaptively adjust regions
mm/idle_page_tracking: make PG_idle reusable
mm/damon: implement primitives for the virtual memory address spaces
mm/damon: add a tracepoint
mm/damon: implement a debugfs-based user space interface
mm/damon/dbgfs: export kdamond pid to the user space
mm/damon/dbgfs: support multiple contexts
Documentation: add documents for DAMON
mm/damon: add kunit tests
mm/damon: add user space selftests
MAINTAINERS: update for DAMON
Subsystem: alpha
Randy Dunlap <rdunlap@infradead.org>:
alpha: agp: make empty macros use do-while-0 style
alpha: pci-sysfs: fix all kernel-doc warnings
Subsystem: percpu
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
percpu: remove export of pcpu_base_addr
Subsystem: procfs
Feng Zhou <zhoufeng.zf@bytedance.com>:
fs/proc/kcore.c: add mmap interface
Christoph Hellwig <hch@lst.de>:
proc: stop using seq_get_buf in proc_task_name
Ohhoon Kwon <ohoono.kwon@samsung.com>:
connector: send event on write to /proc/[pid]/comm
Subsystem: misc
Colin Ian King <colin.king@canonical.com>:
arch: Kconfig: fix spelling mistake "seperate" -> "separate"
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
include/linux/once.h: fix trivia typo Not -> Note
Daniel Lezcano <daniel.lezcano@linaro.org>:
Patch series "Add Hz macros", v3:
units: change from 'L' to 'UL'
units: add the HZ macros
thermal/drivers/devfreq_cooling: use HZ macros
devfreq: use HZ macros
iio/drivers/as73211: use HZ macros
hwmon/drivers/mr75203: use HZ macros
iio/drivers/hid-sensor: use HZ macros
i2c/drivers/ov02q10: use HZ macros
mtd/drivers/nand: use HZ macros
phy/drivers/stm32: use HZ macros
Subsystem: core-kernel
Yang Yang <yang.yang29@zte.com.cn>:
kernel/acct.c: use dedicated helper to access rlimit values
Pavel Skripkin <paskripkin@gmail.com>:
profiling: fix shift-out-of-bounds bugs
Subsystem: MAINTAINERS
Nathan Chancellor <nathan@kernel.org>:
MAINTAINERS: update ClangBuiltLinux mailing list
Documentation/llvm: update mailing list
Documentation/llvm: update IRC location
Subsystem: lib
Geert Uytterhoeven <geert@linux-m68k.org>:
Patch series "math: RATIONAL and RATIONAL_KUNIT_TEST improvements":
math: make RATIONAL tristate
math: RATIONAL_KUNIT_TEST should depend on RATIONAL instead of selecting it
Matteo Croce <mcroce@microsoft.com>:
Patch series "lib/string: optimized mem* functions", v2:
lib/string: optimized memcpy
lib/string: optimized memmove
lib/string: optimized memset
Daniel Latypov <dlatypov@google.com>:
lib/test: convert test_sort.c to use KUnit
Randy Dunlap <rdunlap@infradead.org>:
lib/dump_stack: correct kernel-doc notation
lib/iov_iter.c: fix kernel-doc warnings
Subsystem: bitops
Yury Norov <yury.norov@gmail.com>:
Patch series "Resend bitmap patches":
bitops: protect find_first_{,zero}_bit properly
bitops: move find_bit_*_le functions from le.h to find.h
include: move find.h from asm_generic to linux
arch: remove GENERIC_FIND_FIRST_BIT entirely
lib: add find_first_and_bit()
cpumask: use find_first_and_bit()
all: replace find_next{,_zero}_bit with find_first{,_zero}_bit where appropriate
tools: sync tools/bitmap with mother linux
cpumask: replace cpumask_next_* with cpumask_first_* where appropriate
include/linux: move for_each_bit() macros from bitops.h to find.h
find: micro-optimize for_each_{set,clear}_bit()
bitops: replace for_each_*_bit_from() with for_each_*_bit() where appropriate
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
tools: rename bitmap_alloc() to bitmap_zalloc()
Yury Norov <yury.norov@gmail.com>:
mm/percpu: micro-optimize pcpu_is_populated()
bitmap: unify find_bit operations
lib: bitmap: add performance test for bitmap_print_to_pagebuf
vsprintf: rework bitmap_list_string
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: support wide strings
Mimi Zohar <zohar@linux.ibm.com>:
checkpatch: make email address check case insensitive
Joe Perches <joe@perches.com>:
checkpatch: improve GIT_COMMIT_ID test
Subsystem: epoll
Nicholas Piggin <npiggin@gmail.com>:
fs/epoll: use a per-cpu counter for user's watches count
Subsystem: init
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
init: move usermodehelper_enable() to populate_rootfs()
Kefeng Wang <wangkefeng.wang@huawei.com>:
trap: cleanup trap_init()
Subsystem: nilfs2
Nanyong Sun <sunnanyong@huawei.com>:
Patch series "nilfs2: fix incorrect usage of kobject":
nilfs2: fix memory leak in nilfs_sysfs_create_device_group
nilfs2: fix NULL pointer in nilfs_##name##_attr_release
nilfs2: fix memory leak in nilfs_sysfs_create_##name##_group
nilfs2: fix memory leak in nilfs_sysfs_delete_##name##_group
nilfs2: fix memory leak in nilfs_sysfs_create_snapshot_group
nilfs2: fix memory leak in nilfs_sysfs_delete_snapshot_group
Zhen Lei <thunder.leizhen@huawei.com>:
nilfs2: use refcount_dec_and_lock() to fix potential UAF
Subsystem: coredump
David Oberhollenzer <david.oberhollenzer@sigma-star.at>:
fs/coredump.c: log if a core dump is aborted due to changed file permissions
QiuXi <qiuxi1@huawei.com>:
coredump: fix memleak in dump_vma_snapshot()
Subsystem: fork
Christoph Hellwig <hch@lst.de>:
kernel/fork.c: unexport get_{mm,task}_exe_file
Subsystem: pids
Takahiro Itazuri <itazur@amazon.com>:
pid: cleanup the stale comment mentioning pidmap_init().
Subsystem: criu
Cyrill Gorcunov <gorcunov@gmail.com>:
prctl: allow to setup brk for et_dyn executables
Subsystem: kconfig
Zenghui Yu <yuzenghui@huawei.com>:
configs: remove the obsolete CONFIG_INPUT_POLLDEV
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
Kconfig.debug: drop selecting non-existing HARDLOCKUP_DETECTOR_ARCH
Subsystem: selftests
Greg Thelen <gthelen@google.com>:
selftests/memfd: remove unused variable
Subsystem: ipc
Rafael Aquini <aquini@redhat.com>:
ipc: replace costly bailout check in sysvipc_find_ipc()
Subsystem: mm/vmscan
Randy Dunlap <rdunlap@infradead.org>:
mm/workingset: correct kernel-doc notations
Subsystem: scripts
Randy Dunlap <rdunlap@infradead.org>:
scripts: check_extable: fix typo in user error message
a/Documentation/admin-guide/mm/damon/index.rst | 15
a/Documentation/admin-guide/mm/damon/start.rst | 114 +
a/Documentation/admin-guide/mm/damon/usage.rst | 112 +
a/Documentation/admin-guide/mm/index.rst | 1
a/Documentation/admin-guide/mm/memory-hotplug.rst | 842 ++++++-----
a/Documentation/dev-tools/kfence.rst | 98 -
a/Documentation/kbuild/llvm.rst | 5
a/Documentation/vm/damon/api.rst | 20
a/Documentation/vm/damon/design.rst | 166 ++
a/Documentation/vm/damon/faq.rst | 51
a/Documentation/vm/damon/index.rst | 30
a/Documentation/vm/index.rst | 1
a/MAINTAINERS | 17
a/arch/Kconfig | 2
a/arch/alpha/include/asm/agp.h | 4
a/arch/alpha/include/asm/bitops.h | 2
a/arch/alpha/kernel/pci-sysfs.c | 12
a/arch/arc/Kconfig | 1
a/arch/arc/include/asm/bitops.h | 1
a/arch/arc/kernel/traps.c | 5
a/arch/arm/configs/dove_defconfig | 1
a/arch/arm/configs/pxa_defconfig | 1
a/arch/arm/include/asm/bitops.h | 1
a/arch/arm/kernel/traps.c | 5
a/arch/arm64/Kconfig | 1
a/arch/arm64/include/asm/bitops.h | 1
a/arch/arm64/mm/mmu.c | 3
a/arch/csky/include/asm/bitops.h | 1
a/arch/h8300/include/asm/bitops.h | 1
a/arch/h8300/kernel/traps.c | 4
a/arch/hexagon/include/asm/bitops.h | 1
a/arch/hexagon/kernel/traps.c | 4
a/arch/ia64/include/asm/bitops.h | 2
a/arch/ia64/mm/init.c | 3
a/arch/m68k/include/asm/bitops.h | 2
a/arch/mips/Kconfig | 1
a/arch/mips/configs/lemote2f_defconfig | 1
a/arch/mips/configs/pic32mzda_defconfig | 1
a/arch/mips/configs/rt305x_defconfig | 1
a/arch/mips/configs/xway_defconfig | 1
a/arch/mips/include/asm/bitops.h | 1
a/arch/nds32/kernel/traps.c | 5
a/arch/nios2/kernel/traps.c | 5
a/arch/openrisc/include/asm/bitops.h | 1
a/arch/openrisc/kernel/traps.c | 5
a/arch/parisc/configs/generic-32bit_defconfig | 1
a/arch/parisc/include/asm/bitops.h | 2
a/arch/parisc/kernel/traps.c | 4
a/arch/powerpc/include/asm/bitops.h | 2
a/arch/powerpc/include/asm/cputhreads.h | 2
a/arch/powerpc/kernel/traps.c | 5
a/arch/powerpc/mm/mem.c | 3
a/arch/powerpc/platforms/pasemi/dma_lib.c | 4
a/arch/powerpc/platforms/pseries/hotplug-memory.c | 9
a/arch/riscv/Kconfig | 2
a/arch/riscv/include/asm/bitops.h | 1
a/arch/riscv/kernel/traps.c | 5
a/arch/s390/Kconfig | 1
a/arch/s390/include/asm/bitops.h | 1
a/arch/s390/kvm/kvm-s390.c | 2
a/arch/s390/mm/init.c | 3
a/arch/sh/include/asm/bitops.h | 1
a/arch/sh/mm/init.c | 3
a/arch/sparc/include/asm/bitops_32.h | 1
a/arch/sparc/include/asm/bitops_64.h | 2
a/arch/um/kernel/trap.c | 4
a/arch/x86/Kconfig | 1
a/arch/x86/configs/i386_defconfig | 1
a/arch/x86/configs/x86_64_defconfig | 1
a/arch/x86/include/asm/bitops.h | 2
a/arch/x86/kernel/apic/vector.c | 4
a/arch/x86/mm/init_32.c | 3
a/arch/x86/mm/init_64.c | 3
a/arch/x86/um/Kconfig | 1
a/arch/xtensa/include/asm/bitops.h | 1
a/block/blk-mq.c | 2
a/drivers/acpi/acpi_memhotplug.c | 46
a/drivers/base/memory.c | 231 ++-
a/drivers/base/node.c | 2
a/drivers/block/rnbd/rnbd-clt.c | 2
a/drivers/dax/kmem.c | 43
a/drivers/devfreq/devfreq.c | 2
a/drivers/dma/ti/edma.c | 2
a/drivers/gpu/drm/etnaviv/etnaviv_gpu.c | 4
a/drivers/hwmon/ltc2992.c | 3
a/drivers/hwmon/mr75203.c | 2
a/drivers/iio/adc/ad7124.c | 2
a/drivers/iio/common/hid-sensors/hid-sensor-attributes.c | 3
a/drivers/iio/light/as73211.c | 3
a/drivers/infiniband/hw/irdma/hw.c | 16
a/drivers/media/cec/core/cec-core.c | 2
a/drivers/media/i2c/ov02a10.c | 2
a/drivers/media/mc/mc-devnode.c | 2
a/drivers/mmc/host/renesas_sdhi_core.c | 2
a/drivers/mtd/nand/raw/intel-nand-controller.c | 2
a/drivers/net/virtio_net.c | 2
a/drivers/pci/controller/dwc/pci-dra7xx.c | 2
a/drivers/phy/st/phy-stm32-usbphyc.c | 2
a/drivers/scsi/lpfc/lpfc_sli.c | 10
a/drivers/soc/fsl/qbman/bman_portal.c | 2
a/drivers/soc/fsl/qbman/qman_portal.c | 2
a/drivers/soc/ti/k3-ringacc.c | 4
a/drivers/thermal/devfreq_cooling.c | 2
a/drivers/tty/n_tty.c | 2
a/drivers/virt/acrn/ioreq.c | 3
a/drivers/virtio/virtio_mem.c | 26
a/fs/coredump.c | 15
a/fs/eventpoll.c | 18
a/fs/f2fs/segment.c | 8
a/fs/nilfs2/sysfs.c | 26
a/fs/nilfs2/the_nilfs.c | 9
a/fs/ocfs2/cluster/heartbeat.c | 2
a/fs/ocfs2/dlm/dlmdomain.c | 4
a/fs/ocfs2/dlm/dlmmaster.c | 18
a/fs/ocfs2/dlm/dlmrecovery.c | 2
a/fs/ocfs2/dlm/dlmthread.c | 2
a/fs/proc/array.c | 18
a/fs/proc/base.c | 5
a/fs/proc/kcore.c | 73
a/include/asm-generic/bitops.h | 1
a/include/asm-generic/bitops/find.h | 198 --
a/include/asm-generic/bitops/le.h | 64
a/include/asm-generic/early_ioremap.h | 6
a/include/linux/bitmap.h | 34
a/include/linux/bitops.h | 34
a/include/linux/cpumask.h | 46
a/include/linux/damon.h | 290 +++
a/include/linux/find.h | 134 +
a/include/linux/highmem-internal.h | 27
a/include/linux/memory.h | 55
a/include/linux/memory_hotplug.h | 40
a/include/linux/mmzone.h | 19
a/include/linux/once.h | 2
a/include/linux/page-flags.h | 17
a/include/linux/page_ext.h | 2
a/include/linux/page_idle.h | 6
a/include/linux/pagemap.h | 7
a/include/linux/sched/user.h | 3
a/include/linux/slub_def.h | 6
a/include/linux/threads.h | 2
a/include/linux/units.h | 10
a/include/linux/vmalloc.h | 3
a/include/trace/events/damon.h | 43
a/include/trace/events/mmflags.h | 2
a/include/trace/events/page_ref.h | 4
a/init/initramfs.c | 2
a/init/main.c | 3
a/init/noinitramfs.c | 2
a/ipc/util.c | 16
a/kernel/acct.c | 2
a/kernel/fork.c | 2
a/kernel/profile.c | 21
a/kernel/sys.c | 7
a/kernel/time/clocksource.c | 4
a/kernel/user.c | 25
a/lib/Kconfig | 3
a/lib/Kconfig.debug | 9
a/lib/dump_stack.c | 3
a/lib/find_bit.c | 21
a/lib/find_bit_benchmark.c | 21
a/lib/genalloc.c | 2
a/lib/iov_iter.c | 8
a/lib/math/Kconfig | 2
a/lib/math/rational.c | 3
a/lib/string.c | 130 +
a/lib/test_bitmap.c | 37
a/lib/test_printf.c | 2
a/lib/test_sort.c | 40
a/lib/vsprintf.c | 26
a/mm/Kconfig | 15
a/mm/Makefile | 4
a/mm/compaction.c | 20
a/mm/damon/Kconfig | 68
a/mm/damon/Makefile | 5
a/mm/damon/core-test.h | 253 +++
a/mm/damon/core.c | 748 ++++++++++
a/mm/damon/dbgfs-test.h | 126 +
a/mm/damon/dbgfs.c | 631 ++++++++
a/mm/damon/vaddr-test.h | 329 ++++
a/mm/damon/vaddr.c | 672 +++++++++
a/mm/early_ioremap.c | 5
a/mm/highmem.c | 2
a/mm/ioremap.c | 25
a/mm/kfence/core.c | 3
a/mm/kfence/kfence.h | 2
a/mm/kfence/kfence_test.c | 3
a/mm/kfence/report.c | 19
a/mm/kmemleak.c | 2
a/mm/memory_hotplug.c | 396 ++++-
a/mm/memremap.c | 5
a/mm/page_alloc.c | 27
a/mm/page_ext.c | 12
a/mm/page_idle.c | 10
a/mm/page_isolation.c | 7
a/mm/page_owner.c | 14
a/mm/percpu.c | 36
a/mm/rmap.c | 6
a/mm/secretmem.c | 9
a/mm/slab_common.c | 2
a/mm/slub.c | 1023 +++++++++-----
a/mm/vmalloc.c | 24
a/mm/workingset.c | 2
a/net/ncsi/ncsi-manage.c | 4
a/scripts/check_extable.sh | 2
a/scripts/checkpatch.pl | 93 -
a/tools/include/linux/bitmap.h | 4
a/tools/perf/bench/find-bit-bench.c | 2
a/tools/perf/builtin-c2c.c | 6
a/tools/perf/builtin-record.c | 2
a/tools/perf/tests/bitmap.c | 2
a/tools/perf/tests/mem2node.c | 2
a/tools/perf/util/affinity.c | 4
a/tools/perf/util/header.c | 4
a/tools/perf/util/metricgroup.c | 2
a/tools/perf/util/mmap.c | 4
a/tools/testing/selftests/damon/Makefile | 7
a/tools/testing/selftests/damon/_chk_dependency.sh | 28
a/tools/testing/selftests/damon/debugfs_attrs.sh | 75 +
a/tools/testing/selftests/kvm/dirty_log_perf_test.c | 2
a/tools/testing/selftests/kvm/dirty_log_test.c | 4
a/tools/testing/selftests/kvm/x86_64/vmx_dirty_log_test.c | 2
a/tools/testing/selftests/memfd/memfd_test.c | 2
b/MAINTAINERS | 2
b/tools/include/asm-generic/bitops.h | 1
b/tools/include/linux/bitmap.h | 7
b/tools/include/linux/find.h | 81 +
b/tools/lib/find_bit.c | 20
227 files changed, 6695 insertions(+), 1875 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-09-08 2:52 incoming Andrew Morton
@ 2021-09-08 8:57 ` Vlastimil Babka
0 siblings, 0 replies; 348+ messages in thread
From: Vlastimil Babka @ 2021-09-08 8:57 UTC (permalink / raw)
To: Andrew Morton, Linus Torvalds
Cc: linux-mm, mm-commits, Mike Galbraith, Mel Gorman
On 9/8/21 04:52, Andrew Morton wrote:
> Subsystem: mm/slub
>
> Vlastimil Babka <vbabka@suse.cz>:
> Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6:
> mm, slub: don't call flush_all() from slab_debug_trace_open()
> mm, slub: allocate private object map for debugfs listings
> mm, slub: allocate private object map for validate_slab_cache()
> mm, slub: don't disable irq for debug_check_no_locks_freed()
> mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
> mm, slub: extract get_partial() from new_slab_objects()
> mm, slub: dissolve new_slab_objects() into ___slab_alloc()
> mm, slub: return slab page from get_partial() and set c->page afterwards
> mm, slub: restructure new page checks in ___slab_alloc()
> mm, slub: simplify kmem_cache_cpu and tid setup
> mm, slub: move disabling/enabling irqs to ___slab_alloc()
> mm, slub: do initial checks in ___slab_alloc() with irqs enabled
> mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
> mm, slub: restore irqs around calling new_slab()
> mm, slub: validate slab from partial list or page allocator before making it cpu slab
> mm, slub: check new pages with restored irqs
> mm, slub: stop disabling irqs around get_partial()
> mm, slub: move reset of c->page and freelist out of deactivate_slab()
> mm, slub: make locking in deactivate_slab() irq-safe
> mm, slub: call deactivate_slab() without disabling irqs
> mm, slub: move irq control into unfreeze_partials()
> mm, slub: discard slabs in unfreeze_partials() without irqs disabled
> mm, slub: detach whole partial list at once in unfreeze_partials()
> mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
> mm, slub: only disable irq with spin_lock in __unfreeze_partials()
> mm, slub: don't disable irqs in slub_cpu_dead()
> mm, slab: split out the cpu offline variant of flush_slab()
>
> Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
> mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
> mm: slub: make object_map_lock a raw_spinlock_t
>
> Vlastimil Babka <vbabka@suse.cz>:
> mm, slub: make slab_lock() disable irqs with PREEMPT_RT
> mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
> mm, slub: use migrate_disable() on PREEMPT_RT
> mm, slub: convert kmem_cpu_slab protection to local_lock
For my own piece of mind, I've checked that this part (patches 1 to 33)
are identical to the v6 posting [1] and git version [2] that Mel and
Mike tested (replies to [1]).
[1] https://lore.kernel.org/all/20210904105003.11688-1-vbabka@suse.cz/
[2] git://git.kernel.org/pub/scm/linux/kernel/git/vbabka/linux.git
tags/mm-slub-5.15-rc1
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-09-08 22:17 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-09-08 22:17 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
This is the post-linux-next material, so it is based upon latest
upstream to catch the now-merged dependencies.
10 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c.
Subsystems affected by this patch series:
mm/vmstat
mm/migration
compat
Subsystem: mm/vmstat
Ingo Molnar <mingo@elte.hu>:
mm/vmstat: protect per cpu variables with preempt disable on RT
Subsystem: mm/migration
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: migrate: introduce a local variable to get the number of pages
mm: migrate: fix the incorrect function name in comments
mm: migrate: change to use bool type for 'page_was_mapped'
Subsystem: compat
Arnd Bergmann <arnd@arndb.de>:
Patch series "compat: remove compat_alloc_user_space", v5:
kexec: move locking into do_kexec_load
kexec: avoid compat_alloc_user_space
mm: simplify compat_sys_move_pages
mm: simplify compat numa syscalls
compat: remove some compat entry points
arch: remove compat_alloc_user_space
arch/arm64/include/asm/compat.h | 5
arch/arm64/include/asm/uaccess.h | 11 -
arch/arm64/include/asm/unistd32.h | 10 -
arch/arm64/lib/Makefile | 2
arch/arm64/lib/copy_in_user.S | 77 ----------
arch/mips/cavium-octeon/octeon-memcpy.S | 2
arch/mips/include/asm/compat.h | 8 -
arch/mips/include/asm/uaccess.h | 26 ---
arch/mips/kernel/syscalls/syscall_n32.tbl | 10 -
arch/mips/kernel/syscalls/syscall_o32.tbl | 10 -
arch/mips/lib/memcpy.S | 11 -
arch/parisc/include/asm/compat.h | 6
arch/parisc/include/asm/uaccess.h | 2
arch/parisc/kernel/syscalls/syscall.tbl | 8 -
arch/parisc/lib/memcpy.c | 9 -
arch/powerpc/include/asm/compat.h | 16 --
arch/powerpc/kernel/syscalls/syscall.tbl | 10 -
arch/s390/include/asm/compat.h | 10 -
arch/s390/include/asm/uaccess.h | 3
arch/s390/kernel/syscalls/syscall.tbl | 10 -
arch/s390/lib/uaccess.c | 63 --------
arch/sparc/include/asm/compat.h | 19 --
arch/sparc/kernel/process_64.c | 2
arch/sparc/kernel/signal32.c | 12 -
arch/sparc/kernel/signal_64.c | 8 -
arch/sparc/kernel/syscalls/syscall.tbl | 10 -
arch/x86/entry/syscalls/syscall_32.tbl | 4
arch/x86/entry/syscalls/syscall_64.tbl | 2
arch/x86/include/asm/compat.h | 13 -
arch/x86/include/asm/uaccess_64.h | 7
include/linux/compat.h | 39 +----
include/linux/uaccess.h | 10 -
include/uapi/asm-generic/unistd.h | 10 -
kernel/compat.c | 21 --
kernel/kexec.c | 105 +++++---------
kernel/sys_ni.c | 5
mm/mempolicy.c | 213 +++++++-----------------------
mm/migrate.c | 69 +++++----
mm/vmstat.c | 48 ++++++
39 files changed, 243 insertions(+), 663 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-09-09 1:08 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-09-09 1:08 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
A bunch of hotfixes, mostly cc:stable.
8 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c.
Subsystems affected by this patch series:
mm/hmm
mm/hugetlb
mm/vmscan
mm/pagealloc
mm/pagemap
mm/kmemleak
mm/mempolicy
mm/memblock
Subsystem: mm/hmm
Li Zhijian <lizhijian@cn.fujitsu.com>:
mm/hmm: bypass devmap pte when all pfn requested flags are fulfilled
Subsystem: mm/hugetlb
Liu Zixian <liuzixian4@huawei.com>:
mm/hugetlb: initialize hugetlb_usage in mm_init
Subsystem: mm/vmscan
Rik van Riel <riel@surriel.com>:
mm,vmscan: fix divide by zero in get_scan_count
Subsystem: mm/pagealloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/page_alloc.c: avoid accessing uninitialized pcp page migratetype
Subsystem: mm/pagemap
Liam Howlett <liam.howlett@oracle.com>:
mmap_lock: change trace and locking order
Subsystem: mm/kmemleak
Naohiro Aota <naohiro.aota@wdc.com>:
mm/kmemleak: allow __GFP_NOLOCKDEP passed to kmemleak's gfp
Subsystem: mm/mempolicy
yanghui <yanghui.def@bytedance.com>:
mm/mempolicy: fix a race between offset_il_node and mpol_rebind_task
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
nds32/setup: remove unused memblock_region variable in setup_memory()
arch/nds32/kernel/setup.c | 1 -
include/linux/hugetlb.h | 9 +++++++++
include/linux/mmap_lock.h | 8 ++++----
kernel/fork.c | 1 +
mm/hmm.c | 5 ++++-
mm/kmemleak.c | 3 ++-
mm/mempolicy.c | 17 +++++++++++++----
mm/page_alloc.c | 4 +++-
mm/vmscan.c | 2 +-
9 files changed, 37 insertions(+), 13 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-09-10 3:09 Andrew Morton
2021-09-10 17:11 ` incoming Kees Cook
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2021-09-10 3:09 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
More post linux-next material.
9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
Subsystems affected by this patch series:
mm/slab-generic
rapidio
mm/debug
Subsystem: mm/slab-generic
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: move kvmalloc-related functions to slab.h
Subsystem: rapidio
Kees Cook <keescook@chromium.org>:
rapidio: avoid bogus __alloc_size warning
Subsystem: mm/debug
Kees Cook <keescook@chromium.org>:
Patch series "Add __alloc_size() for better bounds checking", v2:
Compiler Attributes: add __alloc_size() for better bounds checking
checkpatch: add __alloc_size() to known $Attribute
slab: clean up function declarations
slab: add __alloc_size attributes for better bounds checking
mm/page_alloc: add __alloc_size attributes for better bounds checking
percpu: add __alloc_size attributes for better bounds checking
mm/vmalloc: add __alloc_size attributes for better bounds checking
Makefile | 15 +++
drivers/of/kexec.c | 1
drivers/rapidio/devices/rio_mport_cdev.c | 9 +-
include/linux/compiler_attributes.h | 6 +
include/linux/gfp.h | 2
include/linux/mm.h | 34 --------
include/linux/percpu.h | 3
include/linux/slab.h | 122 ++++++++++++++++++++++---------
include/linux/vmalloc.h | 11 ++
scripts/checkpatch.pl | 3
10 files changed, 132 insertions(+), 74 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-09-10 3:09 incoming Andrew Morton
@ 2021-09-10 17:11 ` Kees Cook
2021-09-10 20:13 ` incoming Kees Cook
0 siblings, 1 reply; 348+ messages in thread
From: Kees Cook @ 2021-09-10 17:11 UTC (permalink / raw)
To: Linus Torvalds, Andrew Morton; +Cc: linux-mm, mm-commits
On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote:
>
> More post linux-next material.
>
> 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
>
> Subsystems affected by this patch series:
>
> mm/slab-generic
> rapidio
> mm/debug
>
> Subsystem: mm/slab-generic
>
> "Matthew Wilcox (Oracle)" <willy@infradead.org>:
> mm: move kvmalloc-related functions to slab.h
>
> Subsystem: rapidio
>
> Kees Cook <keescook@chromium.org>:
> rapidio: avoid bogus __alloc_size warning
>
> Subsystem: mm/debug
>
> Kees Cook <keescook@chromium.org>:
> Patch series "Add __alloc_size() for better bounds checking", v2:
> Compiler Attributes: add __alloc_size() for better bounds checking
> checkpatch: add __alloc_size() to known $Attribute
> slab: clean up function declarations
> slab: add __alloc_size attributes for better bounds checking
> mm/page_alloc: add __alloc_size attributes for better bounds checking
> percpu: add __alloc_size attributes for better bounds checking
> mm/vmalloc: add __alloc_size attributes for better bounds checking
Hi,
FYI, in overnight build testing I found yet another corner case in
GCC's handling of the __alloc_size attribute. It's the gift that keeps
on giving. The fix is here:
https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/
>
> Makefile | 15 +++
> drivers/of/kexec.c | 1
> drivers/rapidio/devices/rio_mport_cdev.c | 9 +-
> include/linux/compiler_attributes.h | 6 +
> include/linux/gfp.h | 2
> include/linux/mm.h | 34 --------
> include/linux/percpu.h | 3
> include/linux/slab.h | 122 ++++++++++++++++++++++---------
> include/linux/vmalloc.h | 11 ++
> scripts/checkpatch.pl | 3
> 10 files changed, 132 insertions(+), 74 deletions(-)
>
--
Kees Cook
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2021-09-10 17:11 ` incoming Kees Cook
@ 2021-09-10 20:13 ` Kees Cook
0 siblings, 0 replies; 348+ messages in thread
From: Kees Cook @ 2021-09-10 20:13 UTC (permalink / raw)
To: linux-kernel; +Cc: Linus Torvalds, Andrew Morton, linux-mm, mm-commits
On Fri, Sep 10, 2021 at 10:11:53AM -0700, Kees Cook wrote:
> On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote:
> >
> > More post linux-next material.
> >
> > 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
> >
> > Subsystems affected by this patch series:
> >
> > mm/slab-generic
> > rapidio
> > mm/debug
> >
> > Subsystem: mm/slab-generic
> >
> > "Matthew Wilcox (Oracle)" <willy@infradead.org>:
> > mm: move kvmalloc-related functions to slab.h
> >
> > Subsystem: rapidio
> >
> > Kees Cook <keescook@chromium.org>:
> > rapidio: avoid bogus __alloc_size warning
> >
> > Subsystem: mm/debug
> >
> > Kees Cook <keescook@chromium.org>:
> > Patch series "Add __alloc_size() for better bounds checking", v2:
> > Compiler Attributes: add __alloc_size() for better bounds checking
> > checkpatch: add __alloc_size() to known $Attribute
> > slab: clean up function declarations
> > slab: add __alloc_size attributes for better bounds checking
> > mm/page_alloc: add __alloc_size attributes for better bounds checking
> > percpu: add __alloc_size attributes for better bounds checking
> > mm/vmalloc: add __alloc_size attributes for better bounds checking
>
> Hi,
>
> FYI, in overnight build testing I found yet another corner case in
> GCC's handling of the __alloc_size attribute. It's the gift that keeps
> on giving. The fix is here:
>
> https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/
I'm so glad it's Friday. Here's the v2 fix... *sigh*
https://lore.kernel.org/lkml/20210910201132.3809437-1-keescook@chromium.org/
-Kees
>
> >
> > Makefile | 15 +++
> > drivers/of/kexec.c | 1
> > drivers/rapidio/devices/rio_mport_cdev.c | 9 +-
> > include/linux/compiler_attributes.h | 6 +
> > include/linux/gfp.h | 2
> > include/linux/mm.h | 34 --------
> > include/linux/percpu.h | 3
> > include/linux/slab.h | 122 ++++++++++++++++++++++---------
> > include/linux/vmalloc.h | 11 ++
> > scripts/checkpatch.pl | 3
> > 10 files changed, 132 insertions(+), 74 deletions(-)
> >
>
> --
> Kees Cook
--
Kees Cook
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-09-24 22:42 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-09-24 22:42 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
16 patches, based on 7d42e98182586f57f376406d033f05fe135edb75.
