* incoming @ 2022-03-25 1:07 Andrew Morton 2022-03-25 1:08 ` [patch 001/114] tools/vm/page_owner_sort.c: sort by stacktrace before culling Andrew Morton ` (112 more replies) 0 siblings, 113 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:07 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches This is the material which was staged after willystuff in linux-next. Everything applied seamlessly on your latest, all looks well. 114 patches, based on 52deda9551a01879b3562e7b41748e85c591f14c. Subsystems affected by this patch series: mm/debug mm/selftests mm/pagecache mm/thp mm/rmap mm/migration mm/kasan mm/hugetlb mm/pagemap mm/madvise selftests Subsystem: mm/debug Sean Anderson <seanga2@gmail.com>: tools/vm/page_owner_sort.c: sort by stacktrace before culling tools/vm/page_owner_sort.c: support sorting by stack trace Yinan Zhang <zhangyinan2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: add switch between culling by stacktrace and txt Chongxi Zhao <zhaochongxi2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: support sorting pid and time Shenghong Han <hanshenghong2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: two trivial fixes Yixuan Cao <caoyixuan2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: delete invalid duplicate code Shenghong Han <hanshenghong2019@email.szu.edu.cn>: Documentation/vm/page_owner.rst: update the documentation Shuah Khan <skhan@linuxfoundation.org>: Documentation/vm/page_owner.rst: fix unexpected indentation warns Waiman Long <longman@redhat.com>: Patch series "mm/page_owner: Extend page_owner to show memcg information", v4: lib/vsprintf: avoid redundant work with 0 size mm/page_owner: use scnprintf() to avoid excessive buffer overrun check mm/page_owner: print memcg information mm/page_owner: record task command name Yixuan Cao <caoyixuan2019@email.szu.edu.cn>: mm/page_owner.c: record tgid tools/vm/page_owner_sort.c: fix the instructions for use Jiajian Ye <yejiajian2018@email.szu.edu.cn>: tools/vm/page_owner_sort.c: fix comments tools/vm/page_owner_sort.c: add a security check tools/vm/page_owner_sort.c: support sorting by tgid and update documentation tools/vm/page_owner_sort: fix three trivival places tools/vm/page_owner_sort: support for sorting by task command name tools/vm/page_owner_sort.c: support for selecting by PID, TGID or task command name tools/vm/page_owner_sort.c: support for user-defined culling rules Christoph Hellwig <hch@lst.de>: mm: unexport page_init_poison Subsystem: mm/selftests "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: selftest/vm: add util.h and and move helper functions there Mike Rapoport <rppt@kernel.org>: selftest/vm: add helpers to detect PAGE_SIZE and PAGE_SHIFT Subsystem: mm/pagecache Hugh Dickins <hughd@google.com>: mm: delete __ClearPageWaiters() mm: filemap_unaccount_folio() large skip mapcount fixup Subsystem: mm/thp Hugh Dickins <hughd@google.com>: mm/thp: fix NR_FILE_MAPPED accounting in page_*_file_rmap() Subsystem: mm/rmap Subsystem: mm/migration Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/migration: Add trace events", v3: mm/migration: add trace events for THP migrations mm/migration: add trace events for base page and HugeTLB migrations Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan, vmalloc, arm64: add vmalloc tagging support for SW/HW_TAGS", v6: kasan, page_alloc: deduplicate should_skip_kasan_poison kasan, page_alloc: move tag_clear_highpage out of kernel_init_free_pages kasan, page_alloc: merge kasan_free_pages into free_pages_prepare kasan, page_alloc: simplify kasan_poison_pages call site kasan, page_alloc: init memory of skipped pages on free kasan: drop skip_kasan_poison variable in free_pages_prepare mm: clarify __GFP_ZEROTAGS comment kasan: only apply __GFP_ZEROTAGS when memory is zeroed kasan, page_alloc: refactor init checks in post_alloc_hook kasan, page_alloc: merge kasan_alloc_pages into post_alloc_hook kasan, page_alloc: combine tag_clear_highpage calls in post_alloc_hook kasan, page_alloc: move SetPageSkipKASanPoison in post_alloc_hook kasan, page_alloc: move kernel_init_free_pages in post_alloc_hook kasan, page_alloc: rework kasan_unpoison_pages call site kasan: clean up metadata byte definitions kasan: define KASAN_VMALLOC_INVALID for SW_TAGS kasan, x86, arm64, s390: rename functions for modules shadow kasan, vmalloc: drop outdated VM_KASAN comment kasan: reorder vmalloc hooks kasan: add wrappers for vmalloc hooks kasan, vmalloc: reset tags in vmalloc functions kasan, fork: reset pointer tags of vmapped stacks kasan, arm64: reset pointer tags of vmapped stacks kasan, vmalloc: add vmalloc tagging for SW_TAGS kasan, vmalloc, arm64: mark vmalloc mappings as pgprot_tagged kasan, vmalloc: unpoison VM_ALLOC pages after mapping kasan, mm: only define ___GFP_SKIP_KASAN_POISON with HW_TAGS kasan, page_alloc: allow skipping unpoisoning for HW_TAGS kasan, page_alloc: allow skipping memory init for HW_TAGS kasan, vmalloc: add vmalloc tagging for HW_TAGS kasan, vmalloc: only tag normal vmalloc allocations kasan, arm64: don't tag executable vmalloc allocations kasan: mark kasan_arg_stacktrace as __initdata kasan: clean up feature flags for HW_TAGS mode kasan: add kasan.vmalloc command line flag kasan: allow enabling KASAN_VMALLOC and SW/HW_TAGS arm64: select KASAN_VMALLOC for SW/HW_TAGS modes kasan: documentation updates kasan: improve vmalloc tests kasan: test: support async (again) and asymm modes for HW_TAGS tangmeng <tangmeng@uniontech.com>: mm/kasan: remove unnecessary CONFIG_KASAN option Peter Collingbourne <pcc@google.com>: kasan: update function name in comments Andrey Konovalov <andreyknvl@google.com>: kasan: print virtual mapping info in reports Patch series "kasan: report clean-ups and improvements": kasan: drop addr check from describe_object_addr kasan: more line breaks in reports kasan: rearrange stack frame info in reports kasan: improve stack frame info in reports kasan: print basic stack frame info for SW_TAGS kasan: simplify async check in end_report() kasan: simplify kasan_update_kunit_status() and call sites kasan: check CONFIG_KASAN_KUNIT_TEST instead of CONFIG_KUNIT kasan: move update_kunit_status to start_report kasan: move disable_trace_on_warning to start_report kasan: split out print_report from __kasan_report kasan: simplify kasan_find_first_bad_addr call sites kasan: restructure kasan_report kasan: merge __kasan_report into kasan_report kasan: call print_report from kasan_report_invalid_free kasan: move and simplify kasan_report_async kasan: rename kasan_access_info to kasan_report_info kasan: add comment about UACCESS regions to kasan_report kasan: respect KASAN_BIT_REPORTED in all reporting routines kasan: reorder reporting functions kasan: move and hide kasan_save_enable/restore_multi_shot kasan: disable LOCKDEP when printing reports Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: Patch series "Add hugetlb MADV_DONTNEED support", v3: mm: enable MADV_DONTNEED for hugetlb mappings selftests/vm: add hugetlb madvise MADV_DONTNEED MADV_REMOVE test userfaultfd/selftests: enable hugetlb remap and remove event testing Miaohe Lin <linmiaohe@huawei.com>: mm/huge_memory: make is_transparent_hugepage() static Subsystem: mm/pagemap David Hildenbrand <david@redhat.com>: Patch series "mm: COW fixes part 1: fix the COW security issue for THP and swap", v3: mm: optimize do_wp_page() for exclusive pages in the swapcache mm: optimize do_wp_page() for fresh pages in local LRU pagevecs mm: slightly clarify KSM logic in do_swap_page() mm: streamline COW logic in do_swap_page() mm/huge_memory: streamline COW logic in do_huge_pmd_wp_page() mm/khugepaged: remove reuse_swap_page() usage mm/swapfile: remove stale reuse_swap_page() mm/huge_memory: remove stale page_trans_huge_mapcount() mm/huge_memory: remove stale locking logic from __split_huge_pmd() Hugh Dickins <hughd@google.com>: mm: warn on deleting redirtied only if accounted mm: unmap_mapping_range_tree() with i_mmap_rwsem shared Anshuman Khandual <anshuman.khandual@arm.com>: mm: generalize ARCH_HAS_FILTER_PGPROT Subsystem: mm/madvise Mauricio Faria de Oliveira <mfo@canonical.com>: mm: fix race between MADV_FREE reclaim and blkdev direct IO read Johannes Weiner <hannes@cmpxchg.org>: mm: madvise: MADV_DONTNEED_LOCKED Subsystem: selftests Muhammad Usama Anjum <usama.anjum@collabora.com>: selftests: vm: remove dependecy from internal kernel macros Kees Cook <keescook@chromium.org>: selftests: kselftest framework: provide "finished" helper Documentation/dev-tools/kasan.rst | 17 Documentation/vm/page_owner.rst | 72 ++ arch/alpha/include/uapi/asm/mman.h | 2 arch/arm64/Kconfig | 2 arch/arm64/include/asm/vmalloc.h | 6 arch/arm64/include/asm/vmap_stack.h | 5 arch/arm64/kernel/module.c | 5 arch/arm64/mm/pageattr.c | 2 arch/arm64/net/bpf_jit_comp.c | 3 arch/mips/include/uapi/asm/mman.h | 2 arch/parisc/include/uapi/asm/mman.h | 2 arch/powerpc/mm/book3s64/trace.c | 1 arch/s390/kernel/module.c | 2 arch/x86/Kconfig | 3 arch/x86/kernel/module.c | 2 arch/x86/mm/init.c | 1 arch/xtensa/include/uapi/asm/mman.h | 2 include/linux/gfp.h | 53 +- include/linux/huge_mm.h | 6 include/linux/kasan.h | 136 +++-- include/linux/mm.h | 5 include/linux/page-flags.h | 2 include/linux/pagemap.h | 3 include/linux/swap.h | 4 include/linux/vmalloc.h | 18 include/trace/events/huge_memory.h | 1 include/trace/events/migrate.h | 31 + include/trace/events/mmflags.h | 18 include/trace/events/thp.h | 27 + include/uapi/asm-generic/mman-common.h | 2 kernel/fork.c | 13 kernel/scs.c | 16 lib/Kconfig.kasan | 18 lib/test_kasan.c | 239 ++++++++- lib/vsprintf.c | 8 mm/Kconfig | 3 mm/debug.c | 1 mm/filemap.c | 63 +- mm/huge_memory.c | 109 ---- mm/kasan/Makefile | 2 mm/kasan/common.c | 4 mm/kasan/hw_tags.c | 243 +++++++--- mm/kasan/kasan.h | 76 ++- mm/kasan/report.c | 516 +++++++++++---------- mm/kasan/report_generic.c | 34 - mm/kasan/report_hw_tags.c | 1 mm/kasan/report_sw_tags.c | 16 mm/kasan/report_tags.c | 2 mm/kasan/shadow.c | 76 +-- mm/khugepaged.c | 11 mm/madvise.c | 57 +- mm/memory.c | 129 +++-- mm/memremap.c | 2 mm/migrate.c | 4 mm/page-writeback.c | 18 mm/page_alloc.c | 270 ++++++----- mm/page_owner.c | 86 ++- mm/rmap.c | 62 +- mm/swap.c | 4 mm/swapfile.c | 104 ---- mm/vmalloc.c | 167 ++++-- tools/testing/selftests/kselftest.h | 10 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 1 tools/testing/selftests/vm/gup_test.c | 3 tools/testing/selftests/vm/hugetlb-madvise.c | 410 ++++++++++++++++ tools/testing/selftests/vm/ksm_tests.c | 38 - tools/testing/selftests/vm/memfd_secret.c | 2 tools/testing/selftests/vm/run_vmtests.sh | 15 tools/testing/selftests/vm/transhuge-stress.c | 41 - tools/testing/selftests/vm/userfaultfd.c | 72 +- tools/testing/selftests/vm/util.h | 75 ++- tools/vm/page_owner_sort.c | 628 +++++++++++++++++++++----- 73 files changed, 2797 insertions(+), 1288 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 001/114] tools/vm/page_owner_sort.c: sort by stacktrace before culling 2022-03-25 1:07 incoming Andrew Morton @ 2022-03-25 1:08 ` Andrew Morton 2022-03-25 1:08 ` [patch 002/114] tools/vm/page_owner_sort.c: support sorting by stack trace Andrew Morton ` (111 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:08 UTC (permalink / raw) To: zhangyinan2019, zhangshengju, weizhenliang, tangbin, sfr, ch0.han, seanga2, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Sean Anderson <seanga2@gmail.com> Subject: tools/vm/page_owner_sort.c: sort by stacktrace before culling The contents of page_owner have changed to include more information than the stack trace. On a modern kernel, the blocks look like Page allocated via order 0, mask 0x0(), pid 1, ts 165564237 ns, free_ts 0 ns register_early_stack+0x4b/0x90 init_page_owner+0x39/0x250 kernel_init_freeable+0x11e/0x242 kernel_init+0x16/0x130 Sorting by the contents of .txt will result in almost no repeated pages, as the pid, ts, and free_ts will almost never be the same. Instead, sort by the contents of the stack trace, which we assume to be whatever is after the first line. [seanga2@gmail.com: fix NULL-pointer dereference when comparing stack traces] Link: https://lkml.kernel.org/r/20211125162653.1855958-1-seanga2@gmail.com Link: https://lkml.kernel.org/r/20211124193709.1805776-1-seanga2@gmail.com Signed-off-by: Sean Anderson <seanga2@gmail.com> Signed-off-by: Sean Anderson <seanga2@gmail.com> Cc: Changhee Han <ch0.han@lge.com> Cc: Tang Bin <tangbin@cmss.chinamobile.com> Cc: Zhang Shengju <zhangshengju@cmss.chinamobile.com> Cc: Zhenliang Wei <weizhenliang@huawei.com> Cc: Stephen Rothwell <sfr@canb.auug.org.au> Cc: Yinan Zhang <zhangyinan2019@email.szu.edu.cn> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/vm/page_owner_sort.c | 10 ++++++---- 1 file changed, 6 insertions(+), 4 deletions(-) --- a/tools/vm/page_owner_sort.c~tools-vm-page_owner_sortc-sort-by-stacktrace-before-culling +++ a/tools/vm/page_owner_sort.c @@ -23,6 +23,7 @@ struct block_list { char *txt; + char *stacktrace; int len; int num; int page_num; @@ -51,11 +52,11 @@ int read_block(char *buf, int buf_size, return -1; /* EOF or no space left in buf. */ } -static int compare_txt(const void *p1, const void *p2) +static int compare_stacktrace(const void *p1, const void *p2) { const struct block_list *l1 = p1, *l2 = p2; - return strcmp(l1->txt, l2->txt); + return strcmp(l1->stacktrace, l2->stacktrace); } static int compare_num(const void *p1, const void *p2) @@ -121,6 +122,7 @@ static void add_list(char *buf, int len) list[list_size].page_num = get_page_num(buf); memcpy(list[list_size].txt, buf, len); list[list_size].txt[len] = 0; + list[list_size].stacktrace = strchr(list[list_size].txt, '\n') ?: ""; list_size++; if (list_size % 1000 == 0) { printf("loaded %d\r", list_size); @@ -199,7 +201,7 @@ int main(int argc, char **argv) printf("sorting ....\n"); - qsort(list, list_size, sizeof(list[0]), compare_txt); + qsort(list, list_size, sizeof(list[0]), compare_stacktrace); list2 = malloc(sizeof(*list) * list_size); if (!list2) { @@ -211,7 +213,7 @@ int main(int argc, char **argv) for (i = count = 0; i < list_size; i++) { if (count == 0 || - strcmp(list2[count-1].txt, list[i].txt) != 0) { + strcmp(list2[count-1].stacktrace, list[i].stacktrace) != 0) { list2[count++] = list[i]; } else { list2[count-1].num += list[i].num; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 002/114] tools/vm/page_owner_sort.c: support sorting by stack trace 2022-03-25 1:07 incoming Andrew Morton 2022-03-25 1:08 ` [patch 001/114] tools/vm/page_owner_sort.c: sort by stacktrace before culling Andrew Morton @ 2022-03-25 1:08 ` Andrew Morton 2022-03-25 1:08 ` [patch 003/114] tools/vm/page_owner_sort.c: add switch between culling by stacktrace and txt Andrew Morton ` (110 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:08 UTC (permalink / raw) To: zhangyinan2019, zhangshengju, weizhenliang, tangbin, sfr, ch0.han, seanga2, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Sean Anderson <seanga2@gmail.com> Subject: tools/vm/page_owner_sort.c: support sorting by stack trace This adds the ability to sort by stacktraces. This is helpful when comparing multiple dumps of page_owner taken at different times, since blocks will not be reordered if they were allocated/free'd. Link: https://lkml.kernel.org/r/20211124193709.1805776-2-seanga2@gmail.com Signed-off-by: Sean Anderson <seanga2@gmail.com> Cc: Zhenliang Wei <weizhenliang@huawei.com> Cc: Changhee Han <ch0.han@lge.com> Cc: Tang Bin <tangbin@cmss.chinamobile.com> Cc: Zhang Shengju <zhangshengju@cmss.chinamobile.com> Cc: Stephen Rothwell <sfr@canb.auug.org.au> Cc: Yinan Zhang <zhangyinan2019@email.szu.edu.cn> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/vm/page_owner_sort.c | 23 ++++++++++++++--------- 1 file changed, 14 insertions(+), 9 deletions(-) --- a/tools/vm/page_owner_sort.c~tools-vm-page_owner_sortc-support-sorting-by-stack-trace +++ a/tools/vm/page_owner_sort.c @@ -29,7 +29,6 @@ struct block_list { int page_num; }; -static int sort_by_memory; static regex_t order_pattern; static struct block_list *list; static int list_size; @@ -134,13 +133,16 @@ static void add_list(char *buf, int len) static void usage(void) { - printf("Usage: ./page_owner_sort [-m] <input> <output>\n" - "-m Sort by total memory. If this option is unset, sort by times\n" + printf("Usage: ./page_owner_sort [OPTIONS] <input> <output>\n" + "-m Sort by total memory.\n" + "-s Sort by the stack trace.\n" + "-t Sort by times (default).\n" ); } int main(int argc, char **argv) { + int (*cmp)(const void *, const void *) = compare_num; FILE *fin, *fout; char *buf; int ret, i, count; @@ -149,10 +151,16 @@ int main(int argc, char **argv) int err; int opt; - while ((opt = getopt(argc, argv, "m")) != -1) + while ((opt = getopt(argc, argv, "mst")) != -1) switch (opt) { case 'm': - sort_by_memory = 1; + cmp = compare_page_num; + break; + case 's': + cmp = compare_stacktrace; + break; + case 't': + cmp = compare_num; break; default: usage(); @@ -221,10 +229,7 @@ int main(int argc, char **argv) } } - if (sort_by_memory) - qsort(list2, count, sizeof(list[0]), compare_page_num); - else - qsort(list2, count, sizeof(list[0]), compare_num); + qsort(list2, count, sizeof(list[0]), cmp); for (i = 0; i < count; i++) fprintf(fout, "%d times, %d pages:\n%s\n", _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 003/114] tools/vm/page_owner_sort.c: add switch between culling by stacktrace and txt 2022-03-25 1:07 incoming Andrew Morton 2022-03-25 1:08 ` [patch 001/114] tools/vm/page_owner_sort.c: sort by stacktrace before culling Andrew Morton 2022-03-25 1:08 ` [patch 002/114] tools/vm/page_owner_sort.c: support sorting by stack trace Andrew Morton @ 2022-03-25 1:08 ` Andrew Morton 2022-03-25 1:08 ` [patch 004/114] tools/vm/page_owner_sort.c: support sorting pid and time Andrew Morton ` (109 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:08 UTC (permalink / raw) To: zhangshengju, weizhenliang, tangbin, sfr, seanga2, ch0.han, zhangyinan2019, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Yinan Zhang <zhangyinan2019@email.szu.edu.cn> Subject: tools/vm/page_owner_sort.c: add switch between culling by stacktrace and txt Culling by comparing stacktrace would casue loss of some information. For example, if there exists 2 blocks which have the same stacktrace and the different head info Page allocated via order 0, mask 0x108c48(...), pid 73696, ts 1578829190639010 ns, free_ts 1576583851324450 ns prep_new_page+0x80/0xb8 get_page_from_freelist+0x924/0xee8 __alloc_pages+0x138/0xc18 alloc_pages+0x80/0xf0 __page_cache_alloc+0x90/0xc8 Page allocated via order 0, mask 0x108c48(...), pid 61806, ts 1354113726046100 ns, free_ts 1354104926841400 ns prep_new_page+0x80/0xb8 get_page_from_freelist+0x924/0xee8 __alloc_pages+0x138/0xc18 alloc_pages+0x80/0xf0 __page_cache_alloc+0x90/0xc8 After culling, it would be like this 2 times, 2 pages: Page allocated via order 0, mask 0x108c48(...), pid 73696, ts 1578829190639010 ns, free_ts 1576583851324450 ns prep_new_page+0x80/0xb8 get_page_from_freelist+0x924/0xee8 __alloc_pages+0x138/0xc18 alloc_pages+0x80/0xf0 __page_cache_alloc+0x90/0xc8 The info of second block missed. So, add -c to turn on culling by stacktrace. By default, it will cull by txt. Link: https://lkml.kernel.org/r/20211129145658.2491-1-zhangyinan2019@email.szu.edu.cn Signed-off-by: Yinan Zhang <zhangyinan2019@email.szu.edu.cn> Cc: Changhee Han <ch0.han@lge.com> Cc: Sean Anderson <seanga2@gmail.com> Cc: Stephen Rothwell <sfr@canb.auug.org.au> Cc: Tang Bin <tangbin@cmss.chinamobile.com> Cc: Zhang Shengju <zhangshengju@cmss.chinamobile.com> Cc: Zhenliang Wei <weizhenliang@huawei.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/vm/page_owner_sort.c | 23 ++++++++++++++++++++--- 1 file changed, 20 insertions(+), 3 deletions(-) --- a/tools/vm/page_owner_sort.c~tools-vm-page_owner_sortc-add-switch-between-culling-by-stacktrace-and-txt +++ a/tools/vm/page_owner_sort.c @@ -51,6 +51,13 @@ int read_block(char *buf, int buf_size, return -1; /* EOF or no space left in buf. */ } +static int compare_txt(const void *p1, const void *p2) +{ + const struct block_list *l1 = p1, *l2 = p2; + + return strcmp(l1->txt, l2->txt); +} + static int compare_stacktrace(const void *p1, const void *p2) { const struct block_list *l1 = p1, *l2 = p2; @@ -137,12 +144,14 @@ static void usage(void) "-m Sort by total memory.\n" "-s Sort by the stack trace.\n" "-t Sort by times (default).\n" + "-c cull by comparing stacktrace instead of total block.\n" ); } int main(int argc, char **argv) { int (*cmp)(const void *, const void *) = compare_num; + int cull_st = 0; FILE *fin, *fout; char *buf; int ret, i, count; @@ -151,7 +160,7 @@ int main(int argc, char **argv) int err; int opt; - while ((opt = getopt(argc, argv, "mst")) != -1) + while ((opt = getopt(argc, argv, "mstc")) != -1) switch (opt) { case 'm': cmp = compare_page_num; @@ -162,6 +171,9 @@ int main(int argc, char **argv) case 't': cmp = compare_num; break; + case 'c': + cull_st = 1; + break; default: usage(); exit(1); @@ -209,7 +221,10 @@ int main(int argc, char **argv) printf("sorting ....\n"); - qsort(list, list_size, sizeof(list[0]), compare_stacktrace); + if (cull_st == 1) + qsort(list, list_size, sizeof(list[0]), compare_stacktrace); + else + qsort(list, list_size, sizeof(list[0]), compare_txt); list2 = malloc(sizeof(*list) * list_size); if (!list2) { @@ -219,9 +234,11 @@ int main(int argc, char **argv) printf("culling\n"); + long offset = cull_st ? &list[0].stacktrace - &list[0].txt : 0; + for (i = count = 0; i < list_size; i++) { if (count == 0 || - strcmp(list2[count-1].stacktrace, list[i].stacktrace) != 0) { + strcmp(*(&list2[count-1].txt+offset), *(&list[i].txt+offset)) != 0) { list2[count++] = list[i]; } else { list2[count-1].num += list[i].num; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 004/114] tools/vm/page_owner_sort.c: support sorting pid and time 2022-03-25 1:07 incoming Andrew Morton ` (2 preceding siblings ...) 2022-03-25 1:08 ` [patch 003/114] tools/vm/page_owner_sort.c: add switch between culling by stacktrace and txt Andrew Morton @ 2022-03-25 1:08 ` Andrew Morton 2022-03-25 1:08 ` [patch 005/114] tools/vm/page_owner_sort.c: two trivial fixes Andrew Morton ` (108 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:08 UTC (permalink / raw) To: seanga2, zhaochongxi2019, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Chongxi Zhao <zhaochongxi2019@email.szu.edu.cn> Subject: tools/vm/page_owner_sort.c: support sorting pid and time When viewing the page owner information, we expect that the information can be sorted by PID, so that we can quickly combine PID with the program to check the information together. We also expect that the information can be sorted by time. Time sorting helps to view the running status of the program according to the time interval when the program hangs up. Finally, we hope to pass the page_ owner_ Sort. C can reduce part of the output and only output the plate information whose memory has not been released, which can make us locate the problem of the program faster. Therefore, the following adjustments have been made: 1. Add the static functions search_pattern and check_regcomp to improve the cleanliness. 