Subsystems affected by this patch series:
mm/memory-failure
mm/kasan
mm/damon
xtensa
mm/shmem
ocfs2
scripts
mm/tools
lib
mm/pagecache
mm/debug
sh
mm/kasan
mm/memory-failure
mm/pagemap
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm, hwpoison: add is_free_buddy_page() in HWPoisonHandlable()
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
kasan: fix Kconfig check of CC_HAS_WORKING_NOSANITIZE_ADDRESS
Subsystem: mm/damon
Adam Borowski <kilobyte@angband.pl>:
mm/damon: don't use strnlen() with known-bogus source length
Subsystem: xtensa
Guenter Roeck <linux@roeck-us.net>:
xtensa: increase size of gcc stack frame check
Subsystem: mm/shmem
Liu Yuntao <liuyuntao10@huawei.com>:
mm/shmem.c: fix judgment error in shmem_is_huge()
Subsystem: ocfs2
Wengang Wang <wen.gang.wang@oracle.com>:
ocfs2: drop acl cache for directories too
Subsystem: scripts
Miles Chen <miles.chen@mediatek.com>:
scripts/sorttable: riscv: fix undeclared identifier 'EM_RISCV' error
Subsystem: mm/tools
Changbin Du <changbin.du@gmail.com>:
tools/vm/page-types: remove dependency on opt_file for idle page tracking
Subsystem: lib
Paul Menzel <pmenzel@molgen.mpg.de>:
lib/zlib_inflate/inffast: check config in C to avoid unused function warning
Subsystem: mm/pagecache
Minchan Kim <minchan@kernel.org>:
mm: fs: invalidate bh_lrus for only cold path
Subsystem: mm/debug
Weizhao Ouyang <o451686892@gmail.com>:
mm/debug: sync up MR_CONTIG_RANGE and MR_LONGTERM_PIN
mm/debug: sync up latest migrate_reason to migrate_reason_names
Subsystem: sh
Geert Uytterhoeven <geert+renesas@glider.be>:
sh: pgtable-3level: fix cast to pointer from integer of different size
Subsystem: mm/kasan
Nathan Chancellor <nathan@kernel.org>:
kasan: always respect CONFIG_KASAN_STACK
Subsystem: mm/memory-failure
Qi Zheng <zhengqi.arch@bytedance.com>:
mm/memory_failure: fix the missing pte_unmap() call
Subsystem: mm/pagemap
Chen Jun <chenjun102@huawei.com>:
mm: fix uninitialized use in overcommit_policy_handler
arch/sh/include/asm/pgtable-3level.h | 2 +-
fs/buffer.c | 8 ++++++--
fs/ocfs2/dlmglue.c | 3 ++-
include/linux/buffer_head.h | 4 ++--
include/linux/migrate.h | 6 +++++-
lib/Kconfig.debug | 2 +-
lib/Kconfig.kasan | 2 ++
lib/zlib_inflate/inffast.c | 13 ++++++-------
mm/damon/dbgfs-test.h | 16 ++++++++--------
mm/debug.c | 4 +++-
mm/memory-failure.c | 12 ++++++------
mm/shmem.c | 4 ++--
mm/swap.c | 19 ++++++++++++++++---
mm/util.c | 4 ++--
scripts/Makefile.kasan | 3 ++-
scripts/sorttable.c | 4 ++++
tools/vm/page-types.c | 2 +-
17 files changed, 69 insertions(+), 39 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-10-18 22:14 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-10-18 22:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
19 patches, based on 519d81956ee277b4419c723adfb154603c2565ba.
Subsystems affected by this patch series:
mm/userfaultfd
mm/migration
ocfs2
mm/memblock
mm/mempolicy
mm/slub
binfmt
vfs
mm/secretmem
mm/thp
misc
Subsystem: mm/userfaultfd
Peter Xu <peterx@redhat.com>:
mm/userfaultfd: selftests: fix memory corruption with thp enabled
Nadav Amit <namit@vmware.com>:
userfaultfd: fix a race between writeprotect and exit_mmap()
Subsystem: mm/migration
Dave Hansen <dave.hansen@linux.intel.com>:
Patch series "mm/migrate: 5.15 fixes for automatic demotion", v2:
mm/migrate: optimize hotplug-time demotion order updates
mm/migrate: add CPU hotplug to demotion #ifdef
Huang Ying <ying.huang@intel.com>:
mm/migrate: fix CPUHP state to update node demotion order
Subsystem: ocfs2
Jan Kara <jack@suse.cz>:
ocfs2: fix data corruption after conversion from inline format
Valentin Vidic <vvidic@valentin-vidic.from.hr>:
ocfs2: mount fails with buffer overflow in strlen
Subsystem: mm/memblock
Peng Fan <peng.fan@nxp.com>:
memblock: check memory total_size
Subsystem: mm/mempolicy
Eric Dumazet <edumazet@google.com>:
mm/mempolicy: do not allow illegal MPOL_F_NUMA_BALANCING | MPOL_LOCAL in mbind()
Subsystem: mm/slub
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Fixups for slub":
mm, slub: fix two bugs in slab_debug_trace_open()
mm, slub: fix mismatch between reconstructed freelist depth and cnt
mm, slub: fix potential memoryleak in kmem_cache_open()
mm, slub: fix potential use-after-free in slab_debugfs_fops
mm, slub: fix incorrect memcg slab count for bulk free
Subsystem: binfmt
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
elfcore: correct reference to CONFIG_UML
Subsystem: vfs
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
vfs: check fd has read access in kernel_read_file_from_fd()
Subsystem: mm/secretmem
Sean Christopherson <seanjc@google.com>:
mm/secretmem: fix NULL page->mapping dereference in page_is_secretmem()
Subsystem: mm/thp
Marek Szyprowski <m.szyprowski@samsung.com>:
mm/thp: decrease nr_thps in file's mapping on THP split
Subsystem: misc
Andrej Shadura <andrew.shadura@collabora.co.uk>:
mailmap: add Andrej Shadura
.mailmap | 2 +
fs/kernel_read_file.c | 2 -
fs/ocfs2/alloc.c | 46 ++++++-----------------
fs/ocfs2/super.c | 14 +++++--
fs/userfaultfd.c | 12 ++++--
include/linux/cpuhotplug.h | 4 ++
include/linux/elfcore.h | 2 -
include/linux/memory.h | 5 ++
include/linux/secretmem.h | 2 -
mm/huge_memory.c | 6 ++-
mm/memblock.c | 2 -
mm/mempolicy.c | 16 ++------
mm/migrate.c | 62 ++++++++++++++++++-------------
mm/page_ext.c | 4 --
mm/slab.c | 4 +-
mm/slub.c | 31 ++++++++++++---
tools/testing/selftests/vm/userfaultfd.c | 23 ++++++++++-
17 files changed, 138 insertions(+), 99 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-10-28 21:35 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-10-28 21:35 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
11 patches, based on 411a44c24a561e449b592ff631b7ae321f1eb559.
Subsystems affected by this patch series:
mm/memcg
mm/memory-failure
mm/oom-kill
ocfs2
mm/secretmem
mm/vmalloc
mm/hugetlb
mm/damon
mm/tools
Subsystem: mm/memcg
Shakeel Butt <shakeelb@google.com>:
memcg: page_alloc: skip bulk allocator for __GFP_ACCOUNT
Subsystem: mm/memory-failure
Yang Shi <shy828301@gmail.com>:
mm: hwpoison: remove the unnecessary THP check
mm: filemap: check if THP has hwpoisoned subpage for PMD page fault
Subsystem: mm/oom-kill
Suren Baghdasaryan <surenb@google.com>:
mm/oom_kill.c: prevent a race between process_mrelease and exit_mmap
Subsystem: ocfs2
Gautham Ananthakrishna <gautham.ananthakrishna@oracle.com>:
ocfs2: fix race between searching chunks and release journal_head from buffer_head
Subsystem: mm/secretmem
Kees Cook <keescook@chromium.org>:
mm/secretmem: avoid letting secretmem_users drop to zero
Subsystem: mm/vmalloc
Chen Wandun <chenwandun@huawei.com>:
mm/vmalloc: fix numa spreading for large hash tables
Subsystem: mm/hugetlb
Rongwei Wang <rongwei.wang@linux.alibaba.com>:
mm, thp: bail out early in collapse_file for writeback page
Yang Shi <shy828301@gmail.com>:
mm: khugepaged: skip huge page collapse for special files
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
mm/damon/core-test: fix wrong expectations for 'damon_split_regions_of()'
Subsystem: mm/tools
David Yang <davidcomponentone@gmail.com>:
tools/testing/selftests/vm/split_huge_page_test.c: fix application of sizeof to pointer
fs/ocfs2/suballoc.c | 22 ++++++++++-------
include/linux/page-flags.h | 23 ++++++++++++++++++
mm/damon/core-test.h | 4 +--
mm/huge_memory.c | 2 +
mm/khugepaged.c | 26 +++++++++++++-------
mm/memory-failure.c | 28 +++++++++++-----------
mm/memory.c | 9 +++++++
mm/oom_kill.c | 23 +++++++++---------
mm/page_alloc.c | 8 +++++-
mm/secretmem.c | 2 -
mm/vmalloc.c | 15 +++++++----
tools/testing/selftests/vm/split_huge_page_test.c | 2 -
12 files changed, 110 insertions(+), 54 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-11-05 20:34 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-11-05 20:34 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
262 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813
Subsystems affected by this patch series:
scripts
ocfs2
vfs
mm/slab-generic
mm/slab
mm/slub
mm/kconfig
mm/dax
mm/kasan
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/mprotect
mm/mremap
mm/iomap
mm/tracing
mm/vmalloc
mm/pagealloc
mm/memory-failure
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/tools
mm/memblock
mm/oom-kill
mm/hugetlbfs
mm/migration
mm/thp
mm/readahead
mm/nommu
mm/ksm
mm/vmstat
mm/madvise
mm/memory-hotplug
mm/rmap
mm/zsmalloc
mm/highmem
mm/zram
mm/cleanups
mm/kfence
mm/damon
Subsystem: scripts
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Sven Eckelmann <sven@narfation.org>:
scripts/spelling.txt: fix "mistake" version of "synchronization"
weidonghui <weidonghui@allwinnertech.com>:
scripts/decodecode: fix faulting instruction no print when opps.file is DOS format
Subsystem: ocfs2
Chenyuan Mi <cymi20@fudan.edu.cn>:
ocfs2: fix handle refcount leak in two exception handling paths
Valentin Vidic <vvidic@valentin-vidic.from.hr>:
ocfs2: cleanup journal init and shutdown
Colin Ian King <colin.king@canonical.com>:
ocfs2/dlm: remove redundant assignment of variable ret
Jan Kara <jack@suse.cz>:
Patch series "ocfs2: Truncate data corruption fix":
ocfs2: fix data corruption on truncate
ocfs2: do not zero pages beyond i_size
Subsystem: vfs
Arnd Bergmann <arnd@arndb.de>:
fs/posix_acl.c: avoid -Wempty-body warning
Jia He <justin.he@arm.com>:
d_path: fix Kernel doc validator complaining
Subsystem: mm/slab-generic
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: move kvmalloc-related functions to slab.h
Subsystem: mm/slab
Shi Lei <shi_lei@massclouds.com>:
mm/slab.c: remove useless lines in enable_cpucache()
Subsystem: mm/slub
Kefeng Wang <wangkefeng.wang@huawei.com>:
slub: add back check for free nonslab objects
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: change percpu partial accounting from objects to pages
mm/slub: increase default cpu partial list sizes
Hyeonggon Yoo <42.hyeyoo@gmail.com>:
mm, slub: use prefetchw instead of prefetch
Subsystem: mm/kconfig
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm: disable NUMA_BALANCING_DEFAULT_ENABLED and TRANSPARENT_HUGEPAGE on PREEMPT_RT
Subsystem: mm/dax
Christoph Hellwig <hch@lst.de>:
mm: don't include <linux/dax.h> in <linux/mempolicy.h>
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
Patch series "stackdepot, kasan, workqueue: Avoid expanding stackdepot slabs when holding raw_spin_lock", v2:
lib/stackdepot: include gfp.h
lib/stackdepot: remove unused function argument
lib/stackdepot: introduce __stack_depot_save()
kasan: common: provide can_alloc in kasan_save_stack()
kasan: generic: introduce kasan_record_aux_stack_noalloc()
workqueue, kasan: avoid alloc_pages() when recording stack
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
kasan: fix tag for large allocations when using CONFIG_SLAB
Peter Collingbourne <pcc@google.com>:
kasan: test: add memcpy test that avoids out-of-bounds write
Subsystem: mm/debug
Peter Xu <peterx@redhat.com>:
Patch series "mm/smaps: Fixes and optimizations on shmem swap handling":
mm/smaps: fix shmem pte hole swap calculation
mm/smaps: use vma->vm_pgoff directly when counting partial swap
mm/smaps: simplify shmem handling of pte holes
Guo Ren <guoren@linux.alibaba.com>:
mm: debug_vm_pgtable: don't use __P000 directly
Kees Cook <keescook@chromium.org>:
kasan: test: bypass __alloc_size checks
Patch series "Add __alloc_size()", v3:
rapidio: avoid bogus __alloc_size warning
Compiler Attributes: add __alloc_size() for better bounds checking
slab: clean up function prototypes
slab: add __alloc_size attributes for better bounds checking
mm/kvmalloc: add __alloc_size attributes for better bounds checking
mm/vmalloc: add __alloc_size attributes for better bounds checking
mm/page_alloc: add __alloc_size attributes for better bounds checking
percpu: add __alloc_size attributes for better bounds checking
Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
mm/page_ext.c: fix a comment
Subsystem: mm/pagecache
David Howells <dhowells@redhat.com>:
mm: stop filemap_read() from grabbing a superfluous page
Christoph Hellwig <hch@lst.de>:
Patch series "simplify bdi unregistation":
mm: export bdi_unregister
mtd: call bdi_unregister explicitly
fs: explicitly unregister per-superblock BDIs
mm: don't automatically unregister bdis
mm: simplify bdi refcounting
Jens Axboe <axboe@kernel.dk>:
mm: don't read i_size of inode unless we need it
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap.c: remove bogus VM_BUG_ON
Jens Axboe <axboe@kernel.dk>:
mm: move more expensive part of XA setup out of mapping check
Subsystem: mm/gup
John Hubbard <jhubbard@nvidia.com>:
mm/gup: further simplify __gup_device_huge()
Subsystem: mm/swap
Xu Wang <vulab@iscas.ac.cn>:
mm/swapfile: remove needless request_queue NULL pointer check
Rafael Aquini <aquini@redhat.com>:
mm/swapfile: fix an integer overflow in swap_show()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: optimise put_pages_list()
Subsystem: mm/memcg
Peter Xu <peterx@redhat.com>:
mm/memcg: drop swp_entry_t* in mc_handle_file_pte()
Shakeel Butt <shakeelb@google.com>:
memcg: flush stats only if updated
memcg: unify memcg stat flushing
Waiman Long <longman@redhat.com>:
mm/memcg: remove obsolete memcg_free_kmem()
Len Baker <len.baker@gmx.com>:
mm/list_lru.c: prefer struct_size over open coded arithmetic
Shakeel Butt <shakeelb@google.com>:
memcg, kmem: further deprecate kmem.limit_in_bytes
Muchun Song <songmuchun@bytedance.com>:
mm: list_lru: remove holding lru lock
mm: list_lru: fix the return value of list_lru_count_one()
mm: memcontrol: remove kmemcg_id reparenting
mm: memcontrol: remove the kmem states
mm: list_lru: only add memcg-aware lrus to the global lru list
Vasily Averin <vvs@virtuozzo.com>:
Patch series "memcg: prohibit unconditional exceeding the limit of dying tasks", v3:
mm, oom: pagefault_out_of_memory: don't force global OOM for dying tasks
Michal Hocko <mhocko@suse.com>:
mm, oom: do not trigger out_of_memory from the #PF
Vasily Averin <vvs@virtuozzo.com>:
memcg: prohibit unconditional exceeding the limit of dying tasks
Subsystem: mm/pagemap
Peng Liu <liupeng256@huawei.com>:
mm/mmap.c: fix a data race of mm->total_vm
Rolf Eike Beer <eb@emlix.com>:
mm: use __pfn_to_section() instead of open coding it
Amit Daniel Kachhap <amit.kachhap@arm.com>:
mm/memory.c: avoid unnecessary kernel/user pointer conversion
Nadav Amit <namit@vmware.com>:
mm/memory.c: use correct VMA flags when freeing page-tables
Peter Xu <peterx@redhat.com>:
Patch series "mm: A few cleanup patches around zap, shmem and uffd", v4:
mm/shmem: unconditionally set pte dirty in mfill_atomic_install_pte
mm: clear vmf->pte after pte_unmap_same() returns
mm: drop first_index/last_index in zap_details
mm: add zap_skip_check_mapping() helper
Qi Zheng <zhengqi.arch@bytedance.com>:
Patch series "Do some code cleanups related to mm", v3:
mm: introduce pmd_install() helper
mm: remove redundant smp_wmb()
Tiberiu A Georgescu <tiberiu.georgescu@nutanix.com>:
Documentation: update pagemap with shmem exceptions
Nicholas Piggin <npiggin@gmail.com>:
Patch series "shoot lazy tlbs", v4:
lazy tlb: introduce lazy mm refcount helper functions
lazy tlb: allow lazy tlb mm refcounting to be configurable
lazy tlb: shoot lazies, a non-refcounting lazy tlb option
powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
memory: remove unused CONFIG_MEM_BLOCK_SIZE
Subsystem: mm/mprotect
Liu Song <liu.song11@zte.com.cn>:
mm/mprotect.c: avoid repeated assignment in do_mprotect_pkey()
Subsystem: mm/mremap
Dmitry Safonov <dima@arista.com>:
mm/mremap: don't account pages in vma_to_resize()
Subsystem: mm/iomap
Lucas De Marchi <lucas.demarchi@intel.com>:
include/linux/io-mapping.h: remove fallback for writecombine
Subsystem: mm/tracing
Gang Li <ligang.bdlg@bytedance.com>:
mm: mmap_lock: remove redundant newline in TP_printk
mm: mmap_lock: use DECLARE_EVENT_CLASS and DEFINE_EVENT_FN
Subsystem: mm/vmalloc
Vasily Averin <vvs@virtuozzo.com>:
mm/vmalloc: repair warn_alloc()s in __vmalloc_area_node()
Peter Zijlstra <peterz@infradead.org>:
mm/vmalloc: don't allow VM_NO_GUARD on vmap()
Eric Dumazet <edumazet@google.com>:
mm/vmalloc: make show_numa_info() aware of hugepage mappings
mm/vmalloc: make sure to dump unpurged areas in /proc/vmallocinfo
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: do not adjust the search size for alignment overhead
mm/vmalloc: check various alignments when debugging
Vasily Averin <vvs@virtuozzo.com>:
vmalloc: back off when the current task is OOM-killed
Kefeng Wang <wangkefeng.wang@huawei.com>:
vmalloc: choose a better start address in vm_area_register_early()
arm64: support page mapping percpu first chunk allocator
kasan: arm64: fix pcpu_page_first_chunk crash with KASAN_VMALLOC
Michal Hocko <mhocko@suse.com>:
mm/vmalloc: be more explicit about supported gfp flags
Chen Wandun <chenwandun@huawei.com>:
mm/vmalloc: introduce alloc_pages_bulk_array_mempolicy to accelerate memory allocation
Changcheng Deng <deng.changcheng@zte.com.cn>:
lib/test_vmalloc.c: use swap() to make code cleaner
Subsystem: mm/pagealloc
Eric Dumazet <edumazet@google.com>:
mm/large system hash: avoid possible NULL deref in alloc_large_system_hash
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups and fixup for page_alloc", v2:
mm/page_alloc.c: remove meaningless VM_BUG_ON() in pindex_to_order()
mm/page_alloc.c: simplify the code by using macro K()
mm/page_alloc.c: fix obsolete comment in free_pcppages_bulk()
mm/page_alloc.c: use helper function zone_spans_pfn()
mm/page_alloc.c: avoid allocating highmem pages via alloc_pages_exact[_nid]
Bharata B Rao <bharata@amd.com>:
Patch series "Fix NUMA nodes fallback list ordering":
mm/page_alloc: print node fallback order
Krupa Ramakrishnan <krupa.ramakrishnan@amd.com>:
mm/page_alloc: use accumulated load when building node fallback list
Geert Uytterhoeven <geert+renesas@glider.be>:
Patch series "Fix NUMA without SMP":
mm: move node_reclaim_distance to fix NUMA without SMP
mm: move fold_vm_numa_events() to fix NUMA without SMP
Eric Dumazet <edumazet@google.com>:
mm/page_alloc.c: do not acquire zone lock in is_free_buddy_page()
Feng Tang <feng.tang@intel.com>:
mm/page_alloc: detect allocation forbidden by cpuset and bail out early
Liangcai Fan <liangcaifan19@gmail.com>:
mm/page_alloc.c: show watermark_boost of zone in zoneinfo
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm: create a new system state and fix core_kernel_text()
mm: make generic arch_is_kernel_initmem_freed() do what it says
powerpc: use generic version of arch_is_kernel_initmem_freed()
s390: use generic version of arch_is_kernel_initmem_freed()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm: page_alloc: use migrate_disable() in drain_local_pages_wq()
Wang ShaoBo <bobo.shaobowang@huawei.com>:
mm/page_alloc: use clamp() to simplify code
Subsystem: mm/memory-failure
Marco Elver <elver@google.com>:
mm: fix data race in PagePoisoned()
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
mm/memory_failure: constify static mm_walk_ops
Yang Shi <shy828301@gmail.com>:
Patch series "Solve silent data loss caused by poisoned page cache (shmem/tmpfs)", v5:
mm: filemap: coding style cleanup for filemap_map_pmd()
mm: hwpoison: refactor refcount check handling
mm: shmem: don't truncate page if memory failure happens
mm: hwpoison: handle non-anonymous THP correctly
Subsystem: mm/hugetlb
Peter Xu <peterx@redhat.com>:
mm/hugetlb: drop __unmap_hugepage_range definition from hugetlb.h
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "hugetlb: add demote/split page functionality", v4:
hugetlb: add demote hugetlb page sysfs interfaces
mm/cma: add cma_pages_valid to determine if pages are in CMA
hugetlb: be sure to free demoted CMA pages to CMA
hugetlb: add demote bool to gigantic page routines
hugetlb: add hugetlb demote page support
Liangcai Fan <liangcaifan19@gmail.com>:
mm: khugepaged: recalculate min_free_kbytes after stopping khugepaged
Mina Almasry <almasrymina@google.com>:
mm, hugepages: add mremap() support for hugepage backed vma
mm, hugepages: add hugetlb vma mremap() test
Baolin Wang <baolin.wang@linux.alibaba.com>:
hugetlb: support node specified when using cma for gigantic hugepages
Ran Jianping <ran.jianping@zte.com.cn>:
mm: remove duplicate include in hugepage-mremap.c
Baolin Wang <baolin.wang@linux.alibaba.com>:
Patch series "Some cleanups and improvements for hugetlb":
hugetlb_cgroup: remove unused hugetlb_cgroup_from_counter macro
hugetlb: replace the obsolete hugetlb_instantiation_mutex in the comments
hugetlb: remove redundant validation in has_same_uncharge_info()
hugetlb: remove redundant VM_BUG_ON() in add_reservation_in_range()
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: remove unnecessary set_page_count in prep_compound_gigantic_page
Subsystem: mm/userfaultfd
Axel Rasmussen <axelrasmussen@google.com>:
Patch series "Small userfaultfd selftest fixups", v2:
userfaultfd/selftests: don't rely on GNU extensions for random numbers
userfaultfd/selftests: fix feature support detection
userfaultfd/selftests: fix calculation of expected ioctls
Subsystem: mm/vmscan
Miaohe Lin <linmiaohe@huawei.com>:
mm/page_isolation: fix potential missing call to unset_migratetype_isolate()
mm/page_isolation: guard against possible putback unisolated page
Kai Song <songkai01@inspur.com>:
mm/vmscan.c: fix -Wunused-but-set-variable warning
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Remove dependency on congestion_wait in mm/", v5. Patch series:
mm/vmscan: throttle reclaim until some writeback completes if congested
mm/vmscan: throttle reclaim and compaction when too may pages are isolated
mm/vmscan: throttle reclaim when no progress is being made
mm/writeback: throttle based on page writeback instead of congestion
mm/page_alloc: remove the throttling logic from the page allocator
mm/vmscan: centralise timeout values for reclaim_throttle
mm/vmscan: increase the timeout if page reclaim is not making progress
mm/vmscan: delay waking of tasks throttled on NOPROGRESS
Yuanzheng Song <songyuanzheng@huawei.com>:
mm/vmpressure: fix data-race with memcg->socket_pressure
Subsystem: mm/tools
Zhenliang Wei <weizhenliang@huawei.com>:
tools/vm/page_owner_sort.c: count and sort by mem
Naoya Horiguchi <naoya.horiguchi@nec.com>:
Patch series "tools/vm/page-types.c: a few improvements":
tools/vm/page-types.c: make walk_file() aware of address range option
tools/vm/page-types.c: move show_file() to summary output
tools/vm/page-types.c: print file offset in hexadecimal
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "memblock: cleanup memblock_free interface", v2:
arch_numa: simplify numa_distance allocation
xen/x86: free_p2m_page: use memblock_free_ptr() to free a virtual pointer
memblock: drop memblock_free_early_nid() and memblock_free_early()
memblock: stop aliasing __memblock_free_late with memblock_free_late
memblock: rename memblock_free to memblock_phys_free
memblock: use memblock_free for freeing virtual pointers
Subsystem: mm/oom-kill
Sultan Alsawaf <sultan@kerneltoast.com>:
mm: mark the OOM reaper thread as freezable
Subsystem: mm/hugetlbfs
Zhenguo Yao <yaozhenguo1@gmail.com>:
hugetlbfs: extend the definition of hugepages parameter to support node allocation
Subsystem: mm/migration
John Hubbard <jhubbard@nvidia.com>:
mm/migrate: de-duplicate migrate_reason strings
Yang Shi <shy828301@gmail.com>:
mm: migrate: make demotion knob depend on migration
Subsystem: mm/thp
"George G. Davis" <davis.george@siemens.com>:
selftests/vm/transhuge-stress: fix ram size thinko
Rongwei Wang <rongwei.wang@linux.alibaba.com>:
Patch series "fix two bugs for file THP":
mm, thp: lock filemap when truncating page cache
mm, thp: fix incorrect unmap behavior for private pages
Subsystem: mm/readahead
Lin Feng <linf@wangsu.com>:
mm/readahead.c: fix incorrect comments for get_init_ra_size
Subsystem: mm/nommu
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: nommu: kill arch_get_unmapped_area()
Subsystem: mm/ksm
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
selftest/vm: fix ksm selftest to run with different NUMA topologies
Pedro Demarchi Gomes <pedrodemargomes@gmail.com>:
selftests: vm: add KSM huge pages merging time test
Subsystem: mm/vmstat
Liu Shixin <liushixin2@huawei.com>:
mm/vmstat: annotate data race for zone->free_area[order].nr_free
Lin Feng <linf@wangsu.com>:
mm: vmstat.c: make extfrag_index show more pretty
Subsystem: mm/madvise
David Hildenbrand <david@redhat.com>:
selftests/vm: make MADV_POPULATE_(READ|WRITE) use in-tree headers
Subsystem: mm/memory-hotplug
Tang Yizhou <tangyizhou@huawei.com>:
mm/memory_hotplug: add static qualifier for online_policy_to_str()
David Hildenbrand <david@redhat.com>:
Patch series "memory-hotplug.rst: document the "auto-movable" online policy":
memory-hotplug.rst: fix two instances of "movablecore" that should be "movable_node"
memory-hotplug.rst: fix wrong /sys/module/memory_hotplug/parameters/ path
memory-hotplug.rst: document the "auto-movable" online policy
Patch series "mm/memory_hotplug: Kconfig and 32 bit cleanups":
mm/memory_hotplug: remove CONFIG_X86_64_ACPI_NUMA dependency from CONFIG_MEMORY_HOTPLUG
mm/memory_hotplug: remove CONFIG_MEMORY_HOTPLUG_SPARSE
mm/memory_hotplug: restrict CONFIG_MEMORY_HOTPLUG to 64 bit
mm/memory_hotplug: remove HIGHMEM leftovers
mm/memory_hotplug: remove stale function declarations
x86: remove memory hotplug support on X86_32
Patch series "mm/memory_hotplug: full support for add_memory_driver_managed() with CONFIG_ARCH_KEEP_MEMBLOCK", v2:
mm/memory_hotplug: handle memblock_add_node() failures in add_memory_resource()
memblock: improve MEMBLOCK_HOTPLUG documentation
memblock: allow to specify flags with memblock_add_node()
memblock: add MEMBLOCK_DRIVER_MANAGED to mimic IORESOURCE_SYSRAM_DRIVER_MANAGED
mm/memory_hotplug: indicate MEMBLOCK_DRIVER_MANAGED with IORESOURCE_SYSRAM_DRIVER_MANAGED
Subsystem: mm/rmap
Alistair Popple <apopple@nvidia.com>:
mm/rmap.c: avoid double faults migrating device private pages
Subsystem: mm/zsmalloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/zsmalloc.c: close race window between zs_pool_dec_isolated() and zs_unregister_migration()
Subsystem: mm/highmem
Ira Weiny <ira.weiny@intel.com>:
mm/highmem: remove deprecated kmap_atomic
Subsystem: mm/zram
Jaewon Kim <jaewon31.kim@samsung.com>:
zram_drv: allow reclaim on bio_alloc
Dan Carpenter <dan.carpenter@oracle.com>:
zram: off by one in read_block_state()
Brian Geffon <bgeffon@google.com>:
zram: introduce an aged idle interface
Subsystem: mm/cleanups
Stephen Kitt <steve@sk2.org>:
mm: remove HARDENED_USERCOPY_FALLBACK
Mianhan Liu <liumh1@shanghaitech.edu.cn>:
include/linux/mm.h: move nr_free_buffer_pages from swap.h to mm.h
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
stacktrace: move filter_irq_stacks() to kernel/stacktrace.c
kfence: count unexpectedly skipped allocations
kfence: move saving stack trace of allocations into __kfence_alloc()
kfence: limit currently covered allocations when pool nearly full
kfence: add note to documentation about skipping covered allocations
kfence: test: use kunit_skip() to skip tests
kfence: shorten critical sections of alloc/free
kfence: always use static branches to guard kfence_alloc()
kfence: default to dynamic branch instead of static keys mode
Subsystem: mm/damon
Geert Uytterhoeven <geert@linux-m68k.org>:
mm/damon: grammar s/works/work/
SeongJae Park <sjpark@amazon.de>:
Documentation/vm: move user guides to admin-guide/mm/
SeongJae Park <sj@kernel.org>:
MAINTAINERS: update SeongJae's email address
SeongJae Park <sjpark@amazon.de>:
docs/vm/damon: remove broken reference
include/linux/damon.h: fix kernel-doc comments for 'damon_callback'
SeongJae Park <sj@kernel.org>:
mm/damon/core: print kdamond start log in debug mode only
Changbin Du <changbin.du@gmail.com>:
mm/damon: remove unnecessary do_exit() from kdamond
mm/damon: needn't hold kdamond_lock to print pid of kdamond
Colin Ian King <colin.king@canonical.com>:
mm/damon/core: nullify pointer ctx->kdamond with a NULL
SeongJae Park <sj@kernel.org>:
Patch series "Implement Data Access Monitoring-based Memory Operation Schemes":
mm/damon/core: account age of target regions
mm/damon/core: implement DAMON-based Operation Schemes (DAMOS)
mm/damon/vaddr: support DAMON-based Operation Schemes
mm/damon/dbgfs: support DAMON-based Operation Schemes
mm/damon/schemes: implement statistics feature
selftests/damon: add 'schemes' debugfs tests
Docs/admin-guide/mm/damon: document DAMON-based Operation Schemes
Patch series "DAMON: Support Physical Memory Address Space Monitoring::
mm/damon/dbgfs: allow users to set initial monitoring target regions
mm/damon/dbgfs-test: add a unit test case for 'init_regions'
Docs/admin-guide/mm/damon: document 'init_regions' feature
mm/damon/vaddr: separate commonly usable functions
mm/damon: implement primitives for physical address space monitoring
mm/damon/dbgfs: support physical memory monitoring
Docs/DAMON: document physical memory monitoring support
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
mm/damon/vaddr: constify static mm_walk_ops
Rongwei Wang <rongwei.wang@linux.alibaba.com>:
mm/damon/dbgfs: remove unnecessary variables
SeongJae Park <sj@kernel.org>:
mm/damon/paddr: support the pageout scheme
mm/damon/schemes: implement size quota for schemes application speed control
mm/damon/schemes: skip already charged targets and regions
mm/damon/schemes: implement time quota
mm/damon/dbgfs: support quotas of schemes
mm/damon/selftests: support schemes quotas
mm/damon/schemes: prioritize regions within the quotas
mm/damon/vaddr,paddr: support pageout prioritization
mm/damon/dbgfs: support prioritization weights
tools/selftests/damon: update for regions prioritization of schemes
mm/damon/schemes: activate schemes based on a watermarks mechanism
mm/damon/dbgfs: support watermarks
selftests/damon: support watermarks
mm/damon: introduce DAMON-based Reclamation (DAMON_RECLAIM)
Documentation/admin-guide/mm/damon: add a document for DAMON_RECLAIM
Xin Hao <xhao@linux.alibaba.com>:
Patch series "mm/damon: Fix some small bugs", v4:
mm/damon: remove unnecessary variable initialization
mm/damon/dbgfs: add adaptive_targets list check before enable monitor_on
SeongJae Park <sj@kernel.org>:
Patch series "Fix trivial nits in Documentation/admin-guide/mm":
Docs/admin-guide/mm/damon/start: fix wrong example commands
Docs/admin-guide/mm/damon/start: fix a wrong link
Docs/admin-guide/mm/damon/start: simplify the content
Docs/admin-guide/mm/pagemap: wordsmith page flags descriptions
Changbin Du <changbin.du@gmail.com>:
mm/damon: simplify stop mechanism
Colin Ian King <colin.i.king@googlemail.com>:
mm/damon: fix a few spelling mistakes in comments and a pr_debug message
Changbin Du <changbin.du@gmail.com>:
mm/damon: remove return value from before_terminate callback
a/Documentation/admin-guide/blockdev/zram.rst | 8
a/Documentation/admin-guide/cgroup-v1/memory.rst | 11
a/Documentation/admin-guide/kernel-parameters.txt | 14
a/Documentation/admin-guide/mm/damon/index.rst | 1
a/Documentation/admin-guide/mm/damon/reclaim.rst | 235 +++
a/Documentation/admin-guide/mm/damon/start.rst | 140 +
a/Documentation/admin-guide/mm/damon/usage.rst | 117 +
a/Documentation/admin-guide/mm/hugetlbpage.rst | 42
a/Documentation/admin-guide/mm/memory-hotplug.rst | 147 +-
a/Documentation/admin-guide/mm/pagemap.rst | 75 -
a/Documentation/core-api/memory-hotplug.rst | 3
a/Documentation/dev-tools/kfence.rst | 23
a/Documentation/translations/zh_CN/core-api/memory-hotplug.rst | 4
a/Documentation/vm/damon/design.rst | 29
a/Documentation/vm/damon/faq.rst | 5
a/Documentation/vm/damon/index.rst | 1
a/Documentation/vm/page_owner.rst | 23
a/MAINTAINERS | 2
a/Makefile | 15
a/arch/Kconfig | 28
a/arch/alpha/kernel/core_irongate.c | 6
a/arch/arc/mm/init.c | 6
a/arch/arm/mach-hisi/platmcpm.c | 2
a/arch/arm/mach-rpc/ecard.c | 2
a/arch/arm/mm/init.c | 2
a/arch/arm64/Kconfig | 4
a/arch/arm64/mm/kasan_init.c | 16
a/arch/arm64/mm/mmu.c | 4
a/arch/ia64/mm/contig.c | 2
a/arch/ia64/mm/init.c | 2
a/arch/m68k/mm/mcfmmu.c | 3
a/arch/m68k/mm/motorola.c | 6
a/arch/mips/loongson64/init.c | 4
a/arch/mips/mm/init.c | 6
a/arch/mips/sgi-ip27/ip27-memory.c | 3
a/arch/mips/sgi-ip30/ip30-setup.c | 6
a/arch/powerpc/Kconfig | 1
a/arch/powerpc/configs/skiroot_defconfig | 1
a/arch/powerpc/include/asm/machdep.h | 2
a/arch/powerpc/include/asm/sections.h | 13
a/arch/powerpc/kernel/dt_cpu_ftrs.c | 8
a/arch/powerpc/kernel/paca.c | 8
a/arch/powerpc/kernel/setup-common.c | 4
a/arch/powerpc/kernel/setup_64.c | 6
a/arch/powerpc/kernel/smp.c | 2
a/arch/powerpc/mm/book3s64/radix_tlb.c | 4
a/arch/powerpc/mm/hugetlbpage.c | 9
a/arch/powerpc/platforms/powernv/pci-ioda.c | 4
a/arch/powerpc/platforms/powernv/setup.c | 4
a/arch/powerpc/platforms/pseries/setup.c | 2
a/arch/powerpc/platforms/pseries/svm.c | 9
a/arch/riscv/kernel/setup.c | 10
a/arch/s390/include/asm/sections.h | 12
a/arch/s390/kernel/setup.c | 11
a/arch/s390/kernel/smp.c | 6
a/arch/s390/kernel/uv.c | 2
a/arch/s390/mm/init.c | 3
a/arch/s390/mm/kasan_init.c | 2
a/arch/sh/boards/mach-ap325rxa/setup.c | 2
a/arch/sh/boards/mach-ecovec24/setup.c | 4
a/arch/sh/boards/mach-kfr2r09/setup.c | 2
a/arch/sh/boards/mach-migor/setup.c | 2
a/arch/sh/boards/mach-se/7724/setup.c | 4
a/arch/sparc/kernel/smp_64.c | 4
a/arch/um/kernel/mem.c | 4
a/arch/x86/Kconfig | 6
a/arch/x86/kernel/setup.c | 4
a/arch/x86/kernel/setup_percpu.c | 2
a/arch/x86/mm/init.c | 2
a/arch/x86/mm/init_32.c | 31
a/arch/x86/mm/kasan_init_64.c | 4
a/arch/x86/mm/numa.c | 2
a/arch/x86/mm/numa_emulation.c | 2
a/arch/x86/xen/mmu_pv.c | 8
a/arch/x86/xen/p2m.c | 4
a/arch/x86/xen/setup.c | 6
a/drivers/base/Makefile | 2
a/drivers/base/arch_numa.c | 96 +
a/drivers/base/node.c | 9
a/drivers/block/zram/zram_drv.c | 66
a/drivers/firmware/efi/memmap.c | 2
a/drivers/hwmon/occ/p9_sbe.c | 1
a/drivers/macintosh/smu.c | 2
a/drivers/mmc/core/mmc_test.c | 1
a/drivers/mtd/mtdcore.c | 1
a/drivers/of/kexec.c | 4
a/drivers/of/of_reserved_mem.c | 5
a/drivers/rapidio/devices/rio_mport_cdev.c | 9
a/drivers/s390/char/sclp_early.c | 4
a/drivers/usb/early/xhci-dbc.c | 10
a/drivers/virtio/Kconfig | 2
a/drivers/xen/swiotlb-xen.c | 4
a/fs/d_path.c | 8
a/fs/exec.c | 4
a/fs/ocfs2/alloc.c | 21
a/fs/ocfs2/dlm/dlmrecovery.c | 1
a/fs/ocfs2/file.c | 8
a/fs/ocfs2/inode.c | 4
a/fs/ocfs2/journal.c | 28
a/fs/ocfs2/journal.h | 3
a/fs/ocfs2/super.c | 40
a/fs/open.c | 16
a/fs/posix_acl.c | 3
a/fs/proc/task_mmu.c | 28
a/fs/super.c | 3
a/include/asm-generic/sections.h | 14
a/include/linux/backing-dev-defs.h | 3
a/include/linux/backing-dev.h | 1
a/include/linux/cma.h | 1
a/include/linux/compiler-gcc.h | 8
a/include/linux/compiler_attributes.h | 10
a/include/linux/compiler_types.h | 12
a/include/linux/cpuset.h | 17
a/include/linux/damon.h | 258 +++
a/include/linux/fs.h | 1
a/include/linux/gfp.h | 8
a/include/linux/highmem.h | 28
a/include/linux/hugetlb.h | 36
a/include/linux/io-mapping.h | 6
a/include/linux/kasan.h | 8
a/include/linux/kernel.h | 1
a/include/linux/kfence.h | 21
a/include/linux/memblock.h | 48
a/include/linux/memcontrol.h | 9
a/include/linux/memory.h | 26
a/include/linux/memory_hotplug.h | 3
a/include/linux/mempolicy.h | 5
a/include/linux/migrate.h | 23
a/include/linux/migrate_mode.h | 13
a/include/linux/mm.h | 57
a/include/linux/mm_types.h | 2
a/include/linux/mmzone.h | 41
a/include/linux/node.h | 4
a/include/linux/page-flags.h | 2
a/include/linux/percpu.h | 6
a/include/linux/sched/mm.h | 25
a/include/linux/slab.h | 181 +-
a/include/linux/slub_def.h | 13
a/include/linux/stackdepot.h | 8
a/include/linux/stacktrace.h | 1
a/include/linux/swap.h | 1
a/include/linux/vmalloc.h | 24
a/include/trace/events/mmap_lock.h | 50
a/include/trace/events/vmscan.h | 42
a/include/trace/events/writeback.h | 7
a/init/Kconfig | 2
a/init/initramfs.c | 4
a/init/main.c | 6
a/kernel/cgroup/cpuset.c | 23
a/kernel/cpu.c | 2
a/kernel/dma/swiotlb.c | 6
a/kernel/exit.c | 2
a/kernel/extable.c | 2
a/kernel/fork.c | 51
a/kernel/kexec_file.c | 5
a/kernel/kthread.c | 21
a/kernel/locking/lockdep.c | 15
a/kernel/printk/printk.c | 4
a/kernel/sched/core.c | 37
a/kernel/sched/sched.h | 4
a/kernel/sched/topology.c | 1
a/kernel/stacktrace.c | 30
a/kernel/tsacct.c | 2
a/kernel/workqueue.c | 2
a/lib/Kconfig.debug | 2
a/lib/Kconfig.kfence | 26
a/lib/bootconfig.c | 2
a/lib/cpumask.c | 6
a/lib/stackdepot.c | 76 -
a/lib/test_kasan.c | 26
a/lib/test_kasan_module.c | 2
a/lib/test_vmalloc.c | 6
a/mm/Kconfig | 10
a/mm/backing-dev.c | 65
a/mm/cma.c | 26
a/mm/compaction.c | 12
a/mm/damon/Kconfig | 24
a/mm/damon/Makefile | 4
a/mm/damon/core.c | 500 ++++++-
a/mm/damon/dbgfs-test.h | 56
a/mm/damon/dbgfs.c | 486 +++++-
a/mm/damon/paddr.c | 275 +++
a/mm/damon/prmtv-common.c | 133 +
a/mm/damon/prmtv-common.h | 20
a/mm/damon/reclaim.c | 356 ++++
a/mm/damon/vaddr-test.h | 2
a/mm/damon/vaddr.c | 167 +-
a/mm/debug.c | 20
a/mm/debug_vm_pgtable.c | 7
a/mm/filemap.c | 78 -
a/mm/gup.c | 5
a/mm/highmem.c | 6
a/mm/hugetlb.c | 713 +++++++++-
a/mm/hugetlb_cgroup.c | 3
a/mm/internal.h | 26
a/mm/kasan/common.c | 8
a/mm/kasan/generic.c | 16
a/mm/kasan/kasan.h | 2
a/mm/kasan/shadow.c | 5
a/mm/kfence/core.c | 214 ++-
a/mm/kfence/kfence.h | 2
a/mm/kfence/kfence_test.c | 14
a/mm/khugepaged.c | 10
a/mm/list_lru.c | 58
a/mm/memblock.c | 35
a/mm/memcontrol.c | 217 +--
a/mm/memory-failure.c | 117 +
a/mm/memory.c | 166 +-
a/mm/memory_hotplug.c | 57
a/mm/mempolicy.c | 143 +-
a/mm/migrate.c | 61
a/mm/mmap.c | 2
a/mm/mprotect.c | 5
a/mm/mremap.c | 86 -
a/mm/nommu.c | 6
a/mm/oom_kill.c | 27
a/mm/page-writeback.c | 13
a/mm/page_alloc.c | 119 -
a/mm/page_ext.c | 2
a/mm/page_isolation.c | 29
a/mm/percpu.c | 24
a/mm/readahead.c | 2
a/mm/rmap.c | 8
a/mm/shmem.c | 44
a/mm/slab.c | 16
a/mm/slab_common.c | 8
a/mm/slub.c | 117 -
a/mm/sparse-vmemmap.c | 2
a/mm/sparse.c | 6
a/mm/swap.c | 23
a/mm/swapfile.c | 6
a/mm/userfaultfd.c | 8
a/mm/vmalloc.c | 107 +
a/mm/vmpressure.c | 2
a/mm/vmscan.c | 194 ++
a/mm/vmstat.c | 76 -
a/mm/zsmalloc.c | 7
a/net/ipv4/tcp.c | 1
a/net/ipv4/udp.c | 1
a/net/netfilter/ipvs/ip_vs_ctl.c | 1
a/net/openvswitch/meter.c | 1
a/net/sctp/protocol.c | 1
a/scripts/checkpatch.pl | 3
a/scripts/decodecode | 2
a/scripts/spelling.txt | 18
a/security/Kconfig | 14
a/tools/testing/selftests/damon/debugfs_attrs.sh | 25
a/tools/testing/selftests/memory-hotplug/config | 1
a/tools/testing/selftests/vm/.gitignore | 1
a/tools/testing/selftests/vm/Makefile | 1
a/tools/testing/selftests/vm/hugepage-mremap.c | 161 ++
a/tools/testing/selftests/vm/ksm_tests.c | 154 ++
a/tools/testing/selftests/vm/madv_populate.c | 15
a/tools/testing/selftests/vm/run_vmtests.sh | 11
a/tools/testing/selftests/vm/transhuge-stress.c | 2
a/tools/testing/selftests/vm/userfaultfd.c | 157 +-
a/tools/vm/page-types.c | 38
a/tools/vm/page_owner_sort.c | 94 +
b/Documentation/admin-guide/mm/index.rst | 2
b/Documentation/vm/index.rst | 26
260 files changed, 6448 insertions(+), 2327 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-11-09 2:30 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-11-09 2:30 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
87 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813, plus
previously sent material.
Subsystems affected by this patch series:
mm/pagecache
mm/hugetlb
procfs
misc
MAINTAINERS
lib
checkpatch
binfmt
kallsyms
ramfs
init
codafs
nilfs2
hfs
crash_dump
signals
seq_file
fork
sysvfs
kcov
gdb
resource
selftests
ipc
Subsystem: mm/pagecache
Johannes Weiner <hannes@cmpxchg.org>:
vfs: keep inodes with page cache off the inode shrinker LRU
Subsystem: mm/hugetlb
zhangyiru <zhangyiru3@huawei.com>:
mm,hugetlb: remove mlock ulimit for SHM_HUGETLB
Subsystem: procfs
Florian Weimer <fweimer@redhat.com>:
procfs: do not list TID 0 in /proc/<pid>/task
David Hildenbrand <david@redhat.com>:
x86/xen: update xen_oldmem_pfn_is_ram() documentation
x86/xen: simplify xen_oldmem_pfn_is_ram()
x86/xen: print a warning when HVMOP_get_mem_type fails
proc/vmcore: let pfn_is_ram() return a bool
proc/vmcore: convert oldmem_pfn_is_ram callback to more generic vmcore callbacks
virtio-mem: factor out hotplug specifics from virtio_mem_init() into virtio_mem_init_hotplug()
virtio-mem: factor out hotplug specifics from virtio_mem_probe() into virtio_mem_init_hotplug()
virtio-mem: factor out hotplug specifics from virtio_mem_remove() into virtio_mem_deinit_hotplug()
virtio-mem: kdump mode to sanitize /proc/vmcore access
Stephen Brennan <stephen.s.brennan@oracle.com>:
proc: allow pid_revalidate() during LOOKUP_RCU
Subsystem: misc
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
Patch series "kernel.h further split", v5:
kernel.h: drop unneeded <linux/kernel.h> inclusion from other headers
kernel.h: split out container_of() and typeof_member() macros
include/kunit/test.h: replace kernel.h with the necessary inclusions
include/linux/list.h: replace kernel.h with the necessary inclusions
include/linux/llist.h: replace kernel.h with the necessary inclusions
include/linux/plist.h: replace kernel.h with the necessary inclusions
include/media/media-entity.h: replace kernel.h with the necessary inclusions
include/linux/delay.h: replace kernel.h with the necessary inclusions
include/linux/sbitmap.h: replace kernel.h with the necessary inclusions
include/linux/radix-tree.h: replace kernel.h with the necessary inclusions
include/linux/generic-radix-tree.h: replace kernel.h with the necessary inclusions
Stephen Rothwell <sfr@canb.auug.org.au>:
kernel.h: split out instruction pointer accessors
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
linux/container_of.h: switch to static_assert
Colin Ian King <colin.i.king@googlemail.com>:
mailmap: update email address for Colin King
Subsystem: MAINTAINERS
Kees Cook <keescook@chromium.org>:
MAINTAINERS: add "exec & binfmt" section with myself and Eric
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
Patch series "Rectify file references for dt-bindings in MAINTAINERS", v5:
MAINTAINERS: rectify entry for ARM/TOSHIBA VISCONTI ARCHITECTURE
MAINTAINERS: rectify entry for HIKEY960 ONBOARD USB GPIO HUB DRIVER
MAINTAINERS: rectify entry for INTEL KEEM BAY DRM DRIVER
MAINTAINERS: rectify entry for ALLWINNER HARDWARE SPINLOCK SUPPORT
Subsystem: lib
Imran Khan <imran.f.khan@oracle.com>:
Patch series "lib, stackdepot: check stackdepot handle before accessing slabs", v2:
lib, stackdepot: check stackdepot handle before accessing slabs
lib, stackdepot: add helper to print stack entries
lib, stackdepot: add helper to print stack entries into buffer
Lucas De Marchi <lucas.demarchi@intel.com>:
include/linux/string_helpers.h: add linux/string.h for strlen()
Alexey Dobriyan <adobriyan@gmail.com>:
lib: uninline simple_strntoull() as well
Thomas Gleixner <tglx@linutronix.de>:
mm/scatterlist: replace the !preemptible warning in sg_miter_stop()
Subsystem: checkpatch
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
const_structs.checkpatch: add a few sound ops structs
Joe Perches <joe@perches.com>:
checkpatch: improve EXPORT_SYMBOL test for EXPORT_SYMBOL_NS uses
Peter Ujfalusi <peter.ujfalusi@linux.intel.com>:
checkpatch: get default codespell dictionary path from package location
Subsystem: binfmt
Kees Cook <keescook@chromium.org>:
binfmt_elf: reintroduce using MAP_FIXED_NOREPLACE
Alexey Dobriyan <adobriyan@gmail.com>:
ELF: simplify STACK_ALLOC macro
Subsystem: kallsyms
Kefeng Wang <wangkefeng.wang@huawei.com>:
Patch series "sections: Unify kernel sections range check and use", v4:
kallsyms: remove arch specific text and data check
kallsyms: fix address-checks for kernel related range
sections: move and rename core_kernel_data() to is_kernel_core_data()
sections: move is_kernel_inittext() into sections.h
x86: mm: rename __is_kernel_text() to is_x86_32_kernel_text()
sections: provide internal __is_kernel() and __is_kernel_text() helper
mm: kasan: use is_kernel() helper
extable: use is_kernel_text() helper
powerpc/mm: use core_kernel_text() helper
microblaze: use is_kernel_text() helper
alpha: use is_kernel_text() helper
Subsystem: ramfs
yangerkun <yangerkun@huawei.com>:
ramfs: fix mount source show for ramfs
Subsystem: init
Andrew Halaney <ahalaney@redhat.com>:
init: make unknown command line param message clearer
Subsystem: codafs
Jan Harkes <jaharkes@cs.cmu.edu>:
Patch series "Coda updates for -next":
coda: avoid NULL pointer dereference from a bad inode
coda: check for async upcall request using local state
Alex Shi <alex.shi@linux.alibaba.com>:
coda: remove err which no one care
Jan Harkes <jaharkes@cs.cmu.edu>:
coda: avoid flagging NULL inodes
coda: avoid hidden code duplication in rename
coda: avoid doing bad things on inode type changes during revalidation
Xiyu Yang <xiyuyang19@fudan.edu.cn>:
coda: convert from atomic_t to refcount_t on coda_vm_ops->refcnt
Jing Yangyang <jing.yangyang@zte.com.cn>:
coda: use vmemdup_user to replace the open code
Jan Harkes <jaharkes@cs.cmu.edu>:
coda: bump module version to 7.2
Subsystem: nilfs2
Qing Wang <wangqing@vivo.com>:
Patch series "nilfs2 updates":
nilfs2: replace snprintf in show functions with sysfs_emit
Ryusuke Konishi <konishi.ryusuke@gmail.com>:
nilfs2: remove filenames from file comments
Subsystem: hfs
Arnd Bergmann <arnd@arndb.de>:
hfs/hfsplus: use WARN_ON for sanity check
Subsystem: crash_dump
Changcheng Deng <deng.changcheng@zte.com.cn>:
crash_dump: fix boolreturn.cocci warning
Ye Guojin <ye.guojin@zte.com.cn>:
crash_dump: remove duplicate include in crash_dump.h
Subsystem: signals
Ye Guojin <ye.guojin@zte.com.cn>:
signal: remove duplicate include in signal.h
Subsystem: seq_file
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
seq_file: move seq_escape() to a header
Muchun Song <songmuchun@bytedance.com>:
seq_file: fix passing wrong private data
Subsystem: fork
Ran Xiaokai <ran.xiaokai@zte.com.cn>:
kernel/fork.c: unshare(): use swap() to make code cleaner
Subsystem: sysvfs
Pavel Skripkin <paskripkin@gmail.com>:
sysv: use BUILD_BUG_ON instead of runtime check
Subsystem: kcov
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
Patch series "kcov: PREEMPT_RT fixup + misc", v2:
Documentation/kcov: include types.h in the example
Documentation/kcov: define `ip' in the example
kcov: allocate per-CPU memory on the relevant node
kcov: avoid enable+disable interrupts if !in_task()
kcov: replace local_irq_save() with a local_lock_t
Subsystem: gdb
Douglas Anderson <dianders@chromium.org>:
scripts/gdb: handle split debug for vmlinux
Subsystem: resource
David Hildenbrand <david@redhat.com>:
Patch series "virtio-mem: disallow mapping virtio-mem memory via /dev/mem", v5:
kernel/resource: clean up and optimize iomem_is_exclusive()
kernel/resource: disallow access to exclusive system RAM regions
virtio-mem: disallow mapping virtio-mem memory via /dev/mem
Subsystem: selftests
SeongJae Park <sjpark@amazon.de>:
selftests/kselftest/runner/run_one(): allow running non-executable files
Subsystem: ipc
Michal Clapinski <mclapinski@google.com>:
ipc: check checkpoint_restore_ns_capable() to modify C/R proc files
Manfred Spraul <manfred@colorfullife.com>:
ipc/ipc_sysctl.c: remove fallback for !CONFIG_PROC_SYSCTL
.mailmap | 2
Documentation/dev-tools/kcov.rst | 5
MAINTAINERS | 21 +
arch/alpha/kernel/traps.c | 4
arch/microblaze/mm/pgtable.c | 3
arch/powerpc/mm/pgtable_32.c | 7
arch/riscv/lib/delay.c | 4
arch/s390/include/asm/facility.h | 4
arch/x86/kernel/aperture_64.c | 13
arch/x86/kernel/unwind_orc.c | 2
arch/x86/mm/init_32.c | 14
arch/x86/xen/mmu_hvm.c | 39 --
drivers/gpu/drm/drm_dp_mst_topology.c | 5
drivers/gpu/drm/drm_mm.c | 5
drivers/gpu/drm/i915/i915_vma.c | 5
drivers/gpu/drm/i915/intel_runtime_pm.c | 20 -
drivers/media/dvb-frontends/cxd2880/cxd2880_common.h | 1
drivers/virtio/Kconfig | 1
drivers/virtio/virtio_mem.c | 321 +++++++++++++------
fs/binfmt_elf.c | 33 +
fs/coda/cnode.c | 13
fs/coda/coda_linux.c | 39 +-
fs/coda/coda_linux.h | 6
fs/coda/dir.c | 20 -
fs/coda/file.c | 12
fs/coda/psdev.c | 14
fs/coda/upcall.c | 3
fs/hfs/inode.c | 6
fs/hfsplus/inode.c | 12
fs/hugetlbfs/inode.c | 23 -
fs/inode.c | 46 +-
fs/internal.h | 1
fs/nilfs2/alloc.c | 2
fs/nilfs2/alloc.h | 2
fs/nilfs2/bmap.c | 2
fs/nilfs2/bmap.h | 2
fs/nilfs2/btnode.c | 2
fs/nilfs2/btnode.h | 2
fs/nilfs2/btree.c | 2
fs/nilfs2/btree.h | 2
fs/nilfs2/cpfile.c | 2
fs/nilfs2/cpfile.h | 2
fs/nilfs2/dat.c | 2
fs/nilfs2/dat.h | 2
fs/nilfs2/dir.c | 2
fs/nilfs2/direct.c | 2
fs/nilfs2/direct.h | 2
fs/nilfs2/file.c | 2
fs/nilfs2/gcinode.c | 2
fs/nilfs2/ifile.c | 2
fs/nilfs2/ifile.h | 2
fs/nilfs2/inode.c | 2
fs/nilfs2/ioctl.c | 2
fs/nilfs2/mdt.c | 2
fs/nilfs2/mdt.h | 2
fs/nilfs2/namei.c | 2
fs/nilfs2/nilfs.h | 2
fs/nilfs2/page.c | 2
fs/nilfs2/page.h | 2
fs/nilfs2/recovery.c | 2
fs/nilfs2/segbuf.c | 2
fs/nilfs2/segbuf.h | 2
fs/nilfs2/segment.c | 2
fs/nilfs2/segment.h | 2
fs/nilfs2/sufile.c | 2
fs/nilfs2/sufile.h | 2
fs/nilfs2/super.c | 2
fs/nilfs2/sysfs.c | 78 ++--
fs/nilfs2/sysfs.h | 2
fs/nilfs2/the_nilfs.c | 2
fs/nilfs2/the_nilfs.h | 2
fs/proc/base.c | 21 -
fs/proc/vmcore.c | 109 ++++--
fs/ramfs/inode.c | 11
fs/seq_file.c | 16
fs/sysv/super.c | 6
include/asm-generic/sections.h | 75 +++-
include/kunit/test.h | 13
include/linux/bottom_half.h | 3
include/linux/container_of.h | 52 ++-
include/linux/crash_dump.h | 30 +
include/linux/delay.h | 2
include/linux/fs.h | 1
include/linux/fwnode.h | 1
include/linux/generic-radix-tree.h | 3
include/linux/hugetlb.h | 6
include/linux/instruction_pointer.h | 8
include/linux/kallsyms.h | 21 -
include/linux/kernel.h | 39 --
include/linux/list.h | 4
include/linux/llist.h | 4
include/linux/pagemap.h | 50 ++
include/linux/plist.h | 5
include/linux/radix-tree.h | 4
include/linux/rwsem.h | 1
include/linux/sbitmap.h | 11
include/linux/seq_file.h | 19 +
include/linux/signal.h | 1
include/linux/smp.h | 1
include/linux/spinlock.h | 1
include/linux/stackdepot.h | 5
include/linux/string_helpers.h | 1
include/media/media-entity.h | 3
init/main.c | 4
ipc/ipc_sysctl.c | 42 +-
ipc/shm.c | 8
kernel/extable.c | 33 -
kernel/fork.c | 9
kernel/kcov.c | 40 +-
kernel/locking/lockdep.c | 3
kernel/resource.c | 54 ++-
kernel/trace/ftrace.c | 2
lib/scatterlist.c | 11
lib/stackdepot.c | 46 ++
lib/vsprintf.c | 3
mm/Kconfig | 7
mm/filemap.c | 8
mm/kasan/report.c | 17 -
mm/memfd.c | 4
mm/mmap.c | 3
mm/page_owner.c | 18 -
mm/truncate.c | 19 +
mm/vmscan.c | 7
mm/workingset.c | 10
net/sysctl_net.c | 2
scripts/checkpatch.pl | 33 +
scripts/const_structs.checkpatch | 4
scripts/gdb/linux/symbols.py | 3
tools/testing/selftests/kselftest/runner.sh | 28 +
tools/testing/selftests/proc/.gitignore | 1
tools/testing/selftests/proc/Makefile | 2
tools/testing/selftests/proc/proc-tid0.c | 81 ++++
132 files changed, 1206 insertions(+), 681 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-11-11 4:32 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-11-11 4:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
The post-linux-next material.
7 patches, based on debe436e77c72fcee804fb867f275e6d31aa999c.
Subsystems affected by this patch series:
mm/debug
mm/slab-generic
mm/migration
mm/memcg
mm/kasan
Subsystem: mm/debug
Yixuan Cao <caoyixuan2019@email.szu.edu.cn>:
mm/page_owner.c: modify the type of argument "order" in some functions
Subsystem: mm/slab-generic
Ingo Molnar <mingo@kernel.org>:
mm: allow only SLUB on PREEMPT_RT
Subsystem: mm/migration
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: migrate: simplify the file-backed pages validation when migrating its mapping
Alistair Popple <apopple@nvidia.com>:
mm/migrate.c: remove MIGRATE_PFN_LOCKED
Subsystem: mm/memcg
Christoph Hellwig <hch@lst.de>:
Patch series "unexport memcg locking helpers":
mm: unexport folio_memcg_{,un}lock
mm: unexport {,un}lock_page_memcg
Subsystem: mm/kasan
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
kasan: add kasan mode messages when kasan init
Documentation/vm/hmm.rst | 2
arch/arm64/mm/kasan_init.c | 2
arch/powerpc/kvm/book3s_hv_uvmem.c | 4
drivers/gpu/drm/amd/amdkfd/kfd_migrate.c | 2
drivers/gpu/drm/nouveau/nouveau_dmem.c | 4
include/linux/migrate.h | 1
include/linux/page_owner.h | 12 +-
init/Kconfig | 2
lib/test_hmm.c | 5 -
mm/kasan/hw_tags.c | 14 ++
mm/kasan/sw_tags.c | 2
mm/memcontrol.c | 4
mm/migrate.c | 151 +++++--------------------------
mm/page_owner.c | 6 -
14 files changed, 61 insertions(+), 150 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-11-20 0:42 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-11-20 0:42 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
15 patches, based on a90af8f15bdc9449ee2d24e1d73fa3f7e8633f81.
Subsystems affected by this patch series:
mm/swap
ipc
mm/slab-generic
hexagon
mm/kmemleak
mm/hugetlb
mm/kasan
mm/damon
mm/highmem
proc
Subsystem: mm/swap
Matthew Wilcox <willy@infradead.org>:
mm/swap.c:put_pages_list(): reinitialise the page list
Subsystem: ipc
Alexander Mikhalitsyn <alexander.mikhalitsyn@virtuozzo.com>:
Patch series "shm: shm_rmid_forced feature fixes":
ipc: WARN if trying to remove ipc object which is absent
shm: extend forced shm destroy to support objects from several IPC nses
Subsystem: mm/slab-generic
Yunfeng Ye <yeyunfeng@huawei.com>:
mm: emit the "free" trace report before freeing memory in kmem_cache_free()
Subsystem: hexagon
Nathan Chancellor <nathan@kernel.org>:
Patch series "Fixes for ARCH=hexagon allmodconfig", v2:
hexagon: export raw I/O routines for modules
hexagon: clean up timer-regs.h
hexagon: ignore vmlinux.lds
Subsystem: mm/kmemleak
Rustam Kovhaev <rkovhaev@gmail.com>:
mm: kmemleak: slob: respect SLAB_NOLEAKTRACE flag
Subsystem: mm/hugetlb
Bui Quang Minh <minhquangbui99@gmail.com>:
hugetlb: fix hugetlb cgroup refcounting during mremap
Mina Almasry <almasrymina@google.com>:
hugetlb, userfaultfd: fix reservation restore on userfaultfd error
Subsystem: mm/kasan
Kees Cook <keescook@chromium.org>:
kasan: test: silence intentional read overflow warnings
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
Patch series "DAMON fixes":
mm/damon/dbgfs: use '__GFP_NOWARN' for user-specified size buffer allocation
mm/damon/dbgfs: fix missed use of damon_dbgfs_lock
Subsystem: mm/highmem
Ard Biesheuvel <ardb@kernel.org>:
kmap_local: don't assume kmap PTEs are linear arrays in memory
Subsystem: proc
David Hildenbrand <david@redhat.com>:
proc/vmcore: fix clearing user buffer by properly using clear_user()
arch/arm/Kconfig | 1
arch/hexagon/include/asm/timer-regs.h | 26 ----
arch/hexagon/include/asm/timex.h | 3
arch/hexagon/kernel/.gitignore | 1
arch/hexagon/kernel/time.c | 12 +-
arch/hexagon/lib/io.c | 4
fs/proc/vmcore.c | 20 ++-
include/linux/hugetlb_cgroup.h | 12 ++
include/linux/ipc_namespace.h | 15 ++
include/linux/sched/task.h | 2
ipc/shm.c | 189 +++++++++++++++++++++++++---------
ipc/util.c | 6 -
lib/test_kasan.c | 2
mm/Kconfig | 3
mm/damon/dbgfs.c | 20 ++-
mm/highmem.c | 32 +++--
mm/hugetlb.c | 11 +
mm/slab.c | 3
mm/slab.h | 2
mm/slob.c | 3
mm/slub.c | 2
mm/swap.c | 1
22 files changed, 254 insertions(+), 116 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-12-10 22:45 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-12-10 22:45 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
21 patches, based on c741e49150dbb0c0aebe234389f4aa8b47958fa8.