2. Add member attributes and their corresponding sorting methods. In terms of comparison time, int will overflow because the data of ull is too large, so the ternary operator is used 3. Add the -f parameter to filter out the information of blocks whose memory has not been released Link: https://lkml.kernel.org/r/20211206165653.5093-1-zhaochongxi2019@email.szu.edu.cn Signed-off-by: Chongxi Zhao <zhaochongxi2019@email.szu.edu.cn> Reviewed-by: Sean Anderson <seanga2@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/vm/page_owner_sort.c | 177 +++++++++++++++++++++++++++++------ 1 file changed, 148 insertions(+), 29 deletions(-) --- a/tools/vm/page_owner_sort.c~tools-vm-page_owner_sortc-support-sorting-pid-and-time +++ a/tools/vm/page_owner_sort.c @@ -20,6 +20,7 @@ #include <string.h> #include <regex.h> #include <errno.h> +#include <linux/types.h> struct block_list { char *txt; @@ -27,9 +28,15 @@ struct block_list { int len; int num; int page_num; + pid_t pid; + __u64 ts_nsec; + __u64 free_ts_nsec; }; static regex_t order_pattern; +static regex_t pid_pattern; +static regex_t ts_nsec_pattern; +static regex_t free_ts_nsec_pattern; static struct block_list *list; static int list_size; static int max_size; @@ -79,34 +86,124 @@ static int compare_page_num(const void * return l2->page_num - l1->page_num; } -static int get_page_num(char *buf) +static int compare_pid(const void *p1, const void *p2) { - int err, val_len, order_val; - char order_str[4] = {0}; - char *endptr; + const struct block_list *l1 = p1, *l2 = p2; + + return l1->pid - l2->pid; +} + +static int compare_ts(const void *p1, const void *p2) +{ + const struct block_list *l1 = p1, *l2 = p2; + + return l1->ts_nsec < l2->ts_nsec ? -1 : 1; +} + +static int compare_free_ts(const void *p1, const void *p2) +{ + const struct block_list *l1 = p1, *l2 = p2; + + return l1->free_ts_nsec < l2->free_ts_nsec ? -1 : 1; +} + +static int search_pattern(regex_t *pattern, char *pattern_str, char *buf) +{ + int err, val_len; regmatch_t pmatch[2]; - err = regexec(&order_pattern, buf, 2, pmatch, REG_NOTBOL); + err = regexec(pattern, buf, 2, pmatch, REG_NOTBOL); if (err != 0 || pmatch[1].rm_so == -1) { - printf("no order pattern in %s\n", buf); - return 0; + printf("no matching pattern in %s\n", buf); + return -1; } val_len = pmatch[1].rm_eo - pmatch[1].rm_so; - if (val_len > 2) /* max_order should not exceed 2 digits */ - goto wrong_order; - memcpy(order_str, buf + pmatch[1].rm_so, val_len); + memcpy(pattern_str, buf + pmatch[1].rm_so, val_len); + + return 0; +} + +static void check_regcomp(regex_t *pattern, const char *regex) +{ + int err; + + err = regcomp(pattern, regex, REG_EXTENDED | REG_NEWLINE); + if (err != 0 || pattern->re_nsub != 1) { + printf("Invalid pattern %s code %d\n", regex, err); + exit(1); + } +} + +# define FIELD_BUFF 25 + +static int get_page_num(char *buf) +{ + int order_val; + char order_str[FIELD_BUFF] = {0}; + char *endptr; + search_pattern(&order_pattern, order_str, buf); errno = 0; order_val = strtol(order_str, &endptr, 10); - if (errno != 0 || endptr == order_str || *endptr != '\0') - goto wrong_order; + if (order_val > 64 || errno != 0 || endptr == order_str || *endptr != '\0') { + printf("wrong order in follow buf:\n%s\n", buf); + return 0; + } return 1 << order_val; +} -wrong_order: - printf("wrong order in follow buf:\n%s\n", buf); - return 0; +static pid_t get_pid(char *buf) +{ + pid_t pid; + char pid_str[FIELD_BUFF] = {0}; + char *endptr; + + search_pattern(&pid_pattern, pid_str, buf); + errno = 0; + pid = strtol(pid_str, &endptr, 10); + if (errno != 0 || endptr == pid_str || *endptr != '\0') { + printf("wrong/invalid pid in follow buf:\n%s\n", buf); + return -1; + } + + return pid; + +} + +static __u64 get_ts_nsec(char *buf) +{ + __u64 ts_nsec; + char ts_nsec_str[FIELD_BUFF] = {0}; + char *endptr; + + search_pattern(&ts_nsec_pattern, ts_nsec_str, buf); + errno = 0; + ts_nsec = strtoull(ts_nsec_str, &endptr, 10); + if (errno != 0 || endptr == ts_nsec_str || *endptr != '\0') { + printf("wrong ts_nsec in follow buf:\n%s\n", buf); + return -1; + } + + return ts_nsec; +} + +static __u64 get_free_ts_nsec(char *buf) +{ + __u64 free_ts_nsec; + char free_ts_nsec_str[FIELD_BUFF] = {0}; + char *endptr; + + search_pattern(&free_ts_nsec_pattern, free_ts_nsec_str, buf); + errno = 0; + free_ts_nsec = strtoull(free_ts_nsec_str, &endptr, 10); + if (errno != 0 || endptr == free_ts_nsec_str || *endptr != '\0') { + printf("wrong free_ts_nsec in follow buf:\n%s\n", buf); + return -1; + } + + return free_ts_nsec; } static void add_list(char *buf, int len) @@ -129,6 +226,11 @@ static void add_list(char *buf, int len) memcpy(list[list_size].txt, buf, len); list[list_size].txt[len] = 0; list[list_size].stacktrace = strchr(list[list_size].txt, '\n') ?: ""; + list[list_size].pid = get_pid(buf); + list[list_size].ts_nsec = get_ts_nsec(buf); + list[list_size].free_ts_nsec = get_free_ts_nsec(buf); + memcpy(list[list_size].txt, buf, len); + list[list_size].txt[len] = 0; list_size++; if (list_size % 1000 == 0) { printf("loaded %d\r", list_size); @@ -144,6 +246,9 @@ static void usage(void) "-m Sort by total memory.\n" "-s Sort by the stack trace.\n" "-t Sort by times (default).\n" + "-p Sort by pid.\n" + "-a Sort by memory allocate time.\n" + "-r Sort by memory release time.\n" "-c cull by comparing stacktrace instead of total block.\n" ); } @@ -152,28 +257,40 @@ int main(int argc, char **argv) { int (*cmp)(const void *, const void *) = compare_num; int cull_st = 0; + int filter = 0; FILE *fin, *fout; char *buf; int ret, i, count; struct block_list *list2; struct stat st; - int err; int opt; - while ((opt = getopt(argc, argv, "mstc")) != -1) + while ((opt = getopt(argc, argv, "acfmprst")) != -1) switch (opt) { + case 'a': + cmp = compare_ts; + break; + case 'c': + cull_st = 1; + break; + case 'f': + filter = 1; + break; case 'm': cmp = compare_page_num; break; + case 'p': + cmp = compare_pid; + break; + case 'r': + cmp = compare_free_ts; + break; case 's': cmp = compare_stacktrace; break; case 't': cmp = compare_num; break; - case 'c': - cull_st = 1; - break; default: usage(); exit(1); @@ -192,13 +309,10 @@ int main(int argc, char **argv) exit(1); } - err = regcomp(&order_pattern, "order\\s*([0-9]*),", REG_EXTENDED|REG_NEWLINE); - if (err != 0 || order_pattern.re_nsub != 1) { - printf("%s: Invalid pattern 'order\\s*([0-9]*),' code %d\n", - argv[0], err); - exit(1); - } - + check_regcomp(&order_pattern, "order\\s*([0-9]*),"); + check_regcomp(&pid_pattern, "pid\\s*([0-9]*),"); + check_regcomp(&ts_nsec_pattern, "ts\\s*([0-9]*)\\s*ns,"); + check_regcomp(&free_ts_nsec_pattern, "free_ts\\s*([0-9]*)\\s*ns"); fstat(fileno(fin), &st); max_size = st.st_size / 100; /* hack ... */ @@ -248,10 +362,15 @@ int main(int argc, char **argv) qsort(list2, count, sizeof(list[0]), cmp); - for (i = 0; i < count; i++) + for (i = 0; i < count; i++) { + if (filter == 1 && list2[i].free_ts_nsec != 0) + continue; fprintf(fout, "%d times, %d pages:\n%s\n", list2[i].num, list2[i].page_num, list2[i].txt); - + } regfree(&order_pattern); + regfree(&pid_pattern); + regfree(&ts_nsec_pattern); + regfree(&free_ts_nsec_pattern); return 0; } _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 005/114] tools/vm/page_owner_sort.c: two trivial fixes 2022-03-25 1:07 incoming Andrew Morton ` (3 preceding siblings ...) 2022-03-25 1:08 ` [patch 004/114] tools/vm/page_owner_sort.c: support sorting pid and time Andrew Morton @ 2022-03-25 1:08 ` Andrew Morton 2022-03-25 1:08 ` [patch 006/114] tools/vm/page_owner_sort.c: delete invalid duplicate code Andrew Morton ` (107 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:08 UTC (permalink / raw) To: hanshenghong2019, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Shenghong Han <hanshenghong2019@email.szu.edu.cn> Subject: tools/vm/page_owner_sort.c: two trivial fixes 1) There is an unused variable. It's better to delete it. 2) One case is missing in the usage(). Link: https://lkml.kernel.org/r/20211213164518.2461-1-hanshenghong2019@email.szu.edu.cn Signed-off-by: Shenghong Han <hanshenghong2019@email.szu.edu.cn> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/vm/page_owner_sort.c | 5 ++--- 1 file changed, 2 insertions(+), 3 deletions(-) --- a/tools/vm/page_owner_sort.c~tools-vm-page_owner_sortc-two-trivial-fixes +++ a/tools/vm/page_owner_sort.c @@ -41,8 +41,6 @@ static struct block_list *list; static int list_size; static int max_size; -struct block_list *block_head; - int read_block(char *buf, int buf_size, FILE *fin) { char *curr = buf, *const buf_end = buf + buf_size; @@ -249,7 +247,8 @@ static void usage(void) "-p Sort by pid.\n" "-a Sort by memory allocate time.\n" "-r Sort by memory release time.\n" - "-c cull by comparing stacktrace instead of total block.\n" + "-c Cull by comparing stacktrace instead of total block.\n" + "-f Filter out the information of blocks whose memory has not been released.\n" ); } _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 006/114] tools/vm/page_owner_sort.c: delete invalid duplicate code 2022-03-25 1:07 incoming Andrew Morton ` (4 preceding siblings ...) 2022-03-25 1:08 ` [patch 005/114] tools/vm/page_owner_sort.c: two trivial fixes Andrew Morton @ 2022-03-25 1:08 ` Andrew Morton 2022-03-25 1:08 ` [patch 007/114] Documentation/vm/page_owner.rst: update the documentation Andrew Morton ` (106 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:08 UTC (permalink / raw) To: zhangyinan2019, weizhenliang, tangbin, seanga2, broonie, caoyixuan2019, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Yixuan Cao <caoyixuan2019@email.szu.edu.cn> Subject: tools/vm/page_owner_sort.c: delete invalid duplicate code I noticed that there is two invalid lines of duplicate code. It's better to delete it. Link: https://lkml.kernel.org/r/20211213095743.3630-1-caoyixuan2019@email.szu.edu.cn Signed-off-by: Yixuan Cao <caoyixuan2019@email.szu.edu.cn> Cc: Mark Brown <broonie@kernel.org> Cc: Sean Anderson <seanga2@gmail.com> Cc: Zhenliang Wei <weizhenliang@huawei.com> Cc: Tang Bin <tangbin@cmss.chinamobile.com> Cc: Yinan Zhang <zhangyinan2019@email.szu.edu.cn> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/vm/page_owner_sort.c | 2 -- 1 file changed, 2 deletions(-) --- a/tools/vm/page_owner_sort.c~tools-vm-page_owner_sortc-delete-invalid-duplicate-code +++ a/tools/vm/page_owner_sort.c @@ -227,8 +227,6 @@ static void add_list(char *buf, int len) list[list_size].pid = get_pid(buf); list[list_size].ts_nsec = get_ts_nsec(buf); list[list_size].free_ts_nsec = get_free_ts_nsec(buf); - memcpy(list[list_size].txt, buf, len); - list[list_size].txt[len] = 0; list_size++; if (list_size % 1000 == 0) { printf("loaded %d\r", list_size); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 007/114] Documentation/vm/page_owner.rst: update the documentation 2022-03-25 1:07 incoming Andrew Morton ` (5 preceding siblings ...) 2022-03-25 1:08 ` [patch 006/114] tools/vm/page_owner_sort.c: delete invalid duplicate code Andrew Morton @ 2022-03-25 1:08 ` Andrew Morton 2022-03-25 1:08 ` [patch 008/114] Documentation/vm/page_owner.rst: fix unexpected indentation warns Andrew Morton ` (105 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:08 UTC (permalink / raw) To: zhangshengju, weizhenliang, vbabka, tangbin, nixiaoming, lmark, georgi.djakov, corbet, hanshenghong2019, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Shenghong Han <hanshenghong2019@email.szu.edu.cn> Subject: Documentation/vm/page_owner.rst: update the documentation Update the documentation of ``page_owner``. [akpm@linux-foundation.org: small grammatical tweaks] Link: https://lkml.kernel.org/r/20211214134736.2569-1-hanshenghong2019@email.szu.edu.cn Signed-off-by: Shenghong Han <hanshenghong2019@email.szu.edu.cn> Cc: Jonathan Corbet <corbet@lwn.net> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Georgi Djakov <georgi.djakov@linaro.org> Cc: Liam Mark <lmark@codeaurora.org> Cc: Tang Bin <tangbin@cmss.chinamobile.com> Cc: Zhang Shengju <zhangshengju@cmss.chinamobile.com> Cc: Zhenliang Wei <weizhenliang@huawei.com> Cc: Xiaoming Ni <nixiaoming@huawei.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/vm/page_owner.rst | 23 +++++++++++++++++++++-- 1 file changed, 21 insertions(+), 2 deletions(-) --- a/Documentation/vm/page_owner.rst~documentation-vm-page_ownerrst-update-the-documentation +++ a/Documentation/vm/page_owner.rst @@ -97,7 +97,7 @@ Usage The ``page_owner_sort`` tool ignores ``PFN`` rows, puts the remaining rows in buf, uses regexp to extract the page order value, counts the times - and pages of buf, and finally sorts them according to the times. + and pages of buf, and finally sorts them according to the parameter(s). See the result about who allocated each page in the ``sorted_page_owner.txt``. General output:: @@ -107,4 +107,23 @@ Usage // Detailed stack By default, ``page_owner_sort`` is sorted according to the times of buf. - If you want to sort by the pages nums of buf, use the ``-m`` parameter. + If you want to sort by the page nums of buf, use the ``-m`` parameter. + The detailed parameters are: + + fundamental function: + + Sort: + -a Sort by memory allocation time. + -m Sort by total memory. + -p Sort by pid. + -r Sort by memory release time. + -s Sort by stack trace. + -t Sort by times (default). + + additional function: + + Cull: + -c Cull by comparing stacktrace instead of total block. + + Filter: + -f Filter out the information of blocks whose memory has not been released. _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 008/114] Documentation/vm/page_owner.rst: fix unexpected indentation warns 2022-03-25 1:07 incoming Andrew Morton ` (6 preceding siblings ...) 2022-03-25 1:08 ` [patch 007/114] Documentation/vm/page_owner.rst: update the documentation Andrew Morton @ 2022-03-25 1:08 ` Andrew Morton 2022-03-25 1:09 ` [patch 009/114] lib/vsprintf: avoid redundant work with 0 size Andrew Morton ` (104 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:08 UTC (permalink / raw) To: corbet, skhan, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Shuah Khan <skhan@linuxfoundation.org> Subject: Documentation/vm/page_owner.rst: fix unexpected indentation warns Fix Unexpected indentation warns in page_owner: Documentation/vm/page_owner.rst:92: WARNING: Unexpected indentation. Documentation/vm/page_owner.rst:96: WARNING: Unexpected indentation. Documentation/vm/page_owner.rst:107: WARNING: Unexpected indentation. Link: https://lkml.kernel.org/r/20211215001929.47866-1-skhan@linuxfoundation.org Signed-off-by: Shuah Khan <skhan@linuxfoundation.org> Cc: Jonathan Corbet <corbet@lwn.net> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/vm/page_owner.rst | 6 +++--- 1 file changed, 3 insertions(+), 3 deletions(-) --- a/Documentation/vm/page_owner.rst~docs-vm-fix-unexpected-indentation-warns-in-page_owner +++ a/Documentation/vm/page_owner.rst @@ -89,11 +89,11 @@ Usage Page allocated via order XXX, ... PFN XXX ... - // Detailed stack + // Detailed stack Page allocated via order XXX, ... PFN XXX ... - // Detailed stack + // Detailed stack The ``page_owner_sort`` tool ignores ``PFN`` rows, puts the remaining rows in buf, uses regexp to extract the page order value, counts the times @@ -104,7 +104,7 @@ Usage XXX times, XXX pages: Page allocated via order XXX, ... - // Detailed stack + // Detailed stack By default, ``page_owner_sort`` is sorted according to the times of buf. If you want to sort by the page nums of buf, use the ``-m`` parameter. _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 009/114] lib/vsprintf: avoid redundant work with 0 size 2022-03-25 1:07 incoming Andrew Morton ` (7 preceding siblings ...) 2022-03-25 1:08 ` [patch 008/114] Documentation/vm/page_owner.rst: fix unexpected indentation warns Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 010/114] mm/page_owner: use scnprintf() to avoid excessive buffer overrun check Andrew Morton ` (103 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: vdavydov.dev, senozhatsky, rppt, rostedt, roman.gushchin, rientjes, pmladek, mhocko, linux, ira.weiny, hannes, guro, aquini, andriy.shevchenko, longman, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Waiman Long <longman@redhat.com> Subject: lib/vsprintf: avoid redundant work with 0 size Patch series "mm/page_owner: Extend page_owner to show memcg information", v4. While debugging the constant increase in percpu memory consumption on a system that spawned large number of containers, it was found that a lot of offline mem_cgroup structures remained in place without being freed. Further investigation indicated that those mem_cgroup structures were pinned by some pages. In order to find out what those pages are, the existing page_owner debugging tool is extended to show memory cgroup information and whether those memcgs are offline or not. With the enhanced page_owner tool, the following is a typical page that pinned the mem_cgroup structure in my test case: Page allocated via order 0, mask 0x1100cca(GFP_HIGHUSER_MOVABLE), pid 162970 (podman), ts 1097761405537 ns, free_ts 1097760838089 ns PFN 1925700 type Movable Block 3761 type Movable Flags 0x17ffffc00c001c(uptodate|dirty|lru|reclaim|swapbacked|node=0|zone=2|lastcpupid=0x1fffff) prep_new_page+0xac/0xe0 get_page_from_freelist+0x1327/0x14d0 __alloc_pages+0x191/0x340 alloc_pages_vma+0x84/0x250 shmem_alloc_page+0x3f/0x90 shmem_alloc_and_acct_page+0x76/0x1c0 shmem_getpage_gfp+0x281/0x940 shmem_write_begin+0x36/0xe0 generic_perform_write+0xed/0x1d0 __generic_file_write_iter+0xdc/0x1b0 generic_file_write_iter+0x5d/0xb0 new_sync_write+0x11f/0x1b0 vfs_write+0x1ba/0x2a0 ksys_write+0x59/0xd0 do_syscall_64+0x37/0x80 entry_SYSCALL_64_after_hwframe+0x44/0xae Charged to offline memcg libpod-conmon-15e4f9c758422306b73b2dd99f9d50a5ea53cbb16b4a13a2c2308a4253cc0ec8. So the page was not freed because it was part of a shmem segment. That is useful information that can help users to diagnose similar problems. With cgroup v1, /proc/cgroups can be read to find out the total number of memory cgroups (online + offline). With cgroup v2, the cgroup.stat of the root cgroup can be read to find the number of dying cgroups (most likely pinned by dying memcgs). The page_owner feature is not supposed to be enabled for production system due to its memory overhead. However, if it is suspected that dying memcgs are increasing over time, a test environment with page_owner enabled can then be set up with appropriate workload for further analysis on what may be causing the increasing number of dying memcgs. This patch (of 4): For *scnprintf(), vsnprintf() is always called even if the input size is 0. That is a waste of time, so just return 0 in this case. Note that vsnprintf() will never return -1 to indicate an error. So skipping the call to vsnprintf() when size is 0 will have no functional impact at all. Link: https://lkml.kernel.org/r/20220202203036.744010-1-longman@redhat.com Link: https://lkml.kernel.org/r/20220202203036.744010-2-longman@redhat.com Signed-off-by: Waiman Long <longman@redhat.com> Acked-by: David Rientjes <rientjes@google.com> Reviewed-by: Sergey Senozhatsky <senozhatsky@chromium.org> Acked-by: Roman Gushchin <guro@fb.com> Acked-by: Rafael Aquini <aquini@redhat.com> Acked-by: Mike Rapoport <rppt@linux.ibm.com> Cc: Roman Gushchin <roman.gushchin@linux.dev> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Vladimir Davydov <vdavydov.dev@gmail.com> Cc: Petr Mladek <pmladek@suse.com> Cc: Steven Rostedt (Google) <rostedt@goodmis.org> Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com> Cc: Rasmus Villemoes <linux@rasmusvillemoes.dk> Cc: Ira Weiny <ira.weiny@intel.com> Cc: David Rientjes <rientjes@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- lib/vsprintf.c | 8 +++++--- 1 file changed, 5 insertions(+), 3 deletions(-) --- a/lib/vsprintf.c~lib-vsprintf-avoid-redundant-work-with-0-size +++ a/lib/vsprintf.c @@ -2906,13 +2906,15 @@ int vscnprintf(char *buf, size_t size, c { int i; + if (unlikely(!size)) + return 0; + i = vsnprintf(buf, size, fmt, args); if (likely(i < size)) return i; - if (size != 0) - return size - 1; - return 0; + + return size - 1; } EXPORT_SYMBOL(vscnprintf); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 010/114] mm/page_owner: use scnprintf() to avoid excessive buffer overrun check 2022-03-25 1:07 incoming Andrew Morton ` (8 preceding siblings ...) 2022-03-25 1:09 ` [patch 009/114] lib/vsprintf: avoid redundant work with 0 size Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 011/114] mm/page_owner: print memcg information Andrew Morton ` (102 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: vdavydov.dev, senozhatsky, rppt, rostedt, roman.gushchin, rientjes, pmladek, mhocko, linux, ira.weiny, hannes, aquini, andriy.shevchenko, longman, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Waiman Long <longman@redhat.com> Subject: mm/page_owner: use scnprintf() to avoid excessive buffer overrun check The snprintf() function can return a length greater than the given input size. That will require a check for buffer overrun after each invocation of snprintf(). scnprintf(), on the other hand, will never return a greater length. By using scnprintf() in selected places, we can avoid some buffer overrun checks except after stack_depot_snprint() and after the last snprintf(). Link: https://lkml.kernel.org/r/20220202203036.744010-3-longman@redhat.com Signed-off-by: Waiman Long <longman@redhat.com> Acked-by: David Rientjes <rientjes@google.com> Reviewed-by: Sergey Senozhatsky <senozhatsky@chromium.org> Acked-by: Rafael Aquini <aquini@redhat.com> Acked-by: Mike Rapoport <rppt@linux.ibm.com> Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Petr Mladek <pmladek@suse.com> Cc: Rasmus Villemoes <linux@rasmusvillemoes.dk> Cc: Roman Gushchin <roman.gushchin@linux.dev> Cc: Steven Rostedt (Google) <rostedt@goodmis.org> Cc: Vladimir Davydov <vdavydov.dev@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_owner.c | 14 +++----------- 1 file changed, 3 insertions(+), 11 deletions(-) --- a/mm/page_owner.c~mm-page_owner-use-scnprintf-to-avoid-excessive-buffer-overrun-check +++ a/mm/page_owner.c @@ -338,19 +338,16 @@ print_page_owner(char __user *buf, size_ if (!kbuf) return -ENOMEM; - ret = snprintf(kbuf, count, + ret = scnprintf(kbuf, count, "Page allocated via order %u, mask %#x(%pGg), pid %d, ts %llu ns, free_ts %llu ns\n", page_owner->order, page_owner->gfp_mask, &page_owner->gfp_mask, page_owner->pid, page_owner->ts_nsec, page_owner->free_ts_nsec); - if (ret >= count) - goto err; - /* Print information relevant to grouping pages by mobility */ pageblock_mt = get_pageblock_migratetype(page); page_mt = gfp_migratetype(page_owner->gfp_mask); - ret += snprintf(kbuf + ret, count - ret, + ret += scnprintf(kbuf + ret, count - ret, "PFN %lu type %s Block %lu type %s Flags %pGp\n", pfn, migratetype_names[page_mt], @@ -358,19 +355,14 @@ print_page_owner(char __user *buf, size_ migratetype_names[pageblock_mt], &page->flags); - if (ret >= count) - goto err; - ret += stack_depot_snprint(handle, kbuf + ret, count - ret, 0); if (ret >= count) goto err; if (page_owner->last_migrate_reason != -1) { - ret += snprintf(kbuf + ret, count - ret, + ret += scnprintf(kbuf + ret, count - ret, "Page has been migrated, last migrate reason: %s\n", migrate_reason_names[page_owner->last_migrate_reason]); - if (ret >= count) - goto err; } ret += snprintf(kbuf + ret, count - ret, "\n"); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 011/114] mm/page_owner: print memcg information 2022-03-25 1:07 incoming Andrew Morton ` (9 preceding siblings ...) 