Subsystems affected by this patch series:
mm/mlock
MAINTAINERS
mailmap
mm/pagecache
mm/damon
mm/slub
mm/memcg
mm/hugetlb
mm/pagecache
Subsystem: mm/mlock
Drew DeVault <sir@cmpwn.com>:
Increase default MLOCK_LIMIT to 8 MiB
Subsystem: MAINTAINERS
Dave Young <dyoung@redhat.com>:
MAINTAINERS: update kdump maintainers
Subsystem: mailmap
Guo Ren <guoren@linux.alibaba.com>:
mailmap: update email address for Guo Ren
Subsystem: mm/pagecache
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
filemap: remove PageHWPoison check from next_uptodate_page()
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
Patch series "mm/damon: Fix fake /proc/loadavg reports", v3:
timers: implement usleep_idle_range()
mm/damon/core: fix fake load reports due to uninterruptible sleeps
Patch series "mm/damon: Trivial fixups and improvements":
mm/damon/core: use better timer mechanisms selection threshold
mm/damon/dbgfs: remove an unnecessary error message
mm/damon/core: remove unnecessary error messages
mm/damon/vaddr: remove an unnecessary warning message
mm/damon/vaddr-test: split a test function having >1024 bytes frame size
mm/damon/vaddr-test: remove unnecessary variables
selftests/damon: skip test if DAMON is running
selftests/damon: test DAMON enabling with empty target_ids case
selftests/damon: test wrong DAMOS condition ranges input
selftests/damon: test debugfs file reads/writes with huge count
selftests/damon: split test cases
Subsystem: mm/slub
Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
mm/slub: fix endianness bug for alloc/free_traces attributes
Subsystem: mm/memcg
Waiman Long <longman@redhat.com>:
mm/memcg: relocate mod_objcg_mlstate(), get_obj_stock() and put_obj_stock()
Subsystem: mm/hugetlb
Zhenguo Yao <yaozhenguo1@gmail.com>:
hugetlbfs: fix issue of preallocation of gigantic pages can't work
Subsystem: mm/pagecache
Manjong Lee <mj0123.lee@samsung.com>:
mm: bdi: initialize bdi_min_ratio when bdi is unregistered
.mailmap | 2
MAINTAINERS | 2
include/linux/delay.h | 14
include/uapi/linux/resource.h | 13
kernel/time/timer.c | 16 -
mm/backing-dev.c | 7
mm/damon/core.c | 20 -
mm/damon/dbgfs.c | 4
mm/damon/vaddr-test.h | 85 ++---
mm/damon/vaddr.c | 1
mm/filemap.c | 2
mm/hugetlb.c | 2
mm/memcontrol.c | 106 +++----
mm/slub.c | 15 -
tools/testing/selftests/damon/.gitignore | 2
tools/testing/selftests/damon/Makefile | 7
tools/testing/selftests/damon/_debugfs_common.sh | 52 +++
tools/testing/selftests/damon/debugfs_attrs.sh | 149 ++--------
tools/testing/selftests/damon/debugfs_empty_targets.sh | 13
tools/testing/selftests/damon/debugfs_huge_count_read_write.sh | 22 +
tools/testing/selftests/damon/debugfs_schemes.sh | 19 +
tools/testing/selftests/damon/debugfs_target_ids.sh | 19 +
tools/testing/selftests/damon/huge_count_read_write.c | 39 ++
23 files changed, 363 insertions(+), 248 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-12-25 5:11 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-12-25 5:11 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
9 patches, based on bc491fb12513e79702c6f936c838f792b5389129.
Subsystems affected by this patch series:
mm/kfence
mm/mempolicy
core-kernel
MAINTAINERS
mm/memory-failure
mm/pagemap
mm/pagealloc
mm/damon
mm/memory-failure
Subsystem: mm/kfence
Baokun Li <libaokun1@huawei.com>:
kfence: fix memory leak when cat kfence objects
Subsystem: mm/mempolicy
Andrey Ryabinin <arbn@yandex-team.com>:
mm: mempolicy: fix THP allocations escaping mempolicy restrictions
Subsystem: core-kernel
Philipp Rudo <prudo@redhat.com>:
kernel/crash_core: suppress unknown crashkernel parameter warning
Subsystem: MAINTAINERS
Randy Dunlap <rdunlap@infradead.org>:
MAINTAINERS: mark more list instances as moderated
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm, hwpoison: fix condition in free hugetlb page path
Subsystem: mm/pagemap
Hugh Dickins <hughd@google.com>:
mm: delete unsafe BUG from page_cache_add_speculative()
Subsystem: mm/pagealloc
Thibaut Sautereau <thibaut.sautereau@ssi.gouv.fr>:
mm/page_alloc: fix __alloc_size attribute for alloc_pages_exact_nid
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
mm/damon/dbgfs: protect targets destructions with kdamond_lock
Subsystem: mm/memory-failure
Liu Shixin <liushixin2@huawei.com>:
mm/hwpoison: clear MF_COUNT_INCREASED before retrying get_any_page()
MAINTAINERS | 4 ++--
include/linux/gfp.h | 2 +-
include/linux/pagemap.h | 1 -
kernel/crash_core.c | 11 +++++++++++
mm/damon/dbgfs.c | 2 ++
mm/kfence/core.c | 1 +
mm/memory-failure.c | 14 +++++---------
mm/mempolicy.c | 3 +--
8 files changed, 23 insertions(+), 15 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2021-12-31 4:12 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2021-12-31 4:12 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
2 patches, based on 4f3d93c6eaff6b84e43b63e0d7a119c5920e1020.
Subsystems affected by this patch series:
mm/userfaultfd
mm/damon
Subsystem: mm/userfaultfd
Mike Kravetz <mike.kravetz@oracle.com>:
userfaultfd/selftests: fix hugetlb area allocations
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
mm/damon/dbgfs: fix 'struct pid' leaks in 'dbgfs_target_ids_write()'
mm/damon/dbgfs.c | 9 +++++++--
tools/testing/selftests/vm/userfaultfd.c | 16 ++++++++++------
2 files changed, 17 insertions(+), 8 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-01-14 22:02 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-01-14 22:02 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
146 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16")
Subsystems affected by this patch series:
kthread
ia64
scripts
ntfs
squashfs
ocfs2
vfs
mm/slab-generic
mm/slab
mm/kmemleak
mm/dax
mm/kasan
mm/debug
mm/pagecache
mm/gup
mm/shmem
mm/frontswap
mm/memremap
mm/memcg
mm/selftests
mm/pagemap
mm/dma
mm/vmalloc
mm/memory-failure
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/mempolicy
mm/oom-kill
mm/hugetlbfs
mm/migration
mm/thp
mm/ksm
mm/page-poison
mm/percpu
mm/rmap
mm/zswap
mm/zram
mm/cleanups
mm/hmm
mm/damon
Subsystem: kthread
Cai Huoqing <caihuoqing@baidu.com>:
kthread: add the helper function kthread_run_on_cpu()
RDMA/siw: make use of the helper function kthread_run_on_cpu()
ring-buffer: make use of the helper function kthread_run_on_cpu()
rcutorture: make use of the helper function kthread_run_on_cpu()
trace/osnoise: make use of the helper function kthread_run_on_cpu()
trace/hwlat: make use of the helper function kthread_run_on_cpu()
Subsystem: ia64
Yang Guang <yang.guang5@zte.com.cn>:
ia64: module: use swap() to make code cleaner
arch/ia64/kernel/setup.c: use swap() to make code cleaner
Jason Wang <wangborong@cdjrlc.com>:
ia64: fix typo in a comment
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
ia64: topology: use default_groups in kobj_type
Subsystem: scripts
Drew Fustini <dfustini@baylibre.com>:
scripts/spelling.txt: add "oveflow"
Subsystem: ntfs
Yang Li <yang.lee@linux.alibaba.com>:
fs/ntfs/attrib.c: fix one kernel-doc comment
Subsystem: squashfs
Zheng Liang <zhengliang6@huawei.com>:
squashfs: provide backing_dev_info in order to disable read-ahead
Subsystem: ocfs2
Zhang Mingyu <zhang.mingyu@zte.com.cn>:
ocfs2: use BUG_ON instead of if condition followed by BUG.
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: clearly handle ocfs2_grab_pages_for_write() return value
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
ocfs2: use default_groups in kobj_type
Colin Ian King <colin.i.king@gmail.com>:
ocfs2: remove redundant assignment to pointer root_bh
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
ocfs2: cluster: use default_groups in kobj_type
Colin Ian King <colin.i.king@gmail.com>:
ocfs2: remove redundant assignment to variable free_space
Subsystem: vfs
Amit Daniel Kachhap <amit.kachhap@arm.com>:
fs/ioctl: remove unnecessary __user annotation
Subsystem: mm/slab-generic
Marco Elver <elver@google.com>:
mm/slab_common: use WARN() if cache still has objects on destroy
Subsystem: mm/slab
Muchun Song <songmuchun@bytedance.com>:
mm: slab: make slab iterator functions static
Subsystem: mm/kmemleak
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
kmemleak: fix kmemleak false positive report with HW tag-based kasan enable
Calvin Zhang <calvinzhang.cool@gmail.com>:
mm: kmemleak: alloc gray object for reserved region with direct map
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: defer kmemleak object creation of module_alloc()
Subsystem: mm/dax
Joao Martins <joao.m.martins@oracle.com>:
Patch series "mm, device-dax: Introduce compound pages in devmap", v7:
mm/page_alloc: split prep_compound_page into head and tail subparts
mm/page_alloc: refactor memmap_init_zone_device() page init
mm/memremap: add ZONE_DEVICE support for compound pages
device-dax: use ALIGN() for determining pgoff
device-dax: use struct_size()
device-dax: ensure dev_dax->pgmap is valid for dynamic devices
device-dax: factor out page mapping initialization
device-dax: set mapping prior to vmf_insert_pfn{,_pmd,pud}()
device-dax: remove pfn from __dev_dax_{pte,pmd,pud}_fault()
device-dax: compound devmap support
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
kasan: test: add globals left-out-of-bounds test
kasan: add ability to detect double-kmem_cache_destroy()
kasan: test: add test case for double-kmem_cache_destroy()
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix quarantine conflicting with init_on_free
Subsystem: mm/debug
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm,fs: split dump_mapping() out from dump_page()
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/debug_vm_pgtable: update comments regarding migration swap entries
Subsystem: mm/pagecache
chiminghao <chi.minghao@zte.com.cn>:
mm/truncate.c: remove unneeded variable
Subsystem: mm/gup
Christophe Leroy <christophe.leroy@csgroup.eu>:
gup: avoid multiple user access locking/unlocking in fault_in_{read/write}able
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/gup.c: stricter check on THP migration entry during follow_pmd_mask
Subsystem: mm/shmem
Yang Shi <shy828301@gmail.com>:
mm: shmem: don't truncate page if memory failure happens
Gang Li <ligang.bdlg@bytedance.com>:
shmem: fix a race between shmem_unused_huge_shrink and shmem_evict_inode
Subsystem: mm/frontswap
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
mm/frontswap.c: use non-atomic '__set_bit()' when possible
Subsystem: mm/memremap
Subsystem: mm/memcg
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: make cgroup_memory_nokmem static
Donghai Qiao <dqiao@redhat.com>:
mm/page_counter: remove an incorrect call to propagate_protected_usage()
Dan Schatzberg <schatzberg.dan@gmail.com>:
mm/memcg: add oom_group_kill memory event
Shakeel Butt <shakeelb@google.com>:
memcg: better bounds on the memcg stats updates
Wang Weiyang <wangweiyang2@huawei.com>:
mm/memcg: use struct_size() helper in kzalloc()
Shakeel Butt <shakeelb@google.com>:
memcg: add per-memcg vmalloc stat
Subsystem: mm/selftests
chiminghao <chi.minghao@zte.com.cn>:
tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner
Subsystem: mm/pagemap
Qi Zheng <zhengqi.arch@bytedance.com>:
mm: remove redundant check about FAULT_FLAG_ALLOW_RETRY bit
Colin Cross <ccross@google.com>:
Patch series "mm: rearrange madvise code to allow for reuse", v11:
mm: rearrange madvise code to allow for reuse
mm: add a field to store names for private anonymous memory
Suren Baghdasaryan <surenb@google.com>:
mm: add anonymous vma name refcounting
Arnd Bergmann <arnd@arndb.de>:
mm: move anon_vma declarations to linux/mm_inline.h
mm: move tlb_flush_pending inline helpers to mm_inline.h
Suren Baghdasaryan <surenb@google.com>:
mm: protect free_pgtables with mmap_lock write lock in exit_mmap
mm: document locking restrictions for vm_operations_struct::close
mm/oom_kill: allow process_mrelease to run under mmap_lock protection
Shuah Khan <skhan@linuxfoundation.org>:
docs/vm: add vmalloced-kernel-stacks document
Pasha Tatashin <pasha.tatashin@soleen.com>:
Patch series "page table check", v3:
mm: change page type prior to adding page table entry
mm: ptep_clear() page table helper
mm: page table check
x86: mm: add x86_64 support for page table check
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: remove last argument of reuse_swap_page()
mm: remove the total_mapcount argument from page_trans_huge_map_swapcount()
mm: remove the total_mapcount argument from page_trans_huge_mapcount()
Subsystem: mm/dma
Christian König <christian.koenig@amd.com>:
mm/dmapool.c: revert "make dma pool to use kmalloc_node"
Subsystem: mm/vmalloc
Michal Hocko <mhocko@suse.com>:
Patch series "extend vmalloc support for constrained allocations", v2:
mm/vmalloc: alloc GFP_NO{FS,IO} for vmalloc
mm/vmalloc: add support for __GFP_NOFAIL
mm/vmalloc: be more explicit about supported gfp flags.
mm: allow !GFP_KERNEL allocations for kvmalloc
mm: make slab and vmalloc allocators __GFP_NOLOCKDEP aware
"NeilBrown" <neilb@suse.de>:
mm: introduce memalloc_retry_wait()
Suren Baghdasaryan <surenb@google.com>:
mm/pagealloc: sysctl: change watermark_scale_factor max limit to 30%
Changcheng Deng <deng.changcheng@zte.com.cn>:
mm: fix boolreturn.cocci warning
Xiongwei Song <sxwjean@gmail.com>:
mm: page_alloc: fix building error on -Werror=array-compare
Michal Hocko <mhocko@suse.com>:
mm: drop node from alloc_pages_vma
Miles Chen <miles.chen@mediatek.com>:
include/linux/gfp.h: further document GFP_DMA32
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/page_alloc.c: modify the comment section for alloc_contig_pages()
Baoquan He <bhe@redhat.com>:
Patch series "Handle warning of allocation failure on DMA zone w/o managed pages", v4:
mm_zone: add function to check if managed dma zone exists
dma/pool: create dma atomic pool only if dma zone has managed pages
mm/page_alloc.c: do not warn allocation failure on zone DMA if no managed pages
Subsystem: mm/memory-failure
Subsystem: mm/hugetlb
Mina Almasry <almasrymina@google.com>:
hugetlb: add hugetlb.*.numa_stat file
Yosry Ahmed <yosryahmed@google.com>:
mm, hugepages: make memory size variable in hugepage-mremap selftest
Yang Yang <yang.yang29@zte.com.cn>:
mm/vmstat: add events for THP max_ptes_* exceeds
Waiman Long <longman@redhat.com>:
selftests/vm: make charge_reserved_hugetlb.sh work with existing cgroup setting
Subsystem: mm/userfaultfd
Peter Xu <peterx@redhat.com>:
selftests/uffd: allow EINTR/EAGAIN
Mike Kravetz <mike.kravetz@oracle.com>:
userfaultfd/selftests: clean up hugetlb allocation code
Subsystem: mm/vmscan
Gang Li <ligang.bdlg@bytedance.com>:
vmscan: make drop_slab_node static
Chen Wandun <chenwandun@huawei.com>:
mm/page_isolation: unset migratetype directly for non Buddy page
Subsystem: mm/mempolicy
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "mm: add new syscall set_mempolicy_home_node", v6:
mm/mempolicy: use policy_node helper with MPOL_PREFERRED_MANY
mm/mempolicy: add set_mempolicy_home_node syscall
mm/mempolicy: wire up syscall set_mempolicy_home_node
Randy Dunlap <rdunlap@infradead.org>:
mm/mempolicy: fix all kernel-doc warnings
Subsystem: mm/oom-kill
Jann Horn <jannh@google.com>:
mm, oom: OOM sysrq should always kill a process
Subsystem: mm/hugetlbfs
Sean Christopherson <seanjc@google.com>:
hugetlbfs: fix off-by-one error in hugetlb_vmdelete_list()
Subsystem: mm/migration
Baolin Wang <baolin.wang@linux.alibaba.com>:
Patch series "Improve the migration stats":
mm: migrate: fix the return value of migrate_pages()
mm: migrate: correct the hugetlb migration stats
mm: compaction: fix the migration stats in trace_mm_compaction_migratepages()
mm: migrate: support multiple target nodes demotion
mm: migrate: add more comments for selecting target node randomly
Huang Ying <ying.huang@intel.com>:
mm/migrate: move node demotion code to near its user
Colin Ian King <colin.i.king@gmail.com>:
mm/migrate: remove redundant variables used in a for-loop
Subsystem: mm/thp
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/thp: drop unused trace events hugepage_[invalidate|splitting]
Subsystem: mm/ksm
Nanyong Sun <sunnanyong@huawei.com>:
mm: ksm: fix use-after-free kasan report in ksm_might_need_to_copy
Subsystem: mm/page-poison
Naoya Horiguchi <naoya.horiguchi@nec.com>:
Patch series "mm/hwpoison: fix unpoison_memory()", v4:
mm/hwpoison: mf_mutex for soft offline and unpoison
mm/hwpoison: remove MF_MSG_BUDDY_2ND and MF_MSG_POISONED_HUGE
mm/hwpoison: fix unpoison_memory()
Subsystem: mm/percpu
Qi Zheng <zhengqi.arch@bytedance.com>:
mm: memcg/percpu: account extra objcg space to memory cgroups
Subsystem: mm/rmap
Huang Ying <ying.huang@intel.com>:
mm/rmap: fix potential batched TLB flush race
Subsystem: mm/zswap
Zhaoyu Liu <zackary.liu.pro@gmail.com>:
zpool: remove the list of pools_head
Subsystem: mm/zram
Luis Chamberlain <mcgrof@kernel.org>:
zram: use ATTRIBUTE_GROUPS
Subsystem: mm/cleanups
Quanfa Fu <fuqf0919@gmail.com>:
mm: fix some comment errors
Ting Liu <liuting.0x7c00@bytedance.com>:
mm: make some vars and functions static or __init
Subsystem: mm/hmm
Alistair Popple <apopple@nvidia.com>:
mm/hmm.c: allow VM_MIXEDMAP to work with hmm_range_fault
Subsystem: mm/damon
Xin Hao <xhao@linux.alibaba.com>:
Patch series "mm/damon: Do some small changes", v4:
mm/damon: unified access_check function naming rules
mm/damon: add 'age' of region tracepoint support
mm/damon/core: use abs() instead of diff_of()
mm/damon: remove some unneeded function definitions in damon.h
Yihao Han <hanyihao@vivo.com>:
mm/damon/vaddr: remove swap_ranges() and replace it with swap()
Xin Hao <xhao@linux.alibaba.com>:
mm/damon/schemes: add the validity judgment of thresholds
mm/damon: move damon_rand() definition into damon.h
mm/damon: modify damon_rand() macro to static inline function
SeongJae Park <sj@kernel.org>:
Patch series "mm/damon: Misc cleanups":
mm/damon: convert macro functions to static inline functions
Docs/admin-guide/mm/damon/usage: update for scheme quotas and watermarks
Docs/admin-guide/mm/damon/usage: remove redundant information
Docs/admin-guide/mm/damon/usage: mention tracepoint at the beginning
Docs/admin-guide/mm/damon/usage: update for kdamond_pid and (mk|rm)_contexts
mm/damon: remove a mistakenly added comment for a future feature
Patch series "mm/damon/schemes: Extend stats for better online analysis and tuning":
mm/damon/schemes: account scheme actions that successfully applied
mm/damon/schemes: account how many times quota limit has exceeded
mm/damon/reclaim: provide reclamation statistics
Docs/admin-guide/mm/damon/reclaim: document statistics parameters
mm/damon/dbgfs: support all DAMOS stats
Docs/admin-guide/mm/damon/usage: update for schemes statistics
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm/damon: add access checking for hugetlb pages
Guoqing Jiang <guoqing.jiang@linux.dev>:
mm/damon: move the implementation of damon_insert_region to damon.h
SeongJae Park <sj@kernel.org>:
Patch series "mm/damon: Hide unnecessary information disclosures":
mm/damon/dbgfs: remove an unnecessary variable
mm/damon/vaddr: use pr_debug() for damon_va_three_regions() failure logging
mm/damon/vaddr: hide kernel pointer from damon_va_three_regions() failure log
mm/damon: hide kernel pointer from tracepoint event
Documentation/admin-guide/cgroup-v1/hugetlb.rst | 4
Documentation/admin-guide/cgroup-v2.rst | 11
Documentation/admin-guide/mm/damon/reclaim.rst | 25
Documentation/admin-guide/mm/damon/usage.rst | 235 +++++--
Documentation/admin-guide/mm/numa_memory_policy.rst | 16
Documentation/admin-guide/sysctl/vm.rst | 2
Documentation/filesystems/proc.rst | 6
Documentation/vm/arch_pgtable_helpers.rst | 20
Documentation/vm/index.rst | 2
Documentation/vm/page_migration.rst | 12
Documentation/vm/page_table_check.rst | 56 +
Documentation/vm/vmalloced-kernel-stacks.rst | 153 ++++
MAINTAINERS | 9
arch/Kconfig | 3
arch/alpha/kernel/syscalls/syscall.tbl | 1
arch/alpha/mm/fault.c | 16
arch/arc/mm/fault.c | 3
arch/arm/mm/fault.c | 2
arch/arm/tools/syscall.tbl | 1
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 2
arch/arm64/kernel/module.c | 4
arch/arm64/mm/fault.c | 6
arch/hexagon/mm/vm_fault.c | 8
arch/ia64/kernel/module.c | 6
arch/ia64/kernel/setup.c | 5
arch/ia64/kernel/syscalls/syscall.tbl | 1
arch/ia64/kernel/topology.c | 3
arch/ia64/kernel/uncached.c | 2
arch/ia64/mm/fault.c | 16
arch/m68k/kernel/syscalls/syscall.tbl | 1
arch/m68k/mm/fault.c | 18
arch/microblaze/kernel/syscalls/syscall.tbl | 1
arch/microblaze/mm/fault.c | 18
arch/mips/kernel/syscalls/syscall_n32.tbl | 1
arch/mips/kernel/syscalls/syscall_n64.tbl | 1
arch/mips/kernel/syscalls/syscall_o32.tbl | 1
arch/mips/mm/fault.c | 19
arch/nds32/mm/fault.c | 16
arch/nios2/mm/fault.c | 18
arch/openrisc/mm/fault.c | 18
arch/parisc/kernel/syscalls/syscall.tbl | 1
arch/parisc/mm/fault.c | 18
arch/powerpc/kernel/syscalls/syscall.tbl | 1
arch/powerpc/mm/fault.c | 6
arch/riscv/mm/fault.c | 2
arch/s390/kernel/module.c | 5
arch/s390/kernel/syscalls/syscall.tbl | 1
arch/s390/mm/fault.c | 28
arch/sh/kernel/syscalls/syscall.tbl | 1
arch/sh/mm/fault.c | 18
arch/sparc/kernel/syscalls/syscall.tbl | 1
arch/sparc/mm/fault_32.c | 16
arch/sparc/mm/fault_64.c | 16
arch/um/kernel/trap.c | 8
arch/x86/Kconfig | 1
arch/x86/entry/syscalls/syscall_32.tbl | 1
arch/x86/entry/syscalls/syscall_64.tbl | 1
arch/x86/include/asm/pgtable.h | 31 -
arch/x86/kernel/module.c | 7
arch/x86/mm/fault.c | 3
arch/xtensa/kernel/syscalls/syscall.tbl | 1
arch/xtensa/mm/fault.c | 17
drivers/block/zram/zram_drv.c | 11
drivers/dax/bus.c | 32 +
drivers/dax/bus.h | 1
drivers/dax/device.c | 140 ++--
drivers/infiniband/sw/siw/siw_main.c | 7
drivers/of/fdt.c | 6
fs/ext4/extents.c | 8
fs/ext4/inline.c | 5
fs/ext4/page-io.c | 9
fs/f2fs/data.c | 4
fs/f2fs/gc.c | 5
fs/f2fs/inode.c | 4
fs/f2fs/node.c | 4
fs/f2fs/recovery.c | 6
fs/f2fs/segment.c | 9
fs/f2fs/super.c | 5
fs/hugetlbfs/inode.c | 7
fs/inode.c | 49 +
fs/ioctl.c | 2
fs/ntfs/attrib.c | 2
fs/ocfs2/alloc.c | 2
fs/ocfs2/aops.c | 26
fs/ocfs2/cluster/masklog.c | 11
fs/ocfs2/dir.c | 2
fs/ocfs2/filecheck.c | 3
fs/ocfs2/journal.c | 6
fs/proc/task_mmu.c | 13
fs/squashfs/super.c | 33 +
fs/userfaultfd.c | 8
fs/xfs/kmem.c | 3
fs/xfs/xfs_buf.c | 2
include/linux/ceph/libceph.h | 1
include/linux/damon.h | 93 +--
include/linux/fs.h | 1
include/linux/gfp.h | 12
include/linux/hugetlb.h | 4
include/linux/hugetlb_cgroup.h | 7
include/linux/kasan.h | 4
include/linux/kthread.h | 25
include/linux/memcontrol.h | 22
include/linux/mempolicy.h | 1
include/linux/memremap.h | 11
include/linux/mm.h | 76 --
include/linux/mm_inline.h | 136 ++++
include/linux/mm_types.h | 252 +++-----
include/linux/mmzone.h | 9
include/linux/page-flags.h | 6
include/linux/page_idle.h | 1
include/linux/page_table_check.h | 147 ++++
include/linux/pgtable.h | 8
include/linux/sched/mm.h | 26
include/linux/swap.h | 8
include/linux/syscalls.h | 3
include/linux/vm_event_item.h | 3
include/linux/vmalloc.h | 7
include/ras/ras_event.h | 2
include/trace/events/compaction.h | 24
include/trace/events/damon.h | 15
include/trace/events/thp.h | 35 -
include/uapi/asm-generic/unistd.h | 5
include/uapi/linux/prctl.h | 3
kernel/dma/pool.c | 4
kernel/fork.c | 3
kernel/kthread.c | 1
kernel/rcu/rcutorture.c | 7
kernel/sys.c | 63 ++
kernel/sys_ni.c | 1
kernel/sysctl.c | 3
kernel/trace/ring_buffer.c | 7
kernel/trace/trace_hwlat.c | 6
kernel/trace/trace_osnoise.c | 3
lib/test_hmm.c | 24
lib/test_kasan.c | 30
mm/Kconfig | 14
mm/Kconfig.debug | 24
mm/Makefile | 1
mm/compaction.c | 7
mm/damon/core.c | 45 -
mm/damon/dbgfs.c | 20
mm/damon/paddr.c | 24
mm/damon/prmtv-common.h | 4
mm/damon/reclaim.c | 46 +
mm/damon/vaddr.c | 186 ++++--
mm/debug.c | 52 -
mm/debug_vm_pgtable.c | 6
mm/dmapool.c | 2
mm/frontswap.c | 4
mm/gup.c | 31 -
mm/hmm.c | 5
mm/huge_memory.c | 32 -
mm/hugetlb.c | 6
mm/hugetlb_cgroup.c | 133 +++-
mm/internal.h | 7
mm/kasan/quarantine.c | 11
mm/kasan/shadow.c | 9
mm/khugepaged.c | 23
mm/kmemleak.c | 21
mm/ksm.c | 5
mm/madvise.c | 510 ++++++++++------
mm/mapping_dirty_helpers.c | 1
mm/memcontrol.c | 44 -
mm/memory-failure.c | 189 +++---
mm/memory.c | 12
mm/mempolicy.c | 95 ++-
mm/memremap.c | 18
mm/migrate.c | 527 ++++++++++-------
mm/mlock.c | 2
mm/mmap.c | 55 +
mm/mmu_gather.c | 1
mm/mprotect.c | 2
mm/oom_kill.c | 30
mm/page_alloc.c | 198 ++++--
mm/page_counter.c | 1
mm/page_ext.c | 8
mm/page_isolation.c | 2
mm/page_owner.c | 4
mm/page_table_check.c | 270 ++++++++
mm/percpu-internal.h | 18
mm/percpu.c | 10
mm/pgtable-generic.c | 1
mm/rmap.c | 43 +
mm/shmem.c | 91 ++
mm/slab.h | 5
mm/slab_common.c | 34 -
mm/swap.c | 2
mm/swapfile.c | 46 -
mm/truncate.c | 5
mm/userfaultfd.c | 5
mm/util.c | 15
mm/vmalloc.c | 75 +-
mm/vmscan.c | 2
mm/vmstat.c | 3
mm/zpool.c | 12
net/ceph/buffer.c | 4
net/ceph/ceph_common.c | 27
net/ceph/crypto.c | 2
net/ceph/messenger.c | 2
net/ceph/messenger_v2.c | 2
net/ceph/osdmap.c | 12
net/sunrpc/svc_xprt.c | 3
scripts/spelling.txt | 1
tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 34 -
tools/testing/selftests/vm/hmm-tests.c | 42 +
tools/testing/selftests/vm/hugepage-mremap.c | 46 -
tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 21
tools/testing/selftests/vm/run_vmtests.sh | 2
tools/testing/selftests/vm/userfaultfd.c | 33 -
tools/testing/selftests/vm/write_hugetlb_memory.sh | 2
211 files changed, 3980 insertions(+), 1759 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-01-20 2:07 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-01-20 2:07 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
55 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16")
Subsystems affected by this patch series:
percpu
procfs
sysctl
misc
core-kernel
get_maintainer
lib
checkpatch
binfmt
nilfs2
hfs
fat
adfs
panic
delayacct
kconfig
kcov
ubsan
Subsystem: percpu
Kefeng Wang <wangkefeng.wang@huawei.com>:
Patch series "mm: percpu: Cleanup percpu first chunk function":
mm: percpu: generalize percpu related config
mm: percpu: add pcpu_fc_cpu_to_node_fn_t typedef
mm: percpu: add generic pcpu_fc_alloc/free funciton
mm: percpu: add generic pcpu_populate_pte() function
Subsystem: procfs
David Hildenbrand <david@redhat.com>:
proc/vmcore: don't fake reading zeroes on surprise vmcore_cb unregistration
Hans de Goede <hdegoede@redhat.com>:
proc: make the proc_create[_data]() stubs static inlines
Qi Zheng <zhengqi.arch@bytedance.com>:
proc: convert the return type of proc_fd_access_allowed() to be boolean
Subsystem: sysctl
Geert Uytterhoeven <geert+renesas@glider.be>:
sysctl: fix duplicate path separator in printed entries
luo penghao <luo.penghao@zte.com.cn>:
sysctl: remove redundant ret assignment
Subsystem: misc
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
include/linux/unaligned: replace kernel.h with the necessary inclusions
kernel.h: include a note to discourage people from including it in headers
Subsystem: core-kernel
Yafang Shao <laoar.shao@gmail.com>:
Patch series "task comm cleanups", v2:
fs/exec: replace strlcpy with strscpy_pad in __set_task_comm
fs/exec: replace strncpy with strscpy_pad in __get_task_comm
drivers/infiniband: replace open-coded string copy with get_task_comm
fs/binfmt_elf: replace open-coded string copy with get_task_comm
samples/bpf/test_overhead_kprobe_kern: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm
tools/bpf/bpftool/skeleton: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm
tools/testing/selftests/bpf: replace open-coded 16 with TASK_COMM_LEN
kthread: dynamically allocate memory to store kthread's full name
Davidlohr Bueso <dave@stgolabs.net>:
kernel/sys.c: only take tasklist_lock for get/setpriority(PRIO_PGRP)
Subsystem: get_maintainer
Randy Dunlap <rdunlap@infradead.org>:
get_maintainer: don't remind about no git repo when --nogit is used
Subsystem: lib
Alexey Dobriyan <adobriyan@gmail.com>:
kstrtox: uninline everything
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
list: introduce list_is_head() helper and re-use it in list.h
Zhen Lei <thunder.leizhen@huawei.com>:
lib/list_debug.c: print more list debugging context in __list_del_entry_valid()
Isabella Basso <isabbasso@riseup.net>:
Patch series "test_hash.c: refactor into KUnit", v3:
hash.h: remove unused define directive
test_hash.c: split test_int_hash into arch-specific functions
test_hash.c: split test_hash_init
lib/Kconfig.debug: properly split hash test kernel entries
test_hash.c: refactor into kunit
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kunit: replace kernel.h with the necessary inclusions
uuid: discourage people from using UAPI header in new code
uuid: remove licence boilerplate text from the header
Andrey Konovalov <andreyknvl@google.com>:
lib/test_meminit: destroy cache in kmem_cache_alloc_bulk() test
Subsystem: checkpatch
Jerome Forissier <jerome@forissier.org>:
checkpatch: relax regexp for COMMIT_LOG_LONG_LINE
Joe Perches <joe@perches.com>:
checkpatch: improve Kconfig help test
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
const_structs.checkpatch: add frequently used ops structs
Subsystem: binfmt
"H.J. Lu" <hjl.tools@gmail.com>:
fs/binfmt_elf: use PT_LOAD p_align values for static PIE
Subsystem: nilfs2
Colin Ian King <colin.i.king@gmail.com>:
nilfs2: remove redundant pointer sbufs
Subsystem: hfs
Kees Cook <keescook@chromium.org>:
hfsplus: use struct_group_attr() for memcpy() region
Subsystem: fat
"NeilBrown" <neilb@suse.de>:
FAT: use io_schedule_timeout() instead of congestion_wait()
Subsystem: adfs
Minghao Chi <chi.minghao@zte.com.cn>:
fs/adfs: remove unneeded variable make code cleaner
Subsystem: panic
Marco Elver <elver@google.com>:
panic: use error_report_end tracepoint on warnings
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
panic: remove oops_id
Subsystem: delayacct
Yang Yang <yang.yang29@zte.com.cn>:
delayacct: support swapin delay accounting for swapping without blkio
delayacct: fix incomplete disable operation when switch enable to disable
delayacct: cleanup flags in struct task_delay_info and functions use it
wangyong <wang.yong12@zte.com.cn>:
Documentation/accounting/delay-accounting.rst: add thrashing page cache and direct compact
delayacct: track delays from memory compact
Subsystem: kconfig
Qian Cai <quic_qiancai@quicinc.com>:
configs: introduce debug.config for CI-like setup
Nathan Chancellor <nathan@kernel.org>:
Patch series "Fix CONFIG_TEST_KMOD with 256kB page size":
arch/Kconfig: split PAGE_SIZE_LESS_THAN_256KB from PAGE_SIZE_LESS_THAN_64KB
btrfs: use generic Kconfig option for 256kB page size limit
lib/Kconfig.debug: make TEST_KMOD depend on PAGE_SIZE_LESS_THAN_256KB
Subsystem: kcov
Marco Elver <elver@google.com>:
kcov: fix generic Kconfig dependencies if ARCH_WANTS_NO_INSTR
Subsystem: ubsan
Kees Cook <keescook@chromium.org>:
ubsan: remove CONFIG_UBSAN_OBJECT_SIZE
Colin Ian King <colin.i.king@gmail.com>:
lib: remove redundant assignment to variable ret
Documentation/accounting/delay-accounting.rst | 63 +-
arch/Kconfig | 4
arch/arm64/Kconfig | 20
arch/ia64/Kconfig | 9
arch/mips/Kconfig | 10
arch/mips/mm/init.c | 28 -
arch/powerpc/Kconfig | 17
arch/powerpc/kernel/setup_64.c | 113 ----
arch/riscv/Kconfig | 10
arch/sparc/Kconfig | 12
arch/sparc/kernel/led.c | 8
arch/sparc/kernel/smp_64.c | 119 -----
arch/x86/Kconfig | 19
arch/x86/kernel/setup_percpu.c | 82 ---
drivers/base/arch_numa.c | 78 ---
drivers/infiniband/hw/qib/qib.h | 2
drivers/infiniband/hw/qib/qib_file_ops.c | 2
drivers/infiniband/sw/rxe/rxe_qp.c | 3
drivers/net/wireless/broadcom/brcm80211/brcmfmac/xtlv.c | 2
fs/adfs/inode.c | 4
fs/binfmt_elf.c | 6
fs/btrfs/Kconfig | 3
fs/exec.c | 5
fs/fat/file.c | 5
fs/hfsplus/hfsplus_raw.h | 12
fs/hfsplus/xattr.c | 4
fs/nilfs2/page.c | 4
fs/proc/array.c | 3
fs/proc/base.c | 4
fs/proc/proc_sysctl.c | 9
fs/proc/vmcore.c | 10
include/kunit/assert.h | 2
include/linux/delayacct.h | 107 ++--
include/linux/elfcore-compat.h | 5
include/linux/elfcore.h | 5
include/linux/hash.h | 5
include/linux/kernel.h | 9
include/linux/kthread.h | 1
include/linux/list.h | 36 -
include/linux/percpu.h | 21
include/linux/proc_fs.h | 12
include/linux/sched.h | 9
include/linux/unaligned/packed_struct.h | 2
include/trace/events/error_report.h | 8
include/uapi/linux/taskstats.h | 6
include/uapi/linux/uuid.h | 10
kernel/configs/debug.config | 105 ++++
kernel/delayacct.c | 49 +-
kernel/kthread.c | 32 +
kernel/panic.c | 21
kernel/sys.c | 16
lib/Kconfig.debug | 45 +
lib/Kconfig.ubsan | 13
lib/Makefile | 5
lib/asn1_encoder.c | 2
lib/kstrtox.c | 12
lib/list_debug.c | 8
lib/lz4/lz4defs.h | 2
lib/test_hash.c | 375 +++++++---------
lib/test_meminit.c | 1
lib/test_ubsan.c | 22
mm/Kconfig | 12
mm/memory.c | 4
mm/page_alloc.c | 3
mm/page_io.c | 3
mm/percpu.c | 168 +++++--
samples/bpf/offwaketime_kern.c | 4
samples/bpf/test_overhead_kprobe_kern.c | 11
samples/bpf/test_overhead_tp_kern.c | 5
scripts/Makefile.ubsan | 1
scripts/checkpatch.pl | 54 +-
scripts/const_structs.checkpatch | 23
scripts/get_maintainer.pl | 2
tools/accounting/getdelays.c | 8
tools/bpf/bpftool/skeleton/pid_iter.bpf.c | 4
tools/include/linux/hash.h | 5
tools/testing/selftests/bpf/progs/test_stacktrace_map.c | 6
tools/testing/selftests/bpf/progs/test_tracepoint.c | 6
78 files changed, 943 insertions(+), 992 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-01-22 6:10 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-01-22 6:10 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
This is the post-linux-next queue. Material which was based on or
dependent upon material which was in -next.
69 patches, based on 9b57f458985742bd1c585f4c7f36d04634ce1143.
Subsystems affected by this patch series:
mm/migration
sysctl
mm/zsmalloc
proc
lib
Subsystem: mm/migration
Alistair Popple <apopple@nvidia.com>:
mm/migrate.c: rework migration_entry_wait() to not take a pageref
Subsystem: sysctl
Xiaoming Ni <nixiaoming@huawei.com>:
Patch series "sysctl: first set of kernel/sysctl cleanups", v2:
sysctl: add a new register_sysctl_init() interface
sysctl: move some boundary constants from sysctl.c to sysctl_vals
hung_task: move hung_task sysctl interface to hung_task.c
watchdog: move watchdog sysctl interface to watchdog.c
Stephen Kitt <steve@sk2.org>:
sysctl: make ngroups_max const
Xiaoming Ni <nixiaoming@huawei.com>:
sysctl: use const for typically used max/min proc sysctls
sysctl: use SYSCTL_ZERO to replace some static int zero uses
aio: move aio sysctl to aio.c
dnotify: move dnotify sysctl to dnotify.c
Luis Chamberlain <mcgrof@kernel.org>:
Patch series "sysctl: second set of kernel/sysctl cleanups", v2:
hpet: simplify subdirectory registration with register_sysctl()
i915: simplify subdirectory registration with register_sysctl()
macintosh/mac_hid.c: simplify subdirectory registration with register_sysctl()
ocfs2: simplify subdirectory registration with register_sysctl()
test_sysctl: simplify subdirectory registration with register_sysctl()
Xiaoming Ni <nixiaoming@huawei.com>:
inotify: simplify subdirectory registration with register_sysctl()
Luis Chamberlain <mcgrof@kernel.org>:
cdrom: simplify subdirectory registration with register_sysctl()
Xiaoming Ni <nixiaoming@huawei.com>:
eventpoll: simplify sysctl declaration with register_sysctl()
Patch series "sysctl: 3rd set of kernel/sysctl cleanups", v2:
firmware_loader: move firmware sysctl to its own files
random: move the random sysctl declarations to its own file
Luis Chamberlain <mcgrof@kernel.org>:
sysctl: add helper to register a sysctl mount point
fs: move binfmt_misc sysctl to its own file
Xiaoming Ni <nixiaoming@huawei.com>:
printk: move printk sysctl to printk/sysctl.c
scsi/sg: move sg-big-buff sysctl to scsi/sg.c
stackleak: move stack_erasing sysctl to stackleak.c
Luis Chamberlain <mcgrof@kernel.org>:
sysctl: share unsigned long const values
Patch series "sysctl: 4th set of kernel/sysctl cleanups":
fs: move inode sysctls to its own file
fs: move fs stat sysctls to file_table.c
fs: move dcache sysctls to its own file
sysctl: move maxolduid as a sysctl specific const
fs: move shared sysctls to fs/sysctls.c
fs: move locking sysctls where they are used
fs: move namei sysctls to its own file
fs: move fs/exec.c sysctls into its own file
fs: move pipe sysctls to is own file
Patch series "sysctl: add and use base directory declarer and registration helper":
sysctl: add and use base directory declarer and registration helper
fs: move namespace sysctls and declare fs base directory
kernel/sysctl.c: rename sysctl_init() to sysctl_init_bases()
Xiaoming Ni <nixiaoming@huawei.com>:
printk: fix build warning when CONFIG_PRINTK=n
fs/coredump: move coredump sysctls into its own file
kprobe: move sysctl_kprobes_optimization to kprobes.c
Colin Ian King <colin.i.king@gmail.com>:
kernel/sysctl.c: remove unused variable ten_thousand
Baokun Li <libaokun1@huawei.com>:
sysctl: returns -EINVAL when a negative value is passed to proc_doulongvec_minmax
Subsystem: mm/zsmalloc
Minchan Kim <minchan@kernel.org>:
Patch series "zsmalloc: remove bit_spin_lock", v2:
zsmalloc: introduce some helper functions
zsmalloc: rename zs_stat_type to class_stat_type
zsmalloc: decouple class actions from zspage works
zsmalloc: introduce obj_allocated
zsmalloc: move huge compressed obj from page to zspage
zsmalloc: remove zspage isolation for migration
locking/rwlocks: introduce write_lock_nested
zsmalloc: replace per zpage lock with pool->migrate_lock
Mike Galbraith <umgwanakikbuti@gmail.com>:
zsmalloc: replace get_cpu_var with local_lock
Subsystem: proc
Muchun Song <songmuchun@bytedance.com>:
fs: proc: store PDE()->data into inode->i_private
proc: remove PDE_DATA() completely
Subsystem: lib
Vlastimil Babka <vbabka@suse.cz>:
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc()
lib/stackdepot: fix spelling mistake and grammar in pr_err message
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup3
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup4
Marco Elver <elver@google.com>:
lib/stackdepot: always do filter_irq_stacks() in stack_depot_save()
Christoph Hellwig <hch@lst.de>:
Patch series "remove Xen tmem leftovers":
mm: remove cleancache
frontswap: remove frontswap_writethrough
frontswap: remove frontswap_tmem_exclusive_gets
frontswap: remove frontswap_shrink
frontswap: remove frontswap_curr_pages
frontswap: simplify frontswap_init
frontswap: remove the frontswap exports
mm: simplify try_to_unuse
frontswap: remove frontswap_test
frontswap: simplify frontswap_register_ops
mm: mark swap_lock and swap_active_head static
frontswap: remove support for multiple ops
mm: hide the FRONTSWAP Kconfig symbol
Documentation/vm/cleancache.rst | 296 ------
Documentation/vm/frontswap.rst | 31
Documentation/vm/index.rst | 1
MAINTAINERS | 7
arch/alpha/kernel/srm_env.c | 4
arch/arm/configs/bcm2835_defconfig | 1
arch/arm/configs/qcom_defconfig | 1
arch/arm/kernel/atags_proc.c | 2
arch/arm/mm/alignment.c | 2
arch/ia64/kernel/salinfo.c | 10
arch/m68k/configs/amiga_defconfig | 1
arch/m68k/configs/apollo_defconfig | 1
arch/m68k/configs/atari_defconfig | 1
arch/m68k/configs/bvme6000_defconfig | 1
arch/m68k/configs/hp300_defconfig | 1
arch/m68k/configs/mac_defconfig | 1
arch/m68k/configs/multi_defconfig | 1
arch/m68k/configs/mvme147_defconfig | 1
arch/m68k/configs/mvme16x_defconfig | 1
arch/m68k/configs/q40_defconfig | 1
arch/m68k/configs/sun3_defconfig | 1
arch/m68k/configs/sun3x_defconfig | 1
arch/powerpc/kernel/proc_powerpc.c | 4
arch/s390/configs/debug_defconfig | 1
arch/s390/configs/defconfig | 1
arch/sh/mm/alignment.c | 4
arch/xtensa/platforms/iss/simdisk.c | 4
block/bdev.c | 5
drivers/acpi/proc.c | 2
drivers/base/firmware_loader/fallback.c | 7
drivers/base/firmware_loader/fallback.h | 11
drivers/base/firmware_loader/fallback_table.c | 25
drivers/cdrom/cdrom.c | 23
drivers/char/hpet.c | 22
drivers/char/random.c | 14
drivers/gpu/drm/drm_dp_mst_topology.c | 1
drivers/gpu/drm/drm_mm.c | 4
drivers/gpu/drm/drm_modeset_lock.c | 9
drivers/gpu/drm/i915/i915_perf.c | 22
drivers/gpu/drm/i915/intel_runtime_pm.c | 3
drivers/hwmon/dell-smm-hwmon.c | 4
drivers/macintosh/mac_hid.c | 24
drivers/net/bonding/bond_procfs.c | 8
drivers/net/wireless/cisco/airo.c | 22
drivers/net/wireless/intersil/hostap/hostap_ap.c | 16
drivers/net/wireless/intersil/hostap/hostap_download.c | 2
drivers/net/wireless/intersil/hostap/hostap_proc.c | 24
drivers/net/wireless/ray_cs.c | 2
drivers/nubus/proc.c | 36
drivers/parisc/led.c | 4
drivers/pci/proc.c | 10
drivers/platform/x86/thinkpad_acpi.c | 4
drivers/platform/x86/toshiba_acpi.c | 16
drivers/pnp/isapnp/proc.c | 2
drivers/pnp/pnpbios/proc.c | 4
drivers/scsi/scsi_proc.c | 4
drivers/scsi/sg.c | 35
drivers/usb/gadget/function/rndis.c | 4
drivers/zorro/proc.c | 2
fs/Makefile | 4
fs/afs/proc.c | 6
fs/aio.c | 31
fs/binfmt_misc.c | 6
fs/btrfs/extent_io.c | 10
fs/btrfs/super.c | 2
fs/coredump.c | 66 +
fs/dcache.c | 37
fs/eventpoll.c | 10
fs/exec.c | 145 +--
fs/ext4/mballoc.c | 14
fs/ext4/readpage.c | 6
fs/ext4/super.c | 3
fs/f2fs/data.c | 13
fs/file_table.c | 47 -
fs/inode.c | 39
fs/jbd2/journal.c | 2
fs/locks.c | 34
fs/mpage.c | 7
fs/namei.c | 58 +
fs/namespace.c | 24
fs/notify/dnotify/dnotify.c | 21
fs/notify/fanotify/fanotify_user.c | 10
fs/notify/inotify/inotify_user.c | 11
fs/ntfs3/ntfs_fs.h | 1
fs/ocfs2/stackglue.c | 25
fs/ocfs2/super.c | 2
fs/pipe.c | 64 +
fs/proc/generic.c | 6
fs/proc/inode.c | 1
fs/proc/internal.h | 5
fs/proc/proc_net.c | 8
fs/proc/proc_sysctl.c | 67 +
fs/super.c | 3
fs/sysctls.c | 47 -
include/linux/aio.h | 4
include/linux/cleancache.h | 124 --
include/linux/coredump.h | 10
include/linux/dcache.h | 10
include/linux/dnotify.h | 1
include/linux/fanotify.h | 2
include/linux/frontswap.h | 35
include/linux/fs.h | 18
include/linux/inotify.h | 3
include/linux/kprobes.h | 6
include/linux/migrate.h | 2
include/linux/mount.h | 3
include/linux/pipe_fs_i.h | 4
include/linux/poll.h | 2
include/linux/printk.h | 4
include/linux/proc_fs.h | 17
include/linux/ref_tracker.h | 2
include/linux/rwlock.h | 6
include/linux/rwlock_api_smp.h | 8
include/linux/rwlock_rt.h | 10
include/linux/sched/sysctl.h | 14
include/linux/seq_file.h | 2
include/linux/shmem_fs.h | 3
include/linux/spinlock_api_up.h | 1
include/linux/stackdepot.h | 25
include/linux/stackleak.h | 5
include/linux/swapfile.h | 3
include/linux/sysctl.h | 67 +
include/scsi/sg.h | 4
init/main.c | 9
ipc/util.c | 2
kernel/hung_task.c | 81 +
kernel/irq/proc.c | 8
kernel/kprobes.c | 30
kernel/locking/spinlock.c | 10
kernel/locking/spinlock_rt.c | 12
kernel/printk/Makefile | 5
kernel/printk/internal.h | 8
kernel/printk/printk.c | 4
kernel/printk/sysctl.c | 85 +
kernel/resource.c | 4
kernel/stackleak.c | 26
kernel/sysctl.c | 790 +----------------
kernel/watchdog.c | 101 ++
lib/Kconfig | 4
lib/Kconfig.kasan | 2
lib/stackdepot.c | 46
lib/test_sysctl.c | 22
mm/Kconfig | 40
mm/Makefile | 1
mm/cleancache.c | 315 ------
mm/filemap.c | 102 +-
mm/frontswap.c | 259 -----
mm/kasan/common.c | 1
mm/migrate.c | 38
mm/page_owner.c | 2
mm/shmem.c | 33
mm/swapfile.c | 90 -
mm/truncate.c | 15
mm/zsmalloc.c | 557 ++++-------
mm/zswap.c | 8
net/atm/proc.c | 4
net/bluetooth/af_bluetooth.c | 8
net/can/bcm.c | 2
net/can/proc.c | 2
net/core/neighbour.c | 6
net/core/pktgen.c | 6
net/ipv4/netfilter/ipt_CLUSTERIP.c | 6
net/ipv4/raw.c | 8
net/ipv4/tcp_ipv4.c | 2
net/ipv4/udp.c | 6
net/netfilter/x_tables.c | 10
net/netfilter/xt_hashlimit.c | 18
net/netfilter/xt_recent.c | 4
net/sunrpc/auth_gss/svcauth_gss.c | 4
net/sunrpc/cache.c | 24
net/sunrpc/stats.c | 2
sound/core/info.c | 4
172 files changed, 1877 insertions(+), 2931 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-01-29 2:13 Andrew Morton
2022-01-29 4:25 ` incoming Matthew Wilcox
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2022-01-29 2:13 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f.
Subsystems affected by this patch series:
sysctl
binfmt
ia64
mm/memory-failure
mm/folios
selftests
mm/kasan
mm/psi
ocfs2
Subsystem: sysctl
Andrew Morton <akpm@linux-foundation.org>:
include/linux/sysctl.h: fix register_sysctl_mount_point() return type
Subsystem: binfmt
Tong Zhang <ztong0001@gmail.com>:
binfmt_misc: fix crash when load/unload module
Subsystem: ia64
Randy Dunlap <rdunlap@infradead.org>:
ia64: make IA64_MCA_RECOVERY bool instead of tristate
Subsystem: mm/memory-failure
Joao Martins <joao.m.martins@oracle.com>:
memory-failure: fetch compound_head after pgmap_pfn_valid()
Subsystem: mm/folios
Wei Yang <richard.weiyang@gmail.com>:
mm: page->mapping folio->mapping should have the same offset
Subsystem: selftests
Maor Gottlieb <maorg@nvidia.com>:
tools/testing/scatterlist: add missing defines
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
kasan: test: fix compatibility with FORTIFY_SOURCE
Peter Collingbourne <pcc@google.com>:
mm, kasan: use compare-exchange operation to set KASAN page tag
Subsystem: mm/psi
Suren Baghdasaryan <surenb@google.com>:
psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n
psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n
Subsystem: ocfs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
Patch series "ocfs2: fix a deadlock case":
jbd2: export jbd2_journal_[grab|put]_journal_head
ocfs2: fix a deadlock when commit trans
arch/ia64/Kconfig | 2
fs/binfmt_misc.c | 8 +--
fs/jbd2/journal.c | 2
fs/ocfs2/suballoc.c | 25 ++++-------
include/linux/mm.h | 17 +++++--
include/linux/mm_types.h | 1
include/linux/psi.h | 11 ++--
include/linux/sysctl.h | 2
kernel/sched/psi.c | 79 ++++++++++++++++++-----------------
lib/test_kasan.c | 5 ++
mm/memory-failure.c | 6 ++
tools/testing/scatterlist/linux/mm.h | 3 -
12 files changed, 91 insertions(+), 70 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2022-01-29 2:13 incoming Andrew Morton
@ 2022-01-29 4:25 ` Matthew Wilcox
2022-01-29 6:23 ` incoming Andrew Morton
0 siblings, 1 reply; 348+ messages in thread
From: Matthew Wilcox @ 2022-01-29 4:25 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linus Torvalds, mm-commits, linux-mm
On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote:
> 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f.
^^
I see 7?
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2022-01-29 4:25 ` incoming Matthew Wilcox
@ 2022-01-29 6:23 ` Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-01-29 6:23 UTC (permalink / raw)
To: Matthew Wilcox; +Cc: Linus Torvalds, mm-commits, linux-mm
On Sat, 29 Jan 2022 04:25:33 +0000 Matthew Wilcox <willy@infradead.org> wrote:
> On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote:
> > 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f.
> ^^
>
> I see 7?
Crap, sorry, ignore all this, shall redo tomorrow.
(It wasn't a good day over here. The thing with disk drives is that
the bigger they are, the harder they fall).
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-01-29 21:40 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-01-29 21:40 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
12 patches, based on f8c7e4ede46fe63ff10000669652648aab09d112.
Subsystems affected by this patch series:
sysctl
binfmt
ia64
mm/memory-failure
mm/folios
selftests
mm/kasan
mm/psi
ocfs2
Subsystem: sysctl
Andrew Morton <akpm@linux-foundation.org>:
include/linux/sysctl.h: fix register_sysctl_mount_point() return type
Subsystem: binfmt
Tong Zhang <ztong0001@gmail.com>:
binfmt_misc: fix crash when load/unload module
Subsystem: ia64
Randy Dunlap <rdunlap@infradead.org>:
ia64: make IA64_MCA_RECOVERY bool instead of tristate
Subsystem: mm/memory-failure
Joao Martins <joao.m.martins@oracle.com>:
memory-failure: fetch compound_head after pgmap_pfn_valid()
Subsystem: mm/folios
Wei Yang <richard.weiyang@gmail.com>:
mm: page->mapping folio->mapping should have the same offset
Subsystem: selftests
Maor Gottlieb <maorg@nvidia.com>:
tools/testing/scatterlist: add missing defines
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
kasan: test: fix compatibility with FORTIFY_SOURCE
Peter Collingbourne <pcc@google.com>:
mm, kasan: use compare-exchange operation to set KASAN page tag
Subsystem: mm/psi
Suren Baghdasaryan <surenb@google.com>:
psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n
psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n
Subsystem: ocfs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
Patch series "ocfs2: fix a deadlock case":
jbd2: export jbd2_journal_[grab|put]_journal_head
ocfs2: fix a deadlock when commit trans
arch/ia64/Kconfig | 2
fs/binfmt_misc.c | 8 +--
fs/jbd2/journal.c | 2
fs/ocfs2/suballoc.c | 25 ++++-------
include/linux/mm.h | 17 +++++--
include/linux/mm_types.h | 1
include/linux/psi.h | 11 ++--
include/linux/sysctl.h | 2
kernel/sched/psi.c | 79 ++++++++++++++++++-----------------
lib/test_kasan.c | 5 ++
mm/memory-failure.c | 6 ++
tools/testing/scatterlist/linux/mm.h | 3 -
12 files changed, 91 insertions(+), 70 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-02-04 4:48 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-02-04 4:48 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
10 patches, based on 1f2cfdd349b7647f438c1e552dc1b983da86d830.
Subsystems affected by this patch series:
mm/vmscan
mm/debug
mm/pagemap
ipc
mm/kmemleak
MAINTAINERS
mm/selftests
Subsystem: mm/vmscan
Chen Wandun <chenwandun@huawei.com>:
Revert "mm/page_isolation: unset migratetype directly for non Buddy page"
Subsystem: mm/debug
Pasha Tatashin <pasha.tatashin@soleen.com>:
Patch series "page table check fixes and cleanups", v5:
mm/debug_vm_pgtable: remove pte entry from the page table
mm/page_table_check: use unsigned long for page counters and cleanup
mm/khugepaged: unify collapse pmd clear, flush and free
mm/page_table_check: check entries at pmd levels
Subsystem: mm/pagemap
Mike Rapoport <rppt@linux.ibm.com>:
mm/pgtable: define pte_index so that preprocessor could recognize it
Subsystem: ipc
Minghao Chi <chi.minghao@zte.com.cn>:
ipc/sem: do not sleep with a spin lock held
Subsystem: mm/kmemleak
Lang Yu <lang.yu@amd.com>:
mm/kmemleak: avoid scanning potential huge holes
Subsystem: MAINTAINERS
Mike Rapoport <rppt@linux.ibm.com>:
MAINTAINERS: update rppt's email
Subsystem: mm/selftests
Shuah Khan <skhan@linuxfoundation.org>:
kselftest/vm: revert "tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner"
MAINTAINERS | 2 -
include/linux/page_table_check.h | 19 ++++++++++
include/linux/pgtable.h | 1
ipc/sem.c | 4 +-
mm/debug_vm_pgtable.c | 2 +
mm/khugepaged.c | 37 +++++++++++---------
mm/kmemleak.c | 13 +++----
mm/page_isolation.c | 2 -
mm/page_table_check.c | 55 +++++++++++++++----------------
tools/testing/selftests/vm/userfaultfd.c | 11 ++++--
10 files changed, 89 insertions(+), 57 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-02-12 0:27 Andrew Morton
2022-02-12 2:02 ` incoming Linus Torvalds
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2022-02-12 0:27 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43.
Subsystems affected by this patch series:
binfmt
procfs
mm/vmscan
mm/memcg
mm/kfence
Subsystem: binfmt
Mike Rapoport <rppt@linux.ibm.com>:
fs/binfmt_elf: fix PT_LOAD p_align values for loaders
Subsystem: procfs
Yang Shi <shy828301@gmail.com>:
fs/proc: task_mmu.c: don't read mapcount for migration entry
Subsystem: mm/vmscan
Mel Gorman <mgorman@suse.de>:
mm: vmscan: remove deadlock due to throttling failing to make progress
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: memcg: synchronize objcg lists with a dedicated spinlock
Subsystem: mm/kfence
Peng Liu <liupeng256@huawei.com>:
kfence: make test case compatible with run time set sample interval
fs/binfmt_elf.c | 2 +-
fs/proc/task_mmu.c | 40 +++++++++++++++++++++++++++++++---------
include/linux/kfence.h | 2 ++
include/linux/memcontrol.h | 5 +++--
mm/kfence/core.c | 3 ++-
mm/kfence/kfence_test.c | 8 ++++----
mm/memcontrol.c | 10 +++++-----
mm/vmscan.c | 4 +++-
8 files changed, 51 insertions(+), 23 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2022-02-12 0:27 incoming Andrew Morton
@ 2022-02-12 2:02 ` Linus Torvalds
2022-02-12 5:24 ` incoming Andrew Morton
0 siblings, 1 reply; 348+ messages in thread
From: Linus Torvalds @ 2022-02-12 2:02 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits, patches
On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43.
So this *completely* flummoxed 'b4', because you first sent the wrong
series, and then sent the right one in the same thread.
I fetched the emails manually, but honestly, this was confusing even
then, with two "[PATCH x/5]" series where the only way to tell the
right one was basically by date of email. They did arrive in the same
order in my mailbox, but even that wouldn't have been guaranteed if
there had been some mailer delays somewhere..
So next time when you mess up, resend it all as a completely new
series and completely new threading - so with a new header email too.
Please?
And since I'm here, let me just verify that yes, the series you
actually want me to apply is this one (as described by the head
email):
Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values ..
Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f..
Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl..
Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a ..
Subject: [patch 5/5] kfence: make test case compatible with run..
and not the other one with GUP patches?
Linus
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2022-02-12 2:02 ` incoming Linus Torvalds
@ 2022-02-12 5:24 ` Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-02-12 5:24 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Linux-MM, mm-commits, patches
On Fri, 11 Feb 2022 18:02:53 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43.
>
> So this *completely* flummoxed 'b4', because you first sent the wrong
> series, and then sent the right one in the same thread.
>
> I fetched the emails manually, but honestly, this was confusing even
> then, with two "[PATCH x/5]" series where the only way to tell the
> right one was basically by date of email. They did arrive in the same
> order in my mailbox, but even that wouldn't have been guaranteed if
> there had been some mailer delays somewhere..
Yes, I wondered. Sorry bout that.
> So next time when you mess up, resend it all as a completely new
> series and completely new threading - so with a new header email too.
> Please?
Wilco.
> And since I'm here, let me just verify that yes, the series you
> actually want me to apply is this one (as described by the head
> email):
>
> Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values ..
> Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f..
> Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl..
> Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a ..
> Subject: [patch 5/5] kfence: make test case compatible with run..
>
> and not the other one with GUP patches?
Those are the ones. Five fixes, three with cc:stable.
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-02-26 3:10 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-02-26 3:10 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
12 patches, based on c47658311d60be064b839f329c0e4d34f5f0735b.
Subsystems affected by this patch series:
MAINTAINERS
mm/hugetlb
mm/kasan
mm/hugetlbfs
mm/pagemap
mm/selftests
mm/memcg
m/slab
mailmap
memfd
Subsystem: MAINTAINERS
Luis Chamberlain <mcgrof@kernel.org>:
MAINTAINERS: add sysctl-next git tree
Subsystem: mm/hugetlb
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/hugetlb: fix kernel crash with hugetlb mremap
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: test: prevent cache merging in kmem_cache_double_destroy
Subsystem: mm/hugetlbfs
Liu Yuntao <liuyuntao10@huawei.com>:
hugetlbfs: fix a truncation issue in hugepages parameter
Subsystem: mm/pagemap
Suren Baghdasaryan <surenb@google.com>:
mm: fix use-after-free bug when mm->mmap is reused after being freed
Subsystem: mm/selftests
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
selftest/vm: fix map_fixed_noreplace test failure
Subsystem: mm/memcg
Roman Gushchin <roman.gushchin@linux.dev>:
MAINTAINERS: add Roman as a memcg co-maintainer
Vladimir Davydov <vdavydov.dev@gmail.com>:
MAINTAINERS: remove Vladimir from memcg maintainers
Shakeel Butt <shakeelb@google.com>:
MAINTAINERS: add Shakeel as a memcg co-maintainer
Subsystem: m/slab
Vlastimil Babka <vbabka@suse.cz>:
MAINTAINERS, SLAB: add Roman as reviewer, git tree
Subsystem: mailmap
Roman Gushchin <roman.gushchin@linux.dev>:
mailmap: update Roman Gushchin's email
Subsystem: memfd
Mike Kravetz <mike.kravetz@oracle.com>:
selftests/memfd: clean up mapping in mfd_fail_write
.mailmap | 3 +
MAINTAINERS | 6 ++
lib/test_kasan.c | 5 +-
mm/hugetlb.c | 11 ++---
mm/mmap.c | 1
tools/testing/selftests/memfd/memfd_test.c | 1
tools/testing/selftests/vm/map_fixed_noreplace.c | 49 +++++++++++++++++------
7 files changed, 56 insertions(+), 20 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-03-05 4:28 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-03-05 4:28 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
8 patches, based on 07ebd38a0da24d2534da57b4841346379db9f354.