2022-03-25 1:09 ` [patch 010/114] mm/page_owner: use scnprintf() to avoid excessive buffer overrun check Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 012/114] mm/page_owner: record task command name Andrew Morton ` (101 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: vdavydov.dev, senozhatsky, rppt, rostedt, roman.gushchin, rientjes, pmladek, mhocko, linux, ira.weiny, hannes, guro, aquini, andriy.shevchenko, longman, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Waiman Long <longman@redhat.com> Subject: mm/page_owner: print memcg information It was found that a number of offline memcgs were not freed because they were pinned by some charged pages that were present. Even "echo 1 > /proc/sys/vm/drop_caches" wasn't able to free those pages. These offline but not freed memcgs tend to increase in number over time with the side effect that percpu memory consumption as shown in /proc/meminfo also increases over time. In order to find out more information about those pages that pin offline memcgs, the page_owner feature is extended to print memory cgroup information especially whether the cgroup is offline or not. RCU read lock is taken when memcg is being accessed to make sure that it won't be freed. Link: https://lkml.kernel.org/r/20220202203036.744010-4-longman@redhat.com Signed-off-by: Waiman Long <longman@redhat.com> Acked-by: David Rientjes <rientjes@google.com> Acked-by: Roman Gushchin <guro@fb.com> Acked-by: Rafael Aquini <aquini@redhat.com> Acked-by: Mike Rapoport <rppt@linux.ibm.com> Cc: Roman Gushchin <roman.gushchin@linux.dev> Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Petr Mladek <pmladek@suse.com> Cc: Rasmus Villemoes <linux@rasmusvillemoes.dk> Cc: Sergey Senozhatsky <senozhatsky@chromium.org> Cc: Steven Rostedt (Google) <rostedt@goodmis.org> Cc: Vladimir Davydov <vdavydov.dev@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_owner.c | 42 ++++++++++++++++++++++++++++++++++++++++++ 1 file changed, 42 insertions(+) --- a/mm/page_owner.c~mm-page_owner-print-memcg-information +++ a/mm/page_owner.c @@ -10,6 +10,7 @@ #include <linux/migrate.h> #include <linux/stackdepot.h> #include <linux/seq_file.h> +#include <linux/memcontrol.h> #include <linux/sched/clock.h> #include "internal.h" @@ -325,6 +326,45 @@ void pagetypeinfo_showmixedcount_print(s seq_putc(m, '\n'); } +/* + * Looking for memcg information and print it out + */ +static inline int print_page_owner_memcg(char *kbuf, size_t count, int ret, + struct page *page) +{ +#ifdef CONFIG_MEMCG + unsigned long memcg_data; + struct mem_cgroup *memcg; + bool online; + char name[80]; + + rcu_read_lock(); + memcg_data = READ_ONCE(page->memcg_data); + if (!memcg_data) + goto out_unlock; + + if (memcg_data & MEMCG_DATA_OBJCGS) + ret += scnprintf(kbuf + ret, count - ret, + "Slab cache page\n"); + + memcg = page_memcg_check(page); + if (!memcg) + goto out_unlock; + + online = (memcg->css.flags & CSS_ONLINE); + cgroup_name(memcg->css.cgroup, name, sizeof(name)); + ret += scnprintf(kbuf + ret, count - ret, + "Charged %sto %smemcg %s\n", + PageMemcgKmem(page) ? "(via objcg) " : "", + online ? "" : "offline ", + name); +out_unlock: + rcu_read_unlock(); +#endif /* CONFIG_MEMCG */ + + return ret; +} + static ssize_t print_page_owner(char __user *buf, size_t count, unsigned long pfn, struct page *page, struct page_owner *page_owner, @@ -365,6 +405,8 @@ print_page_owner(char __user *buf, size_ migrate_reason_names[page_owner->last_migrate_reason]); } + ret = print_page_owner_memcg(kbuf, count, ret, page); + ret += snprintf(kbuf + ret, count - ret, "\n"); if (ret >= count) goto err; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 012/114] mm/page_owner: record task command name 2022-03-25 1:07 incoming Andrew Morton ` (10 preceding siblings ...) 2022-03-25 1:09 ` [patch 011/114] mm/page_owner: print memcg information Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 013/114] mm/page_owner.c: record tgid Andrew Morton ` (100 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: vdavydov.dev, senozhatsky, rppt, rostedt, roman.gushchin, rientjes, pmladek, mhocko, linux, ira.weiny, hannes, aquini, andriy.shevchenko, longman, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Waiman Long <longman@redhat.com> Subject: mm/page_owner: record task command name The page_owner information currently includes the pid of the calling task. That is useful as long as the task is still running. Otherwise, the number is meaningless. To have more information about the allocating tasks that had exited by the time the page_owner information is retrieved, we need to store the command name of the task. Add a new comm field into page_owner structure to store the command name and display it when the page_owner information is retrieved. Link: https://lkml.kernel.org/r/20220202203036.744010-5-longman@redhat.com Signed-off-by: Waiman Long <longman@redhat.com> Acked-by: Rafael Aquini <aquini@redhat.com> Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com> Cc: David Rientjes <rientjes@google.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Mike Rapoport <rppt@kernel.org> Cc: Petr Mladek <pmladek@suse.com> Cc: Rasmus Villemoes <linux@rasmusvillemoes.dk> Cc: Roman Gushchin <roman.gushchin@linux.dev> Cc: Sergey Senozhatsky <senozhatsky@chromium.org> Cc: Steven Rostedt (Google) <rostedt@goodmis.org> Cc: Vladimir Davydov <vdavydov.dev@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_owner.c | 14 ++++++++++---- 1 file changed, 10 insertions(+), 4 deletions(-) --- a/mm/page_owner.c~mm-page_owner-record-task-command-name +++ a/mm/page_owner.c @@ -29,6 +29,7 @@ struct page_owner { depot_stack_handle_t free_handle; u64 ts_nsec; u64 free_ts_nsec; + char comm[TASK_COMM_LEN]; pid_t pid; }; @@ -165,6 +166,8 @@ static inline void __set_page_owner_hand page_owner->last_migrate_reason = -1; page_owner->pid = current->pid; page_owner->ts_nsec = local_clock(); + strlcpy(page_owner->comm, current->comm, + sizeof(page_owner->comm)); __set_bit(PAGE_EXT_OWNER, &page_ext->flags); __set_bit(PAGE_EXT_OWNER_ALLOCATED, &page_ext->flags); @@ -232,6 +235,7 @@ void __folio_copy_owner(struct folio *ne new_page_owner->pid = old_page_owner->pid; new_page_owner->ts_nsec = old_page_owner->ts_nsec; new_page_owner->free_ts_nsec = old_page_owner->ts_nsec; + strcpy(new_page_owner->comm, old_page_owner->comm); /* * We don't clear the bit on the old folio as it's going to be freed @@ -379,10 +383,11 @@ print_page_owner(char __user *buf, size_ return -ENOMEM; ret = scnprintf(kbuf, count, - "Page allocated via order %u, mask %#x(%pGg), pid %d, ts %llu ns, free_ts %llu ns\n", + "Page allocated via order %u, mask %#x(%pGg), pid %d (%s), ts %llu ns, free_ts %llu ns\n", page_owner->order, page_owner->gfp_mask, &page_owner->gfp_mask, page_owner->pid, - page_owner->ts_nsec, page_owner->free_ts_nsec); + page_owner->comm, page_owner->ts_nsec, + page_owner->free_ts_nsec); /* Print information relevant to grouping pages by mobility */ pageblock_mt = get_pageblock_migratetype(page); @@ -449,9 +454,10 @@ void __dump_page_owner(const struct page else pr_alert("page_owner tracks the page as freed\n"); - pr_alert("page last allocated via order %u, migratetype %s, gfp_mask %#x(%pGg), pid %d, ts %llu, free_ts %llu\n", + pr_alert("page last allocated via order %u, migratetype %s, gfp_mask %#x(%pGg), pid %d (%s), ts %llu, free_ts %llu\n", page_owner->order, migratetype_names[mt], gfp_mask, &gfp_mask, - page_owner->pid, page_owner->ts_nsec, page_owner->free_ts_nsec); + page_owner->pid, page_owner->comm, page_owner->ts_nsec, + page_owner->free_ts_nsec); handle = READ_ONCE(page_owner->handle); if (!handle) _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 013/114] mm/page_owner.c: record tgid 2022-03-25 1:07 incoming Andrew Morton ` (11 preceding siblings ...) 2022-03-25 1:09 ` [patch 012/114] mm/page_owner: record task command name Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 014/114] tools/vm/page_owner_sort.c: fix the instructions for use Andrew Morton ` (99 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: longman, aquini, caoyixuan2019, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Yixuan Cao <caoyixuan2019@email.szu.edu.cn> Subject: mm/page_owner.c: record tgid In a single-threaded process, the pid in kernel task_struct is the same as the tgid, which can mark the process of page allocation. But in a multithreaded process, only the task_struct of the thread leader has the same pid as tgid, and the pids of other threads are different from tgid. Therefore, tgid is recorded to provide effective information for debugging and data statistics of multithreaded programs. This can also be achieved by observing the task name (executable file name) for a specific process. However, when the same program is started multiple times, the task name is the same and the tgid is different. Therefore, in the debugging of multi-threaded programs, combined with the task name and tgid, more accurate runtime information of a certain run of the program can be obtained. Link: https://lkml.kernel.org/r/20220219180450.2399-1-caoyixuan2019@email.szu.edu.cn Signed-off-by: Yixuan Cao <caoyixuan2019@email.szu.edu.cn> Cc: Waiman Long <longman@redhat.com> Cc: Rafael Aquini <aquini@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_owner.c | 16 ++++++++++------ 1 file changed, 10 insertions(+), 6 deletions(-) --- a/mm/page_owner.c~mm-page_ownerc-record-tgid +++ a/mm/page_owner.c @@ -31,6 +31,7 @@ struct page_owner { u64 free_ts_nsec; char comm[TASK_COMM_LEN]; pid_t pid; + pid_t tgid; }; static bool page_owner_enabled = false; @@ -165,6 +166,7 @@ static inline void __set_page_owner_hand page_owner->gfp_mask = gfp_mask; page_owner->last_migrate_reason = -1; page_owner->pid = current->pid; + page_owner->tgid = current->tgid; page_owner->ts_nsec = local_clock(); strlcpy(page_owner->comm, current->comm, sizeof(page_owner->comm)); @@ -233,6 +235,7 @@ void __folio_copy_owner(struct folio *ne old_page_owner->last_migrate_reason; new_page_owner->handle = old_page_owner->handle; new_page_owner->pid = old_page_owner->pid; + new_page_owner->tgid = old_page_owner->tgid; new_page_owner->ts_nsec = old_page_owner->ts_nsec; new_page_owner->free_ts_nsec = old_page_owner->ts_nsec; strcpy(new_page_owner->comm, old_page_owner->comm); @@ -383,11 +386,11 @@ print_page_owner(char __user *buf, size_ return -ENOMEM; ret = scnprintf(kbuf, count, - "Page allocated via order %u, mask %#x(%pGg), pid %d (%s), ts %llu ns, free_ts %llu ns\n", + "Page allocated via order %u, mask %#x(%pGg), pid %d, tgid %d (%s), ts %llu ns, free_ts %llu ns\n", page_owner->order, page_owner->gfp_mask, &page_owner->gfp_mask, page_owner->pid, - page_owner->comm, page_owner->ts_nsec, - page_owner->free_ts_nsec); + page_owner->tgid, page_owner->comm, + page_owner->ts_nsec, page_owner->free_ts_nsec); /* Print information relevant to grouping pages by mobility */ pageblock_mt = get_pageblock_migratetype(page); @@ -454,10 +457,10 @@ void __dump_page_owner(const struct page else pr_alert("page_owner tracks the page as freed\n"); - pr_alert("page last allocated via order %u, migratetype %s, gfp_mask %#x(%pGg), pid %d (%s), ts %llu, free_ts %llu\n", + pr_alert("page last allocated via order %u, migratetype %s, gfp_mask %#x(%pGg), pid %d, tgid %d (%s), ts %llu, free_ts %llu\n", page_owner->order, migratetype_names[mt], gfp_mask, &gfp_mask, - page_owner->pid, page_owner->comm, page_owner->ts_nsec, - page_owner->free_ts_nsec); + page_owner->pid, page_owner->tgid, page_owner->comm, + page_owner->ts_nsec, page_owner->free_ts_nsec); handle = READ_ONCE(page_owner->handle); if (!handle) @@ -669,3 +672,4 @@ static int __init pageowner_init(void) return 0; } late_initcall(pageowner_init) + _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 014/114] tools/vm/page_owner_sort.c: fix the instructions for use 2022-03-25 1:07 incoming Andrew Morton ` (12 preceding siblings ...) 2022-03-25 1:09 ` [patch 013/114] mm/page_owner.c: record tgid Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 015/114] tools/vm/page_owner_sort.c: fix comments Andrew Morton ` (98 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: zhangyinan2019, weizhenliang, tangbin, songmuchun, sfr, seanga2, caoyixuan2019, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Yixuan Cao <caoyixuan2019@email.szu.edu.cn> Subject: tools/vm/page_owner_sort.c: fix the instructions for use I noticed a discrepancy between the usage method and the code logic. If we enable the -f option, it should be "Filter out the information of blocks whose memory has been released". Link: https://lkml.kernel.org/r/20220219143106.2805-1-caoyixuan2019@email.szu.edu.cn Signed-off-by: Yixuan Cao <caoyixuan2019@email.szu.edu.cn> Cc: Stephen Rothwell <sfr@canb.auug.org.au> Cc: Sean Anderson <seanga2@gmail.com> Cc: Muchun Song <songmuchun@bytedance.com> Cc: Zhenliang Wei <weizhenliang@huawei.com> Cc: Tang Bin <tangbin@cmss.chinamobile.com> Cc: Yinan Zhang <zhangyinan2019@email.szu.edu.cn> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/vm/page_owner_sort.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/tools/vm/page_owner_sort.c~tools-vm-page_owner_sortc-fix-the-instructions-for-use +++ a/tools/vm/page_owner_sort.c @@ -246,7 +246,7 @@ static void usage(void) "-a Sort by memory allocate time.\n" "-r Sort by memory release time.\n" "-c Cull by comparing stacktrace instead of total block.\n" - "-f Filter out the information of blocks whose memory has not been released.\n" + "-f Filter out the information of blocks whose memory has been released.\n" ); } _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 015/114] tools/vm/page_owner_sort.c: fix comments 2022-03-25 1:07 incoming Andrew Morton ` (13 preceding siblings ...) 2022-03-25 1:09 ` [patch 014/114] tools/vm/page_owner_sort.c: fix the instructions for use Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 016/114] tools/vm/page_owner_sort.c: add a security check Andrew Morton ` (97 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: zhangyinan2019, weizhenliang, sfr, caoyixuan2019, yejiajian2018, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Jiajian Ye <yejiajian2018@email.szu.edu.cn> Subject: tools/vm/page_owner_sort.c: fix comments Two adjustments are made: 1. Correct a grammatical error: replace the "what" in "Do the job what you want to debug" with "that". 2. Replace "has not been" with "has been" in the description of the -f option: According to Commit b1c9ba071e7d ("tools/vm/page_owner_sort.c: fix the instructions for use"), the description of the "-f" option is "Filter out the information of blocks whose memory has been released." Link: https://lkml.kernel.org/r/20220301151438.166118-1-yejiajian2018@email.szu.edu.cn Signed-off-by: Jiajian Ye <yejiajian2018@email.szu.edu.cn> Cc: Stephen Rothwell <sfr@canb.auug.org.au> Cc: Yinan Zhang <zhangyinan2019@email.szu.edu.cn> Cc: Yixuan Cao <caoyixuan2019@email.szu.edu.cn> Cc: Zhenliang Wei <weizhenliang@huawei.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/vm/page_owner.rst | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) --- a/Documentation/vm/page_owner.rst~tools-vm-page_owner_sortc-fix-comments +++ a/Documentation/vm/page_owner.rst @@ -78,7 +78,7 @@ Usage 2) Enable page owner: add "page_owner=on" to boot cmdline. -3) Do the job what you want to debug +3) Do the job that you want to debug. 4) Analyze information from page owner:: @@ -126,4 +126,4 @@ Usage -c Cull by comparing stacktrace instead of total block. Filter: - -f Filter out the information of blocks whose memory has not been released. + -f Filter out the information of blocks whose memory has been released. _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 016/114] tools/vm/page_owner_sort.c: add a security check 2022-03-25 1:07 incoming Andrew Morton ` (14 preceding siblings ...) 2022-03-25 1:09 ` [patch 015/114] tools/vm/page_owner_sort.c: fix comments Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 017/114] tools/vm/page_owner_sort.c: support sorting by tgid and update documentation Andrew Morton ` (96 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: zhangyinan2019, weizhenliang, sfr, caoyixuan2019, yejiajian2018, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Jiajian Ye <yejiajian2018@email.szu.edu.cn> Subject: tools/vm/page_owner_sort.c: add a security check Add a security check after using malloc() to allocate memory. Link: https://lkml.kernel.org/r/20220301151438.166118-2-yejiajian2018@email.szu.edu.cn Signed-off-by: Jiajian Ye <yejiajian2018@email.szu.edu.cn> Cc: Stephen Rothwell <sfr@canb.auug.org.au> Cc: Yinan Zhang <zhangyinan2019@email.szu.edu.cn> Cc: Yixuan Cao <caoyixuan2019@email.szu.edu.cn> Cc: Zhenliang Wei <weizhenliang@huawei.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/vm/page_owner_sort.c | 6 ++++++ 1 file changed, 6 insertions(+) --- a/tools/vm/page_owner_sort.c~tools-vm-page_owner_sortc-add-a-security-check +++ a/tools/vm/page_owner_sort.c @@ -217,7 +217,13 @@ static void add_list(char *buf, int len) printf("max_size too small??\n"); exit(1); } + list[list_size].txt = malloc(len+1); + if (!list[list_size].txt) { + printf("Out of memory\n"); + exit(1); + } + list[list_size].len = len; list[list_size].num = 1; list[list_size].page_num = get_page_num(buf); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 017/114] tools/vm/page_owner_sort.c: support sorting by tgid and update documentation 2022-03-25 1:07 incoming Andrew Morton ` (15 preceding siblings ...) 2022-03-25 1:09 ` [patch 016/114] tools/vm/page_owner_sort.c: add a security check Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 018/114] tools/vm/page_owner_sort: fix three trivival places Andrew Morton ` (95 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: zhangyinan2019, weizhenliang, sfr, caoyixuan2019, yejiajian2018, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Jiajian Ye <yejiajian2018@email.szu.edu.cn> Subject: tools/vm/page_owner_sort.c: support sorting by tgid and update documentation When the "page owner" information is read, the information sorted by TGID is expected. As a result, the following adjustments have been made: 1. Add a new -P option to sort the information of blocks by TGID in ascending order. 2. Adjust the order of member variables in block_list strust to avoid one 4 byte hole. 3. Add -P option explanation in the document. Link: https://lkml.kernel.org/r/20220301151438.166118-3-yejiajian2018@email.szu.edu.cn Signed-off-by: Jiajian Ye <yejiajian2018@email.szu.edu.cn> Cc: Stephen Rothwell <sfr@canb.auug.org.au> Cc: Yixuan Cao <caoyixuan2019@email.szu.edu.cn> Cc: Zhenliang Wei <weizhenliang@huawei.com> Cc: Yinan Zhang <zhangyinan2019@email.szu.edu.cn> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/vm/page_owner.rst | 1 tools/vm/page_owner_sort.c | 40 +++++++++++++++++++++++++++--- 2 files changed, 38 insertions(+), 3 deletions(-) --- a/Documentation/vm/page_owner.rst~tools-vm-page_owner_sortc-support-sorting-by-tgid-and-update-documentation +++ a/Documentation/vm/page_owner.rst @@ -116,6 +116,7 @@ Usage -a Sort by memory allocation time. -m Sort by total memory. -p Sort by pid. + -P Sort by tgid. -r Sort by memory release time. -s Sort by stack trace. -t Sort by times (default). --- a/tools/vm/page_owner_sort.c~tools-vm-page_owner_sortc-support-sorting-by-tgid-and-update-documentation +++ a/tools/vm/page_owner_sort.c @@ -25,16 +25,18 @@ struct block_list { char *txt; char *stacktrace; + __u64 ts_nsec; + __u64 free_ts_nsec; int len; int num; int page_num; pid_t pid; - __u64 ts_nsec; - __u64 free_ts_nsec; + pid_t tgid; }; static regex_t order_pattern; static regex_t pid_pattern; +static regex_t tgid_pattern; static regex_t ts_nsec_pattern; static regex_t free_ts_nsec_pattern; static struct block_list *list; @@ -91,6 +93,13 @@ static int compare_pid(const void *p1, c return l1->pid - l2->pid; } +static int compare_tgid(const void *p1, const void *p2) +{ + const struct block_list *l1 = p1, *l2 = p2; + + return l1->tgid - l2->tgid; +} + static int compare_ts(const void *p1, const void *p2) { const struct block_list *l1 = p1, *l2 = p2; @@ -170,6 +179,24 @@ static pid_t get_pid(char *buf) } +static pid_t get_tgid(char *buf) +{ + pid_t tgid; + char tgid_str[FIELD_BUFF] = {0}; + char *endptr; + + search_pattern(&tgid_pattern, tgid_str, buf); + errno = 0; + tgid = strtol(tgid_str, &endptr, 10); + if (errno != 0 || endptr == tgid_str || *endptr != '\0') { + printf("wrong/invalid tgid in follow buf:\n%s\n", buf); + return -1; + } + + return tgid; + +} + static __u64 get_ts_nsec(char *buf) { __u64 ts_nsec; @@ -231,6 +258,7 @@ static void add_list(char *buf, int len) list[list_size].txt[len] = 0; list[list_size].stacktrace = strchr(list[list_size].txt, '\n') ?: ""; list[list_size].pid = get_pid(buf); + list[list_size].tgid = get_tgid(buf); list[list_size].ts_nsec = get_ts_nsec(buf); list[list_size].free_ts_nsec = get_free_ts_nsec(buf); list_size++; @@ -249,6 +277,7 @@ static void usage(void) "-s Sort by the stack trace.\n" "-t Sort by times (default).\n" "-p Sort by pid.\n" + "-P Sort by tgid.\n" "-a Sort by memory allocate time.\n" "-r Sort by memory release time.\n" "-c Cull by comparing stacktrace instead of total block.\n" @@ -268,7 +297,7 @@ int main(int argc, char **argv) struct stat st; int opt; - while ((opt = getopt(argc, argv, "acfmprst")) != -1) + while ((opt = getopt(argc, argv, "acfmprstP")) != -1) switch (opt) { case 'a': cmp = compare_ts; @@ -294,6 +323,9 @@ int main(int argc, char **argv) case 't': cmp = compare_num; break; + case 'P': + cmp = compare_tgid; + break; default: usage(); exit(1); @@ -314,6 +346,7 @@ int main(int argc, char **argv) check_regcomp(&order_pattern, "order\\s*([0-9]*),"); check_regcomp(&pid_pattern, "pid\\s*([0-9]*),"); + check_regcomp(&tgid_pattern, "tgid\\s*([0-9]*) "); check_regcomp(&ts_nsec_pattern, "ts\\s*([0-9]*)\\s*ns,"); check_regcomp(&free_ts_nsec_pattern, "free_ts\\s*([0-9]*)\\s*ns"); fstat(fileno(fin), &st); @@ -373,6 +406,7 @@ int main(int argc, char **argv) } regfree(&order_pattern); regfree(&pid_pattern); + regfree(&tgid_pattern); regfree(&ts_nsec_pattern); regfree(&free_ts_nsec_pattern); return 0; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 018/114] tools/vm/page_owner_sort: fix three trivival places 2022-03-25 1:07 incoming Andrew Morton ` (16 preceding siblings ...) 2022-03-25 1:09 ` [patch 017/114] tools/vm/page_owner_sort.c: support sorting by tgid and update documentation Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 019/114] tools/vm/page_owner_sort: support for sorting by task command name Andrew Morton ` (94 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: zhangyinan2019, weizhenliang, sfr, seanga2, hanshenghong2019, caoyixuan2019, yejiajian2018, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Jiajian Ye <yejiajian2018@email.szu.edu.cn> Subject: tools/vm/page_owner_sort: fix three trivival places The following adjustments are made: 1. Instead of using another array to cull the blocks after sorting, reuse the old array. So there is no need to malloc a new array. 2. When enabling '-f' option to filter out the blocks which have been released, only add those have not been released in the list, rather than add all of blocks in the list and then do the filtering when printing the result. 3. When enabling '-c' option to cull the blocks by comparing stacktrace, print the stacetrace rather than the total block. Link: https://lkml.kernel.org/r/20220306030640.43054-1-yejiajian2018@email.szu.edu.cn Signed-off-by: Jiajian Ye <yejiajian2018@email.szu.edu.cn> Cc: <hanshenghong2019@email.szu.edu.cn> Cc: Sean Anderson <seanga2@gmail.com> Cc: Stephen Rothwell <sfr@canb.auug.org.au> Cc: Yixuan Cao <caoyixuan2019@email.szu.edu.cn> Cc: <zhangyinan2019@email.szu.edu.cn> Cc: Zhenliang Wei <weizhenliang@huawei.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/vm/page_owner_sort.c | 37 +++++++++++++++++------------------ 1 file changed, 19 insertions(+), 18 deletions(-) --- a/tools/vm/page_owner_sort.c~tools-vm-page_owner_sort-fix-three-trivival-places +++ a/tools/vm/page_owner_sort.c @@ -42,6 +42,8 @@ static regex_t free_ts_nsec_pattern; static struct block_list *list; static int list_size; static int max_size; +static int cull_st; +static int filter; int read_block(char *buf, int buf_size, FILE *fin) { @@ -245,6 +247,9 @@ static void add_list(char *buf, int len) exit(1); } + list[list_size].free_ts_nsec = get_free_ts_nsec(buf); + if (filter == 1 && list[list_size].free_ts_nsec != 0) + return; list[list_size].txt = malloc(len+1); if (!list[list_size].txt) { printf("Out of memory\n"); @@ -257,10 +262,11 @@ static void add_list(char *buf, int len) memcpy(list[list_size].txt, buf, len); list[list_size].txt[len] = 0; list[list_size].stacktrace = strchr(list[list_size].txt, '\n') ?: ""; + if (*list[list_size].stacktrace == '\n') + list[list_size].stacktrace++; list[list_size].pid = get_pid(buf); list[list_size].tgid = get_tgid(buf); list[list_size].ts_nsec = get_ts_nsec(buf); - list[list_size].free_ts_nsec = get_free_ts_nsec(buf); list_size++; if (list_size % 1000 == 0) { printf("loaded %d\r", list_size); @@ -288,12 +294,9 @@ static void usage(void) int main(int argc, char **argv) { int (*cmp)(const void *, const void *) = compare_num; - int cull_st = 0; - int filter = 0; FILE *fin, *fout; char *buf; int ret, i, count; - struct block_list *list2; struct stat st; int opt; @@ -376,11 +379,7 @@ int main(int argc, char **argv) else qsort(list, list_size, sizeof(list[0]), compare_txt); - list2 = malloc(sizeof(*list) * list_size); - if (!list2) { - printf("Out of memory\n"); - exit(1); - } + printf("culling\n"); @@ -388,21 +387,23 @@ int main(int argc, char **argv) for (i = count = 0; i < list_size; i++) { if (count == 0 || - strcmp(*(&list2[count-1].txt+offset), *(&list[i].txt+offset)) != 0) { - list2[count++] = list[i]; + strcmp(*(&list[count-1].txt+offset), *(&list[i].txt+offset)) != 0) { + list[count++] = list[i]; } else { - list2[count-1].num += list[i].num; - list2[count-1].page_num += list[i].page_num; + list[count-1].num += list[i].num; + list[count-1].page_num += list[i].page_num; } } - qsort(list2, count, sizeof(list[0]), cmp); + qsort(list, count, sizeof(list[0]), cmp); for (i = 0; i < count; i++) { - if (filter == 1 && list2[i].free_ts_nsec != 0) - continue; - fprintf(fout, "%d times, %d pages:\n%s\n", - list2[i].num, list2[i].page_num, list2[i].txt); + if (cull_st == 0) + fprintf(fout, "%d times, %d pages:\n%s\n", + list[i].num, list[i].page_num, list[i].txt); + else + fprintf(fout, "%d times, %d pages:\n%s\n", + list[i].num, list[i].page_num, list[i].stacktrace); } regfree(&order_pattern); regfree(&pid_pattern); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 019/114] tools/vm/page_owner_sort: support for sorting by task command name 2022-03-25 1:07 incoming Andrew Morton ` (17 preceding siblings ...) 2022-03-25 1:09 ` [patch 018/114] tools/vm/page_owner_sort: fix three trivival places Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 020/114] tools/vm/page_owner_sort.c: support for selecting by PID, TGID or " Andrew Morton ` (93 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: zhaochongxi2019, zhangyinan2019, weizhenliang, sfr, seanga2, hanshenghong2019, caoyixuan2019, yejiajian2018, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Jiajian Ye <yejiajian2018@email.szu.edu.cn> Subject: tools/vm/page_owner_sort: support for sorting by task command name When viewing page owner information, we may also need to the block to be sorted by task command name. Therefore, the following adjustments are made: 1. Add a member variable to record task command name of block. 2. Add a new -n option to sort the information of blocks by task command name. 3. Add -n option explanation in the document. Link: https://lkml.kernel.org/r/20220306030640.43054-2-yejiajian2018@email.szu.edu.cn Signed-off-by: Jiajian Ye <yejiajian2018@email.szu.edu.cn> Cc: Stephen Rothwell <sfr@canb.auug.org.au> Cc: Sean Anderson <seanga2@gmail.com> Cc: Yixuan Cao <caoyixuan2019@email.szu.edu.cn> Cc: Zhenliang Wei <weizhenliang@huawei.com> Cc: <zhaochongxi2019@email.szu.edu.cn> Cc: <hanshenghong2019@email.szu.edu.cn> Cc: <zhangyinan2019@email.szu.edu.cn> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/vm/page_owner.rst | 1 tools/vm/page_owner_sort.c | 35 +++++++++++++++++++++++++++++- 2 files changed, 35 insertions(+), 1 deletion(-) --- a/Documentation/vm/page_owner.rst~tools-vm-page_owner_sort-support-for-sorting-by-task-command-name +++ a/Documentation/vm/page_owner.rst @@ -117,6 +117,7 @@ Usage -m Sort by total memory. -p Sort by pid. -P Sort by tgid. + -n Sort by task command name. -r Sort by memory release time. -s Sort by stack trace. -t Sort by times (default). --- a/tools/vm/page_owner_sort.c~tools-vm-page_owner_sort-support-for-sorting-by-task-command-name +++ a/tools/vm/page_owner_sort.c @@ -24,6 +24,7 @@ struct block_list { char *txt; + char *comm; // task command name char *stacktrace; __u64 ts_nsec; __u64 free_ts_nsec; @@ -37,6 +38,7 @@ struct block_list { static regex_t order_pattern; static regex_t pid_pattern; static regex_t tgid_pattern; +static regex_t comm_pattern; static regex_t ts_nsec_pattern; static regex_t free_ts_nsec_pattern; static struct block_list *list; @@ -102,6 +104,13 @@ static int compare_tgid(const void *p1, return l1->tgid - l2->tgid; } +static int compare_comm(const void *p1, const void *p2) +{ + const struct block_list *l1 = p1, *l2 = p2; + + return strcmp(l1->comm, l2->comm); +} + static int compare_ts(const void *p1, const void *p2) { const struct block_list *l1 = p1, *l2 = p2; @@ -145,6 +154,7 @@ static void check_regcomp(regex_t *patte } # define FIELD_BUFF 25 +# define TASK_COMM_LEN 16 static int get_page_num(char *buf) { @@ -233,6 +243,22 @@ static __u64 get_free_ts_nsec(char *buf) return free_ts_nsec; } +static char *get_comm(char *buf) +{ + char *comm_str = malloc(TASK_COMM_LEN); + + memset(comm_str, 0, TASK_COMM_LEN); + + search_pattern(&comm_pattern, comm_str, buf); + errno = 0; + if (errno != 0) { + printf("wrong comm in follow buf:\n%s\n", buf); + return NULL; + } + + return comm_str; +} + static void add_list(char *buf, int len) { if (list_size != 0 && @@ -266,6 +292,7 @@ static void add_list(char *buf, int len) list[list_size].stacktrace++; list[list_size].pid = get_pid(buf); list[list_size].tgid = get_tgid(buf); + list[list_size].comm = get_comm(buf); list[list_size].ts_nsec = get_ts_nsec(buf); list_size++; if (list_size % 1000 == 0) { @@ -284,6 +311,7 @@ static void usage(void) "-t Sort by times (default).\n" "-p Sort by pid.\n" "-P Sort by tgid.\n" + "-n Sort by task command name.\n" "-a Sort by memory allocate time.\n" "-r Sort by memory release time.\n" "-c Cull by comparing stacktrace instead of total block.\n" @@ -300,7 +328,7 @@ int main(int argc, char **argv) struct stat st; int opt; - while ((opt = getopt(argc, argv, "acfmprstP")) != -1) + while ((opt = getopt(argc, argv, "acfmnprstP")) != -1) switch (opt) { case 'a': cmp = compare_ts; @@ -329,6 +357,9 @@ int main(int argc, char **argv) case 'P': cmp = compare_tgid; break; + case 'n': + cmp = compare_comm; + break; default: usage(); exit(1); @@ -350,6 +381,7 @@ int main(int argc, char **argv) check_regcomp(&order_pattern, "order\\s*([0-9]*),"); check_regcomp(&pid_pattern, "pid\\s*([0-9]*),"); check_regcomp(&tgid_pattern, "tgid\\s*([0-9]*) "); + check_regcomp(&comm_pattern, "tgid\\s*[0-9]*\\s*\\((.*)\\),\\s*ts"); check_regcomp(&ts_nsec_pattern, "ts\\s*([0-9]*)\\s*ns,"); check_regcomp(&free_ts_nsec_pattern, "free_ts\\s*([0-9]*)\\s*ns"); fstat(fileno(fin), &st); @@ -408,6 +440,7 @@ int main(int argc, char **argv) regfree(&order_pattern); regfree(&pid_pattern); regfree(&tgid_pattern); + regfree(&comm_pattern); regfree(&ts_nsec_pattern); regfree(&free_ts_nsec_pattern); return 0; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 020/114] tools/vm/page_owner_sort.c: support for selecting by PID, TGID or task command name 2022-03-25 1:07 incoming Andrew Morton ` (18 preceding siblings ...) 2022-03-25 1:09 ` [patch 019/114] tools/vm/page_owner_sort: support for sorting by task command name Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 021/114] tools/vm/page_owner_sort.c: support for user-defined culling rules Andrew Morton ` (92 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: weizhenliang, sfr, seanga2, yejiajian2018, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Jiajian Ye <yejiajian2018@email.szu.edu.cn> Subject: tools/vm/page_owner_sort.c: support for selecting by PID, TGID or task command name When viewing page owner information, we may also need to select the blocks by PID, TGID or task command name, which helps to get more accurate page allocation information as needed. Therefore, following adjustments are made: 1. Add three new options, including --pid, --tgid and --name, to support the selection of information blocks by a specific pid, tgid and task command name. In addtion, multiple options are allowed to be used at the same time. ./page_owner_sort [input] [output] --pid <PID> ./page_owner_sort [input] [output] --tgid <TGID> ./page_owner_sort [input] [output] --name <TASK_COMMAND_NAME> Assuming a scenario when a multi-threaded program, ./demo (PID = 5280), is running, and ./demo creates a child process (PID = 5281). $ps PID TTY TIME CMD 5215 pts/0 00:00:00 bash 5280 pts/0 00:00:00 ./demo 5281 pts/0 00:00:00 ./demo 5282 pts/0 00:00:00 ps It would be better to filter out the records with tgid=5280 and the task name "demo" when debugging the parent process, and the specific usage is ./page_owner_sort [input] [output] --tgid 5280 --name demo 2. Add explanations of three new options, including --pid, --tgid and --name, to the document. This work is coauthored by Shenghong Han <hanshenghong2019@email.szu.edu.cn>, Yixuan Cao <caoyixuan2019@email.szu.edu.cn>, Yinan Zhang <zhangyinan2019@email.szu.edu.cn>, Chongxi Zhao <zhaochongxi2019@email.szu.edu.cn>, Yuhong Feng <yuhongf@szu.edu.cn>. Link: https://lkml.kernel.org/r/1646835223-7584-1-git-send-email-yejiajian2018@email.szu.edu.cn Signed-off-by: Jiajian Ye <yejiajian2018@email.szu.edu.cn> Cc: Sean Anderson <seanga2@gmail.com> Cc: Stephen Rothwell <sfr@canb.auug.org.au> Cc: Zhenliang Wei <weizhenliang@huawei.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/vm/page_owner.rst | 6 + tools/vm/page_owner_sort.c | 118 +++++++++++++++++++++++------- 2 files changed, 98 insertions(+), 26 deletions(-) --- a/Documentation/vm/page_owner.rst~tools-vm-page_owner_sortc-support-for-selecting-by-pid-tgid-or-task-command-name +++ a/Documentation/vm/page_owner.rst @@ -129,3 +129,9 @@ Usage Filter: -f Filter out the information of blocks whose memory has been released. + + Select: + --pid <PID> Select by pid. + --tgid <TGID> Select by tgid. + --name <command> Select by task command name. + --- a/tools/vm/page_owner_sort.c~tools-vm-page_owner_sortc-support-for-selecting-by-pid-tgid-or-task-command-name +++ a/tools/vm/page_owner_sort.c @@ -21,6 +21,12 @@ #include <regex.h> #include <errno.h> #include <linux/types.h> +#include <getopt.h> + +#define bool int +#define true 1 +#define false 0 +#define TASK_COMM_LEN 16 struct block_list { char *txt; @@ -34,7 +40,18 @@ struct block_list { pid_t pid; pid_t tgid; }; - +enum FILTER_BIT { + FILTER_UNRELEASE = 1<<1, + FILTER_PID = 1<<2, + FILTER_TGID = 1<<3, + FILTER_TASK_COMM_NAME = 1<<4 +}; +struct filter_condition { + pid_t tgid; + pid_t pid; + char comm[TASK_COMM_LEN]; +}; +static struct filter_condition fc; static regex_t order_pattern; static regex_t pid_pattern; static regex_t tgid_pattern; @@ -154,7 +171,6 @@ static void check_regcomp(regex_t *patte } # define FIELD_BUFF 25 -# define TASK_COMM_LEN 16 static int get_page_num(char *buf) { @@ -259,11 +275,30 @@ static char *get_comm(char *buf) return comm_str; } +static bool is_need(char *buf) +{ + if ((filter & FILTER_UNRELEASE) != 0 && get_free_ts_nsec(buf) != 0) + return false; + if ((filter & FILTER_PID) != 0 && get_pid(buf) != fc.pid) + return false; + if ((filter & FILTER_TGID) != 0 && get_tgid(buf) != fc.tgid) + return false; + + char *comm = get_comm(buf); + + if ((filter & FILTER_TASK_COMM_NAME) != 0 && + strncmp(comm, fc.comm, TASK_COMM_LEN) != 0) { + free(comm); + return false; + } + return true; +} + static void add_list(char *buf, int len) { if (list_size != 0 && - len == list[list_size-1].len && - memcmp(buf, list[list_size-1].txt, len) == 0) { + len == list[list_size-1].len && + memcmp(buf, list[list_size-1].txt, len) == 0) { list[list_size-1].num++; list[list_size-1].page_num += get_page_num(buf); return; @@ -272,28 +307,27 @@ static void add_list(char *buf, int len) printf("max_size too small??\n"); exit(1); } - - list[list_size].free_ts_nsec = get_free_ts_nsec(buf); - if (filter == 1 && list[list_size].free_ts_nsec != 0) + if (!is_need(buf)) return; + list[list_size].pid = get_pid(buf); + list[list_size].tgid = get_tgid(buf); + list[list_size].comm = get_comm(buf); list[list_size].txt = malloc(len+1); if (!list[list_size].txt) { printf("Out of memory\n"); exit(1); } - + memcpy(list[list_size].txt, buf, len); + list[list_size].txt[len] = 0; list[list_size].len = len; list[list_size].num = 1; list[list_size].page_num = get_page_num(buf); - memcpy(list[list_size].txt, buf, len); - list[list_size].txt[len] = 0; + list[list_size].stacktrace = strchr(list[list_size].txt, '\n') ?: ""; if (*list[list_size].stacktrace == '\n') list[list_size].stacktrace++; - list[list_size].pid = get_pid(buf); - list[list_size].tgid = get_tgid(buf); - list[list_size].comm = get_comm(buf); list[list_size].ts_nsec = get_ts_nsec(buf); + list[list_size].free_ts_nsec = get_free_ts_nsec(buf); list_size++; if (list_size % 1000 == 0) { printf("loaded %d\r", list_size); @@ -306,16 +340,19 @@ static void add_list(char *buf, int len) static void usage(void) { printf("Usage: ./page_owner_sort [OPTIONS] <input> <output>\n" - "-m Sort by total memory.\n" - "-s Sort by the stack trace.\n" - "-t Sort by times (default).\n" - "-p Sort by pid.\n" - "-P Sort by tgid.\n" - "-n Sort by task command name.\n" - "-a Sort by memory allocate time.\n" - "-r Sort by memory release time.\n" - "-c Cull by comparing stacktrace instead of total block.\n" - "-f Filter out the information of blocks whose memory has been released.\n" + "-m\t\tSort by total memory.\n" + "-s\t\tSort by the stack trace.\n" + "-t\t\tSort by times (default).\n" + "-p\t\tSort by pid.\n" + "-P\t\tSort by tgid.\n" + "-n\t\tSort by task command name.\n" + "-a\t\tSort by memory allocate time.\n" + "-r\t\tSort by memory release time.\n" + "-c\t\tCull by comparing stacktrace instead of total block.\n" + "-f\t\tFilter out the information of blocks whose memory has been released.\n" + "--pid <PID>\tSelect by pid. This selects the information of blocks whose process ID number equals to <PID>.\n" + "--tgid <TGID>\tSelect by tgid. This selects the information of blocks whose Thread Group ID number equals to <TGID>.\n" + "--name <command>\n\t\tSelect by command name. This selects the information of blocks whose command name identical to <command>.\n" ); } @@ -323,12 +360,18 @@ int main(int argc, char **argv) { int (*cmp)(const void *, const void *) = compare_num; FILE *fin, *fout; - char *buf; + char *buf, *endptr; int ret, i, count; struct stat st; int opt; + struct option longopts[] = { + { "pid", required_argument, NULL, 1 }, + { "tgid", required_argument, NULL, 2 }, + { "name", required_argument, NULL, 3 }, + { 0, 0, 0, 0}, + }; - while ((opt = getopt(argc, argv, "acfmnprstP")) != -1) + while ((opt = getopt_long(argc, argv, "acfmnprstP", longopts, NULL)) != -1) switch (opt) { case 'a': cmp = compare_ts; @@ -337,7 +380,7 @@ int main(int argc, char **argv) cull_st = 1; break; case 'f': - filter = 1; + filter = filter | FILTER_UNRELEASE; break; case 'm': cmp = compare_page_num; @@ -360,6 +403,29 @@ int main(int argc, char **argv) case 'n': cmp = compare_comm; break; + case 1: + filter = filter | FILTER_PID; + errno = 0; + fc.pid = strtol(optarg, &endptr, 10); + if (errno != 0 || endptr == optarg || *endptr != '\0') { + printf("wrong/invalid pid in from the command line:%s\n", optarg); + exit(1); + } + break; + case 2: + filter = filter | FILTER_TGID; + errno = 0; + fc.tgid = strtol(optarg, &endptr, 10); + if (errno != 0 || endptr == optarg || *endptr != '\0') { + printf("wrong/invalid tgid in from the command line:%s\n", optarg); + exit(1); + } + break; + case 3: + filter = filter | FILTER_TASK_COMM_NAME; + strncpy(fc.comm, optarg, TASK_COMM_LEN); + fc.comm[TASK_COMM_LEN-1] = '\0'; + break; default: usage(); exit(1); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 021/114] tools/vm/page_owner_sort.c: support for user-defined culling rules 2022-03-25 1:07 incoming Andrew Morton ` (19 preceding siblings ...) 2022-03-25 1:09 ` [patch 020/114] tools/vm/page_owner_sort.c: support for selecting by PID, TGID or " Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 022/114] mm: unexport page_init_poison Andrew Morton ` (91 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: zhaochongxi2019, zhangyinan2019, yuhongf, sfr, seanga2, hanshenghong2019, caoyixuan2019, yejiajian2018, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Jiajian Ye <yejiajian2018@email.szu.edu.cn> Subject: tools/vm/page_owner_sort.c: support for user-defined culling rules When viewing page owner information, we may want to cull blocks of information with our own rules. So it is important to enhance culling function to provide the support for customizing culling rules. Therefore, following adjustments are made: 1. Add --cull option to support the culling of blocks of information with user-defined culling rules. ./page_owner_sort <input> <output> --cull=<rules> ./page_owner_sort <input> <output> --cull <rules> <rules> is a single argument in the form of a comma-separated list to specify individual culling rules, by the sequence of keys k1,k2, .... Mixed use of abbreviated and complete-form of keys is allowed. For reference, please see the document(Documentation/vm/page_owner.rst). Now, assuming two blocks in the input file are as follows: Page allocated via order 0, mask xxxx, pid 1, tgid 1 (task_name_demo) PFN xxxx prep_new_page+0xd0/0xf8 get_page_from_freelist+0x4a0/0x1290 __alloc_pages+0x168/0x340 alloc_pages+0xb0/0x158 Page allocated via order 0, mask xxxx, pid 32, tgid 32 (task_name_demo) PFN xxxx prep_new_page+0xd0/0xf8 get_page_from_freelist+0x4a0/0x1290 __alloc_pages+0x168/0x340 alloc_pages+0xb0/0x158 If we want to cull the blocks by stacktrace and task command name, we can use this command: ./page_owner_sort <input> <output> --cull=stacktrace,name The output would be like: 2 times, 2 pages, task_comm_name: task_name_demo prep_new_page+0xd0/0xf8 get_page_from_freelist+0x4a0/0x1290 __alloc_pages+0x168/0x340 alloc_pages+0xb0/0x158 As we can see, these two blocks are culled successfully, for they share the same pid and task command name. However, if we want to cull the blocks by pid, stacktrace and task command name, we can this command: ./page_owner_sort <input> <output> --cull=stacktrace,name,pid The output would be like: 1 times, 1 pages, PID 1, task_comm_name: task_name_demo prep_new_page+0xd0/0xf8 get_page_from_freelist+0x4a0/0x1290 __alloc_pages+0x168/0x340 alloc_pages+0xb0/0x158 1 times, 1 pages, PID 32, task_comm_name: task_name_demo prep_new_page+0xd0/0xf8 get_page_from_freelist+0x4a0/0x1290 __alloc_pages+0x168/0x340 alloc_pages+0xb0/0x158 As we can see, these two blocks are failed to cull, for their PIDs are different. 