Subsystems affected by this patch series:
mm/hugetlb
mm/pagemap
memfd
selftests
mm/userfaultfd
kconfig
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
selftests/vm: cleanup hugetlb file after mremap test
Subsystem: mm/pagemap
Suren Baghdasaryan <surenb@google.com>:
mm: refactor vm_area_struct::anon_vma_name usage code
mm: prevent vm_area_struct::anon_name refcount saturation
mm: fix use-after-free when anon vma name is used after vma is freed
Subsystem: memfd
Hugh Dickins <hughd@google.com>:
memfd: fix F_SEAL_WRITE after shmem huge page allocated
Subsystem: selftests
Chengming Zhou <zhouchengming@bytedance.com>:
kselftest/vm: fix tests build with old libc
Subsystem: mm/userfaultfd
Yun Zhou <yun.zhou@windriver.com>:
proc: fix documentation and description of pagemap
Subsystem: kconfig
Qian Cai <quic_qiancai@quicinc.com>:
configs/debug: set CONFIG_DEBUG_INFO=y properly
Documentation/admin-guide/mm/pagemap.rst | 2
fs/proc/task_mmu.c | 9 +-
fs/userfaultfd.c | 6 -
include/linux/mm.h | 7 +
include/linux/mm_inline.h | 105 ++++++++++++++++++---------
include/linux/mm_types.h | 5 +
kernel/configs/debug.config | 2
kernel/fork.c | 4 -
kernel/sys.c | 19 +++-
mm/madvise.c | 98 +++++++++----------------
mm/memfd.c | 40 +++++++---
mm/mempolicy.c | 2
mm/mlock.c | 2
mm/mmap.c | 12 +--
mm/mprotect.c | 2
tools/testing/selftests/vm/hugepage-mremap.c | 26 ++++--
tools/testing/selftests/vm/run_vmtests.sh | 3
tools/testing/selftests/vm/userfaultfd.c | 1
18 files changed, 201 insertions(+), 144 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-03-16 23:14 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-03-16 23:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
4 patches, based on 56e337f2cf1326323844927a04e9dbce9a244835.
Subsystems affected by this patch series:
mm/swap
kconfig
ocfs2
selftests
Subsystem: mm/swap
Guo Ziliang <guo.ziliang@zte.com.cn>:
mm: swap: get rid of deadloop in swapin readahead
Subsystem: kconfig
Qian Cai <quic_qiancai@quicinc.com>:
configs/debug: restore DEBUG_INFO=y for overriding
Subsystem: ocfs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: fix crash when initialize filecheck kobj fails
Subsystem: selftests
Yosry Ahmed <yosryahmed@google.com>:
selftests: vm: fix clang build error multiple output files
fs/ocfs2/super.c | 22 +++++++++++-----------
kernel/configs/debug.config | 1 +
mm/swap_state.c | 2 +-
tools/testing/selftests/vm/Makefile | 6 ++----
4 files changed, 15 insertions(+), 16 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-03-22 21:38 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-03-22 21:38 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
- A few misc subsystems
- There is a lot of MM material in Willy's tree. Folio work and
non-folio patches which depended on that work.
Here I send almost all the MM patches which precede the patches in
Willy's tree. The remaining ~100 MM patches are staged on Willy's
tree and I'll send those along once Willy is merged up.
I tried this batch against your current tree (as of
51912904076680281) and a couple need some extra persuasion to apply,
but all looks OK otherwise.
227 patches, based on f443e374ae131c168a065ea1748feac6b2e76613
Subsystems affected by this patch series:
kthread
scripts
ntfs
ocfs2
block
vfs
mm/kasan
mm/pagecache
mm/gup
mm/swap
mm/shmem
mm/memcg
mm/selftests
mm/pagemap
mm/mremap
mm/sparsemem
mm/vmalloc
mm/pagealloc
mm/memory-failure
mm/mlock
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/compaction
mm/mempolicy
mm/oom-kill
mm/migration
mm/thp
mm/cma
mm/autonuma
mm/psi
mm/ksm
mm/page-poison
mm/madvise
mm/memory-hotplug
mm/rmap
mm/zswap
mm/uaccess
mm/ioremap
mm/highmem
mm/cleanups
mm/kfence
mm/hmm
mm/damon
Subsystem: kthread
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
linux/kthread.h: remove unused macros
Subsystem: scripts
Colin Ian King <colin.i.king@gmail.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ntfs
Dongliang Mu <mudongliangabcd@gmail.com>:
ntfs: add sanity check on allocation size
Subsystem: ocfs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: cleanup some return variables
hongnanli <hongnan.li@linux.alibaba.com>:
fs/ocfs2: fix comments mentioning i_mutex
Subsystem: block
NeilBrown <neilb@suse.de>:
Patch series "Remove remaining parts of congestion tracking code", v2:
doc: convert 'subsection' to 'section' in gfp.h
mm: document and polish read-ahead code
mm: improve cleanup when ->readpages doesn't process all pages
fuse: remove reliance on bdi congestion
nfs: remove reliance on bdi congestion
ceph: remove reliance on bdi congestion
remove inode_congested()
remove bdi_congested() and wb_congested() and related functions
f2fs: replace congestion_wait() calls with io_schedule_timeout()
block/bfq-iosched.c: use "false" rather than "BLK_RW_ASYNC"
remove congestion tracking framework
Subsystem: vfs
Anthony Iliopoulos <ailiop@suse.com>:
mount: warn only once about timestamp range expiration
Subsystem: mm/kasan
Miaohe Lin <linmiaohe@huawei.com>:
mm/memremap: avoid calling kasan_remove_zero_shadow() for device private memory
Subsystem: mm/pagecache
Miaohe Lin <linmiaohe@huawei.com>:
filemap: remove find_get_pages()
mm/writeback: minor clean up for highmem_dirtyable_memory
Minchan Kim <minchan@kernel.org>:
mm: fs: fix lru_cache_disabled race in bh_lru
Subsystem: mm/gup
Peter Xu <peterx@redhat.com>:
Patch series "mm/gup: some cleanups", v5:
mm: fix invalid page pointer returned with FOLL_PIN gups
John Hubbard <jhubbard@nvidia.com>:
mm/gup: follow_pfn_pte(): -EEXIST cleanup
mm/gup: remove unused pin_user_pages_locked()
mm: change lookup_node() to use get_user_pages_fast()
mm/gup: remove unused get_user_pages_locked()
Subsystem: mm/swap
Bang Li <libang.linuxer@gmail.com>:
mm/swap: fix confusing comment in folio_mark_accessed
Subsystem: mm/shmem
Xavier Roche <xavier.roche@algolia.com>:
tmpfs: support for file creation time
Hugh Dickins <hughd@google.com>:
shmem: mapping_set_exiting() to help mapped resilience
tmpfs: do not allocate pages on read
Miaohe Lin <linmiaohe@huawei.com>:
mm: shmem: use helper macro __ATTR_RW
Subsystem: mm/memcg
Shakeel Butt <shakeelb@google.com>:
memcg: replace in_interrupt() with !in_task()
Yosry Ahmed <yosryahmed@google.com>:
memcg: add per-memcg total kernel memory stat
Wei Yang <richard.weiyang@gmail.com>:
mm/memcg: mem_cgroup_per_node is already set to 0 on allocation
mm/memcg: retrieve parent memcg from css.parent
Shakeel Butt <shakeelb@google.com>:
Patch series "memcg: robust enforcement of memory.high", v2:
memcg: refactor mem_cgroup_oom
memcg: unify force charging conditions
selftests: memcg: test high limit for single entry allocation
memcg: synchronously enforce memory.high for large overcharges
Randy Dunlap <rdunlap@infradead.org>:
mm/memcontrol: return 1 from cgroup.memory __setup() handler
Michal Hocko <mhocko@suse.com>:
Patch series "mm/memcg: Address PREEMPT_RT problems instead of disabling it", v5:
mm/memcg: revert ("mm/memcg: optimize user context object stock access")
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/memcg: disable threshold event handlers on PREEMPT_RT
mm/memcg: protect per-CPU counter by disabling preemption on PREEMPT_RT where needed.
Johannes Weiner <hannes@cmpxchg.org>:
mm/memcg: opencode the inner part of obj_cgroup_uncharge_pages() in drain_obj_stock()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/memcg: protect memcg_stock with a local_lock_t
mm/memcg: disable migration instead of preemption in drain_all_stock().
Muchun Song <songmuchun@bytedance.com>:
Patch series "Optimize list lru memory consumption", v6:
mm: list_lru: transpose the array of per-node per-memcg lru lists
mm: introduce kmem_cache_alloc_lru
fs: introduce alloc_inode_sb() to allocate filesystems specific inode
fs: allocate inode by using alloc_inode_sb()
f2fs: allocate inode by using alloc_inode_sb()
mm: dcache: use kmem_cache_alloc_lru() to allocate dentry
xarray: use kmem_cache_alloc_lru to allocate xa_node
mm: memcontrol: move memcg_online_kmem() to mem_cgroup_css_online()
mm: list_lru: allocate list_lru_one only when needed
mm: list_lru: rename memcg_drain_all_list_lrus to memcg_reparent_list_lrus
mm: list_lru: replace linear array with xarray
mm: memcontrol: reuse memory cgroup ID for kmem ID
mm: memcontrol: fix cannot alloc the maximum memcg ID
mm: list_lru: rename list_lru_per_memcg to list_lru_memcg
mm: memcontrol: rename memcg_cache_id to memcg_kmem_id
Vasily Averin <vvs@virtuozzo.com>:
memcg: enable accounting for tty-related objects
Subsystem: mm/selftests
Guillaume Tucker <guillaume.tucker@collabora.com>:
selftests, x86: fix how check_cc.sh is being invoked
Subsystem: mm/pagemap
Anshuman Khandual <anshuman.khandual@arm.com>:
mm: merge pte_mkhuge() call into arch_make_huge_pte()
Stafford Horne <shorne@gmail.com>:
mm: remove mmu_gathers storage from remaining architectures
Muchun Song <songmuchun@bytedance.com>:
Patch series "Fix some cache flush bugs", v5:
mm: thp: fix wrong cache flush in remove_migration_pmd()
mm: fix missing cache flush for all tail pages of compound page
mm: hugetlb: fix missing cache flush in copy_huge_page_from_user()
mm: hugetlb: fix missing cache flush in hugetlb_mcopy_atomic_pte()
mm: shmem: fix missing cache flush in shmem_mfill_atomic_pte()
mm: userfaultfd: fix missing cache flush in mcopy_atomic_pte() and __mcopy_atomic()
mm: replace multiple dcache flush with flush_dcache_folio()
Peter Xu <peterx@redhat.com>:
Patch series "mm: Rework zap ptes on swap entries", v5:
mm: don't skip swap entry even if zap_details specified
mm: rename zap_skip_check_mapping() to should_zap_page()
mm: change zap_details.zap_mapping into even_cows
mm: rework swap handling of zap_pte_range
Randy Dunlap <rdunlap@infradead.org>:
mm/mmap: return 1 from stack_guard_gap __setup() handler
Miaohe Lin <linmiaohe@huawei.com>:
mm/memory.c: use helper function range_in_vma()
mm/memory.c: use helper macro min and max in unmap_mapping_range_tree()
Hugh Dickins <hughd@google.com>:
mm: _install_special_mapping() apply VM_LOCKED_CLEAR_MASK
Miaohe Lin <linmiaohe@huawei.com>:
mm/mmap: remove obsolete comment in ksys_mmap_pgoff
Subsystem: mm/mremap
Miaohe Lin <linmiaohe@huawei.com>:
mm/mremap:: use vma_lookup() instead of find_vma()
Subsystem: mm/sparsemem
Miaohe Lin <linmiaohe@huawei.com>:
mm/sparse: make mminit_validate_memmodel_limits() static
Subsystem: mm/vmalloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/vmalloc: remove unneeded function forward declaration
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: Move draining areas out of caller context
Uladzislau Rezki <uladzislau.rezki@sony.com>:
mm/vmalloc: add adjust_search_size parameter
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: eliminate an extra orig_gfp_mask
Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
mm/vmalloc.c: fix "unused function" warning
Bang Li <libang.linuxer@gmail.com>:
mm/vmalloc: fix comments about vmap_area struct
Subsystem: mm/pagealloc
Zi Yan <ziy@nvidia.com>:
mm: page_alloc: avoid merging non-fallbackable pageblocks with others
Peter Collingbourne <pcc@google.com>:
mm/mmzone.c: use try_cmpxchg() in page_cpupid_xchg_last()
Miaohe Lin <linmiaohe@huawei.com>:
mm/mmzone.h: remove unused macros
Nicolas Saenz Julienne <nsaenzju@redhat.com>:
mm/page_alloc: don't pass pfn to free_unref_page_commit()
David Hildenbrand <david@redhat.com>:
Patch series "mm: enforce pageblock_order < MAX_ORDER":
cma: factor out minimum alignment requirement
mm: enforce pageblock_order < MAX_ORDER
Nathan Chancellor <nathan@kernel.org>:
mm/page_alloc: mark pagesets as __maybe_unused
Alistair Popple <apopple@nvidia.com>:
mm/pages_alloc.c: don't create ZONE_MOVABLE beyond the end of a node
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Follow-up on high-order PCP caching", v2:
mm/page_alloc: fetch the correct pcp buddy during bulk free
mm/page_alloc: track range of active PCP lists during bulk free
mm/page_alloc: simplify how many pages are selected per pcp list during bulk free
mm/page_alloc: drain the requested list first during bulk free
mm/page_alloc: free pages in a single pass during bulk free
mm/page_alloc: limit number of high-order pages on PCP during bulk free
mm/page_alloc: do not prefetch buddies during bulk free
Oscar Salvador <osalvador@suse.de>:
arch/x86/mm/numa: Do not initialize nodes twice
Suren Baghdasaryan <surenb@google.com>:
mm: count time in drain_all_pages during direct reclaim as memory pressure
Eric Dumazet <edumazet@google.com>:
mm/page_alloc: call check_new_pages() while zone spinlock is not held
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: check high-order pages for corruption during PCP operations
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/memory-failure.c: remove obsolete comment
mm/hwpoison: fix error page recovered but reported "not recovered"
Rik van Riel <riel@surriel.com>:
mm: invalidate hwpoison page cache page in fault path
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "A few cleanup and fixup patches for memory failure", v3:
mm/memory-failure.c: minor clean up for memory_failure_dev_pagemap
mm/memory-failure.c: catch unexpected -EFAULT from vma_address()
mm/memory-failure.c: rework the signaling logic in kill_proc
mm/memory-failure.c: fix race with changing page more robustly
mm/memory-failure.c: remove PageSlab check in hwpoison_filter_dev
mm/memory-failure.c: rework the try_to_unmap logic in hwpoison_user_mappings()
mm/memory-failure.c: remove obsolete comment in __soft_offline_page
mm/memory-failure.c: remove unnecessary PageTransTail check
mm/hwpoison-inject: support injecting hwpoison to free page
luofei <luofei@unicloud.com>:
mm/hwpoison: avoid the impact of hwpoison_filter() return value on mce handler
mm/hwpoison: add in-use hugepage hwpoison filter judgement
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "A few fixup patches for memory failure", v2:
mm/memory-failure.c: fix race with changing page compound again
mm/memory-failure.c: avoid calling invalidate_inode_page() with unexpected pages
mm/memory-failure.c: make non-LRU movable pages unhandlable
Vlastimil Babka <vbabka@suse.cz>:
mm, fault-injection: declare should_fail_alloc_page()
Subsystem: mm/mlock
Miaohe Lin <linmiaohe@huawei.com>:
mm/mlock: fix potential imbalanced rlimit ucounts adjustment
Subsystem: mm/hugetlb
Muchun Song <songmuchun@bytedance.com>:
Patch series "Free the 2nd vmemmap page associated with each HugeTLB page", v7:
mm: hugetlb: free the 2nd vmemmap page associated with each HugeTLB page
mm: hugetlb: replace hugetlb_free_vmemmap_enabled with a static_key
mm: sparsemem: use page table lock to protect kernel pmd operations
selftests: vm: add a hugetlb test case
mm: sparsemem: move vmemmap related to HugeTLB to CONFIG_HUGETLB_PAGE_FREE_VMEMMAP
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/hugetlb: generalize ARCH_WANT_GENERAL_HUGETLB
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: clean up potential spectre issue warnings
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: use helper macro __ATTR_RW
David Howells <dhowells@redhat.com>:
mm/hugetlb.c: export PageHeadHuge()
Miaohe Lin <linmiaohe@huawei.com>:
mm: remove unneeded local variable follflags
Subsystem: mm/userfaultfd
Nadav Amit <namit@vmware.com>:
userfaultfd: provide unmasked address on page-fault
Guo Zhengkui <guozhengkui@vivo.com>:
userfaultfd/selftests: fix uninitialized_var.cocci warning
Subsystem: mm/vmscan
Hugh Dickins <hughd@google.com>:
mm/fs: delete PF_SWAPWRITE
mm: __isolate_lru_page_prepare() in isolate_migratepages_block()
Waiman Long <longman@redhat.com>:
mm/list_lru: optimize memcg_reparent_list_lru_node()
Marcelo Tosatti <mtosatti@redhat.com>:
mm: lru_cache_disable: replace work queue synchronization with synchronize_rcu
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm: workingset: replace IRQ-off check with a lockdep assert.
Charan Teja Kalla <quic_charante@quicinc.com>:
mm: vmscan: fix documentation for page_check_references()
Subsystem: mm/compaction
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: compaction: cleanup the compaction trace events
Subsystem: mm/mempolicy
Hugh Dickins <hughd@google.com>:
mempolicy: mbind_range() set_policy() after vma_merge()
Subsystem: mm/oom-kill
Miaohe Lin <linmiaohe@huawei.com>:
mm/oom_kill: remove unneeded is_memcg_oom check
Subsystem: mm/migration
Huang Ying <ying.huang@intel.com>:
mm,migrate: fix establishing demotion target
"andrew.yang" <andrew.yang@mediatek.com>:
mm/migrate: fix race between lock page and clear PG_Isolated
Subsystem: mm/thp
Hugh Dickins <hughd@google.com>:
mm/thp: refix __split_huge_pmd_locked() for migration PMD
Subsystem: mm/cma
Hari Bathini <hbathini@linux.ibm.com>:
Patch series "powerpc/fadump: handle CMA activation failure appropriately", v3:
mm/cma: provide option to opt out from exposing pages on activation failure
powerpc/fadump: opt out from freeing pages on cma activation failure
Subsystem: mm/autonuma
Huang Ying <ying.huang@intel.com>:
Patch series "NUMA balancing: optimize memory placement for memory tiering system", v13:
NUMA Balancing: add page promotion counter
NUMA balancing: optimize page placement for memory tiering system
memory tiering: skip to scan fast memory
Subsystem: mm/psi
Johannes Weiner <hannes@cmpxchg.org>:
mm: page_io: fix psi memory pressure error on cold swapins
Subsystem: mm/ksm
Yang Yang <yang.yang29@zte.com.cn>:
mm/vmstat: add event for ksm swapping in copy
Miaohe Lin <linmiaohe@huawei.com>:
mm/ksm: use helper macro __ATTR_RW
Subsystem: mm/page-poison
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/hwpoison: check the subpage, not the head page
Subsystem: mm/madvise
Miaohe Lin <linmiaohe@huawei.com>:
mm/madvise: use vma_lookup() instead of find_vma()
Charan Teja Kalla <quic_charante@quicinc.com>:
Patch series "mm: madvise: return correct bytes processed with:
mm: madvise: return correct bytes advised with process_madvise
mm: madvise: skip unmapped vma holes passed to process_madvise
Subsystem: mm/memory-hotplug
Michal Hocko <mhocko@suse.com>:
Patch series "mm, memory_hotplug: handle unitialized numa node gracefully":
mm, memory_hotplug: make arch_alloc_nodedata independent on CONFIG_MEMORY_HOTPLUG
mm: handle uninitialized numa nodes gracefully
mm, memory_hotplug: drop arch_free_nodedata
mm, memory_hotplug: reorganize new pgdat initialization
mm: make free_area_init_node aware of memory less nodes
Wei Yang <richard.weiyang@gmail.com>:
memcg: do not tweak node in alloc_mem_cgroup_per_node_info
David Hildenbrand <david@redhat.com>:
drivers/base/memory: add memory block to memory group after registration succeeded
drivers/base/node: consolidate node device subsystem initialization in node_dev_init()
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "A few cleanup patches around memory_hotplug":
mm/memory_hotplug: remove obsolete comment of __add_pages
mm/memory_hotplug: avoid calling zone_intersects() for ZONE_NORMAL
mm/memory_hotplug: clean up try_offline_node
mm/memory_hotplug: fix misplaced comment in offline_pages
David Hildenbrand <david@redhat.com>:
Patch series "drivers/base/memory: determine and store zone for single-zone memory blocks", v2:
drivers/base/node: rename link_mem_sections() to register_memory_block_under_node()
drivers/base/memory: determine and store zone for single-zone memory blocks
drivers/base/memory: clarify adding and removing of memory blocks
Oscar Salvador <osalvador@suse.de>:
mm: only re-generate demotion targets when a numa node changes its N_CPU state
Subsystem: mm/rmap
Hugh Dickins <hughd@google.com>:
mm/thp: ClearPageDoubleMap in first page_add_file_rmap()
Subsystem: mm/zswap
"Maciej S. Szmigiero" <maciej.szmigiero@oracle.com>:
mm/zswap.c: allow handling just same-value filled pages
Subsystem: mm/uaccess
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm: remove usercopy_warn()
mm: uninline copy_overflow()
Randy Dunlap <rdunlap@infradead.org>:
mm/usercopy: return 1 from hardened_usercopy __setup() handler
Subsystem: mm/ioremap
Vlastimil Babka <vbabka@suse.cz>:
mm/early_ioremap: declare early_memremap_pgprot_adjust()
Subsystem: mm/highmem
Ira Weiny <ira.weiny@intel.com>:
highmem: document kunmap_local()
Miaohe Lin <linmiaohe@huawei.com>:
mm/highmem: remove unnecessary done label
Subsystem: mm/cleanups
"Dr. David Alan Gilbert" <linux@treblig.org>:
mm/page_table_check.c: use strtobool for param parsing
Subsystem: mm/kfence
tangmeng <tangmeng@uniontech.com>:
mm/kfence: remove unnecessary CONFIG_KFENCE option
Tianchen Ding <dtcccc@linux.alibaba.com>:
Patch series "provide the flexibility to enable KFENCE", v3:
kfence: allow re-enabling KFENCE after system startup
kfence: alloc kfence_pool after system startup
Peng Liu <liupeng256@huawei.com>:
Patch series "kunit: fix a UAF bug and do some optimization", v2:
kunit: fix UAF when run kfence test case test_gfpzero
kunit: make kunit_test_timeout compatible with comment
kfence: test: try to avoid test_gfpzero trigger rcu_stall
Marco Elver <elver@google.com>:
kfence: allow use of a deferrable timer
Subsystem: mm/hmm
Miaohe Lin <linmiaohe@huawei.com>:
mm/hmm.c: remove unneeded local variable ret
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
Patch series "Remove the type-unclear target id concept":
mm/damon/dbgfs/init_regions: use target index instead of target id
Docs/admin-guide/mm/damon/usage: update for changed initail_regions file input
mm/damon/core: move damon_set_targets() into dbgfs
mm/damon: remove the target id concept
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm/damon: remove redundant page validation
SeongJae Park <sj@kernel.org>:
Patch series "Allow DAMON user code independent of monitoring primitives":
mm/damon: rename damon_primitives to damon_operations
mm/damon: let monitoring operations can be registered and selected
mm/damon/paddr,vaddr: register themselves to DAMON in subsys_initcall
mm/damon/reclaim: use damon_select_ops() instead of damon_{v,p}a_set_operations()
mm/damon/dbgfs: use damon_select_ops() instead of damon_{v,p}a_set_operations()
mm/damon/dbgfs: use operations id for knowing if the target has pid
mm/damon/dbgfs-test: fix is_target_id() change
mm/damon/paddr,vaddr: remove damon_{p,v}a_{target_valid,set_operations}()
tangmeng <tangmeng@uniontech.com>:
mm/damon: remove unnecessary CONFIG_DAMON option
SeongJae Park <sj@kernel.org>:
Patch series "Docs/damon: Update documents for better consistency":
Docs/vm/damon: call low level monitoring primitives the operations
Docs/vm/damon/design: update DAMON-Idle Page Tracking interference handling
Docs/damon: update outdated term 'regions update interval'
Patch series "Introduce DAMON sysfs interface", v3:
mm/damon/core: allow non-exclusive DAMON start/stop
mm/damon/core: add number of each enum type values
mm/damon: implement a minimal stub for sysfs-based DAMON interface
mm/damon/sysfs: link DAMON for virtual address spaces monitoring
mm/damon/sysfs: support the physical address space monitoring
mm/damon/sysfs: support DAMON-based Operation Schemes
mm/damon/sysfs: support DAMOS quotas
mm/damon/sysfs: support schemes prioritization
mm/damon/sysfs: support DAMOS watermarks
mm/damon/sysfs: support DAMOS stats
selftests/damon: add a test for DAMON sysfs interface
Docs/admin-guide/mm/damon/usage: document DAMON sysfs interface
Docs/ABI/testing: add DAMON sysfs interface ABI document
Xin Hao <xhao@linux.alibaba.com>:
mm/damon/sysfs: remove repeat container_of() in damon_sysfs_kdamond_release()
Documentation/ABI/testing/sysfs-kernel-mm-damon | 274 ++
Documentation/admin-guide/cgroup-v1/memory.rst | 2
Documentation/admin-guide/cgroup-v2.rst | 5
Documentation/admin-guide/kernel-parameters.txt | 2
Documentation/admin-guide/mm/damon/usage.rst | 380 +++
Documentation/admin-guide/mm/zswap.rst | 22
Documentation/admin-guide/sysctl/kernel.rst | 31
Documentation/core-api/mm-api.rst | 19
Documentation/dev-tools/kfence.rst | 12
Documentation/filesystems/porting.rst | 6
Documentation/filesystems/vfs.rst | 16
Documentation/vm/damon/design.rst | 43
Documentation/vm/damon/faq.rst | 2
MAINTAINERS | 1
arch/arm/Kconfig | 4
arch/arm64/kernel/setup.c | 3
arch/arm64/mm/hugetlbpage.c | 1
arch/hexagon/mm/init.c | 2
arch/ia64/kernel/topology.c | 10
arch/ia64/mm/discontig.c | 11
arch/mips/kernel/topology.c | 5
arch/nds32/mm/init.c | 1
arch/openrisc/mm/init.c | 2
arch/powerpc/include/asm/fadump-internal.h | 5
arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h | 4
arch/powerpc/kernel/fadump.c | 8
arch/powerpc/kernel/sysfs.c | 17
arch/riscv/Kconfig | 4
arch/riscv/kernel/setup.c | 3
arch/s390/kernel/numa.c | 7
arch/sh/kernel/topology.c | 5
arch/sparc/kernel/sysfs.c | 12
arch/sparc/mm/hugetlbpage.c | 1
arch/x86/Kconfig | 4
arch/x86/kernel/cpu/mce/core.c | 8
arch/x86/kernel/topology.c | 5
arch/x86/mm/numa.c | 33
block/bdev.c | 2
block/bfq-iosched.c | 2
drivers/base/init.c | 1
drivers/base/memory.c | 149 +
drivers/base/node.c | 48
drivers/block/drbd/drbd_int.h | 3
drivers/block/drbd/drbd_req.c | 3
drivers/dax/super.c | 2
drivers/of/of_reserved_mem.c | 9
drivers/tty/tty_io.c | 2
drivers/virtio/virtio_mem.c | 9
fs/9p/vfs_inode.c | 2
fs/adfs/super.c | 2
fs/affs/super.c | 2
fs/afs/super.c | 2
fs/befs/linuxvfs.c | 2
fs/bfs/inode.c | 2
fs/btrfs/inode.c | 2
fs/buffer.c | 8
fs/ceph/addr.c | 22
fs/ceph/inode.c | 2
fs/ceph/super.c | 1
fs/ceph/super.h | 1
fs/cifs/cifsfs.c | 2
fs/coda/inode.c | 2
fs/dcache.c | 3
fs/ecryptfs/super.c | 2
fs/efs/super.c | 2
fs/erofs/super.c | 2
fs/exfat/super.c | 2
fs/ext2/ialloc.c | 5
fs/ext2/super.c | 2
fs/ext4/super.c | 2
fs/f2fs/compress.c | 4
fs/f2fs/data.c | 3
fs/f2fs/f2fs.h | 6
fs/f2fs/segment.c | 8
fs/f2fs/super.c | 14
fs/fat/inode.c | 2
fs/freevxfs/vxfs_super.c | 2
fs/fs-writeback.c | 40
fs/fuse/control.c | 17
fs/fuse/dev.c | 8
fs/fuse/file.c | 17
fs/fuse/inode.c | 2
fs/gfs2/super.c | 2
fs/hfs/super.c | 2
fs/hfsplus/super.c | 2
fs/hostfs/hostfs_kern.c | 2
fs/hpfs/super.c | 2
fs/hugetlbfs/inode.c | 2
fs/inode.c | 2
fs/isofs/inode.c | 2
fs/jffs2/super.c | 2
fs/jfs/super.c | 2
fs/minix/inode.c | 2
fs/namespace.c | 2
fs/nfs/inode.c | 2
fs/nfs/write.c | 14
fs/nilfs2/segbuf.c | 16
fs/nilfs2/super.c | 2
fs/ntfs/inode.c | 6
fs/ntfs3/super.c | 2
fs/ocfs2/alloc.c | 2
fs/ocfs2/aops.c | 2
fs/ocfs2/cluster/nodemanager.c | 2
fs/ocfs2/dir.c | 4
fs/ocfs2/dlmfs/dlmfs.c | 2
fs/ocfs2/file.c | 13
fs/ocfs2/inode.c | 2
fs/ocfs2/localalloc.c | 6
fs/ocfs2/namei.c | 2
fs/ocfs2/ocfs2.h | 4
fs/ocfs2/quota_global.c | 2
fs/ocfs2/stack_user.c | 18
fs/ocfs2/super.c | 2
fs/ocfs2/xattr.c | 2
fs/openpromfs/inode.c | 2
fs/orangefs/super.c | 2
fs/overlayfs/super.c | 2
fs/proc/inode.c | 2
fs/qnx4/inode.c | 2
fs/qnx6/inode.c | 2
fs/reiserfs/super.c | 2
fs/romfs/super.c | 2
fs/squashfs/super.c | 2
fs/sysv/inode.c | 2
fs/ubifs/super.c | 2
fs/udf/super.c | 2
fs/ufs/super.c | 2
fs/userfaultfd.c | 5
fs/vboxsf/super.c | 2
fs/xfs/libxfs/xfs_btree.c | 2
fs/xfs/xfs_buf.c | 3
fs/xfs/xfs_icache.c | 2
fs/zonefs/super.c | 2
include/linux/backing-dev-defs.h | 8
include/linux/backing-dev.h | 50
include/linux/cma.h | 14
include/linux/damon.h | 95
include/linux/fault-inject.h | 2
include/linux/fs.h | 21
include/linux/gfp.h | 10
include/linux/highmem-internal.h | 10
include/linux/hugetlb.h | 8
include/linux/kthread.h | 22
include/linux/list_lru.h | 45
include/linux/memcontrol.h | 46
include/linux/memory.h | 12
include/linux/memory_hotplug.h | 132 -
include/linux/migrate.h | 8
include/linux/mm.h | 11
include/linux/mmzone.h | 22
include/linux/nfs_fs_sb.h | 1
include/linux/node.h | 25
include/linux/page-flags.h | 96
include/linux/pageblock-flags.h | 7
include/linux/pagemap.h | 7
include/linux/sched.h | 1
include/linux/sched/sysctl.h | 10
include/linux/shmem_fs.h | 1
include/linux/slab.h | 3
include/linux/swap.h | 6
include/linux/thread_info.h | 5
include/linux/uaccess.h | 2
include/linux/vm_event_item.h | 3
include/linux/vmalloc.h | 4
include/linux/xarray.h | 9
include/ras/ras_event.h | 1
include/trace/events/compaction.h | 26
include/trace/events/writeback.h | 28
include/uapi/linux/userfaultfd.h | 8
ipc/mqueue.c | 2
kernel/dma/contiguous.c | 4
kernel/sched/core.c | 21
kernel/sysctl.c | 2
lib/Kconfig.kfence | 12
lib/kunit/try-catch.c | 3
lib/xarray.c | 10
mm/Kconfig | 6
mm/backing-dev.c | 57
mm/cma.c | 31
mm/cma.h | 1
mm/compaction.c | 60
mm/damon/Kconfig | 19
mm/damon/Makefile | 7
mm/damon/core-test.h | 23
mm/damon/core.c | 190 +
mm/damon/dbgfs-test.h | 103
mm/damon/dbgfs.c | 264 +-
mm/damon/ops-common.c | 133 +
mm/damon/ops-common.h | 16
mm/damon/paddr.c | 62
mm/damon/prmtv-common.c | 133 -
mm/damon/prmtv-common.h | 16
mm/damon/reclaim.c | 11
mm/damon/sysfs.c | 2632 ++++++++++++++++++++++-
mm/damon/vaddr-test.h | 8
mm/damon/vaddr.c | 67
mm/early_ioremap.c | 1
mm/fadvise.c | 5
mm/filemap.c | 17
mm/gup.c | 103
mm/highmem.c | 9
mm/hmm.c | 3
mm/huge_memory.c | 41
mm/hugetlb.c | 23
mm/hugetlb_vmemmap.c | 74
mm/hwpoison-inject.c | 7
mm/internal.h | 19
mm/kfence/Makefile | 2
mm/kfence/core.c | 147 +
mm/kfence/kfence_test.c | 3
mm/ksm.c | 6
mm/list_lru.c | 690 ++----
mm/maccess.c | 6
mm/madvise.c | 18
mm/memcontrol.c | 549 ++--
mm/memory-failure.c | 148 -
mm/memory.c | 116 -
mm/memory_hotplug.c | 136 -
mm/mempolicy.c | 29
mm/memremap.c | 3
mm/migrate.c | 128 -
mm/mlock.c | 1
mm/mmap.c | 5
mm/mmzone.c | 7
mm/mprotect.c | 13
mm/mremap.c | 4
mm/oom_kill.c | 3
mm/page-writeback.c | 12
mm/page_alloc.c | 429 +--
mm/page_io.c | 7
mm/page_table_check.c | 10
mm/ptdump.c | 16
mm/readahead.c | 124 +
mm/rmap.c | 15
mm/shmem.c | 46
mm/slab.c | 39
mm/slab.h | 25
mm/slob.c | 6
mm/slub.c | 42
mm/sparse-vmemmap.c | 70
mm/sparse.c | 2
mm/swap.c | 25
mm/swapfile.c | 1
mm/usercopy.c | 16
mm/userfaultfd.c | 3
mm/vmalloc.c | 102
mm/vmscan.c | 138 -
mm/vmstat.c | 19
mm/workingset.c | 7
mm/zswap.c | 15
net/socket.c | 2
net/sunrpc/rpc_pipe.c | 2
scripts/spelling.txt | 16
tools/testing/selftests/cgroup/cgroup_util.c | 15
tools/testing/selftests/cgroup/cgroup_util.h | 1
tools/testing/selftests/cgroup/test_memcontrol.c | 78
tools/testing/selftests/damon/Makefile | 1
tools/testing/selftests/damon/sysfs.sh | 306 ++
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 7
tools/testing/selftests/vm/hugepage-vmemmap.c | 144 +
tools/testing/selftests/vm/run_vmtests.sh | 11
tools/testing/selftests/vm/userfaultfd.c | 2
tools/testing/selftests/x86/Makefile | 6
264 files changed, 7205 insertions(+), 3090 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-03-23 23:04 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-03-23 23:04 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
Various misc subsystems, before getting into the post-linux-next material.