2. Add explanations of --cull options to the document. This work is coauthored by Yixuan Cao Shenghong Han Yinan Zhang Chongxi Zhao Yuhong Feng Link: https://lkml.kernel.org/r/20220312145834.624-1-yejiajian2018@email.szu.edu.cn Signed-off-by: Jiajian Ye <yejiajian2018@email.szu.edu.cn> Cc: Yixuan Cao <caoyixuan2019@email.szu.edu.cn> Cc: Shenghong Han <hanshenghong2019@email.szu.edu.cn> Cc: Yinan Zhang <zhangyinan2019@email.szu.edu.cn> Cc: Chongxi Zhao <zhaochongxi2019@email.szu.edu.cn> Cc: Yuhong Feng <yuhongf@szu.edu.cn> Cc: Stephen Rothwell <sfr@canb.auug.org.au> Cc: Sean Anderson <seanga2@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/vm/page_owner.rst | 31 ++++++ tools/vm/page_owner_sort.c | 150 +++++++++++++++++++++++++----- 2 files changed, 159 insertions(+), 22 deletions(-) --- a/Documentation/vm/page_owner.rst~tools-vm-page_owner_sortc-support-for-user-defined-culling-rules +++ a/Documentation/vm/page_owner.rst @@ -126,12 +126,41 @@ Usage Cull: -c Cull by comparing stacktrace instead of total block. + --cull <rules> + Specify culling rules.Culling syntax is key[,key[,...]].Choose a + multi-letter key from the **STANDARD FORMAT SPECIFIERS** section. + + + <rules> is a single argument in the form of a comma-separated list, + which offers a way to specify individual culling rules. The recognized + keywords are described in the **STANDARD FORMAT SPECIFIERS** section below. + <rules> can be specified by the sequence of keys k1,k2, ..., as described in + the STANDARD SORT KEYS section below. Mixed use of abbreviated and + complete-form of keys is allowed. + + + Examples: + ./page_owner_sort <input> <output> --cull=stacktrace + ./page_owner_sort <input> <output> --cull=st,pid,name + ./page_owner_sort <input> <output> --cull=n,f Filter: -f Filter out the information of blocks whose memory has been released. Select: - --pid <PID> Select by pid. + --pid <PID> Select by pid. --tgid <TGID> Select by tgid. --name <command> Select by task command name. +STANDARD FORMAT SPECIFIERS +========================== + + KEY LONG DESCRIPTION + p pid process ID + tg tgid thread group ID + n name task command name + f free whether the page has been released or not + st stacktrace stace trace of the page allocation + + + --- a/tools/vm/page_owner_sort.c~tools-vm-page_owner_sortc-support-for-user-defined-culling-rules +++ a/tools/vm/page_owner_sort.c @@ -44,7 +44,14 @@ enum FILTER_BIT { FILTER_UNRELEASE = 1<<1, FILTER_PID = 1<<2, FILTER_TGID = 1<<3, - FILTER_TASK_COMM_NAME = 1<<4 + FILTER_COMM = 1<<4 +}; +enum CULL_BIT { + CULL_UNRELEASE = 1<<1, + CULL_PID = 1<<2, + CULL_TGID = 1<<3, + CULL_COMM = 1<<4, + CULL_STACKTRACE = 1<<5 }; struct filter_condition { pid_t tgid; @@ -61,7 +68,7 @@ static regex_t free_ts_nsec_pattern; static struct block_list *list; static int list_size; static int max_size; -static int cull_st; +static int cull; static int filter; int read_block(char *buf, int buf_size, FILE *fin) @@ -142,6 +149,36 @@ static int compare_free_ts(const void *p return l1->free_ts_nsec < l2->free_ts_nsec ? -1 : 1; } + +static int compare_release(const void *p1, const void *p2) +{ + const struct block_list *l1 = p1, *l2 = p2; + + if (!l1->free_ts_nsec && !l2->free_ts_nsec) + return 0; + if (l1->free_ts_nsec && l2->free_ts_nsec) + return 0; + return l1->free_ts_nsec ? 1 : -1; +} + + +static int compare_cull_condition(const void *p1, const void *p2) +{ + if (cull == 0) + return compare_txt(p1, p2); + if ((cull & CULL_STACKTRACE) && compare_stacktrace(p1, p2)) + return compare_stacktrace(p1, p2); + if ((cull & CULL_PID) && compare_pid(p1, p2)) + return compare_pid(p1, p2); + if ((cull & CULL_TGID) && compare_tgid(p1, p2)) + return compare_tgid(p1, p2); + if ((cull & CULL_COMM) && compare_comm(p1, p2)) + return compare_comm(p1, p2); + if ((cull & CULL_UNRELEASE) && compare_release(p1, p2)) + return compare_release(p1, p2); + return 0; +} + static int search_pattern(regex_t *pattern, char *pattern_str, char *buf) { int err, val_len; @@ -170,6 +207,38 @@ static void check_regcomp(regex_t *patte } } +static char **explode(char sep, const char *str, int *size) +{ + int count = 0, len = strlen(str); + int lastindex = -1, j = 0; + + for (int i = 0; i < len; i++) + if (str[i] == sep) + count++; + char **ret = calloc(++count, sizeof(char *)); + + for (int i = 0; i < len; i++) { + if (str[i] == sep) { + ret[j] = calloc(i - lastindex, sizeof(char)); + memcpy(ret[j++], str + lastindex + 1, i - lastindex - 1); + lastindex = i; + } + } + if (lastindex <= len - 1) { + ret[j] = calloc(len - lastindex, sizeof(char)); + memcpy(ret[j++], str + lastindex + 1, strlen(str) - 1 - lastindex); + } + *size = j; + return ret; +} + +static void free_explode(char **arr, int size) +{ + for (int i = 0; i < size; i++) + free(arr[i]); + free(arr); +} + # define FIELD_BUFF 25 static int get_page_num(char *buf) @@ -277,16 +346,16 @@ static char *get_comm(char *buf) static bool is_need(char *buf) { - if ((filter & FILTER_UNRELEASE) != 0 && get_free_ts_nsec(buf) != 0) + if ((filter & FILTER_UNRELEASE) && get_free_ts_nsec(buf) != 0) return false; - if ((filter & FILTER_PID) != 0 && get_pid(buf) != fc.pid) + if ((filter & FILTER_PID) && get_pid(buf) != fc.pid) return false; - if ((filter & FILTER_TGID) != 0 && get_tgid(buf) != fc.tgid) + if ((filter & FILTER_TGID) && get_tgid(buf) != fc.tgid) return false; char *comm = get_comm(buf); - if ((filter & FILTER_TASK_COMM_NAME) != 0 && + if ((filter & FILTER_COMM) && strncmp(comm, fc.comm, TASK_COMM_LEN) != 0) { free(comm); return false; @@ -335,6 +404,30 @@ static void add_list(char *buf, int len) } } +static bool parse_cull_args(const char *arg_str) +{ + int size = 0; + char **args = explode(',', arg_str, &size); + + for (int i = 0; i < size; ++i) + if (!strcmp(args[i], "pid") || !strcmp(args[i], "p")) + cull |= CULL_PID; + else if (!strcmp(args[i], "tgid") || !strcmp(args[i], "tg")) + cull |= CULL_TGID; + else if (!strcmp(args[i], "name") || !strcmp(args[i], "n")) + cull |= CULL_COMM; + else if (!strcmp(args[i], "stacktrace") || !strcmp(args[i], "st")) + cull |= CULL_STACKTRACE; + else if (!strcmp(args[i], "free") || !strcmp(args[i], "f")) + cull |= CULL_UNRELEASE; + else { + free_explode(args, size); + return false; + } + free_explode(args, size); + return true; +} + #define BUF_SIZE (128 * 1024) static void usage(void) @@ -353,6 +446,7 @@ static void usage(void) "--pid <PID>\tSelect by pid. This selects the information of blocks whose process ID number equals to <PID>.\n" "--tgid <TGID>\tSelect by tgid. This selects the information of blocks whose Thread Group ID number equals to <TGID>.\n" "--name <command>\n\t\tSelect by command name. This selects the information of blocks whose command name identical to <command>.\n" + "--cull <rules>\tCull by user-defined rules. <rules> is a single argument in the form of a comma-separated list with some common fields predefined\n" ); } @@ -368,6 +462,7 @@ int main(int argc, char **argv) { "pid", required_argument, NULL, 1 }, { "tgid", required_argument, NULL, 2 }, { "name", required_argument, NULL, 3 }, + { "cull", required_argument, NULL, 4 }, { 0, 0, 0, 0}, }; @@ -377,7 +472,7 @@ int main(int argc, char **argv) cmp = compare_ts; break; case 'c': - cull_st = 1; + cull = cull | CULL_STACKTRACE; break; case 'f': filter = filter | FILTER_UNRELEASE; @@ -422,10 +517,17 @@ int main(int argc, char **argv) } break; case 3: - filter = filter | FILTER_TASK_COMM_NAME; + filter = filter | FILTER_COMM; strncpy(fc.comm, optarg, TASK_COMM_LEN); fc.comm[TASK_COMM_LEN-1] = '\0'; break; + case 4: + if (!parse_cull_args(optarg)) { + printf("wrong argument after --cull in from the command line:%s\n", + optarg); + exit(1); + } + break; default: usage(); exit(1); @@ -472,20 +574,13 @@ int main(int argc, char **argv) printf("sorting ....\n"); - if (cull_st == 1) - qsort(list, list_size, sizeof(list[0]), compare_stacktrace); - else - qsort(list, list_size, sizeof(list[0]), compare_txt); - - + qsort(list, list_size, sizeof(list[0]), compare_cull_condition); printf("culling\n"); - long offset = cull_st ? &list[0].stacktrace - &list[0].txt : 0; - for (i = count = 0; i < list_size; i++) { if (count == 0 || - strcmp(*(&list[count-1].txt+offset), *(&list[i].txt+offset)) != 0) { + compare_cull_condition((void *)(&list[count-1]), (void *)(&list[i])) != 0) { list[count++] = list[i]; } else { list[count-1].num += list[i].num; @@ -496,12 +591,25 @@ int main(int argc, char **argv) qsort(list, count, sizeof(list[0]), cmp); for (i = 0; i < count; i++) { - if (cull_st == 0) + if (cull == 0) fprintf(fout, "%d times, %d pages:\n%s\n", list[i].num, list[i].page_num, list[i].txt); - else - fprintf(fout, "%d times, %d pages:\n%s\n", - list[i].num, list[i].page_num, list[i].stacktrace); + else { + fprintf(fout, "%d times, %d pages", + list[i].num, list[i].page_num); + if (cull & CULL_PID || filter & FILTER_PID) + fprintf(fout, ", PID %d", list[i].pid); + if (cull & CULL_TGID || filter & FILTER_TGID) + fprintf(fout, ", TGID %d", list[i].pid); + if (cull & CULL_COMM || filter & FILTER_COMM) + fprintf(fout, ", task_comm_name: %s", list[i].comm); + if (cull & CULL_UNRELEASE) + fprintf(fout, " (%s)", + list[i].free_ts_nsec ? "UNRELEASED" : "RELEASED"); + if (cull & CULL_STACKTRACE) + fprintf(fout, ":\n%s", list[i].stacktrace); + fprintf(fout, "\n"); + } } regfree(&order_pattern); regfree(&pid_pattern); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 022/114] mm: unexport page_init_poison 2022-03-25 1:07 incoming Andrew Morton ` (20 preceding siblings ...) 2022-03-25 1:09 ` [patch 021/114] tools/vm/page_owner_sort.c: support for user-defined culling rules Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 023/114] selftest/vm: add util.h and and move helper functions there Andrew Morton ` (90 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: david, hch, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Christoph Hellwig <hch@lst.de> Subject: mm: unexport page_init_poison page_init_poison is only used in core MM code, so unexport it. Link: https://lkml.kernel.org/r/20220207063446.1833404-1-hch@lst.de Signed-off-by: Christoph Hellwig <hch@lst.de> Reviewed-by: David Hildenbrand <david@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/debug.c | 1 - 1 file changed, 1 deletion(-) --- a/mm/debug.c~mm-unexport-page_init_poison +++ a/mm/debug.c @@ -261,5 +261,4 @@ void page_init_poison(struct page *page, if (page_init_poisoning) memset(page, PAGE_POISON_PATTERN, size); } -EXPORT_SYMBOL_GPL(page_init_poison); #endif /* CONFIG_DEBUG_VM */ _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 023/114] selftest/vm: add util.h and and move helper functions there 2022-03-25 1:07 incoming Andrew Morton ` (21 preceding siblings ...) 2022-03-25 1:09 ` [patch 022/114] mm: unexport page_init_poison Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 024/114] selftest/vm: add helpers to detect PAGE_SIZE and PAGE_SHIFT Andrew Morton ` (89 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: shuah, rppt, aneesh.kumar, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com> Subject: selftest/vm: add util.h and and move helper functions there Avoid code duplication by adding util.h. No functional change in this patch. Link: https://lkml.kernel.org/r/20220307054355.149820-1-aneesh.kumar@linux.ibm.com Signed-off-by: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com> Cc: Shuah Khan <shuah@kernel.org> Cc: Mike Rapoport <rppt@linux.ibm.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/testing/selftests/vm/ksm_tests.c | 38 ------------ tools/testing/selftests/vm/transhuge-stress.c | 41 +------------ tools/testing/selftests/vm/util.h | 48 ++++++++++++++++ 3 files changed, 52 insertions(+), 75 deletions(-) --- a/tools/testing/selftests/vm/ksm_tests.c~selftest-vm-add-utilh-and-and-move-helper-functions-there +++ a/tools/testing/selftests/vm/ksm_tests.c @@ -12,6 +12,7 @@ #include "../kselftest.h" #include "../../../../include/vdso/time64.h" +#include "util.h" #define KSM_SYSFS_PATH "/sys/kernel/mm/ksm/" #define KSM_FP(s) (KSM_SYSFS_PATH s) @@ -22,15 +23,6 @@ #define KSM_MERGE_ACROSS_NODES_DEFAULT true #define MB (1ul << 20) -#define PAGE_SHIFT 12 -#define HPAGE_SHIFT 21 - -#define PAGE_SIZE (1 << PAGE_SHIFT) -#define HPAGE_SIZE (1 << HPAGE_SHIFT) - -#define PAGEMAP_PRESENT(ent) (((ent) & (1ull << 63)) != 0) -#define PAGEMAP_PFN(ent) ((ent) & ((1ull << 55) - 1)) - struct ksm_sysfs { unsigned long max_page_sharing; unsigned long merge_across_nodes; @@ -456,34 +448,6 @@ err_out: return KSFT_FAIL; } -int64_t allocate_transhuge(void *ptr, int pagemap_fd) -{ - uint64_t ent[2]; - - /* drop pmd */ - if (mmap(ptr, HPAGE_SIZE, PROT_READ | PROT_WRITE, - MAP_FIXED | MAP_ANONYMOUS | - MAP_NORESERVE | MAP_PRIVATE, -1, 0) != ptr) - errx(2, "mmap transhuge"); - - if (madvise(ptr, HPAGE_SIZE, MADV_HUGEPAGE)) - err(2, "MADV_HUGEPAGE"); - - /* allocate transparent huge page */ - *(volatile void **)ptr = ptr; - - if (pread(pagemap_fd, ent, sizeof(ent), - (uintptr_t)ptr >> (PAGE_SHIFT - 3)) != sizeof(ent)) - err(2, "read pagemap"); - - if (PAGEMAP_PRESENT(ent[0]) && PAGEMAP_PRESENT(ent[1]) && - PAGEMAP_PFN(ent[0]) + 1 == PAGEMAP_PFN(ent[1]) && - !(PAGEMAP_PFN(ent[0]) & ((1 << (HPAGE_SHIFT - PAGE_SHIFT)) - 1))) - return PAGEMAP_PFN(ent[0]); - - return -1; -} - static int ksm_merge_hugepages_time(int mapping, int prot, int timeout, size_t map_size) { void *map_ptr, *map_ptr_orig; --- a/tools/testing/selftests/vm/transhuge-stress.c~selftest-vm-add-utilh-and-and-move-helper-functions-there +++ a/tools/testing/selftests/vm/transhuge-stress.c @@ -15,48 +15,12 @@ #include <fcntl.h> #include <string.h> #include <sys/mman.h> +#include "util.h" -#define PAGE_SHIFT 12 -#define HPAGE_SHIFT 21 - -#define PAGE_SIZE (1 << PAGE_SHIFT) -#define HPAGE_SIZE (1 << HPAGE_SHIFT) - -#define PAGEMAP_PRESENT(ent) (((ent) & (1ull << 63)) != 0) -#define PAGEMAP_PFN(ent) ((ent) & ((1ull << 55) - 1)) - -int pagemap_fd; int backing_fd = -1; int mmap_flags = MAP_ANONYMOUS | MAP_NORESERVE | MAP_PRIVATE; #define PROT_RW (PROT_READ | PROT_WRITE) -int64_t allocate_transhuge(void *ptr) -{ - uint64_t ent[2]; - - /* drop pmd */ - if (mmap(ptr, HPAGE_SIZE, PROT_RW, MAP_FIXED | mmap_flags, - backing_fd, 0) != ptr) - errx(2, "mmap transhuge"); - - if (madvise(ptr, HPAGE_SIZE, MADV_HUGEPAGE)) - err(2, "MADV_HUGEPAGE"); - - /* allocate transparent huge page */ - *(volatile void **)ptr = ptr; - - if (pread(pagemap_fd, ent, sizeof(ent), - (uintptr_t)ptr >> (PAGE_SHIFT - 3)) != sizeof(ent)) - err(2, "read pagemap"); - - if (PAGEMAP_PRESENT(ent[0]) && PAGEMAP_PRESENT(ent[1]) && - PAGEMAP_PFN(ent[0]) + 1 == PAGEMAP_PFN(ent[1]) && - !(PAGEMAP_PFN(ent[0]) & ((1 << (HPAGE_SHIFT - PAGE_SHIFT)) - 1))) - return PAGEMAP_PFN(ent[0]); - - return -1; -} - int main(int argc, char **argv) { size_t ram, len; @@ -67,6 +31,7 @@ int main(int argc, char **argv) double s; uint8_t *map; size_t map_len; + int pagemap_fd; ram = sysconf(_SC_PHYS_PAGES); if (ram > SIZE_MAX / sysconf(_SC_PAGESIZE) / 4) @@ -122,7 +87,7 @@ int main(int argc, char **argv) for (p = ptr; p < ptr + len; p += HPAGE_SIZE) { int64_t pfn; - pfn = allocate_transhuge(p); + pfn = allocate_transhuge(p, pagemap_fd); if (pfn < 0) { nr_failed++; --- /dev/null +++ a/tools/testing/selftests/vm/util.h @@ -0,0 +1,48 @@ +/* SPDX-License-Identifier: GPL-2.0 */ + +#ifndef __KSELFTEST_VM_UTIL_H +#define __KSELFTEST_VM_UTIL_H + +#include <stdint.h> +#include <sys/mman.h> +#include <err.h> + +#define PAGE_SHIFT 12 +#define HPAGE_SHIFT 21 + +#define PAGE_SIZE (1 << PAGE_SHIFT) +#define HPAGE_SIZE (1 << HPAGE_SHIFT) + +#define PAGEMAP_PRESENT(ent) (((ent) & (1ull << 63)) != 0) +#define PAGEMAP_PFN(ent) ((ent) & ((1ull << 55) - 1)) + + +static inline int64_t allocate_transhuge(void *ptr, int pagemap_fd) +{ + uint64_t ent[2]; + + /* drop pmd */ + if (mmap(ptr, HPAGE_SIZE, PROT_READ | PROT_WRITE, + MAP_FIXED | MAP_ANONYMOUS | + MAP_NORESERVE | MAP_PRIVATE, -1, 0) != ptr) + errx(2, "mmap transhuge"); + + if (madvise(ptr, HPAGE_SIZE, MADV_HUGEPAGE)) + err(2, "MADV_HUGEPAGE"); + + /* allocate transparent huge page */ + *(volatile void **)ptr = ptr; + + if (pread(pagemap_fd, ent, sizeof(ent), + (uintptr_t)ptr >> (PAGE_SHIFT - 3)) != sizeof(ent)) + err(2, "read pagemap"); + + if (PAGEMAP_PRESENT(ent[0]) && PAGEMAP_PRESENT(ent[1]) && + PAGEMAP_PFN(ent[0]) + 1 == PAGEMAP_PFN(ent[1]) && + !(PAGEMAP_PFN(ent[0]) & ((1 << (HPAGE_SHIFT - PAGE_SHIFT)) - 1))) + return PAGEMAP_PFN(ent[0]); + + return -1; +} + +#endif _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 024/114] selftest/vm: add helpers to detect PAGE_SIZE and PAGE_SHIFT 2022-03-25 1:07 incoming Andrew Morton ` (22 preceding siblings ...) 2022-03-25 1:09 ` [patch 023/114] selftest/vm: add util.h and and move helper functions there Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 025/114] mm: delete __ClearPageWaiters() Andrew Morton ` (88 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: shuah, rppt, aneesh.kumar, rppt, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Mike Rapoport <rppt@kernel.org> Subject: selftest/vm: add helpers to detect PAGE_SIZE and PAGE_SHIFT PAGE_SIZE is not 4096 in many configurations, particularly ppc64 uses 64K pages in majority of cases. Add helpers to detect PAGE_SIZE and PAGE_SHIFT dynamically. Without this tests are broken w.r.t reading /proc/self/pagemap if (pread(pagemap_fd, ent, sizeof(ent), (uintptr_t)ptr >> (PAGE_SHIFT - 3)) != sizeof(ent)) err(2, "read pagemap"); Link: https://lkml.kernel.org/r/20220307054355.149820-2-aneesh.kumar@linux.ibm.com Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Signed-off-by: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com> Cc: Shuah Khan <shuah@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/testing/selftests/vm/gup_test.c | 3 +- tools/testing/selftests/vm/util.h | 27 +++++++++++++++++++++--- 2 files changed, 26 insertions(+), 4 deletions(-) --- a/tools/testing/selftests/vm/gup_test.c~selftest-vm-add-helpers-to-detect-page_size-and-page_shift +++ a/tools/testing/selftests/vm/gup_test.c @@ -10,8 +10,9 @@ #include <assert.h> #include "../../../../mm/gup_test.h" +#include "util.h" + #define MB (1UL << 20) -#define PAGE_SIZE sysconf(_SC_PAGESIZE) /* Just the flags we need, copied from mm.h: */ #define FOLL_WRITE 0x01 /* check pte is writable */ --- a/tools/testing/selftests/vm/util.h~selftest-vm-add-helpers-to-detect-page_size-and-page_shift +++ a/tools/testing/selftests/vm/util.h @@ -6,11 +6,32 @@ #include <stdint.h> #include <sys/mman.h> #include <err.h> +#include <string.h> /* ffsl() */ +#include <unistd.h> /* _SC_PAGESIZE */ -#define PAGE_SHIFT 12 -#define HPAGE_SHIFT 21 +static unsigned int __page_size; +static unsigned int __page_shift; -#define PAGE_SIZE (1 << PAGE_SHIFT) +static inline unsigned int page_size(void) +{ + if (!__page_size) + __page_size = sysconf(_SC_PAGESIZE); + return __page_size; +} + +static inline unsigned int page_shift(void) +{ + if (!__page_shift) + __page_shift = (ffsl(page_size()) - 1); + return __page_shift; +} + +#define PAGE_SHIFT (page_shift()) +#define PAGE_SIZE (page_size()) +/* + * On ppc64 this will only work with radix 2M hugepage size + */ +#define HPAGE_SHIFT 21 #define HPAGE_SIZE (1 << HPAGE_SHIFT) #define PAGEMAP_PRESENT(ent) (((ent) & (1ull << 63)) != 0) _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 025/114] mm: delete __ClearPageWaiters() 2022-03-25 1:07 incoming Andrew Morton ` (23 preceding siblings ...) 2022-03-25 1:09 ` [patch 024/114] selftest/vm: add helpers to detect PAGE_SIZE and PAGE_SHIFT Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 026/114] mm: filemap_unaccount_folio() large skip mapcount fixup Andrew Morton ` (87 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: yuzhao, willy, shy828301, npiggin, mhocko, david, hughd, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Hugh Dickins <hughd@google.com> Subject: mm: delete __ClearPageWaiters() The PG_waiters bit is not included in PAGE_FLAGS_CHECK_AT_FREE, and vmscan.c's free_unref_page_list() callers rely on that not to generate bad_page() alerts. So __page_cache_release(), put_pages_list() and release_pages() (and presumably copy-and-pasted free_zone_device_page()) are redundant and misleading to make a special point of clearing it (as the "__" implies, it could only safely be used on the freeing path). Delete __ClearPageWaiters(). Remark on this in one of the "possible" comments in folio_wake_bit(), and delete the superfluous comments. Link: https://lkml.kernel.org/r/3eafa969-5b1a-accf-88fe-318784c791a@google.com Signed-off-by: Hugh Dickins <hughd@google.com> Tested-by: Yu Zhao <yuzhao@google.com> Reviewed-by: Yang Shi <shy828301@gmail.com> Reviewed-by: David Hildenbrand <david@redhat.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Nicholas Piggin <npiggin@gmail.com> Cc: Yu Zhao <yuzhao@google.com> Cc: Michal Hocko <mhocko@suse.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/page-flags.h | 2 +- mm/filemap.c | 23 ++++++++--------------- mm/memremap.c | 2 -- mm/swap.c | 4 ---- 4 files changed, 9 insertions(+), 22 deletions(-) --- a/include/linux/page-flags.h~mm-delete-__clearpagewaiters +++ a/include/linux/page-flags.h @@ -481,7 +481,7 @@ static inline int TestClearPage##uname(s TESTSETFLAG_FALSE(uname, lname) TESTCLEARFLAG_FALSE(uname, lname) __PAGEFLAG(Locked, locked, PF_NO_TAIL) -PAGEFLAG(Waiters, waiters, PF_ONLY_HEAD) __CLEARPAGEFLAG(Waiters, waiters, PF_ONLY_HEAD) +PAGEFLAG(Waiters, waiters, PF_ONLY_HEAD) PAGEFLAG(Error, error, PF_NO_TAIL) TESTCLEARFLAG(Error, error, PF_NO_TAIL) PAGEFLAG(Referenced, referenced, PF_HEAD) TESTCLEARFLAG(Referenced, referenced, PF_HEAD) --- a/mm/filemap.c~mm-delete-__clearpagewaiters +++ a/mm/filemap.c @@ -1185,24 +1185,17 @@ static void folio_wake_bit(struct folio } /* - * It is possible for other pages to have collided on the waitqueue - * hash, so in that case check for a page match. That prevents a long- - * term waiter + * It's possible to miss clearing waiters here, when we woke our page + * waiters, but the hashed waitqueue has waiters for other pages on it. + * That's okay, it's a rare case. The next waker will clear it. * - * It is still possible to miss a case here, when we woke page waiters - * and removed them from the waitqueue, but there are still other - * page waiters. + * Note that, depending on the page pool (buddy, hugetlb, ZONE_DEVICE, + * other), the flag may be cleared in the course of freeing the page; + * but that is not required for correctness. */ - if (!waitqueue_active(q) || !key.page_match) { + if (!waitqueue_active(q) || !key.page_match) folio_clear_waiters(folio); - /* - * It's possible to miss clearing Waiters here, when we woke - * our page waiters, but the hashed waitqueue has waiters for - * other pages on it. - * - * That's okay, it's a rare case. The next waker will clear it. - */ - } + spin_unlock_irqrestore(&q->lock, flags); } --- a/mm/memremap.c~mm-delete-__clearpagewaiters +++ a/mm/memremap.c @@ -456,8 +456,6 @@ void free_zone_device_page(struct page * if (WARN_ON_ONCE(!page->pgmap->ops || !page->pgmap->ops->page_free)) return; - __ClearPageWaiters(page); - mem_cgroup_uncharge(page_folio(page)); /* --- a/mm/swap.c~mm-delete-__clearpagewaiters +++ a/mm/swap.c @@ -97,7 +97,6 @@ static void __page_cache_release(struct mod_zone_page_state(page_zone(page), NR_MLOCK, -nr_pages); count_vm_events(UNEVICTABLE_PGCLEARED, nr_pages); } - __ClearPageWaiters(page); } static void __put_single_page(struct page *page) @@ -152,7 +151,6 @@ void put_pages_list(struct list_head *pa continue; } /* Cannot be PageLRU because it's passed to us using the lru */ - __ClearPageWaiters(page); } free_unref_page_list(pages); @@ -971,8 +969,6 @@ void release_pages(struct page **pages, count_vm_event(UNEVICTABLE_PGCLEARED); } - __ClearPageWaiters(page); - list_add(&page->lru, &pages_to_free); } if (lruvec) _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 026/114] mm: filemap_unaccount_folio() large skip mapcount fixup 2022-03-25 1:07 incoming Andrew Morton ` (24 preceding siblings ...) 