This is all based on v5.17. I tested applying and compiling against
today's 1bc191051dca28fa6. One patch required an extra whack, all
looks good.
41 patches, based on f443e374ae131c168a065ea1748feac6b2e76613.
Subsystems affected by this patch series:
procfs
misc
core-kernel
lib
checkpatch
init
pipe
minix
fat
cgroups
kexec
kdump
taskstats
panic
kcov
resource
ubsan
Subsystem: procfs
Hao Lee <haolee.swjtu@gmail.com>:
proc: alloc PATH_MAX bytes for /proc/${pid}/fd/ symlinks
David Hildenbrand <david@redhat.com>:
proc/vmcore: fix possible deadlock on concurrent mmap and read
Yang Li <yang.lee@linux.alibaba.com>:
proc/vmcore: fix vmcore_alloc_buf() kernel-doc comment
Subsystem: misc
Bjorn Helgaas <bhelgaas@google.com>:
linux/types.h: remove unnecessary __bitwise__
Documentation/sparse: add hints about __CHECKER__
Subsystem: core-kernel
Miaohe Lin <linmiaohe@huawei.com>:
kernel/ksysfs.c: use helper macro __ATTR_RW
Subsystem: lib
Kees Cook <keescook@chromium.org>:
Kconfig.debug: make DEBUG_INFO selectable from a choice
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
include: drop pointless __compiler_offsetof indirection
Christophe Leroy <christophe.leroy@csgroup.eu>:
ilog2: force inlining of __ilog2_u32() and __ilog2_u64()
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
bitfield: add explicit inclusions to the example
Feng Tang <feng.tang@intel.com>:
lib/Kconfig.debug: add ARCH dependency for FUNCTION_ALIGN option
Randy Dunlap <rdunlap@infradead.org>:
lib: bitmap: fix many kernel-doc warnings
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: prefer MODULE_LICENSE("GPL") over MODULE_LICENSE("GPL v2")
checkpatch: add --fix option for some TRAILING_STATEMENTS
checkpatch: add early_param exception to blank line after struct/function test
Sagar Patel <sagarmp@cs.unc.edu>:
checkpatch: use python3 to find codespell dictionary
Subsystem: init
Mark-PK Tsai <mark-pk.tsai@mediatek.com>:
init: use ktime_us_delta() to make initcall_debug log more precise
Randy Dunlap <rdunlap@infradead.org>:
init.h: improve __setup and early_param documentation
init/main.c: return 1 from handled __setup() functions
Subsystem: pipe
Andrei Vagin <avagin@gmail.com>:
fs/pipe: use kvcalloc to allocate a pipe_buffer array
fs/pipe.c: local vars have to match types of proper pipe_inode_info fields
Subsystem: minix
Qinghua Jin <qhjin.dev@gmail.com>:
minix: fix bug when opening a file with O_DIRECT
Subsystem: fat
Helge Deller <deller@gmx.de>:
fat: use pointer to simple type in put_user()
Subsystem: cgroups
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
cgroup: use irqsave in cgroup_rstat_flush_locked().
cgroup: add a comment to cgroup_rstat_flush_locked().
Subsystem: kexec
Jisheng Zhang <jszhang@kernel.org>:
Patch series "kexec: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef", v2:
kexec: make crashk_res, crashk_low_res and crash_notes symbols always visible
riscv: mm: init: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef
x86/setup: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef
arm64: mm: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef
Subsystem: kdump
Tiezhu Yang <yangtiezhu@loongson.cn>:
Patch series "Update doc and fix some issues about kdump", v2:
docs: kdump: update description about sysfs file system support
docs: kdump: add scp example to write out the dump file
panic: unset panic_on_warn inside panic()
ubsan: no need to unset panic_on_warn in ubsan_epilogue()
kasan: no need to unset panic_on_warn in end_report()
Subsystem: taskstats
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
taskstats: remove unneeded dead assignment
Subsystem: panic
"Guilherme G. Piccoli" <gpiccoli@igalia.com>:
Patch series "Some improvements on panic_print":
docs: sysctl/kernel: add missing bit to panic_print
panic: add option to dump all CPUs backtraces in panic_print
panic: move panic_print before kmsg dumpers
Subsystem: kcov
Aleksandr Nogikh <nogikh@google.com>:
Patch series "kcov: improve mmap processing", v3:
kcov: split ioctl handling into locked and unlocked parts
kcov: properly handle subsequent mmap calls
Subsystem: resource
Miaohe Lin <linmiaohe@huawei.com>:
kernel/resource: fix kfree() of bootmem memory again
Subsystem: ubsan
Marco Elver <elver@google.com>:
Revert "ubsan, kcsan: Don't combine sanitizer with kcov on clang"
Documentation/admin-guide/kdump/kdump.rst | 10 +
Documentation/admin-guide/kernel-parameters.txt | 5
Documentation/admin-guide/sysctl/kernel.rst | 2
Documentation/dev-tools/sparse.rst | 2
arch/arm64/mm/init.c | 9 -
arch/riscv/mm/init.c | 6 -
arch/x86/kernel/setup.c | 10 -
fs/fat/dir.c | 2
fs/minix/inode.c | 3
fs/pipe.c | 13 +-
fs/proc/base.c | 8 -
fs/proc/vmcore.c | 43 +++----
include/linux/bitfield.h | 3
include/linux/compiler_types.h | 3
include/linux/init.h | 11 +
include/linux/kexec.h | 12 +-
include/linux/log2.h | 4
include/linux/stddef.h | 6 -
include/uapi/linux/types.h | 6 -
init/main.c | 14 +-
kernel/cgroup/rstat.c | 13 +-
kernel/kcov.c | 102 ++++++++---------
kernel/ksysfs.c | 3
kernel/panic.c | 37 ++++--
kernel/resource.c | 41 +-----
kernel/taskstats.c | 5
lib/Kconfig.debug | 142 ++++++++++++------------
lib/Kconfig.kcsan | 11 -
lib/Kconfig.ubsan | 12 --
lib/bitmap.c | 24 ++--
lib/ubsan.c | 10 -
mm/kasan/report.c | 10 -
scripts/checkpatch.pl | 31 ++++-
tools/include/linux/types.h | 5
34 files changed, 313 insertions(+), 305 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-03-25 1:07 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-03-25 1:07 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
This is the material which was staged after willystuff in linux-next.
Everything applied seamlessly on your latest, all looks well.
114 patches, based on 52deda9551a01879b3562e7b41748e85c591f14c.
Subsystems affected by this patch series:
mm/debug
mm/selftests
mm/pagecache
mm/thp
mm/rmap
mm/migration
mm/kasan
mm/hugetlb
mm/pagemap
mm/madvise
selftests
Subsystem: mm/debug
Sean Anderson <seanga2@gmail.com>:
tools/vm/page_owner_sort.c: sort by stacktrace before culling
tools/vm/page_owner_sort.c: support sorting by stack trace
Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: add switch between culling by stacktrace and txt
Chongxi Zhao <zhaochongxi2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: support sorting pid and time
Shenghong Han <hanshenghong2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: two trivial fixes
Yixuan Cao <caoyixuan2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: delete invalid duplicate code
Shenghong Han <hanshenghong2019@email.szu.edu.cn>:
Documentation/vm/page_owner.rst: update the documentation
Shuah Khan <skhan@linuxfoundation.org>:
Documentation/vm/page_owner.rst: fix unexpected indentation warns
Waiman Long <longman@redhat.com>:
Patch series "mm/page_owner: Extend page_owner to show memcg information", v4:
lib/vsprintf: avoid redundant work with 0 size
mm/page_owner: use scnprintf() to avoid excessive buffer overrun check
mm/page_owner: print memcg information
mm/page_owner: record task command name
Yixuan Cao <caoyixuan2019@email.szu.edu.cn>:
mm/page_owner.c: record tgid
tools/vm/page_owner_sort.c: fix the instructions for use
Jiajian Ye <yejiajian2018@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: fix comments
tools/vm/page_owner_sort.c: add a security check
tools/vm/page_owner_sort.c: support sorting by tgid and update documentation
tools/vm/page_owner_sort: fix three trivival places
tools/vm/page_owner_sort: support for sorting by task command name
tools/vm/page_owner_sort.c: support for selecting by PID, TGID or task command name
tools/vm/page_owner_sort.c: support for user-defined culling rules
Christoph Hellwig <hch@lst.de>:
mm: unexport page_init_poison
Subsystem: mm/selftests
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
selftest/vm: add util.h and and move helper functions there
Mike Rapoport <rppt@kernel.org>:
selftest/vm: add helpers to detect PAGE_SIZE and PAGE_SHIFT
Subsystem: mm/pagecache
Hugh Dickins <hughd@google.com>:
mm: delete __ClearPageWaiters()
mm: filemap_unaccount_folio() large skip mapcount fixup
Subsystem: mm/thp
Hugh Dickins <hughd@google.com>:
mm/thp: fix NR_FILE_MAPPED accounting in page_*_file_rmap()
Subsystem: mm/rmap
Subsystem: mm/migration
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/migration: Add trace events", v3:
mm/migration: add trace events for THP migrations
mm/migration: add trace events for base page and HugeTLB migrations
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan, vmalloc, arm64: add vmalloc tagging support for SW/HW_TAGS", v6:
kasan, page_alloc: deduplicate should_skip_kasan_poison
kasan, page_alloc: move tag_clear_highpage out of kernel_init_free_pages
kasan, page_alloc: merge kasan_free_pages into free_pages_prepare
kasan, page_alloc: simplify kasan_poison_pages call site
kasan, page_alloc: init memory of skipped pages on free
kasan: drop skip_kasan_poison variable in free_pages_prepare
mm: clarify __GFP_ZEROTAGS comment
kasan: only apply __GFP_ZEROTAGS when memory is zeroed
kasan, page_alloc: refactor init checks in post_alloc_hook
kasan, page_alloc: merge kasan_alloc_pages into post_alloc_hook
kasan, page_alloc: combine tag_clear_highpage calls in post_alloc_hook
kasan, page_alloc: move SetPageSkipKASanPoison in post_alloc_hook
kasan, page_alloc: move kernel_init_free_pages in post_alloc_hook
kasan, page_alloc: rework kasan_unpoison_pages call site
kasan: clean up metadata byte definitions
kasan: define KASAN_VMALLOC_INVALID for SW_TAGS
kasan, x86, arm64, s390: rename functions for modules shadow
kasan, vmalloc: drop outdated VM_KASAN comment
kasan: reorder vmalloc hooks
kasan: add wrappers for vmalloc hooks
kasan, vmalloc: reset tags in vmalloc functions
kasan, fork: reset pointer tags of vmapped stacks
kasan, arm64: reset pointer tags of vmapped stacks
kasan, vmalloc: add vmalloc tagging for SW_TAGS
kasan, vmalloc, arm64: mark vmalloc mappings as pgprot_tagged
kasan, vmalloc: unpoison VM_ALLOC pages after mapping
kasan, mm: only define ___GFP_SKIP_KASAN_POISON with HW_TAGS
kasan, page_alloc: allow skipping unpoisoning for HW_TAGS
kasan, page_alloc: allow skipping memory init for HW_TAGS
kasan, vmalloc: add vmalloc tagging for HW_TAGS
kasan, vmalloc: only tag normal vmalloc allocations
kasan, arm64: don't tag executable vmalloc allocations
kasan: mark kasan_arg_stacktrace as __initdata
kasan: clean up feature flags for HW_TAGS mode
kasan: add kasan.vmalloc command line flag
kasan: allow enabling KASAN_VMALLOC and SW/HW_TAGS
arm64: select KASAN_VMALLOC for SW/HW_TAGS modes
kasan: documentation updates
kasan: improve vmalloc tests
kasan: test: support async (again) and asymm modes for HW_TAGS
tangmeng <tangmeng@uniontech.com>:
mm/kasan: remove unnecessary CONFIG_KASAN option
Peter Collingbourne <pcc@google.com>:
kasan: update function name in comments
Andrey Konovalov <andreyknvl@google.com>:
kasan: print virtual mapping info in reports
Patch series "kasan: report clean-ups and improvements":
kasan: drop addr check from describe_object_addr
kasan: more line breaks in reports
kasan: rearrange stack frame info in reports
kasan: improve stack frame info in reports
kasan: print basic stack frame info for SW_TAGS
kasan: simplify async check in end_report()
kasan: simplify kasan_update_kunit_status() and call sites
kasan: check CONFIG_KASAN_KUNIT_TEST instead of CONFIG_KUNIT
kasan: move update_kunit_status to start_report
kasan: move disable_trace_on_warning to start_report
kasan: split out print_report from __kasan_report
kasan: simplify kasan_find_first_bad_addr call sites
kasan: restructure kasan_report
kasan: merge __kasan_report into kasan_report
kasan: call print_report from kasan_report_invalid_free
kasan: move and simplify kasan_report_async
kasan: rename kasan_access_info to kasan_report_info
kasan: add comment about UACCESS regions to kasan_report
kasan: respect KASAN_BIT_REPORTED in all reporting routines
kasan: reorder reporting functions
kasan: move and hide kasan_save_enable/restore_multi_shot
kasan: disable LOCKDEP when printing reports
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "Add hugetlb MADV_DONTNEED support", v3:
mm: enable MADV_DONTNEED for hugetlb mappings
selftests/vm: add hugetlb madvise MADV_DONTNEED MADV_REMOVE test
userfaultfd/selftests: enable hugetlb remap and remove event testing
Miaohe Lin <linmiaohe@huawei.com>:
mm/huge_memory: make is_transparent_hugepage() static
Subsystem: mm/pagemap
David Hildenbrand <david@redhat.com>:
Patch series "mm: COW fixes part 1: fix the COW security issue for THP and swap", v3:
mm: optimize do_wp_page() for exclusive pages in the swapcache
mm: optimize do_wp_page() for fresh pages in local LRU pagevecs
mm: slightly clarify KSM logic in do_swap_page()
mm: streamline COW logic in do_swap_page()
mm/huge_memory: streamline COW logic in do_huge_pmd_wp_page()
mm/khugepaged: remove reuse_swap_page() usage
mm/swapfile: remove stale reuse_swap_page()
mm/huge_memory: remove stale page_trans_huge_mapcount()
mm/huge_memory: remove stale locking logic from __split_huge_pmd()
Hugh Dickins <hughd@google.com>:
mm: warn on deleting redirtied only if accounted
mm: unmap_mapping_range_tree() with i_mmap_rwsem shared
Anshuman Khandual <anshuman.khandual@arm.com>:
mm: generalize ARCH_HAS_FILTER_PGPROT
Subsystem: mm/madvise
Mauricio Faria de Oliveira <mfo@canonical.com>:
mm: fix race between MADV_FREE reclaim and blkdev direct IO read
Johannes Weiner <hannes@cmpxchg.org>:
mm: madvise: MADV_DONTNEED_LOCKED
Subsystem: selftests
Muhammad Usama Anjum <usama.anjum@collabora.com>:
selftests: vm: remove dependecy from internal kernel macros
Kees Cook <keescook@chromium.org>:
selftests: kselftest framework: provide "finished" helper
Documentation/dev-tools/kasan.rst | 17
Documentation/vm/page_owner.rst | 72 ++
arch/alpha/include/uapi/asm/mman.h | 2
arch/arm64/Kconfig | 2
arch/arm64/include/asm/vmalloc.h | 6
arch/arm64/include/asm/vmap_stack.h | 5
arch/arm64/kernel/module.c | 5
arch/arm64/mm/pageattr.c | 2
arch/arm64/net/bpf_jit_comp.c | 3
arch/mips/include/uapi/asm/mman.h | 2
arch/parisc/include/uapi/asm/mman.h | 2
arch/powerpc/mm/book3s64/trace.c | 1
arch/s390/kernel/module.c | 2
arch/x86/Kconfig | 3
arch/x86/kernel/module.c | 2
arch/x86/mm/init.c | 1
arch/xtensa/include/uapi/asm/mman.h | 2
include/linux/gfp.h | 53 +-
include/linux/huge_mm.h | 6
include/linux/kasan.h | 136 +++--
include/linux/mm.h | 5
include/linux/page-flags.h | 2
include/linux/pagemap.h | 3
include/linux/swap.h | 4
include/linux/vmalloc.h | 18
include/trace/events/huge_memory.h | 1
include/trace/events/migrate.h | 31 +
include/trace/events/mmflags.h | 18
include/trace/events/thp.h | 27 +
include/uapi/asm-generic/mman-common.h | 2
kernel/fork.c | 13
kernel/scs.c | 16
lib/Kconfig.kasan | 18
lib/test_kasan.c | 239 ++++++++-
lib/vsprintf.c | 8
mm/Kconfig | 3
mm/debug.c | 1
mm/filemap.c | 63 +-
mm/huge_memory.c | 109 ----
mm/kasan/Makefile | 2
mm/kasan/common.c | 4
mm/kasan/hw_tags.c | 243 +++++++---
mm/kasan/kasan.h | 76 ++-
mm/kasan/report.c | 516 +++++++++++----------
mm/kasan/report_generic.c | 34 -
mm/kasan/report_hw_tags.c | 1
mm/kasan/report_sw_tags.c | 16
mm/kasan/report_tags.c | 2
mm/kasan/shadow.c | 76 +--
mm/khugepaged.c | 11
mm/madvise.c | 57 +-
mm/memory.c | 129 +++--
mm/memremap.c | 2
mm/migrate.c | 4
mm/page-writeback.c | 18
mm/page_alloc.c | 270 ++++++-----
mm/page_owner.c | 86 ++-
mm/rmap.c | 62 +-
mm/swap.c | 4
mm/swapfile.c | 104 ----
mm/vmalloc.c | 167 ++++--
tools/testing/selftests/kselftest.h | 10
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 1
tools/testing/selftests/vm/gup_test.c | 3
tools/testing/selftests/vm/hugetlb-madvise.c | 410 ++++++++++++++++
tools/testing/selftests/vm/ksm_tests.c | 38 -
tools/testing/selftests/vm/memfd_secret.c | 2
tools/testing/selftests/vm/run_vmtests.sh | 15
tools/testing/selftests/vm/transhuge-stress.c | 41 -
tools/testing/selftests/vm/userfaultfd.c | 72 +-
tools/testing/selftests/vm/util.h | 75 ++-
tools/vm/page_owner_sort.c | 628 +++++++++++++++++++++-----
73 files changed, 2797 insertions(+), 1288 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-04-01 18:20 Andrew Morton
2022-04-01 18:27 ` incoming Andrew Morton
0 siblings, 1 reply; 348+ messages in thread
From: Andrew Morton @ 2022-04-01 18:20 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696.
Subsystems affected by this patch series:
mm/madvise
ofs2
nilfs2
mm/mlock
mm/mfence
mailmap
mm/memory-failure
mm/kasan
mm/debug
mm/kmemleak
mm/damon
Subsystem: mm/madvise
Charan Teja Kalla <quic_charante@quicinc.com>:
Revert "mm: madvise: skip unmapped vma holes passed to process_madvise"
Subsystem: ofs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: fix crash when mount with quota enabled
Subsystem: nilfs2
Ryusuke Konishi <konishi.ryusuke@gmail.com>:
Patch series "nilfs2 lockdep warning fixes":
nilfs2: fix lockdep warnings in page operations for btree nodes
nilfs2: fix lockdep warnings during disk space reclamation
nilfs2: get rid of nilfs_mapping_init()
Subsystem: mm/mlock
Hugh Dickins <hughd@google.com>:
mm/munlock: add lru_add_drain() to fix memcg_stat_test
mm/munlock: update Documentation/vm/unevictable-lru.rst
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/munlock: protect the per-CPU pagevec by a local_lock_t
Subsystem: mm/kfence
Muchun Song <songmuchun@bytedance.com>:
mm: kfence: fix objcgs vector allocation
Subsystem: mailmap
Kirill Tkhai <kirill.tkhai@openvz.org>:
mailmap: update Kirill's email
Subsystem: mm/memory-failure
Rik van Riel <riel@surriel.com>:
mm,hwpoison: unmap poisoned page before invalidation
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP
Subsystem: mm/debug
Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: remove -c option
doc/vm/page_owner.rst: remove content related to -c option
Subsystem: mm/kmemleak
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
mm/kmemleak: reset tag when compare object pointer
Subsystem: mm/damon
Jonghyeon Kim <tome01@ajou.ac.kr>:
mm/damon: prevent activated scheme from sleeping by deactivated schemes
.mailmap | 1
Documentation/vm/page_owner.rst | 1
Documentation/vm/unevictable-lru.rst | 473 +++++++++++++++--------------------
fs/nilfs2/btnode.c | 23 +
fs/nilfs2/btnode.h | 1
fs/nilfs2/btree.c | 27 +
fs/nilfs2/dat.c | 4
fs/nilfs2/gcinode.c | 7
fs/nilfs2/inode.c | 167 +++++++++++-
fs/nilfs2/mdt.c | 45 ++-
fs/nilfs2/mdt.h | 6
fs/nilfs2/nilfs.h | 16 -
fs/nilfs2/page.c | 16 -
fs/nilfs2/page.h | 1
fs/nilfs2/segment.c | 9
fs/nilfs2/super.c | 5
fs/ocfs2/quota_global.c | 23 -
fs/ocfs2/quota_local.c | 2
include/linux/gfp.h | 4
mm/damon/core.c | 5
mm/gup.c | 10
mm/internal.h | 6
mm/kfence/core.c | 11
mm/kfence/kfence.h | 3
mm/kmemleak.c | 9
mm/madvise.c | 9
mm/memory.c | 12
mm/migrate.c | 2
mm/mlock.c | 46 ++-
mm/page_alloc.c | 1
mm/rmap.c | 4
mm/swap.c | 4
tools/vm/page_owner_sort.c | 6
33 files changed, 560 insertions(+), 399 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* Re: incoming
2022-04-01 18:20 incoming Andrew Morton
@ 2022-04-01 18:27 ` Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-04-01 18:27 UTC (permalink / raw)
To: Linus Torvalds, linux-mm, mm-commits, patches
Argh, messed up in-reply-to. Let me redo...
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-04-01 18:27 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-04-01 18:27 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696.
Subsystems affected by this patch series:
mm/madvise
ofs2
nilfs2
mm/mlock
mm/mfence
mailmap
mm/memory-failure
mm/kasan
mm/debug
mm/kmemleak
mm/damon
Subsystem: mm/madvise
Charan Teja Kalla <quic_charante@quicinc.com>:
Revert "mm: madvise: skip unmapped vma holes passed to process_madvise"
Subsystem: ofs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: fix crash when mount with quota enabled
Subsystem: nilfs2
Ryusuke Konishi <konishi.ryusuke@gmail.com>:
Patch series "nilfs2 lockdep warning fixes":
nilfs2: fix lockdep warnings in page operations for btree nodes
nilfs2: fix lockdep warnings during disk space reclamation
nilfs2: get rid of nilfs_mapping_init()
Subsystem: mm/mlock
Hugh Dickins <hughd@google.com>:
mm/munlock: add lru_add_drain() to fix memcg_stat_test
mm/munlock: update Documentation/vm/unevictable-lru.rst
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/munlock: protect the per-CPU pagevec by a local_lock_t
Subsystem: mm/kfence
Muchun Song <songmuchun@bytedance.com>:
mm: kfence: fix objcgs vector allocation
Subsystem: mailmap
Kirill Tkhai <kirill.tkhai@openvz.org>:
mailmap: update Kirill's email
Subsystem: mm/memory-failure
Rik van Riel <riel@surriel.com>:
mm,hwpoison: unmap poisoned page before invalidation
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP
Subsystem: mm/debug
Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: remove -c option
doc/vm/page_owner.rst: remove content related to -c option
Subsystem: mm/kmemleak
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
mm/kmemleak: reset tag when compare object pointer
Subsystem: mm/damon
Jonghyeon Kim <tome01@ajou.ac.kr>:
mm/damon: prevent activated scheme from sleeping by deactivated schemes
.mailmap | 1
Documentation/vm/page_owner.rst | 1
Documentation/vm/unevictable-lru.rst | 473 +++++++++++++++--------------------
fs/nilfs2/btnode.c | 23 +
fs/nilfs2/btnode.h | 1
fs/nilfs2/btree.c | 27 +
fs/nilfs2/dat.c | 4
fs/nilfs2/gcinode.c | 7
fs/nilfs2/inode.c | 167 +++++++++++-
fs/nilfs2/mdt.c | 45 ++-
fs/nilfs2/mdt.h | 6
fs/nilfs2/nilfs.h | 16 -
fs/nilfs2/page.c | 16 -
fs/nilfs2/page.h | 1
fs/nilfs2/segment.c | 9
fs/nilfs2/super.c | 5
fs/ocfs2/quota_global.c | 23 -
fs/ocfs2/quota_local.c | 2
include/linux/gfp.h | 4
mm/damon/core.c | 5
mm/gup.c | 10
mm/internal.h | 6
mm/kfence/core.c | 11
mm/kfence/kfence.h | 3
mm/kmemleak.c | 9
mm/madvise.c | 9
mm/memory.c | 12
mm/migrate.c | 2
mm/mlock.c | 46 ++-
mm/page_alloc.c | 1
mm/rmap.c | 4
mm/swap.c | 4
tools/vm/page_owner_sort.c | 6
33 files changed, 560 insertions(+), 399 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-04-08 20:08 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-04-08 20:08 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
9 patches, based on d00c50b35101b862c3db270ffeba53a63a1063d9.
Subsystems affected by this patch series:
mm/migration
mm/highmem
lz4
mm/sparsemem
mm/mremap
mm/mempolicy
mailmap
mm/memcg
MAINTAINERS
Subsystem: mm/migration
Zi Yan <ziy@nvidia.com>:
mm: migrate: use thp_order instead of HPAGE_PMD_ORDER for new page allocation.
Subsystem: mm/highmem
Max Filippov <jcmvbkbc@gmail.com>:
highmem: fix checks in __kmap_local_sched_{in,out}
Subsystem: lz4
Guo Xuenan <guoxuenan@huawei.com>:
lz4: fix LZ4_decompress_safe_partial read out of bound
Subsystem: mm/sparsemem
Waiman Long <longman@redhat.com>:
mm/sparsemem: fix 'mem_section' will never be NULL gcc 12 warning
Subsystem: mm/mremap
Paolo Bonzini <pbonzini@redhat.com>:
mmmremap.c: avoid pointless invalidate_range_start/end on mremap(old_size=0)
Subsystem: mm/mempolicy
Miaohe Lin <linmiaohe@huawei.com>:
mm/mempolicy: fix mpol_new leak in shared_policy_replace
Subsystem: mailmap
Vasily Averin <vasily.averin@linux.dev>:
mailmap: update Vasily Averin's email address
Subsystem: mm/memcg
Andrew Morton <akpm@linux-foundation.org>:
mm/list_lru.c: revert "mm/list_lru: optimize memcg_reparent_list_lru_node()"
Subsystem: MAINTAINERS
Tom Rix <trix@redhat.com>:
MAINTAINERS: add Tom as clang reviewer
.mailmap | 4 ++++
MAINTAINERS | 1 +
include/linux/mmzone.h | 11 +++++++----
lib/lz4/lz4_decompress.c | 8 ++++++--
mm/highmem.c | 4 ++--
mm/list_lru.c | 6 ------
mm/mempolicy.c | 3 ++-
mm/migrate.c | 2 +-
mm/mremap.c | 3 +++
9 files changed, 26 insertions(+), 16 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-04-15 2:12 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-04-15 2:12 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
14 patches, based on 115acbb56978941bb7537a97dfc303da286106c1.
Subsystems affected by this patch series:
MAINTAINERS
mm/tmpfs
m/secretmem
mm/kasan
mm/kfence
mm/pagealloc
mm/zram
mm/compaction
mm/hugetlb
binfmt
mm/vmalloc
mm/kmemleak
Subsystem: MAINTAINERS
Joe Perches <joe@perches.com>:
MAINTAINERS: Broadcom internal lists aren't maintainers
Subsystem: mm/tmpfs
Hugh Dickins <hughd@google.com>:
tmpfs: fix regressions from wider use of ZERO_PAGE
Subsystem: m/secretmem
Axel Rasmussen <axelrasmussen@google.com>:
mm/secretmem: fix panic when growing a memfd_secret
Subsystem: mm/kasan
Zqiang <qiang1.zhang@intel.com>:
irq_work: use kasan_record_aux_stack_noalloc() record callstack
Vincenzo Frascino <vincenzo.frascino@arm.com>:
kasan: fix hw tags enablement when KUNIT tests are disabled
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
mm, kfence: support kmem_dump_obj() for KFENCE objects
Subsystem: mm/pagealloc
Juergen Gross <jgross@suse.com>:
mm, page_alloc: fix build_zonerefs_node()
Subsystem: mm/zram
Minchan Kim <minchan@kernel.org>:
mm: fix unexpected zeroed page mapping with zram swap
Subsystem: mm/compaction
Charan Teja Kalla <quic_charante@quicinc.com>:
mm: compaction: fix compiler warning when CONFIG_COMPACTION=n
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: do not demote poisoned hugetlb pages
Subsystem: binfmt
Andrew Morton <akpm@linux-foundation.org>:
revert "fs/binfmt_elf: fix PT_LOAD p_align values for loaders"
revert "fs/binfmt_elf: use PT_LOAD p_align values for static PIE"
Subsystem: mm/vmalloc
Omar Sandoval <osandov@fb.com>:
mm/vmalloc: fix spinning drain_vmap_work after reading from /proc/vmcore
Subsystem: mm/kmemleak
Patrick Wang <patrick.wang.shcn@gmail.com>:
mm: kmemleak: take a full lowmem check in kmemleak_*_phys()
MAINTAINERS | 64 ++++++++++++++++++++--------------------
arch/x86/include/asm/io.h | 2 -
arch/x86/kernel/crash_dump_64.c | 1
fs/binfmt_elf.c | 6 +--
include/linux/kfence.h | 24 +++++++++++++++
kernel/irq_work.c | 2 -
mm/compaction.c | 10 +++---
mm/filemap.c | 6 ---
mm/hugetlb.c | 17 ++++++----
mm/kasan/hw_tags.c | 5 +--
mm/kasan/kasan.h | 10 +++---
mm/kfence/core.c | 21 -------------
mm/kfence/kfence.h | 21 +++++++++++++
mm/kfence/report.c | 47 +++++++++++++++++++++++++++++
mm/kmemleak.c | 8 ++---
mm/page_alloc.c | 2 -
mm/page_io.c | 54 ---------------------------------
mm/secretmem.c | 17 ++++++++++
mm/shmem.c | 31 ++++++++++++-------
mm/slab.c | 2 -
mm/slab.h | 2 -
mm/slab_common.c | 9 +++++
mm/slob.c | 2 -
mm/slub.c | 2 -
mm/vmalloc.c | 11 ------
25 files changed, 207 insertions(+), 169 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-04-21 23:35 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-04-21 23:35 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
13 patches, based on b253435746d9a4a701b5f09211b9c14d3370d0da.