2022-03-25 1:09 ` [patch 025/114] mm: delete __ClearPageWaiters() Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 027/114] mm/thp: fix NR_FILE_MAPPED accounting in page_*_file_rmap() Andrew Morton ` (86 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: willy, hughd, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Hugh Dickins <hughd@google.com> Subject: mm: filemap_unaccount_folio() large skip mapcount fixup The page_mapcount_reset() when folio_mapped() while mapping_exiting() was devised long before there were huge or compound pages in the cache. It is still valid for small pages, but not at all clear what's right to check and reset on large pages. Just don't try when folio_test_large(). Link: https://lkml.kernel.org/r/879c4426-4122-da9c-1a86-697f2c9a083@google.com Signed-off-by: Hugh Dickins <hughd@google.com> Cc: Matthew Wilcox <willy@infradead.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/filemap.c | 26 +++++++++++++------------- 1 file changed, 13 insertions(+), 13 deletions(-) --- a/mm/filemap.c~mm-filemap_unaccount_folio-large-skip-mapcount-fixup +++ a/mm/filemap.c @@ -152,25 +152,25 @@ static void filemap_unaccount_folio(stru VM_BUG_ON_FOLIO(folio_mapped(folio), folio); if (!IS_ENABLED(CONFIG_DEBUG_VM) && unlikely(folio_mapped(folio))) { - int mapcount; - pr_alert("BUG: Bad page cache in process %s pfn:%05lx\n", current->comm, folio_pfn(folio)); dump_page(&folio->page, "still mapped when deleted"); dump_stack(); add_taint(TAINT_BAD_PAGE, LOCKDEP_NOW_UNRELIABLE); - mapcount = page_mapcount(&folio->page); - if (mapping_exiting(mapping) && - folio_ref_count(folio) >= mapcount + 2) { - /* - * All vmas have already been torn down, so it's - * a good bet that actually the folio is unmapped, - * and we'd prefer not to leak it: if we're wrong, - * some other bad page check should catch it later. - */ - page_mapcount_reset(&folio->page); - folio_ref_sub(folio, mapcount); + if (mapping_exiting(mapping) && !folio_test_large(folio)) { + int mapcount = page_mapcount(&folio->page); + + if (folio_ref_count(folio) >= mapcount + 2) { + /* + * All vmas have already been torn down, so it's + * a good bet that actually the page is unmapped + * and we'd rather not leak it: if we're wrong, + * another bad page check should catch it later. + */ + page_mapcount_reset(&folio->page); + folio_ref_sub(folio, mapcount); + } } } _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 027/114] mm/thp: fix NR_FILE_MAPPED accounting in page_*_file_rmap() 2022-03-25 1:07 incoming Andrew Morton ` (25 preceding siblings ...) 2022-03-25 1:09 ` [patch 026/114] mm: filemap_unaccount_folio() large skip mapcount fixup Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:09 ` [patch 028/114] mm/migration: add trace events for THP migrations Andrew Morton ` (85 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: shy828301, kirill.shutemov, hughd, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Hugh Dickins <hughd@google.com> Subject: mm/thp: fix NR_FILE_MAPPED accounting in page_*_file_rmap() NR_FILE_MAPPED accounting in mm/rmap.c (for /proc/meminfo "Mapped" and /proc/vmstat "nr_mapped" and the memcg's memory.stat "mapped_file") is slightly flawed for file or shmem huge pages. It is well thought out, and looks convincing, but there's a racy case when the careful counting in page_remove_file_rmap() (without page lock) gets discarded. So that in a workload like two "make -j20" kernel builds under memory pressure, with cc1 on hugepage text, "Mapped" can easily grow by a spurious 5MB or more on each iteration, ending up implausibly bigger than most other numbers in /proc/meminfo. And, hypothetically, might grow to the point of seriously interfering in mm/vmscan.c's heuristics, which do take NR_FILE_MAPPED into some consideration. Fixed by moving the __mod_lruvec_page_state() down to where it will not be missed before return (and I've grown a bit tired of that oft-repeated but-not-everywhere comment on the __ness: it gets lost in the move here). Does page_add_file_rmap() need the same change? I suspect not, because page lock is held in all relevant cases, and its skipping case looks safe; but it's much easier to be sure, if we do make the same change. Link: https://lkml.kernel.org/r/e02e52a1-8550-a57c-ed29-f51191ea2375@google.com Fixes: dd78fedde4b9 ("rmap: support file thp") Signed-off-by: Hugh Dickins <hughd@google.com> Reviewed-by: Yang Shi <shy828301@gmail.com> Cc: "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/rmap.c | 31 ++++++++++++++----------------- 1 file changed, 14 insertions(+), 17 deletions(-) --- a/mm/rmap.c~mm-thp-fix-nr_file_mapped-accounting-in-page__file_rmap +++ a/mm/rmap.c @@ -1236,14 +1236,14 @@ void page_add_new_anon_rmap(struct page void page_add_file_rmap(struct page *page, struct vm_area_struct *vma, bool compound) { - int i, nr = 1; + int i, nr = 0; VM_BUG_ON_PAGE(compound && !PageTransHuge(page), page); lock_page_memcg(page); if (compound && PageTransHuge(page)) { int nr_pages = thp_nr_pages(page); - for (i = 0, nr = 0; i < nr_pages; i++) { + for (i = 0; i < nr_pages; i++) { if (atomic_inc_and_test(&page[i]._mapcount)) nr++; } @@ -1271,11 +1271,12 @@ void page_add_file_rmap(struct page *pag VM_WARN_ON_ONCE(!PageLocked(page)); SetPageDoubleMap(compound_head(page)); } - if (!atomic_inc_and_test(&page->_mapcount)) - goto out; + if (atomic_inc_and_test(&page->_mapcount)) + nr++; } - __mod_lruvec_page_state(page, NR_FILE_MAPPED, nr); out: + if (nr) + __mod_lruvec_page_state(page, NR_FILE_MAPPED, nr); unlock_page_memcg(page); mlock_vma_page(page, vma, compound); @@ -1283,7 +1284,7 @@ out: static void page_remove_file_rmap(struct page *page, bool compound) { - int i, nr = 1; + int i, nr = 0; VM_BUG_ON_PAGE(compound && !PageHead(page), page); @@ -1298,12 +1299,12 @@ static void page_remove_file_rmap(struct if (compound && PageTransHuge(page)) { int nr_pages = thp_nr_pages(page); - for (i = 0, nr = 0; i < nr_pages; i++) { + for (i = 0; i < nr_pages; i++) { if (atomic_add_negative(-1, &page[i]._mapcount)) nr++; } if (!atomic_add_negative(-1, compound_mapcount_ptr(page))) - return; + goto out; if (PageSwapBacked(page)) __mod_lruvec_page_state(page, NR_SHMEM_PMDMAPPED, -nr_pages); @@ -1311,16 +1312,12 @@ static void page_remove_file_rmap(struct __mod_lruvec_page_state(page, NR_FILE_PMDMAPPED, -nr_pages); } else { - if (!atomic_add_negative(-1, &page->_mapcount)) - return; + if (atomic_add_negative(-1, &page->_mapcount)) + nr++; } - - /* - * We use the irq-unsafe __{inc|mod}_lruvec_page_state because - * these counters are not modified in interrupt context, and - * pte lock(a spinlock) is held, which implies preemption disabled. - */ - __mod_lruvec_page_state(page, NR_FILE_MAPPED, -nr); +out: + if (nr) + __mod_lruvec_page_state(page, NR_FILE_MAPPED, -nr); } static void page_remove_anon_compound_rmap(struct page *page) _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 028/114] mm/migration: add trace events for THP migrations 2022-03-25 1:07 incoming Andrew Morton ` (26 preceding siblings ...) 2022-03-25 1:09 ` [patch 027/114] mm/thp: fix NR_FILE_MAPPED accounting in page_*_file_rmap() Andrew Morton @ 2022-03-25 1:09 ` Andrew Morton 2022-03-25 1:10 ` [patch 029/114] mm/migration: add trace events for base page and HugeTLB migrations Andrew Morton ` (84 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:09 UTC (permalink / raw) To: ziy, willy, rostedt, paulus, naoya.horiguchi, mpe, mingo, jhubbard, anshuman.khandual, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Anshuman Khandual <anshuman.khandual@arm.com> Subject: mm/migration: add trace events for THP migrations Patch series "mm/migration: Add trace events", v3. This adds trace events for all migration scenarios including base page, THP and HugeTLB. This patch (of 3): This adds two trace events for PMD based THP migration without split. These events closely follow the implementation details like setting and removing of PMD migration entries, which are essential operations for THP migration. This moves CREATE_TRACE_POINTS into generic THP from powerpc for these new trace events to be available on other platforms as well. Link: https://lkml.kernel.org/r/1643368182-9588-1-git-send-email-anshuman.khandual@arm.com Link: https://lkml.kernel.org/r/1643368182-9588-2-git-send-email-anshuman.khandual@arm.com Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com> Cc: Steven Rostedt <rostedt@goodmis.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Zi Yan <ziy@nvidia.com> Cc: Naoya Horiguchi <naoya.horiguchi@nec.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Paul Mackerras <paulus@samba.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/powerpc/mm/book3s64/trace.c | 1 - include/trace/events/thp.h | 27 +++++++++++++++++++++++++++ mm/huge_memory.c | 5 +++++ 3 files changed, 32 insertions(+), 1 deletion(-) --- a/arch/powerpc/mm/book3s64/trace.c~mm-migration-add-trace-events-for-thp-migrations +++ a/arch/powerpc/mm/book3s64/trace.c @@ -3,6 +3,5 @@ * This file is for defining trace points and trace related helpers. */ #ifdef CONFIG_TRANSPARENT_HUGEPAGE -#define CREATE_TRACE_POINTS #include <trace/events/thp.h> #endif --- a/include/trace/events/thp.h~mm-migration-add-trace-events-for-thp-migrations +++ a/include/trace/events/thp.h @@ -48,6 +48,33 @@ TRACE_EVENT(hugepage_update, TP_printk("hugepage update at addr 0x%lx and pte = 0x%lx clr = 0x%lx, set = 0x%lx", __entry->addr, __entry->pte, __entry->clr, __entry->set) ); +DECLARE_EVENT_CLASS(migration_pmd, + + TP_PROTO(unsigned long addr, unsigned long pmd), + + TP_ARGS(addr, pmd), + + TP_STRUCT__entry( + __field(unsigned long, addr) + __field(unsigned long, pmd) + ), + + TP_fast_assign( + __entry->addr = addr; + __entry->pmd = pmd; + ), + TP_printk("addr=%lx, pmd=%lx", __entry->addr, __entry->pmd) +); + +DEFINE_EVENT(migration_pmd, set_migration_pmd, + TP_PROTO(unsigned long addr, unsigned long pmd), + TP_ARGS(addr, pmd) +); + +DEFINE_EVENT(migration_pmd, remove_migration_pmd, + TP_PROTO(unsigned long addr, unsigned long pmd), + TP_ARGS(addr, pmd) +); #endif /* _TRACE_THP_H */ /* This part must be outside protection */ --- a/mm/huge_memory.c~mm-migration-add-trace-events-for-thp-migrations +++ a/mm/huge_memory.c @@ -40,6 +40,9 @@ #include <asm/pgalloc.h> #include "internal.h" +#define CREATE_TRACE_POINTS +#include <trace/events/thp.h> + /* * By default, transparent hugepage support is disabled in order to avoid * risking an increased memory footprint for applications that are not @@ -3131,6 +3134,7 @@ void set_pmd_migration_entry(struct page set_pmd_at(mm, address, pvmw->pmd, pmdswp); page_remove_rmap(page, vma, true); put_page(page); + trace_set_migration_pmd(address, pmd_val(pmdswp)); } void remove_migration_pmd(struct page_vma_mapped_walk *pvmw, struct page *new) @@ -3163,5 +3167,6 @@ void remove_migration_pmd(struct page_vm /* No need to invalidate - it was non-present before */ update_mmu_cache_pmd(vma, address, pvmw->pmd); + trace_remove_migration_pmd(address, pmd_val(pmde)); } #endif _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 029/114] mm/migration: add trace events for base page and HugeTLB migrations 2022-03-25 1:07 incoming Andrew Morton ` (27 preceding siblings ...) 2022-03-25 1:09 ` [patch 028/114] mm/migration: add trace events for THP migrations Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 030/114] kasan, page_alloc: deduplicate should_skip_kasan_poison Andrew Morton ` (83 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: ziy, willy, rostedt, naoya.horiguchi, mingo, lkp, jhubbard, anshuman.khandual, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Anshuman Khandual <anshuman.khandual@arm.com> Subject: mm/migration: add trace events for base page and HugeTLB migrations This adds two trace events for base page and HugeTLB page migrations. These events, closely follow the implementation details like setting and removing of PTE migration entries, which are essential operations for migration. The new CREATE_TRACE_POINTS in <mm/rmap.c> covers both <events/migration.h> and <events/tlb.h> based trace events. Hence drop redundant CREATE_TRACE_POINTS from other places which could have otherwise conflicted during build. Link: https://lkml.kernel.org/r/1643368182-9588-3-git-send-email-anshuman.khandual@arm.com Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com> Reported-by: kernel test robot <lkp@intel.com> Cc: Steven Rostedt <rostedt@goodmis.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Zi Yan <ziy@nvidia.com> Cc: Naoya Horiguchi <naoya.horiguchi@nec.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Matthew Wilcox <willy@infradead.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/x86/mm/init.c | 1 - include/trace/events/migrate.h | 31 +++++++++++++++++++++++++++++++ mm/migrate.c | 4 +++- mm/rmap.c | 6 ++++++ 4 files changed, 40 insertions(+), 2 deletions(-) --- a/arch/x86/mm/init.c~mm-migration-add-trace-events-for-base-page-and-hugetlb-migrations +++ a/arch/x86/mm/init.c @@ -31,7 +31,6 @@ * We need to define the tracepoints somewhere, and tlb.c * is only compiled when SMP=y. */ -#define CREATE_TRACE_POINTS #include <trace/events/tlb.h> #include "mm_internal.h" --- a/include/trace/events/migrate.h~mm-migration-add-trace-events-for-base-page-and-hugetlb-migrations +++ a/include/trace/events/migrate.h @@ -105,6 +105,37 @@ TRACE_EVENT(mm_migrate_pages_start, __print_symbolic(__entry->reason, MIGRATE_REASON)) ); +DECLARE_EVENT_CLASS(migration_pte, + + TP_PROTO(unsigned long addr, unsigned long pte, int order), + + TP_ARGS(addr, pte, order), + + TP_STRUCT__entry( + __field(unsigned long, addr) + __field(unsigned long, pte) + __field(int, order) + ), + + TP_fast_assign( + __entry->addr = addr; + __entry->pte = pte; + __entry->order = order; + ), + + TP_printk("addr=%lx, pte=%lx order=%d", __entry->addr, __entry->pte, __entry->order) +); + +DEFINE_EVENT(migration_pte, set_migration_pte, + TP_PROTO(unsigned long addr, unsigned long pte, int order), + TP_ARGS(addr, pte, order) +); + +DEFINE_EVENT(migration_pte, remove_migration_pte, + TP_PROTO(unsigned long addr, unsigned long pte, int order), + TP_ARGS(addr, pte, order) +); + #endif /* _TRACE_MIGRATE_H */ /* This part must be outside protection */ --- a/mm/migrate.c~mm-migration-add-trace-events-for-base-page-and-hugetlb-migrations +++ a/mm/migrate.c @@ -53,7 +53,6 @@ #include <asm/tlbflush.h> -#define CREATE_TRACE_POINTS #include <trace/events/migrate.h> #include "internal.h" @@ -249,6 +248,9 @@ static bool remove_migration_pte(struct if (vma->vm_flags & VM_LOCKED) mlock_page_drain(smp_processor_id()); + trace_remove_migration_pte(pvmw.address, pte_val(pte), + compound_order(new)); + /* No need to invalidate - it was non-present before */ update_mmu_cache(vma, pvmw.address, pvmw.pte); } --- a/mm/rmap.c~mm-migration-add-trace-events-for-base-page-and-hugetlb-migrations +++ a/mm/rmap.c @@ -76,7 +76,9 @@ #include <asm/tlbflush.h> +#define CREATE_TRACE_POINTS #include <trace/events/tlb.h> +#include <trace/events/migrate.h> #include "internal.h" @@ -1849,6 +1851,8 @@ static bool try_to_migrate_one(struct fo if (pte_swp_uffd_wp(pteval)) swp_pte = pte_swp_mkuffd_wp(swp_pte); set_pte_at(mm, pvmw.address, pvmw.pte, swp_pte); + trace_set_migration_pte(pvmw.address, pte_val(swp_pte), + compound_order(&folio->page)); /* * No need to invalidate here it will synchronize on * against the special swap migration pte. @@ -1917,6 +1921,8 @@ static bool try_to_migrate_one(struct fo if (pte_uffd_wp(pteval)) swp_pte = pte_swp_mkuffd_wp(swp_pte); set_pte_at(mm, address, pvmw.pte, swp_pte); + trace_set_migration_pte(address, pte_val(swp_pte), + compound_order(&folio->page)); /* * No need to invalidate here it will synchronize on * against the special swap migration pte. _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 030/114] kasan, page_alloc: deduplicate should_skip_kasan_poison 2022-03-25 1:07 incoming Andrew Morton ` (28 preceding siblings ...) 2022-03-25 1:10 ` [patch 029/114] mm/migration: add trace events for base page and HugeTLB migrations Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 031/114] kasan, page_alloc: move tag_clear_highpage out of kernel_init_free_pages Andrew Morton ` (82 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, page_alloc: deduplicate should_skip_kasan_poison Patch series "kasan, vmalloc, arm64: add vmalloc tagging support for SW/HW_TAGS", v6. This patchset adds vmalloc tagging support for SW_TAGS and HW_TAGS KASAN modes. About half of patches are cleanups I went for along the way. None of them seem to be important enough to go through stable, so I decided not to split them out into separate patches/series. The patchset is partially based on an early version of the HW_TAGS patchset by Vincenzo that had vmalloc support. Thus, I added a Co-developed-by tag into a few patches. SW_TAGS vmalloc tagging support is straightforward. It reuses all of the generic KASAN machinery, but uses shadow memory to store tags instead of magic values. Naturally, vmalloc tagging requires adding a few kasan_reset_tag() annotations to the vmalloc code. HW_TAGS vmalloc tagging support stands out. HW_TAGS KASAN is based on Arm MTE, which can only assigns tags to physical memory. As a result, HW_TAGS KASAN only tags vmalloc() allocations, which are backed by page_alloc memory. It ignores vmap() and others. This patch (of 39): Currently, should_skip_kasan_poison() has two definitions: one for when CONFIG_DEFERRED_STRUCT_PAGE_INIT is enabled, one for when it's not. Instead of duplicating the checks, add a deferred_pages_enabled() helper and use it in a single should_skip_kasan_poison() definition. Also move should_skip_kasan_poison() closer to its caller and clarify all conditions in the comment. Link: https://lkml.kernel.org/r/cover.1643047180.git.andreyknvl@google.com Link: https://lkml.kernel.org/r/658b79f5fb305edaf7dc16bc52ea870d3220d4a8.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Will Deacon <will@kernel.org> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 55 +++++++++++++++++++++++++++------------------- 1 file changed, 33 insertions(+), 22 deletions(-) --- a/mm/page_alloc.c~kasan-page_alloc-deduplicate-should_skip_kasan_poison +++ a/mm/page_alloc.c @@ -378,25 +378,9 @@ int page_group_by_mobility_disabled __re */ static DEFINE_STATIC_KEY_TRUE(deferred_pages); -/* - * Calling kasan_poison_pages() only after deferred memory initialization - * has completed. Poisoning pages during deferred memory init will greatly - * lengthen the process and cause problem in large memory systems as the - * deferred pages initialization is done with interrupt disabled. - * - * Assuming that there will be no reference to those newly initialized - * pages before they are ever allocated, this should have no effect on - * KASAN memory tracking as the poison will be properly inserted at page - * allocation time. The only corner case is when pages are allocated by - * on-demand allocation and then freed again before the deferred pages - * initialization is done, but this is not likely to happen. - */ -static inline bool should_skip_kasan_poison(struct page *page, fpi_t fpi_flags) +static inline bool deferred_pages_enabled(void) { - return static_branch_unlikely(&deferred_pages) || - (!IS_ENABLED(CONFIG_KASAN_GENERIC) && - (fpi_flags & FPI_SKIP_KASAN_POISON)) || - PageSkipKASanPoison(page); + return static_branch_unlikely(&deferred_pages); } /* Returns true if the struct page for the pfn is uninitialised */ @@ -447,11 +431,9 @@ defer_init(int nid, unsigned long pfn, u return false; } #else -static inline bool should_skip_kasan_poison(struct page *page, fpi_t fpi_flags) +static inline bool deferred_pages_enabled(void) { - return (!IS_ENABLED(CONFIG_KASAN_GENERIC) && - (fpi_flags & FPI_SKIP_KASAN_POISON)) || - PageSkipKASanPoison(page); + return false; } static inline bool early_page_uninitialised(unsigned long pfn) @@ -1267,6 +1249,35 @@ out: return ret; } +/* + * Skip KASAN memory poisoning when either: + * + * 1. Deferred memory initialization has not yet completed, + * see the explanation below. + * 2. Skipping poisoning is requested via FPI_SKIP_KASAN_POISON, + * see the comment next to it. + * 3. Skipping poisoning is requested via __GFP_SKIP_KASAN_POISON, + * see the comment next to it. + * + * Poisoning pages during deferred memory init will greatly lengthen the + * process and cause problem in large memory systems as the deferred pages + * initialization is done with interrupt disabled. + * + * Assuming that there will be no reference to those newly initialized + * pages before they are ever allocated, this should have no effect on + * KASAN memory tracking as the poison will be properly inserted at page + * allocation time. The only corner case is when pages are allocated by + * on-demand allocation and then freed again before the deferred pages + * initialization is done, but this is not likely to happen. + */ +static inline bool should_skip_kasan_poison(struct page *page, fpi_t fpi_flags) +{ + return deferred_pages_enabled() || + (!IS_ENABLED(CONFIG_KASAN_GENERIC) && + (fpi_flags & FPI_SKIP_KASAN_POISON)) || + PageSkipKASanPoison(page); +} + static void kernel_init_free_pages(struct page *page, int numpages, bool zero_tags) { int i; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 031/114] kasan, page_alloc: move tag_clear_highpage out of kernel_init_free_pages 2022-03-25 1:07 incoming Andrew Morton ` (29 preceding siblings ...) 2022-03-25 1:10 ` [patch 030/114] kasan, page_alloc: deduplicate should_skip_kasan_poison Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 032/114] kasan, page_alloc: merge kasan_free_pages into free_pages_prepare Andrew Morton ` (81 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, page_alloc: move tag_clear_highpage out of kernel_init_free_pages Currently, kernel_init_free_pages() serves two purposes: it either only zeroes memory or zeroes both memory and memory tags via a different code path. As this function has only two callers, each using only one code path, this behaviour is confusing. Pull the code that zeroes both memory and tags out of kernel_init_free_pages(). As a result of this change, the code in free_pages_prepare() starts to look complicated, but this is improved in the few following patches. Those improvements are not integrated into this patch to make diffs easier to read. This patch does no functional changes. Link: https://lkml.kernel.org/r/7719874e68b23902629c7cf19f966c4fd5f57979.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 24 +++++++++++++----------- 1 file changed, 13 insertions(+), 11 deletions(-) --- a/mm/page_alloc.c~kasan-page_alloc-move-tag_clear_highpage-out-of-kernel_init_free_pages +++ a/mm/page_alloc.c @@ -1278,16 +1278,10 @@ static inline bool should_skip_kasan_poi PageSkipKASanPoison(page); } -static void kernel_init_free_pages(struct page *page, int numpages, bool zero_tags) +static void kernel_init_free_pages(struct page *page, int numpages) { int i; - if (zero_tags) { - for (i = 0; i < numpages; i++) - tag_clear_highpage(page + i); - return; - } - /* s390's use of memset() could override KASAN redzones. */ kasan_disable_current(); for (i = 0; i < numpages; i++) { @@ -1383,7 +1377,7 @@ static __always_inline bool free_pages_p bool init = want_init_on_free(); if (init) - kernel_init_free_pages(page, 1 << order, false); + kernel_init_free_pages(page, 1 << order); if (!skip_kasan_poison) kasan_poison_pages(page, order, init); } @@ -2378,9 +2372,17 @@ inline void post_alloc_hook(struct page bool init = !want_init_on_free() && want_init_on_alloc(gfp_flags); kasan_unpoison_pages(page, order, init); - if (init) - kernel_init_free_pages(page, 1 << order, - gfp_flags & __GFP_ZEROTAGS); + + if (init) { + if (gfp_flags & __GFP_ZEROTAGS) { + int i; + + for (i = 0; i < 1 << order; i++) + tag_clear_highpage(page + i); + } else { + kernel_init_free_pages(page, 1 << order); + } + } } set_page_owner(page, order, gfp_flags); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 032/114] kasan, page_alloc: merge kasan_free_pages into free_pages_prepare 2022-03-25 1:07 incoming Andrew Morton ` (30 preceding siblings ...) 2022-03-25 1:10 ` [patch 031/114] kasan, page_alloc: move tag_clear_highpage out of kernel_init_free_pages Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 033/114] kasan, page_alloc: simplify kasan_poison_pages call site Andrew Morton ` (80 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, page_alloc: merge kasan_free_pages into free_pages_prepare Currently, the code responsible for initializing and poisoning memory in free_pages_prepare() is scattered across two locations: kasan_free_pages() for HW_TAGS KASAN and free_pages_prepare() itself. This is confusing. This and a few following patches combine the code from these two locations. Along the way, these patches also simplify the performed checks to make them easier to follow. Replaces the only caller of kasan_free_pages() with its implementation. As kasan_has_integrated_init() is only true when CONFIG_KASAN_HW_TAGS is enabled, moving the code does no functional changes. This patch is not useful by itself but makes the simplifications in the following patches easier to follow. Link: https://lkml.kernel.org/r/303498d15840bb71905852955c6e2390ecc87139.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/kasan.h | 8 -------- mm/kasan/common.c | 2 +- mm/kasan/hw_tags.c | 11 ----------- mm/page_alloc.c | 6 ++++-- 4 files changed, 5 insertions(+), 22 deletions(-) --- a/include/linux/kasan.h~kasan-page_alloc-merge-kasan_free_pages-into-free_pages_prepare +++ a/include/linux/kasan.h @@ -85,7 +85,6 @@ static inline void kasan_disable_current #ifdef CONFIG_KASAN_HW_TAGS void kasan_alloc_pages(struct page *page, unsigned int order, gfp_t flags); -void kasan_free_pages(struct page *page, unsigned int order); #else /* CONFIG_KASAN_HW_TAGS */ @@ -94,13 +93,6 @@ static __always_inline void kasan_alloc_ { /* Only available for integrated init. */ BUILD_BUG(); -} - -static __always_inline void kasan_free_pages(struct page *page, - unsigned int order) -{ - /* Only available for integrated init. */ - BUILD_BUG(); } #endif /* CONFIG_KASAN_HW_TAGS */ --- a/mm/kasan/common.c~kasan-page_alloc-merge-kasan_free_pages-into-free_pages_prepare +++ a/mm/kasan/common.c @@ -387,7 +387,7 @@ static inline bool ____kasan_kfree_large } /* - * The object will be poisoned by kasan_free_pages() or + * The object will be poisoned by kasan_poison_pages() or * kasan_slab_free_mempool(). */ --- a/mm/kasan/hw_tags.c~kasan-page_alloc-merge-kasan_free_pages-into-free_pages_prepare +++ a/mm/kasan/hw_tags.c @@ -213,17 +213,6 @@ void kasan_alloc_pages(struct page *page } } -void kasan_free_pages(struct page *page, unsigned int order) -{ - /* - * This condition should match the one in free_pages_prepare() in - * page_alloc.c. - */ - bool init = want_init_on_free(); - - kasan_poison_pages(page, order, init); -} - #if IS_ENABLED(CONFIG_KASAN_KUNIT_TEST) void kasan_enable_tagging_sync(void) --- a/mm/page_alloc.c~kasan-page_alloc-merge-kasan_free_pages-into-free_pages_prepare +++ a/mm/page_alloc.c @@ -1364,15 +1364,17 @@ static __always_inline bool free_pages_p /* * As memory initialization might be integrated into KASAN, - * kasan_free_pages and kernel_init_free_pages must be + * KASAN poisoning and memory initialization code must be * kept together to avoid discrepancies in behavior. * * With hardware tag-based KASAN, memory tags must be set before the * page becomes unavailable via debug_pagealloc or arch_free_page. */ if (kasan_has_integrated_init()) { + bool init = want_init_on_free(); + if (!skip_kasan_poison) - kasan_free_pages(page, order); + kasan_poison_pages(page, order, init); } else { bool init = want_init_on_free(); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 033/114] kasan, page_alloc: simplify kasan_poison_pages call site 2022-03-25 1:07 incoming Andrew Morton ` (31 preceding siblings ...) 2022-03-25 1:10 ` [patch 032/114] kasan, page_alloc: merge kasan_free_pages into free_pages_prepare Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 034/114] kasan, page_alloc: init memory of skipped pages on free Andrew Morton ` (79 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, page_alloc: simplify kasan_poison_pages call site Simplify the code around calling kasan_poison_pages() in free_pages_prepare(). This patch does no functional changes. Link: https://lkml.kernel.org/r/ae4f9bcf071577258e786bcec4798c145d718c46.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 18 +++++------------- 1 file changed, 5 insertions(+), 13 deletions(-) --- a/mm/page_alloc.c~kasan-page_alloc-simplify-kasan_poison_pages-call-site +++ a/mm/page_alloc.c @@ -1298,6 +1298,7 @@ static __always_inline bool free_pages_p { int bad = 0; bool skip_kasan_poison = should_skip_kasan_poison(page, fpi_flags); + bool init = want_init_on_free(); VM_BUG_ON_PAGE(PageTail(page), page); @@ -1370,19 +1371,10 @@ static __always_inline bool free_pages_p * With hardware tag-based KASAN, memory tags must be set before the * page becomes unavailable via debug_pagealloc or arch_free_page. */ - if (kasan_has_integrated_init()) { - bool init = want_init_on_free(); - - if (!skip_kasan_poison) - kasan_poison_pages(page, order, init); - } else { - bool init = want_init_on_free(); - - if (init) - kernel_init_free_pages(page, 1 << order); - if (!skip_kasan_poison) - kasan_poison_pages(page, order, init); - } + if (init && !kasan_has_integrated_init()) + kernel_init_free_pages(page, 1 << order); + if (!skip_kasan_poison) + kasan_poison_pages(page, order, init); /* * arch_free_page() can make the page's contents inaccessible. s390 _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 034/114] kasan, page_alloc: init memory of skipped pages on free 2022-03-25 1:07 incoming Andrew Morton ` (32 preceding siblings ...) 2022-03-25 1:10 ` [patch 033/114] kasan, page_alloc: simplify kasan_poison_pages call site Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 035/114] kasan: drop skip_kasan_poison variable in free_pages_prepare Andrew Morton ` (78 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, page_alloc: init memory of skipped pages on free Since commit 7a3b83537188 ("kasan: use separate (un)poison implementation for integrated init"), when all init, kasan_has_integrated_init(), and skip_kasan_poison are true, free_pages_prepare() doesn't initialize the page. This is wrong. Fix it by remembering whether kasan_poison_pages() performed initialization, and call kernel_init_free_pages() if it didn't. Reordering kasan_poison_pages() and kernel_init_free_pages() is OK, since kernel_init_free_pages() can handle poisoned memory. Link: https://lkml.kernel.org/r/1d97df75955e52727a3dc1c4e33b3b50506fc3fd.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 11 ++++++++--- 1 file changed, 8 insertions(+), 3 deletions(-) --- a/mm/page_alloc.c~kasan-page_alloc-init-memory-of-skipped-pages-on-free +++ a/mm/page_alloc.c @@ -1371,11 +1371,16 @@ static __always_inline bool free_pages_p * With hardware tag-based KASAN, memory tags must be set before the * page becomes unavailable via debug_pagealloc or arch_free_page. */ - if (init && !kasan_has_integrated_init()) - kernel_init_free_pages(page, 1 << order); - if (!skip_kasan_poison) + if (!skip_kasan_poison) { kasan_poison_pages(page, order, init); + /* Memory is already initialized if KASAN did it internally. */ + if (kasan_has_integrated_init()) + init = false; + } + if (init) + kernel_init_free_pages(page, 1 << order); + /* * arch_free_page() can make the page's contents inaccessible. s390 * does this. So nothing which can access the page's contents should _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 035/114] kasan: drop skip_kasan_poison variable in free_pages_prepare 2022-03-25 1:07 incoming Andrew Morton ` (33 preceding siblings ...) 2022-03-25 1:10 ` [patch 034/114] kasan, page_alloc: init memory of skipped pages on free Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 036/114] mm: clarify __GFP_ZEROTAGS comment Andrew Morton ` (77 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: drop skip_kasan_poison variable in free_pages_prepare skip_kasan_poison is only used in a single place. Call should_skip_kasan_poison() directly for simplicity. Link: https://lkml.kernel.org/r/1d33212e79bc9ef0b4d3863f903875823e89046f.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Suggested-by: Marco Elver <elver@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 3 +-- 1 file changed, 1 insertion(+), 2 deletions(-) --- a/mm/page_alloc.c~kasan-drop-skip_kasan_poison-variable-in-free_pages_prepare +++ a/mm/page_alloc.c @@ -1297,7 +1297,6 @@ static __always_inline bool free_pages_p unsigned int order, bool check_free, fpi_t fpi_flags) { int bad = 0; - bool skip_kasan_poison = should_skip_kasan_poison(page, fpi_flags); bool init = want_init_on_free(); VM_BUG_ON_PAGE(PageTail(page), page); @@ -1371,7 +1370,7 @@ static __always_inline bool free_pages_p * With hardware tag-based KASAN, memory tags must be set before the * page becomes unavailable via debug_pagealloc or arch_free_page. */ - if (!skip_kasan_poison) { + if (!should_skip_kasan_poison(page, fpi_flags)) { kasan_poison_pages(page, order, init); /* Memory is already initialized if KASAN did it internally. */ _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 036/114] mm: clarify __GFP_ZEROTAGS comment 2022-03-25 1:07 incoming Andrew Morton ` (34 preceding siblings ...) 2022-03-25 1:10 ` [patch 035/114] kasan: drop skip_kasan_poison variable in free_pages_prepare Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 037/114] kasan: only apply __GFP_ZEROTAGS when memory is zeroed Andrew Morton ` (76 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: mm: clarify __GFP_ZEROTAGS comment __GFP_ZEROTAGS is intended as an optimization: if memory is zeroed during allocation, it's possible to set memory tags at the same time with little performance impact. Clarify this intention of __GFP_ZEROTAGS in the comment. Link: https://lkml.kernel.org/r/cdffde013973c5634a447513e10ec0d21e8eee29.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/gfp.h | 6 ++++-- 1 file changed, 4 insertions(+), 2 deletions(-) --- a/include/linux/gfp.h~mm-clarify-__gfp_zerotags-comment +++ a/include/linux/gfp.h @@ -232,8 +232,10 @@ struct vm_area_struct; * * %__GFP_ZERO returns a zeroed page on success. * - * %__GFP_ZEROTAGS returns a page with zeroed memory tags on success, if - * __GFP_ZERO is set. + * %__GFP_ZEROTAGS zeroes memory tags at allocation time if the memory itself + * is being zeroed (either via __GFP_ZERO or via init_on_alloc). This flag is + * intended for optimization: setting memory tags at the same time as zeroing + * memory has minimal additional performace impact. * * %__GFP_SKIP_KASAN_POISON returns a page which does not need to be poisoned * on deallocation. Typically used for userspace pages. Currently only has an _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 037/114] kasan: only apply __GFP_ZEROTAGS when memory is zeroed 2022-03-25 1:07 incoming Andrew Morton ` (35 preceding siblings ...) 2022-03-25 1:10 ` [patch 036/114] mm: clarify __GFP_ZEROTAGS comment Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 038/114] kasan, page_alloc: refactor init checks in post_alloc_hook Andrew Morton ` (75 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: only apply __GFP_ZEROTAGS when memory is zeroed __GFP_ZEROTAGS should only be effective if memory is being zeroed. Currently, hardware tag-based KASAN violates this requirement. Fix by including an initialization check along with checking for __GFP_ZEROTAGS. Link: https://lkml.kernel.org/r/f4f4593f7f675262d29d07c1938db5bd0cd5e285.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/hw_tags.c | 3 ++- 1 file changed, 2 insertions(+), 1 deletion(-) --- a/mm/kasan/hw_tags.c~kasan-only-apply-__gfp_zerotags-when-memory-is-zeroed +++ a/mm/kasan/hw_tags.c @@ -199,11 +199,12 @@ void kasan_alloc_pages(struct page *page * page_alloc.c. */ bool init = !want_init_on_free() && want_init_on_alloc(flags); + bool init_tags = init && (flags & __GFP_ZEROTAGS); if (flags & __GFP_SKIP_KASAN_POISON) SetPageSkipKASanPoison(page); - if (flags & __GFP_ZEROTAGS) { + if (init_tags) { int i; for (i = 0; i != 1 << order; ++i) _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 038/114] kasan, page_alloc: refactor init checks in post_alloc_hook 2022-03-25 1:07 incoming Andrew Morton ` (36 preceding siblings ...) 2022-03-25 1:10 ` [patch 037/114] kasan: only apply __GFP_ZEROTAGS when memory is zeroed Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 039/114] kasan, page_alloc: merge kasan_alloc_pages into post_alloc_hook Andrew Morton ` (74 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, page_alloc: refactor init checks in post_alloc_hook Separate code for zeroing memory from the code clearing tags in post_alloc_hook(). This patch is not useful by itself but makes the simplifications in the following patches easier to follow. This patch does no functional changes. Link: https://lkml.kernel.org/r/2283fde963adfd8a2b29a92066f106cc16661a3c.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 20 +++++++++++--------- 1 file changed, 11 insertions(+), 9 deletions(-) --- a/mm/page_alloc.c~kasan-page_alloc-refactor-init-checks-in-post_alloc_hook +++ a/mm/page_alloc.c @@ -2368,19 +2368,21 @@ inline void post_alloc_hook(struct page kasan_alloc_pages(page, order, gfp_flags); } else { bool init = !want_init_on_free() && want_init_on_alloc(gfp_flags); + bool init_tags = init && (gfp_flags & __GFP_ZEROTAGS); kasan_unpoison_pages(page, order, init); - if (init) { - if (gfp_flags & __GFP_ZEROTAGS) { - int i; - - for (i = 0; i < 1 << order; i++) - tag_clear_highpage(page + i); - } else { - kernel_init_free_pages(page, 1 << order); - } + if (init_tags) { + int i; + + for (i = 0; i < 1 << order; i++) + tag_clear_highpage(page + i); + + init = false; } + + if (init) + kernel_init_free_pages(page, 1 << order); } set_page_owner(page, order, gfp_flags); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 039/114] kasan, page_alloc: merge kasan_alloc_pages into post_alloc_hook 2022-03-25 1:07 incoming Andrew Morton ` (37 preceding siblings ...) 2022-03-25 1:10 ` [patch 038/114] kasan, page_alloc: refactor init checks in post_alloc_hook Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 040/114] kasan, page_alloc: combine tag_clear_highpage calls in post_alloc_hook Andrew Morton ` (73 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, page_alloc: merge kasan_alloc_pages into post_alloc_hook Currently, the code responsible for initializing and poisoning memory in post_alloc_hook() is scattered across two locations: kasan_alloc_pages() hook for HW_TAGS KASAN and post_alloc_hook() itself. This is confusing. This and a few following patches combine the code from these two locations. Along the way, these patches do a step-by-step restructure the many performed checks to make them easier to follow. Replace the only caller of kasan_alloc_pages() with its implementation. As kasan_has_integrated_init() is only true when CONFIG_KASAN_HW_TAGS is enabled, moving the code does no functional changes. Also move init and init_tags variables definitions out of kasan_has_integrated_init() clause in post_alloc_hook(), as they have the same values regardless of what the if condition evaluates to. This patch is not useful by itself but makes the simplifications in the following patches easier to follow. Link: https://lkml.kernel.org/r/5ac7e0b30f5cbb177ec363ddd7878a3141289592.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/kasan.h | 9 --------- mm/kasan/common.c | 2 +- mm/kasan/hw_tags.c | 22 ---------------------- mm/page_alloc.c | 20 +++++++++++++++----- 4 files changed, 16 insertions(+), 37 deletions(-) --- a/include/linux/kasan.h~kasan-page_alloc-merge-kasan_alloc_pages-into-post_alloc_hook +++ a/include/linux/kasan.h @@ -84,17 +84,8 @@ static inline void kasan_disable_current #ifdef CONFIG_KASAN_HW_TAGS -void kasan_alloc_pages(struct page *page, unsigned int order, gfp_t flags); - #else /* CONFIG_KASAN_HW_TAGS */ -static __always_inline void kasan_alloc_pages(struct page *page, - unsigned int order, gfp_t flags) -{ - /* Only available for integrated init. */ - BUILD_BUG(); -} - #endif /* CONFIG_KASAN_HW_TAGS */ static inline bool kasan_has_integrated_init(void) --- a/mm/kasan/common.c~kasan-page_alloc-merge-kasan_alloc_pages-into-post_alloc_hook +++ a/mm/kasan/common.c @@ -538,7 +538,7 @@ void * __must_check __kasan_kmalloc_larg return NULL; /* - * The object has already been unpoisoned by kasan_alloc_pages() for + * The object has already been unpoisoned by kasan_unpoison_pages() for * alloc_pages() or by kasan_krealloc() for krealloc(). */ --- a/mm/kasan/hw_tags.c~kasan-page_alloc-merge-kasan_alloc_pages-into-post_alloc_hook +++ a/mm/kasan/hw_tags.c @@ -192,28 +192,6 @@ void __init kasan_init_hw_tags(void) kasan_stack_collection_enabled() ? "on" : "off"); } -void kasan_alloc_pages(struct page *page, unsigned int order, gfp_t flags) -{ - /* - * This condition should match the one in post_alloc_hook() in - * page_alloc.c. - */ - bool init = !want_init_on_free() && want_init_on_alloc(flags); - bool init_tags = init && (flags & __GFP_ZEROTAGS); - - if (flags & __GFP_SKIP_KASAN_POISON) - SetPageSkipKASanPoison(page); - - if (init_tags) { - int i; - - for (i = 0; i != 1 << order; ++i) - tag_clear_highpage(page + i); - } else { - kasan_unpoison_pages(page, order, init); - } -} - #if IS_ENABLED(CONFIG_KASAN_KUNIT_TEST) void kasan_enable_tagging_sync(void) --- a/mm/page_alloc.c~kasan-page_alloc-merge-kasan_alloc_pages-into-post_alloc_hook +++ a/mm/page_alloc.c @@ -2346,6 +2346,9 @@ static inline bool check_new_pcp(struct inline void post_alloc_hook(struct page *page, unsigned int order, gfp_t gfp_flags) { + bool init = !want_init_on_free() && want_init_on_alloc(gfp_flags); + bool init_tags = init && (gfp_flags & __GFP_ZEROTAGS); + set_page_private(page, 0); set_page_refcounted(page); @@ -2361,15 +2364,22 @@ inline void post_alloc_hook(struct page /* * As memory initialization might be integrated into KASAN, - * kasan_alloc_pages and kernel_init_free_pages must be + * KASAN unpoisoning and memory initializion code must be * kept together to avoid discrepancies in behavior. */ if (kasan_has_integrated_init()) { - kasan_alloc_pages(page, order, gfp_flags); - } else { - bool init = !want_init_on_free() && want_init_on_alloc(gfp_flags); - bool init_tags = init && (gfp_flags & __GFP_ZEROTAGS); + if (gfp_flags & __GFP_SKIP_KASAN_POISON) + SetPageSkipKASanPoison(page); + if (init_tags) { + int i; + + for (i = 0; i != 1 << order; ++i) + tag_clear_highpage(page + i); + } else { + kasan_unpoison_pages(page, order, init); + } + } else { kasan_unpoison_pages(page, order, init); if (init_tags) { _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 040/114] kasan, page_alloc: combine tag_clear_highpage calls in post_alloc_hook 2022-03-25 1:07 incoming Andrew Morton ` (38 preceding siblings ...) 2022-03-25 1:10 ` [patch 039/114] kasan, page_alloc: merge kasan_alloc_pages into post_alloc_hook Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 041/114] kasan, page_alloc: move SetPageSkipKASanPoison " Andrew Morton ` (72 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, page_alloc: combine tag_clear_highpage calls in post_alloc_hook Move tag_clear_highpage() loops out of the kasan_has_integrated_init() clause as a code simplification. This patch does no functional changes. Link: https://lkml.kernel.org/r/587e3fc36358b88049320a89cc8dc6deaecb0cda.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 32 ++++++++++++++++---------------- 1 file changed, 16 insertions(+), 16 deletions(-) --- a/mm/page_alloc.c~kasan-page_alloc-combine-tag_clear_highpage-calls-in-post_alloc_hook +++ a/mm/page_alloc.c @@ -2367,30 +2367,30 @@ inline void post_alloc_hook(struct page * KASAN unpoisoning and memory initializion code must be * kept together to avoid discrepancies in behavior. */ + + /* + * If memory tags should be zeroed (which happens only when memory + * should be initialized as well). + */ + if (init_tags) { + int i; + + /* Initialize both memory and tags. */ + for (i = 0; i != 1 << order; ++i) + tag_clear_highpage(page + i); + + /* Note that memory is already initialized by the loop above. */ + init = false; + } if (kasan_has_integrated_init()) { if (gfp_flags & __GFP_SKIP_KASAN_POISON) SetPageSkipKASanPoison(page); - if (init_tags) { - int i; - - for (i = 0; i != 1 << order; ++i) - tag_clear_highpage(page + i); - } else { + if (!init_tags) kasan_unpoison_pages(page, order, init); - } } else { kasan_unpoison_pages(page, order, init); - if (init_tags) { - int i; - - for (i = 0; i < 1 << order; i++) - tag_clear_highpage(page + i); - - init = false; - } - if (init) kernel_init_free_pages(page, 1 << order); } _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 041/114] kasan, page_alloc: move SetPageSkipKASanPoison in post_alloc_hook 2022-03-25 1:07 incoming Andrew Morton ` (39 preceding siblings ...) 2022-03-25 1:10 ` [patch 040/114] kasan, page_alloc: combine tag_clear_highpage calls in post_alloc_hook Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 042/114] kasan, page_alloc: move kernel_init_free_pages " Andrew Morton ` (71 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, page_alloc: move SetPageSkipKASanPoison in post_alloc_hook Pull the SetPageSkipKASanPoison() call in post_alloc_hook() out of the big if clause for better code readability. This also allows for more simplifications in the following patches. Also turn the kasan_has_integrated_init() check into the proper kasan_hw_tags_enabled() one. These checks evaluate to the same value, but logically skipping kasan poisoning has nothing to do with integrated init. Link: https://lkml.kernel.org/r/7214c1698b754ccfaa44a792113c95cc1f807c48.