Subsystems affected by this patch series:
mm/memory-failure
mm/memcg
mm/userfaultfd
mm/hugetlbfs
mm/mremap
mm/oom-kill
mm/kasan
kcov
mm/hmm
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/hwpoison: fix race between hugetlb free/demotion and memory_failure_hugetlb()
Xu Yu <xuyu@linux.alibaba.com>:
mm/memory-failure.c: skip huge_zero_page in memory_failure()
Subsystem: mm/memcg
Shakeel Butt <shakeelb@google.com>:
memcg: sync flush only if periodic flush is delayed
Subsystem: mm/userfaultfd
Nadav Amit <namit@vmware.com>:
userfaultfd: mark uffd_wp regardless of VM_WRITE flag
Subsystem: mm/hugetlbfs
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm, hugetlb: allow for "high" userspace addresses
Subsystem: mm/mremap
Sidhartha Kumar <sidhartha.kumar@oracle.com>:
selftest/vm: verify mmap addr in mremap_test
selftest/vm: verify remap destination address in mremap_test
selftest/vm: support xfail in mremap_test
selftest/vm: add skip support to mremap_test
Subsystem: mm/oom-kill
Nico Pache <npache@redhat.com>:
oom_kill.c: futex: delay the OOM reaper to allow time for proper futex cleanup
Subsystem: mm/kasan
Vincenzo Frascino <vincenzo.frascino@arm.com>:
MAINTAINERS: add Vincenzo Frascino to KASAN reviewers
Subsystem: kcov
Aleksandr Nogikh <nogikh@google.com>:
kcov: don't generate a warning on vm_insert_page()'s failure
Subsystem: mm/hmm
Alistair Popple <apopple@nvidia.com>:
mm/mmu_notifier.c: fix race in mmu_interval_notifier_remove()
MAINTAINERS | 1
fs/hugetlbfs/inode.c | 9 -
include/linux/hugetlb.h | 6 +
include/linux/memcontrol.h | 5
include/linux/mm.h | 8 +
include/linux/sched.h | 1
include/linux/sched/mm.h | 8 +
kernel/kcov.c | 7 -
mm/hugetlb.c | 10 +
mm/memcontrol.c | 12 ++
mm/memory-failure.c | 158 ++++++++++++++++++++++--------
mm/mmap.c | 8 -
mm/mmu_notifier.c | 14 ++
mm/oom_kill.c | 54 +++++++---
mm/userfaultfd.c | 15 +-
mm/workingset.c | 2
tools/testing/selftests/vm/mremap_test.c | 85 +++++++++++++++-
tools/testing/selftests/vm/run_vmtests.sh | 11 +-
18 files changed, 327 insertions(+), 87 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
* incoming
@ 2022-04-27 19:41 Andrew Morton
0 siblings, 0 replies; 348+ messages in thread
From: Andrew Morton @ 2022-04-27 19:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
2 patches, based on d615b5416f8a1afeb82d13b238f8152c572d59c0.
Subsystems affected by this patch series:
mm/kasan
mm/debug
Subsystem: mm/kasan
Zqiang <qiang1.zhang@intel.com>:
kasan: prevent cpu_quarantine corruption when CPU offline and cache shrink occur at same time
Subsystem: mm/debug
Akira Yokosawa <akiyks@gmail.com>:
docs: vm/page_owner: use literal blocks for param description
Documentation/vm/page_owner.rst | 5 +++--
mm/kasan/quarantine.c | 7 +++++++
2 files changed, 10 insertions(+), 2 deletions(-)
^ permalink raw reply [flat|nested] 348+ messages in thread
end of thread, other threads:[~2022-04-27 19:41 UTC | newest]
Thread overview: 348+ messages (download: mbox.gz follow: Atom feed
-- links below jump to the message on this page --
2021-05-05 1:32 incoming Andrew Morton
2021-05-05 1:32 ` [patch 001/143] mm: introduce and use mapping_empty() Andrew Morton
2021-05-05 1:32 ` [patch 002/143] mm: stop accounting shadow entries Andrew Morton
2021-05-05 1:32 ` [patch 003/143] dax: account DAX entries as nrpages Andrew Morton
2021-05-05 1:32 ` [patch 004/143] mm: remove nrexceptional from inode Andrew Morton
2021-05-05 1:32 ` [patch 005/143] mm: remove nrexceptional from inode: remove BUG_ON Andrew Morton
2021-05-05 1:33 ` [patch 006/143] hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share() Andrew Morton
2021-05-05 1:33 ` [patch 007/143] hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled Andrew Morton
2021-05-05 1:33 ` [patch 008/143] mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h Andrew Morton
2021-05-05 1:33 ` [patch 009/143] hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp Andrew Morton
2021-05-05 1:33 ` [patch 010/143] mm/hugetlb: remove redundant reservation check condition in alloc_huge_page() Andrew Morton
2021-05-05 1:33 ` [patch 011/143] mm: generalize HUGETLB_PAGE_SIZE_VARIABLE Andrew Morton
2021-05-05 1:33 ` [patch 012/143] mm/hugetlb: use some helper functions to cleanup code Andrew Morton
2021-05-05 1:33 ` [patch 013/143] mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state() Andrew Morton
2021-05-05 1:33 ` [patch 014/143] mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate() Andrew Morton
2021-05-05 1:33 ` [patch 015/143] mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page() Andrew Morton
2021-05-05 1:33 ` [patch 016/143] mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case Andrew Morton
2021-05-05 1:33 ` [patch 017/143] khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps() Andrew Morton
2021-05-05 1:33 ` [patch 018/143] khugepaged: reuse the smp_wmb() inside __SetPageUptodate() Andrew Morton
2021-05-05 1:33 ` [patch 019/143] khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter() Andrew Morton
2021-05-05 1:33 ` [patch 020/143] khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate() Andrew Morton
2021-05-05 1:33 ` [patch 021/143] mm/huge_memory.c: remove unnecessary local variable ret2 Andrew Morton
2021-05-05 1:33 ` [patch 022/143] mm/huge_memory.c: rework the function vma_adjust_trans_huge() Andrew Morton
2021-05-05 1:33 ` [patch 023/143] mm/huge_memory.c: make get_huge_zero_page() return bool Andrew Morton
2021-05-05 1:33 ` [patch 024/143] mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly Andrew Morton
2021-05-05 1:34 ` [patch 025/143] mm/huge_memory.c: remove redundant PageCompound() check Andrew Morton
2021-05-05 1:34 ` [patch 026/143] mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG Andrew Morton
2021-05-05 1:34 ` [patch 027/143] mm/huge_memory.c: use helper function migration_entry_to_page() Andrew Morton
2021-05-05 1:34 ` [patch 028/143] mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable Andrew Morton
2021-05-05 1:34 ` [patch 029/143] khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp() Andrew Morton
2021-05-05 1:34 ` [patch 030/143] khugepaged: remove unnecessary out label in collapse_huge_page() Andrew Morton
2021-05-05 1:34 ` [patch 031/143] khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd() Andrew Morton
2021-05-05 1:34 ` [patch 032/143] mm: huge_memory: a new debugfs interface for splitting THP tests Andrew Morton
2021-05-05 1:34 ` [patch 033/143] mm: huge_memory: debugfs for file-backed THP split Andrew Morton
2021-05-05 1:34 ` [patch 034/143] mm/hugeltb: remove redundant VM_BUG_ON() in region_add() Andrew Morton
2021-05-05 1:34 ` [patch 035/143] mm/hugeltb: simplify the return code of __vma_reservation_common() Andrew Morton
2021-05-05 1:34 ` [patch 036/143] mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages() Andrew Morton
2021-05-05 1:34 ` [patch 037/143] mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts() Andrew Morton
2021-05-05 1:34 ` [patch 038/143] mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages() Andrew Morton
2021-05-05 1:34 ` [patch 039/143] mm/cma: change cma mutex to irq safe spinlock Andrew Morton
2021-05-05 1:34 ` [patch 040/143] hugetlb: no need to drop hugetlb_lock to call cma_release Andrew Morton
2021-05-05 1:34 ` [patch 041/143] hugetlb: add per-hstate mutex to synchronize user adjustments Andrew Morton
2021-05-05 1:34 ` [patch 042/143] hugetlb: create remove_hugetlb_page() to separate functionality Andrew Morton
2021-05-05 1:34 ` [patch 043/143] hugetlb: call update_and_free_page without hugetlb_lock Andrew Morton
2021-05-05 1:35 ` [patch 044/143] hugetlb: change free_pool_huge_page to remove_pool_huge_page Andrew Morton
2021-05-05 1:35 ` [patch 045/143] hugetlb: make free_huge_page irq safe Andrew Morton
2021-05-05 1:35 ` [patch 046/143] hugetlb: add lockdep_assert_held() calls for hugetlb_lock Andrew Morton
2021-05-05 1:35 ` [patch 047/143] mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range Andrew Morton
2021-05-05 1:35 ` [patch 048/143] mm,compaction: let isolate_migratepages_{range,block} return error codes Andrew Morton
2021-05-05 1:35 ` [patch 049/143] mm,hugetlb: drop clearing of flag from prep_new_huge_page Andrew Morton
2021-05-05 1:35 ` [patch 050/143] mm,hugetlb: split prep_new_huge_page functionality Andrew Morton
2021-05-05 1:35 ` [patch 051/143] mm: make alloc_contig_range handle free hugetlb pages Andrew Morton
2021-05-05 1:35 ` [patch 052/143] mm: make alloc_contig_range handle in-use " Andrew Morton
2021-05-05 1:35 ` [patch 053/143] mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig Andrew Morton
2021-05-05 1:35 ` [patch 054/143] userfaultfd: add minor fault registration mode Andrew Morton
2021-05-05 1:35 ` [patch 055/143] userfaultfd: disable huge PMD sharing for MINOR registered VMAs Andrew Morton
2021-05-05 1:35 ` [patch 056/143] userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled Andrew Morton
2021-05-05 1:35 ` [patch 057/143] userfaultfd: add UFFDIO_CONTINUE ioctl Andrew Morton
2021-05-05 1:35 ` [patch 058/143] userfaultfd: update documentation to describe minor fault handling Andrew Morton
2021-05-05 1:35 ` [patch 059/143] userfaultfd/selftests: add test exercising " Andrew Morton
2021-05-05 1:36 ` [patch 060/143] mm/vmscan: move RECLAIM* bits to uapi header Andrew Morton
2021-05-05 1:36 ` [patch 061/143] mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks Andrew Morton
2021-05-05 1:36 ` [patch 062/143] mm: vmscan: use nid from shrink_control for tracepoint Andrew Morton
2021-05-05 1:36 ` [patch 063/143] mm: vmscan: consolidate shrinker_maps handling code Andrew Morton
2021-05-05 1:36 ` [patch 064/143] mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation Andrew Morton
2021-05-05 1:36 ` [patch 065/143] mm: vmscan: remove memcg_shrinker_map_size Andrew Morton
2021-05-05 1:36 ` [patch 066/143] mm: vmscan: use kvfree_rcu instead of call_rcu Andrew Morton
2021-05-05 1:36 ` [patch 067/143] mm: memcontrol: rename shrinker_map to shrinker_info Andrew Morton
2021-05-05 1:36 ` [patch 068/143] mm: vmscan: add shrinker_info_protected() helper Andrew Morton
2021-05-05 1:36 ` [patch 069/143] mm: vmscan: use a new flag to indicate shrinker is registered Andrew Morton
2021-05-05 1:36 ` [patch 070/143] mm: vmscan: add per memcg shrinker nr_deferred Andrew Morton
2021-05-05 1:36 ` [patch 071/143] mm: vmscan: use per memcg nr_deferred of shrinker Andrew Morton
2021-05-05 1:36 ` [patch 072/143] mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers Andrew Morton
2021-05-05 1:36 ` [patch 073/143] mm: memcontrol: reparent nr_deferred when memcg offline Andrew Morton
2021-05-05 1:36 ` [patch 074/143] mm: vmscan: shrink deferred objects proportional to priority Andrew Morton
2021-05-05 1:36 ` [patch 075/143] mm/compaction: remove unused variable sysctl_compact_memory Andrew Morton
2021-05-05 1:36 ` [patch 076/143] mm: compaction: update the COMPACT[STALL|FAIL] events properly Andrew Morton
2021-05-05 1:36 ` [patch 077/143] mm: disable LRU pagevec during the migration temporarily Andrew Morton
2021-05-05 1:36 ` [patch 078/143] mm: replace migrate_[prep|finish] with lru_cache_[disable|enable] Andrew Morton
2021-05-05 1:37 ` [patch 079/143] mm: fs: invalidate BH LRU during page migration Andrew Morton
2021-05-05 1:37 ` [patch 080/143] mm/migrate.c: make putback_movable_page() static Andrew Morton
2021-05-05 1:37 ` [patch 081/143] mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case Andrew Morton
2021-05-05 1:37 ` [patch 082/143] mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page() Andrew Morton
2021-05-05 1:37 ` [patch 083/143] mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole() Andrew Morton
2021-05-05 1:37 ` [patch 084/143] Revert "mm: migrate: skip shared exec THP for NUMA balancing" Andrew Morton
2021-05-05 1:37 ` [patch 085/143] mm: vmstat: add cma statistics Andrew Morton
2021-05-05 1:37 ` [patch 086/143] mm: cma: use pr_err_ratelimited for CMA warning Andrew Morton
2021-05-05 1:37 ` [patch 087/143] mm: cma: add trace events for CMA alloc perf testing Andrew Morton
2021-05-05 1:37 ` [patch 088/143] mm: cma: support sysfs Andrew Morton
2021-05-05 1:37 ` [patch 089/143] mm: cma: add the CMA instance name to cma trace events Andrew Morton
2021-05-05 1:37 ` [patch 090/143] mm: use proper type for cma_[alloc|release] Andrew Morton
2021-05-05 1:37 ` [patch 091/143] ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search() Andrew Morton
2021-05-05 1:37 ` [patch 092/143] ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree() Andrew Morton
2021-05-05 1:37 ` [patch 093/143] ksm: remove dedicated macro KSM_FLAG_MASK Andrew Morton
2021-05-05 1:37 ` [patch 094/143] ksm: fix potential missing rmap_item for stable_node Andrew Morton
2021-05-05 1:37 ` [patch 095/143] mm/ksm: remove unused parameter from remove_trailing_rmap_items() Andrew Morton
2021-05-05 1:37 ` [patch 096/143] mm: restore node stat checking in /proc/sys/vm/stat_refresh Andrew Morton
2021-05-05 1:37 ` [patch 097/143] mm: no more EINVAL from /proc/sys/vm/stat_refresh Andrew Morton
2021-05-05 1:37 ` [patch 098/143] mm: /proc/sys/vm/stat_refresh skip checking known negative stats Andrew Morton
2021-05-05 1:38 ` [patch 099/143] mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats Andrew Morton
2021-05-05 1:38 ` [patch 100/143] x86/mm: track linear mapping split events Andrew Morton
2021-05-05 1:38 ` [patch 101/143] mm/mmap.c: don't unlock VMAs in remap_file_pages() Andrew Morton
2021-05-05 1:38 ` [patch 102/143] mm: generalize ARCH_HAS_CACHE_LINE_SIZE Andrew Morton
2021-05-05 1:38 ` [patch 104/143] mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] Andrew Morton
2021-05-05 1:38 ` [patch 105/143] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION Andrew Morton
2021-05-05 1:38 ` [patch 108/143] mm/util.c: reduce mem_dump_obj() object size Andrew Morton
2021-05-05 1:38 ` [patch 109/143] mm/util.c: fix typo Andrew Morton
2021-05-05 1:38 ` [patch 110/143] mm/gup: don't pin migrated cma pages in movable zone Andrew Morton
2021-05-05 1:38 ` [patch 111/143] mm/gup: check every subpage of a compound page during isolation Andrew Morton
2021-05-05 1:38 ` [patch 112/143] mm/gup: return an error on migration failure Andrew Morton
2021-05-05 1:38 ` [patch 113/143] mm/gup: check for isolation errors Andrew Morton
2021-05-05 1:38 ` [patch 114/143] mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN Andrew Morton
2021-05-05 1:38 ` [patch 115/143] mm: apply per-task gfp constraints in fast path Andrew Morton
2021-05-05 1:39 ` [patch 116/143] mm: honor PF_MEMALLOC_PIN for all movable pages Andrew Morton
2021-05-05 1:39 ` [patch 117/143] mm/gup: do not migrate zero page Andrew Morton
2021-05-05 1:39 ` [patch 118/143] mm/gup: migrate pinned pages out of movable zone Andrew Morton
2021-05-05 1:39 ` [patch 119/143] memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning Andrew Morton
2021-05-05 1:39 ` [patch 120/143] mm/gup: change index type to long as it counts pages Andrew Morton
2021-05-05 1:39 ` [patch 121/143] mm/gup: longterm pin migration cleanup Andrew Morton
2021-05-05 1:39 ` [patch 122/143] selftests/vm: gup_test: fix test flag Andrew Morton
2021-05-05 1:39 ` [patch 123/143] selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages Andrew Morton
2021-05-05 1:39 ` [patch 124/143] mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove Andrew Morton
2021-05-05 1:39 ` [patch 125/143] drivers/base/memory: introduce memory_block_{online,offline} Andrew Morton
2021-05-05 1:39 ` [patch 126/143] mm,memory_hotplug: relax fully spanned sections check Andrew Morton
2021-05-05 1:39 ` [patch 127/143] mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count() Andrew Morton
2021-05-05 1:39 ` [patch 128/143] mm,memory_hotplug: allocate memmap from the added memory range Andrew Morton
2021-05-05 1:39 ` [patch 129/143] acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported Andrew Morton
2021-05-05 1:39 ` [patch 130/143] mm,memory_hotplug: add kernel boot option to enable memmap_on_memory Andrew Morton
2021-05-05 1:39 ` [patch 131/143] x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE Andrew Morton
2021-05-05 1:39 ` [patch 132/143] arm64/Kconfig: " Andrew Morton
2021-05-05 1:39 ` [patch 133/143] mm/zswap.c: switch from strlcpy to strscpy Andrew Morton
2021-05-05 1:40 ` [patch 134/143] mm/zsmalloc: use BUG_ON instead of if condition followed by BUG Andrew Morton
2021-05-05 1:40 ` [patch 135/143] iov_iter: lift memzero_page() to highmem.h Andrew Morton
2021-05-05 1:40 ` [patch 136/143] btrfs: use memzero_page() instead of open coded kmap pattern Andrew Morton
2021-05-05 1:40 ` [patch 137/143] mm/highmem.c: fix coding style issue Andrew Morton
2021-05-05 1:40 ` [patch 138/143] mm/mempool: minor coding style tweaks Andrew Morton
2021-05-05 1:40 ` [patch 139/143] mm/process_vm_access.c: remove duplicate include Andrew Morton
2021-05-05 1:40 ` [patch 140/143] kfence: zero guard page after out-of-bounds access Andrew Morton
2021-05-05 1:40 ` [patch 141/143] kfence: await for allocation using wait_event Andrew Morton
2021-05-05 1:40 ` [patch 142/143] kfence: maximize allocation wait timeout duration Andrew Morton
2021-05-05 1:40 ` [patch 143/143] kfence: use power-efficient work queue to run delayed work Andrew Morton
2021-05-05 1:47 ` incoming Linus Torvalds
2021-05-05 3:16 ` incoming Andrew Morton
2021-05-05 17:10 ` incoming Linus Torvalds
2021-05-05 17:44 ` incoming Andrew Morton
2021-05-06 3:19 ` incoming Anshuman Khandual
-- strict thread matches above, loose matches on Subject: below --
2022-04-27 19:41 incoming Andrew Morton
2022-04-21 23:35 incoming Andrew Morton
2022-04-15 2:12 incoming Andrew Morton
2022-04-08 20:08 incoming Andrew Morton
2022-04-01 18:27 incoming Andrew Morton
2022-04-01 18:20 incoming Andrew Morton
2022-04-01 18:27 ` incoming Andrew Morton
2022-03-25 1:07 incoming Andrew Morton
2022-03-23 23:04 incoming Andrew Morton
2022-03-22 21:38 incoming Andrew Morton
2022-03-16 23:14 incoming Andrew Morton
2022-03-05 4:28 incoming Andrew Morton
2022-02-26 3:10 incoming Andrew Morton
2022-02-12 0:27 incoming Andrew Morton
2022-02-12 2:02 ` incoming Linus Torvalds
2022-02-12 5:24 ` incoming Andrew Morton
2022-02-04 4:48 incoming Andrew Morton
2022-01-29 21:40 incoming Andrew Morton
2022-01-29 2:13 incoming Andrew Morton
2022-01-29 4:25 ` incoming Matthew Wilcox
2022-01-29 6:23 ` incoming Andrew Morton
2022-01-22 6:10 incoming Andrew Morton
2022-01-20 2:07 incoming Andrew Morton
2022-01-14 22:02 incoming Andrew Morton
2021-12-31 4:12 incoming Andrew Morton
2021-12-25 5:11 incoming Andrew Morton
2021-12-10 22:45 incoming Andrew Morton
2021-11-20 0:42 incoming Andrew Morton
2021-11-11 4:32 incoming Andrew Morton
2021-11-09 2:30 incoming Andrew Morton
2021-11-05 20:34 incoming Andrew Morton
2021-10-28 21:35 incoming Andrew Morton
2021-10-18 22:14 incoming Andrew Morton
2021-09-24 22:42 incoming Andrew Morton
2021-09-10 3:09 incoming Andrew Morton
2021-09-10 17:11 ` incoming Kees Cook
2021-09-10 20:13 ` incoming Kees Cook
2021-09-09 1:08 incoming Andrew Morton
2021-09-08 22:17 incoming Andrew Morton
2021-09-08 2:52 incoming Andrew Morton
2021-09-08 8:57 ` incoming Vlastimil Babka
2021-09-02 21:48 incoming Andrew Morton
2021-09-02 21:49 ` incoming Andrew Morton
2021-08-25 19:17 incoming Andrew Morton
2021-08-20 2:03 incoming Andrew Morton
2021-08-13 23:53 incoming Andrew Morton
2021-07-29 21:52 incoming Andrew Morton
2021-07-23 22:49 incoming Andrew Morton
2021-07-15 4:26 incoming Andrew Morton
2021-07-08 0:59 incoming Andrew Morton
2021-07-01 1:46 incoming Andrew Morton
2021-07-03 0:28 ` incoming Linus Torvalds
2021-07-03 1:06 ` incoming Linus Torvalds
2021-06-29 2:32 incoming Andrew Morton
2021-06-25 1:38 incoming Andrew Morton
2021-06-16 1:22 incoming Andrew Morton
2021-06-05 3:00 incoming Andrew Morton
2021-05-23 0:41 incoming Andrew Morton
2021-05-15 0:26 incoming Andrew Morton
2021-05-07 1:01 incoming Andrew Morton
2021-05-07 7:12 ` incoming Linus Torvalds
2021-04-30 5:52 incoming Andrew Morton
2021-04-23 21:28 incoming Andrew Morton
2021-04-16 22:45 incoming Andrew Morton
2021-04-09 20:26 incoming Andrew Morton
2021-03-25 4:36 incoming Andrew Morton
2021-03-13 5:06 incoming Andrew Morton
2021-02-26 1:14 incoming Andrew Morton
2021-02-26 17:55 ` incoming Linus Torvalds
2021-02-26 19:16 ` incoming Andrew Morton
2021-02-24 19:58 incoming Andrew Morton
2021-02-24 21:30 ` incoming Linus Torvalds
2021-02-24 21:37 ` incoming Linus Torvalds
2021-02-25 8:53 ` incoming Arnd Bergmann
2021-02-25 9:12 ` incoming Andrey Ryabinin
2021-02-25 11:07 ` incoming Walter Wu
2021-02-13 4:52 incoming Andrew Morton
2021-02-09 21:41 incoming Andrew Morton
2021-02-10 19:30 ` incoming Linus Torvalds
2021-02-05 2:31 incoming Andrew Morton
2021-01-24 5:00 incoming Andrew Morton
2021-01-12 23:48 incoming Andrew Morton
2021-01-15 23:32 ` incoming Linus Torvalds
2020-12-29 23:13 incoming Andrew Morton
2020-12-22 19:58 incoming Andrew Morton
2020-12-22 21:43 ` incoming Linus Torvalds
2020-12-18 22:00 incoming Andrew Morton
2020-12-16 4:41 incoming Andrew Morton
2020-12-15 20:32 incoming Andrew Morton
2020-12-15 21:00 ` incoming Linus Torvalds
2020-12-15 22:48 ` incoming Linus Torvalds
2020-12-15 22:49 ` incoming Linus Torvalds
2020-12-15 22:55 ` incoming Andrew Morton
2020-12-15 3:02 incoming Andrew Morton
2020-12-15 3:25 ` incoming Linus Torvalds
2020-12-15 3:30 ` incoming Linus Torvalds
2020-12-15 14:04 ` incoming Konstantin Ryabitsev
2020-12-11 21:35 incoming Andrew Morton
2020-12-06 6:14 incoming Andrew Morton
2020-11-22 6:16 incoming Andrew Morton
2020-11-14 6:51 incoming Andrew Morton
2020-11-02 1:06 incoming Andrew Morton
2020-10-17 23:13 incoming Andrew Morton
2020-10-16 2:40 incoming Andrew Morton
2020-10-16 3:03 ` incoming Andrew Morton
2020-10-13 23:46 incoming Andrew Morton
2020-10-11 6:15 incoming Andrew Morton
2020-10-03 5:20 incoming Andrew Morton
2020-09-26 4:17 incoming Andrew Morton
2020-09-19 4:19 incoming Andrew Morton
2020-09-04 23:34 incoming Andrew Morton
2020-08-21 0:41 incoming Andrew Morton
2020-08-15 0:29 incoming Andrew Morton
2020-08-12 1:29 incoming Andrew Morton
2020-08-07 6:16 incoming Andrew Morton
2020-07-24 4:14 incoming Andrew Morton
2020-07-03 22:14 incoming Andrew Morton
2020-06-26 3:28 incoming Andrew Morton
2020-06-26 6:51 ` incoming Linus Torvalds
2020-06-26 7:31 ` incoming Linus Torvalds
2020-06-26 17:39 ` incoming Konstantin Ryabitsev
2020-06-26 17:40 ` incoming Konstantin Ryabitsev
2020-06-12 0:30 incoming Andrew Morton
2020-06-11 1:40 incoming Andrew Morton
2020-06-09 4:29 incoming Andrew Morton
2020-06-09 16:58 ` incoming Linus Torvalds
2020-06-08 4:35 incoming Andrew Morton
2020-06-04 23:45 incoming Andrew Morton
2020-06-03 22:55 incoming Andrew Morton
2020-06-02 20:09 incoming Andrew Morton
2020-06-02 4:44 incoming Andrew Morton
2020-06-02 20:08 ` incoming Andrew Morton
2020-06-02 20:45 ` incoming Linus Torvalds
2020-06-02 21:38 ` incoming Andrew Morton
2020-06-02 22:18 ` incoming Linus Torvalds
2020-05-28 5:20 incoming Andrew Morton
2020-05-28 20:10 ` incoming Linus Torvalds
2020-05-29 20:31 ` incoming Andrew Morton
2020-05-29 20:38 ` incoming Linus Torvalds
2020-05-29 21:12 ` incoming Andrew Morton
2020-05-29 21:20 ` incoming Linus Torvalds
2020-05-23 5:22 incoming Andrew Morton
2020-05-14 0:50 incoming Andrew Morton
2020-05-08 1:35 incoming Andrew Morton
2020-04-21 1:13 incoming Andrew Morton
2020-04-12 7:41 incoming Andrew Morton
2020-04-10 21:30 incoming Andrew Morton
2020-04-07 3:02 incoming Andrew Morton
2020-04-02 4:01 incoming Andrew Morton
2020-03-29 2:14 incoming Andrew Morton
2020-03-22 1:19 incoming Andrew Morton
2020-03-06 6:27 incoming Andrew Morton
2020-02-21 4:00 incoming Andrew Morton
2020-02-21 4:03 ` incoming Andrew Morton
2020-02-21 18:21 ` incoming Linus Torvalds
2020-02-21 18:32 ` incoming Konstantin Ryabitsev
2020-02-27 9:59 ` incoming Vlastimil Babka
2020-02-21 19:33 ` incoming Linus Torvalds
2020-02-04 1:33 incoming Andrew Morton
2020-02-04 2:27 ` incoming Linus Torvalds
2020-02-04 2:46 ` incoming Andrew Morton
2020-02-04 3:11 ` incoming Linus Torvalds
2020-01-31 6:10 incoming Andrew Morton
2020-01-14 0:28 incoming Andrew Morton
2020-01-04 20:55 incoming Andrew Morton
2019-12-18 4:50 incoming Andrew Morton
2019-12-05 0:48 incoming Andrew Morton
2019-12-01 1:47 incoming Andrew Morton
2019-12-01 5:17 ` incoming James Bottomley
2019-12-01 21:07 ` incoming Linus Torvalds
2019-12-02 8:21 ` incoming Steven Price
2019-11-22 1:53 incoming Andrew Morton
2019-11-16 1:34 incoming Andrew Morton
2019-11-06 5:16 incoming Andrew Morton
2019-10-19 3:19 incoming Andrew Morton
2019-10-14 21:11 incoming Andrew Morton
2019-10-07 0:57 incoming Andrew Morton
2019-09-25 23:45 incoming Andrew Morton
2019-09-23 22:31 incoming Andrew Morton
2019-09-24 0:55 ` incoming Linus Torvalds
2019-09-24 4:31 ` incoming Andrew Morton
2019-09-24 7:48 ` incoming Michal Hocko
2019-09-24 15:34 ` incoming Linus Torvalds
2019-09-25 6:36 ` incoming Michal Hocko
2019-09-24 19:55 ` incoming Vlastimil Babka
2019-08-30 23:04 incoming Andrew Morton
2019-08-25 0:54 incoming Andrew Morton
[not found] <20190716162536.bb52b8f34a8ecf5331a86a42@linux-foundation.org>
2019-07-17 8:47 ` incoming Vlastimil Babka
2019-07-17 8:57 ` incoming Bhaskar Chowdhury
2019-07-17 16:13 ` incoming Linus Torvalds
2019-07-17 17:09 ` incoming Christian Brauner
2019-07-17 18:13 ` incoming Vlastimil Babka
2007-05-02 22:02 incoming Andrew Morton
2007-05-02 22:31 ` incoming Benjamin Herrenschmidt
2007-05-03 7:55 ` incoming Russell King
2007-05-03 8:05 ` incoming Andrew Morton
2007-05-04 13:37 ` incoming Greg KH
2007-05-04 16:14 ` incoming Andrew Morton
2007-05-04 17:02 ` incoming Greg KH
2007-05-04 18:57 ` incoming Roland McGrath
2007-05-04 19:24 ` incoming Greg KH
2007-05-04 19:29 ` incoming Roland McGrath
This is a public inbox, see mirroring instructions
for how to clone and mirror all data and code used for this inbox;
as well as URLs for NNTP newsgroup(s).