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 6 +++--- 1 file changed, 3 insertions(+), 3 deletions(-) --- a/mm/page_alloc.c~kasan-page_alloc-move-setpageskipkasanpoison-in-post_alloc_hook +++ a/mm/page_alloc.c @@ -2383,9 +2383,6 @@ inline void post_alloc_hook(struct page init = false; } if (kasan_has_integrated_init()) { - if (gfp_flags & __GFP_SKIP_KASAN_POISON) - SetPageSkipKASanPoison(page); - if (!init_tags) kasan_unpoison_pages(page, order, init); } else { @@ -2394,6 +2391,9 @@ inline void post_alloc_hook(struct page if (init) kernel_init_free_pages(page, 1 << order); } + /* Propagate __GFP_SKIP_KASAN_POISON to page flags. */ + if (kasan_hw_tags_enabled() && (gfp_flags & __GFP_SKIP_KASAN_POISON)) + SetPageSkipKASanPoison(page); set_page_owner(page, order, gfp_flags); page_table_check_alloc(page, order); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 042/114] kasan, page_alloc: move kernel_init_free_pages in post_alloc_hook 2022-03-25 1:07 incoming Andrew Morton ` (40 preceding siblings ...) 2022-03-25 1:10 ` [patch 041/114] kasan, page_alloc: move SetPageSkipKASanPoison " Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 043/114] kasan, page_alloc: rework kasan_unpoison_pages call site Andrew Morton ` (70 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, page_alloc: move kernel_init_free_pages in post_alloc_hook Pull the kernel_init_free_pages() call in post_alloc_hook() out of the big if clause for better code readability. This also allows for more simplifications in the following patch. This patch does no functional changes. Link: https://lkml.kernel.org/r/a7a76456501eb37ddf9fca6529cee9555e59cdb1.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 12 ++++++++---- 1 file changed, 8 insertions(+), 4 deletions(-) --- a/mm/page_alloc.c~kasan-page_alloc-move-kernel_init_free_pages-in-post_alloc_hook +++ a/mm/page_alloc.c @@ -2383,14 +2383,18 @@ inline void post_alloc_hook(struct page init = false; } if (kasan_has_integrated_init()) { - if (!init_tags) + if (!init_tags) { kasan_unpoison_pages(page, order, init); + + /* Note that memory is already initialized by KASAN. */ + init = false; + } } else { kasan_unpoison_pages(page, order, init); - - if (init) - kernel_init_free_pages(page, 1 << order); } + /* If memory is still not initialized, do it now. */ + if (init) + kernel_init_free_pages(page, 1 << order); /* Propagate __GFP_SKIP_KASAN_POISON to page flags. */ if (kasan_hw_tags_enabled() && (gfp_flags & __GFP_SKIP_KASAN_POISON)) SetPageSkipKASanPoison(page); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 043/114] kasan, page_alloc: rework kasan_unpoison_pages call site 2022-03-25 1:07 incoming Andrew Morton ` (41 preceding siblings ...) 2022-03-25 1:10 ` [patch 042/114] kasan, page_alloc: move kernel_init_free_pages " Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 044/114] kasan: clean up metadata byte definitions Andrew Morton ` (69 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, page_alloc: rework kasan_unpoison_pages call site Rework the checks around kasan_unpoison_pages() call in post_alloc_hook(). The logical condition for calling this function is: - If a software KASAN mode is enabled, we need to mark shadow memory. - Otherwise, HW_TAGS KASAN is enabled, and it only makes sense to set tags if they haven't already been cleared by tag_clear_highpage(), which is indicated by init_tags. This patch concludes the changes for post_alloc_hook(). Link: https://lkml.kernel.org/r/0ecebd0d7ccd79150e3620ea4185a32d3dfe912f.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 19 ++++++++++++------- 1 file changed, 12 insertions(+), 7 deletions(-) --- a/mm/page_alloc.c~kasan-page_alloc-rework-kasan_unpoison_pages-call-site +++ a/mm/page_alloc.c @@ -2382,15 +2382,20 @@ inline void post_alloc_hook(struct page /* Note that memory is already initialized by the loop above. */ init = false; } - if (kasan_has_integrated_init()) { - if (!init_tags) { - kasan_unpoison_pages(page, order, init); + /* + * If either a software KASAN mode is enabled, or, + * in the case of hardware tag-based KASAN, + * if memory tags have not been cleared via tag_clear_highpage(). + */ + if (IS_ENABLED(CONFIG_KASAN_GENERIC) || + IS_ENABLED(CONFIG_KASAN_SW_TAGS) || + kasan_hw_tags_enabled() && !init_tags) { + /* Mark shadow memory or set memory tags. */ + kasan_unpoison_pages(page, order, init); - /* Note that memory is already initialized by KASAN. */ + /* Note that memory is already initialized by KASAN. */ + if (kasan_has_integrated_init()) init = false; - } - } else { - kasan_unpoison_pages(page, order, init); } /* If memory is still not initialized, do it now. */ if (init) _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 044/114] kasan: clean up metadata byte definitions 2022-03-25 1:07 incoming Andrew Morton ` (42 preceding siblings ...) 2022-03-25 1:10 ` [patch 043/114] kasan, page_alloc: rework kasan_unpoison_pages call site Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 045/114] kasan: define KASAN_VMALLOC_INVALID for SW_TAGS Andrew Morton ` (68 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: clean up metadata byte definitions Most of the metadata byte values are only used for Generic KASAN. Remove KASAN_KMALLOC_FREETRACK definition for !CONFIG_KASAN_GENERIC case, and put it along with other metadata values for the Generic mode under a corresponding ifdef. Link: https://lkml.kernel.org/r/ac11d6e9e007c95e472e8fdd22efb6074ef3c6d8.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/kasan.h | 7 +++++-- 1 file changed, 5 insertions(+), 2 deletions(-) --- a/mm/kasan/kasan.h~kasan-clean-up-metadata-byte-definitions +++ a/mm/kasan/kasan.h @@ -71,15 +71,16 @@ static inline bool kasan_sync_fault_poss #define KASAN_PAGE_REDZONE 0xFE /* redzone for kmalloc_large allocations */ #define KASAN_KMALLOC_REDZONE 0xFC /* redzone inside slub object */ #define KASAN_KMALLOC_FREE 0xFB /* object was freed (kmem_cache_free/kfree) */ -#define KASAN_KMALLOC_FREETRACK 0xFA /* object was freed and has free track set */ #else #define KASAN_FREE_PAGE KASAN_TAG_INVALID #define KASAN_PAGE_REDZONE KASAN_TAG_INVALID #define KASAN_KMALLOC_REDZONE KASAN_TAG_INVALID #define KASAN_KMALLOC_FREE KASAN_TAG_INVALID -#define KASAN_KMALLOC_FREETRACK KASAN_TAG_INVALID #endif +#ifdef CONFIG_KASAN_GENERIC + +#define KASAN_KMALLOC_FREETRACK 0xFA /* object was freed and has free track set */ #define KASAN_GLOBAL_REDZONE 0xF9 /* redzone for global variable */ #define KASAN_VMALLOC_INVALID 0xF8 /* unallocated space in vmapped page */ @@ -110,6 +111,8 @@ static inline bool kasan_sync_fault_poss #define KASAN_ABI_VERSION 1 #endif +#endif /* CONFIG_KASAN_GENERIC */ + /* Metadata layout customization. */ #define META_BYTES_PER_BLOCK 1 #define META_BLOCKS_PER_ROW 16 _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 045/114] kasan: define KASAN_VMALLOC_INVALID for SW_TAGS 2022-03-25 1:07 incoming Andrew Morton ` (43 preceding siblings ...) 2022-03-25 1:10 ` [patch 044/114] kasan: clean up metadata byte definitions Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 046/114] kasan, x86, arm64, s390: rename functions for modules shadow Andrew Morton ` (67 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: define KASAN_VMALLOC_INVALID for SW_TAGS In preparation for adding vmalloc support to SW_TAGS KASAN, provide a KASAN_VMALLOC_INVALID definition for it. HW_TAGS KASAN won't be using this value, as it falls back onto page_alloc for poisoning freed vmalloc() memory. Link: https://lkml.kernel.org/r/1daaaafeb148a7ae8285265edc97d7ca07b6a07d.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/kasan.h | 3 ++- 1 file changed, 2 insertions(+), 1 deletion(-) --- a/mm/kasan/kasan.h~kasan-define-kasan_vmalloc_invalid-for-sw_tags +++ a/mm/kasan/kasan.h @@ -71,18 +71,19 @@ static inline bool kasan_sync_fault_poss #define KASAN_PAGE_REDZONE 0xFE /* redzone for kmalloc_large allocations */ #define KASAN_KMALLOC_REDZONE 0xFC /* redzone inside slub object */ #define KASAN_KMALLOC_FREE 0xFB /* object was freed (kmem_cache_free/kfree) */ +#define KASAN_VMALLOC_INVALID 0xF8 /* unallocated space in vmapped page */ #else #define KASAN_FREE_PAGE KASAN_TAG_INVALID #define KASAN_PAGE_REDZONE KASAN_TAG_INVALID #define KASAN_KMALLOC_REDZONE KASAN_TAG_INVALID #define KASAN_KMALLOC_FREE KASAN_TAG_INVALID +#define KASAN_VMALLOC_INVALID KASAN_TAG_INVALID /* only for SW_TAGS */ #endif #ifdef CONFIG_KASAN_GENERIC #define KASAN_KMALLOC_FREETRACK 0xFA /* object was freed and has free track set */ #define KASAN_GLOBAL_REDZONE 0xF9 /* redzone for global variable */ -#define KASAN_VMALLOC_INVALID 0xF8 /* unallocated space in vmapped page */ /* * Stack redzone shadow values _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 046/114] kasan, x86, arm64, s390: rename functions for modules shadow 2022-03-25 1:07 incoming Andrew Morton ` (44 preceding siblings ...) 2022-03-25 1:10 ` [patch 045/114] kasan: define KASAN_VMALLOC_INVALID for SW_TAGS Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 047/114] kasan, vmalloc: drop outdated VM_KASAN comment Andrew Morton ` (66 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, x86, arm64, s390: rename functions for modules shadow Rename kasan_free_shadow to kasan_free_module_shadow and kasan_module_alloc to kasan_alloc_module_shadow. These functions are used to allocate/free shadow memory for kernel modules when KASAN_VMALLOC is not enabled. The new names better reflect their purpose. Also reword the comment next to their declaration to improve clarity. Link: https://lkml.kernel.org/r/36db32bde765d5d0b856f77d2d806e838513fe84.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Catalin Marinas <catalin.marinas@arm.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm64/kernel/module.c | 2 +- arch/s390/kernel/module.c | 2 +- arch/x86/kernel/module.c | 2 +- include/linux/kasan.h | 14 +++++++------- mm/kasan/shadow.c | 4 ++-- mm/vmalloc.c | 2 +- 6 files changed, 13 insertions(+), 13 deletions(-) --- a/arch/arm64/kernel/module.c~kasan-x86-arm64-s390-rename-functions-for-modules-shadow +++ a/arch/arm64/kernel/module.c @@ -58,7 +58,7 @@ void *module_alloc(unsigned long size) PAGE_KERNEL, 0, NUMA_NO_NODE, __builtin_return_address(0)); - if (p && (kasan_module_alloc(p, size, gfp_mask) < 0)) { + if (p && (kasan_alloc_module_shadow(p, size, gfp_mask) < 0)) { vfree(p); return NULL; } --- a/arch/s390/kernel/module.c~kasan-x86-arm64-s390-rename-functions-for-modules-shadow +++ a/arch/s390/kernel/module.c @@ -45,7 +45,7 @@ void *module_alloc(unsigned long size) p = __vmalloc_node_range(size, MODULE_ALIGN, MODULES_VADDR, MODULES_END, gfp_mask, PAGE_KERNEL_EXEC, VM_DEFER_KMEMLEAK, NUMA_NO_NODE, __builtin_return_address(0)); - if (p && (kasan_module_alloc(p, size, gfp_mask) < 0)) { + if (p && (kasan_alloc_module_shadow(p, size, gfp_mask) < 0)) { vfree(p); return NULL; } --- a/arch/x86/kernel/module.c~kasan-x86-arm64-s390-rename-functions-for-modules-shadow +++ a/arch/x86/kernel/module.c @@ -78,7 +78,7 @@ void *module_alloc(unsigned long size) MODULES_END, gfp_mask, PAGE_KERNEL, VM_DEFER_KMEMLEAK, NUMA_NO_NODE, __builtin_return_address(0)); - if (p && (kasan_module_alloc(p, size, gfp_mask) < 0)) { + if (p && (kasan_alloc_module_shadow(p, size, gfp_mask) < 0)) { vfree(p); return NULL; } --- a/include/linux/kasan.h~kasan-x86-arm64-s390-rename-functions-for-modules-shadow +++ a/include/linux/kasan.h @@ -433,17 +433,17 @@ static inline void kasan_populate_early_ !defined(CONFIG_KASAN_VMALLOC) /* - * These functions provide a special case to support backing module - * allocations with real shadow memory. With KASAN vmalloc, the special - * case is unnecessary, as the work is handled in the generic case. + * These functions allocate and free shadow memory for kernel modules. + * They are only required when KASAN_VMALLOC is not supported, as otherwise + * shadow memory is allocated by the generic vmalloc handlers. */ -int kasan_module_alloc(void *addr, size_t size, gfp_t gfp_mask); -void kasan_free_shadow(const struct vm_struct *vm); +int kasan_alloc_module_shadow(void *addr, size_t size, gfp_t gfp_mask); +void kasan_free_module_shadow(const struct vm_struct *vm); #else /* (CONFIG_KASAN_GENERIC || CONFIG_KASAN_SW_TAGS) && !CONFIG_KASAN_VMALLOC */ -static inline int kasan_module_alloc(void *addr, size_t size, gfp_t gfp_mask) { return 0; } -static inline void kasan_free_shadow(const struct vm_struct *vm) {} +static inline int kasan_alloc_module_shadow(void *addr, size_t size, gfp_t gfp_mask) { return 0; } +static inline void kasan_free_module_shadow(const struct vm_struct *vm) {} #endif /* (CONFIG_KASAN_GENERIC || CONFIG_KASAN_SW_TAGS) && !CONFIG_KASAN_VMALLOC */ --- a/mm/kasan/shadow.c~kasan-x86-arm64-s390-rename-functions-for-modules-shadow +++ a/mm/kasan/shadow.c @@ -498,7 +498,7 @@ void kasan_release_vmalloc(unsigned long #else /* CONFIG_KASAN_VMALLOC */ -int kasan_module_alloc(void *addr, size_t size, gfp_t gfp_mask) +int kasan_alloc_module_shadow(void *addr, size_t size, gfp_t gfp_mask) { void *ret; size_t scaled_size; @@ -534,7 +534,7 @@ int kasan_module_alloc(void *addr, size_ return -ENOMEM; } -void kasan_free_shadow(const struct vm_struct *vm) +void kasan_free_module_shadow(const struct vm_struct *vm) { if (vm->flags & VM_KASAN) vfree(kasan_mem_to_shadow(vm->addr)); --- a/mm/vmalloc.c~kasan-x86-arm64-s390-rename-functions-for-modules-shadow +++ a/mm/vmalloc.c @@ -2547,7 +2547,7 @@ struct vm_struct *remove_vm_area(const v va->vm = NULL; spin_unlock(&vmap_area_lock); - kasan_free_shadow(vm); + kasan_free_module_shadow(vm); free_unmap_vmap_area(va); return vm; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 047/114] kasan, vmalloc: drop outdated VM_KASAN comment 2022-03-25 1:07 incoming Andrew Morton ` (45 preceding siblings ...) 2022-03-25 1:10 ` [patch 046/114] kasan, x86, arm64, s390: rename functions for modules shadow Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:10 ` [patch 048/114] kasan: reorder vmalloc hooks Andrew Morton ` (65 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, vmalloc: drop outdated VM_KASAN comment The comment about VM_KASAN in include/linux/vmalloc.c is outdated. VM_KASAN is currently only used to mark vm_areas allocated for kernel modules when CONFIG_KASAN_VMALLOC is disabled. Drop the comment. Link: https://lkml.kernel.org/r/780395afea83a147b3b5acc36cf2e38f7f8479f9.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/vmalloc.h | 11 ----------- 1 file changed, 11 deletions(-) --- a/include/linux/vmalloc.h~kasan-vmalloc-drop-outdated-vm_kasan-comment +++ a/include/linux/vmalloc.h @@ -35,17 +35,6 @@ struct notifier_block; /* in notifier.h #define VM_DEFER_KMEMLEAK 0 #endif -/* - * VM_KASAN is used slightly differently depending on CONFIG_KASAN_VMALLOC. - * - * If IS_ENABLED(CONFIG_KASAN_VMALLOC), VM_KASAN is set on a vm_struct after - * shadow memory has been mapped. It's used to handle allocation errors so that - * we don't try to poison shadow on free if it was never allocated. - * - * Otherwise, VM_KASAN is set for kasan_module_alloc() allocations and used to - * determine which allocations need the module shadow freed. - */ - /* bits [20..32] reserved for arch specific ioremap internals */ /* _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 048/114] kasan: reorder vmalloc hooks 2022-03-25 1:07 incoming Andrew Morton ` (46 preceding siblings ...) 2022-03-25 1:10 ` [patch 047/114] kasan, vmalloc: drop outdated VM_KASAN comment Andrew Morton @ 2022-03-25 1:10 ` Andrew Morton 2022-03-25 1:11 ` [patch 049/114] kasan: add wrappers for " Andrew Morton ` (64 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:10 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: reorder vmalloc hooks Group functions that [de]populate shadow memory for vmalloc. Group functions that [un]poison memory for vmalloc. This patch does no functional changes but prepares KASAN code for adding vmalloc support to HW_TAGS KASAN. Link: https://lkml.kernel.org/r/aeef49eb249c206c4c9acce2437728068da74c28.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/kasan.h | 20 ++++++++---------- mm/kasan/shadow.c | 43 ++++++++++++++++++++-------------------- 2 files changed, 31 insertions(+), 32 deletions(-) --- a/include/linux/kasan.h~kasan-reorder-vmalloc-hooks +++ a/include/linux/kasan.h @@ -397,34 +397,32 @@ static inline void kasan_init_hw_tags(vo #ifdef CONFIG_KASAN_VMALLOC +void kasan_populate_early_vm_area_shadow(void *start, unsigned long size); int kasan_populate_vmalloc(unsigned long addr, unsigned long size); -void kasan_poison_vmalloc(const void *start, unsigned long size); -void kasan_unpoison_vmalloc(const void *start, unsigned long size); void kasan_release_vmalloc(unsigned long start, unsigned long end, unsigned long free_region_start, unsigned long free_region_end); -void kasan_populate_early_vm_area_shadow(void *start, unsigned long size); +void kasan_unpoison_vmalloc(const void *start, unsigned long size); +void kasan_poison_vmalloc(const void *start, unsigned long size); #else /* CONFIG_KASAN_VMALLOC */ +static inline void kasan_populate_early_vm_area_shadow(void *start, + unsigned long size) { } static inline int kasan_populate_vmalloc(unsigned long start, unsigned long size) { return 0; } - -static inline void kasan_poison_vmalloc(const void *start, unsigned long size) -{ } -static inline void kasan_unpoison_vmalloc(const void *start, unsigned long size) -{ } static inline void kasan_release_vmalloc(unsigned long start, unsigned long end, unsigned long free_region_start, - unsigned long free_region_end) {} + unsigned long free_region_end) { } -static inline void kasan_populate_early_vm_area_shadow(void *start, - unsigned long size) +static inline void kasan_unpoison_vmalloc(const void *start, unsigned long size) +{ } +static inline void kasan_poison_vmalloc(const void *start, unsigned long size) { } #endif /* CONFIG_KASAN_VMALLOC */ --- a/mm/kasan/shadow.c~kasan-reorder-vmalloc-hooks +++ a/mm/kasan/shadow.c @@ -345,27 +345,6 @@ int kasan_populate_vmalloc(unsigned long return 0; } -/* - * Poison the shadow for a vmalloc region. Called as part of the - * freeing process at the time the region is freed. - */ -void kasan_poison_vmalloc(const void *start, unsigned long size) -{ - if (!is_vmalloc_or_module_addr(start)) - return; - - size = round_up(size, KASAN_GRANULE_SIZE); - kasan_poison(start, size, KASAN_VMALLOC_INVALID, false); -} - -void kasan_unpoison_vmalloc(const void *start, unsigned long size) -{ - if (!is_vmalloc_or_module_addr(start)) - return; - - kasan_unpoison(start, size, false); -} - static int kasan_depopulate_vmalloc_pte(pte_t *ptep, unsigned long addr, void *unused) { @@ -496,6 +475,28 @@ void kasan_release_vmalloc(unsigned long } } + +void kasan_unpoison_vmalloc(const void *start, unsigned long size) +{ + if (!is_vmalloc_or_module_addr(start)) + return; + + kasan_unpoison(start, size, false); +} + +/* + * Poison the shadow for a vmalloc region. Called as part of the + * freeing process at the time the region is freed. + */ +void kasan_poison_vmalloc(const void *start, unsigned long size) +{ + if (!is_vmalloc_or_module_addr(start)) + return; + + size = round_up(size, KASAN_GRANULE_SIZE); + kasan_poison(start, size, KASAN_VMALLOC_INVALID, false); +} + #else /* CONFIG_KASAN_VMALLOC */ int kasan_alloc_module_shadow(void *addr, size_t size, gfp_t gfp_mask) _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 049/114] kasan: add wrappers for vmalloc hooks 2022-03-25 1:07 incoming Andrew Morton ` (47 preceding siblings ...) 2022-03-25 1:10 ` [patch 048/114] kasan: reorder vmalloc hooks Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 050/114] kasan, vmalloc: reset tags in vmalloc functions Andrew Morton ` (63 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: add wrappers for vmalloc hooks Add wrappers around functions that [un]poison memory for vmalloc allocations. These functions will be used by HW_TAGS KASAN and therefore need to be disabled when kasan=off command line argument is provided. This patch does no functional changes for software KASAN modes. Link: https://lkml.kernel.org/r/3b8728eac438c55389fb0f9a8a2145d71dd77487.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/kasan.h | 17 +++++++++++++++-- mm/kasan/shadow.c | 5 ++--- 2 files changed, 17 insertions(+), 5 deletions(-) --- a/include/linux/kasan.h~kasan-add-wrappers-for-vmalloc-hooks +++ a/include/linux/kasan.h @@ -403,8 +403,21 @@ void kasan_release_vmalloc(unsigned long unsigned long free_region_start, unsigned long free_region_end); -void kasan_unpoison_vmalloc(const void *start, unsigned long size); -void kasan_poison_vmalloc(const void *start, unsigned long size); +void __kasan_unpoison_vmalloc(const void *start, unsigned long size); +static __always_inline void kasan_unpoison_vmalloc(const void *start, + unsigned long size) +{ + if (kasan_enabled()) + __kasan_unpoison_vmalloc(start, size); +} + +void __kasan_poison_vmalloc(const void *start, unsigned long size); +static __always_inline void kasan_poison_vmalloc(const void *start, + unsigned long size) +{ + if (kasan_enabled()) + __kasan_poison_vmalloc(start, size); +} #else /* CONFIG_KASAN_VMALLOC */ --- a/mm/kasan/shadow.c~kasan-add-wrappers-for-vmalloc-hooks +++ a/mm/kasan/shadow.c @@ -475,8 +475,7 @@ void kasan_release_vmalloc(unsigned long } } - -void kasan_unpoison_vmalloc(const void *start, unsigned long size) +void __kasan_unpoison_vmalloc(const void *start, unsigned long size) { if (!is_vmalloc_or_module_addr(start)) return; @@ -488,7 +487,7 @@ void kasan_unpoison_vmalloc(const void * * Poison the shadow for a vmalloc region. Called as part of the * freeing process at the time the region is freed. */ -void kasan_poison_vmalloc(const void *start, unsigned long size) +void __kasan_poison_vmalloc(const void *start, unsigned long size) { if (!is_vmalloc_or_module_addr(start)) return; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 050/114] kasan, vmalloc: reset tags in vmalloc functions 2022-03-25 1:07 incoming Andrew Morton ` (48 preceding siblings ...) 2022-03-25 1:11 ` [patch 049/114] kasan: add wrappers for " Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 051/114] kasan, fork: reset pointer tags of vmapped stacks Andrew Morton ` (62 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, vmalloc: reset tags in vmalloc functions In preparation for adding vmalloc support to SW/HW_TAGS KASAN, reset pointer tags in functions that use pointer values in range checks. vread() is a special case here. Despite the untagging of the addr pointer in its prologue, the accesses performed by vread() are checked. Instead of accessing the virtual mappings though addr directly, vread() recovers the physical address via page_address(vmalloc_to_page()) and acceses that. And as page_address() recovers the pointer tag, the accesses get checked. Link: https://lkml.kernel.org/r/046003c5f683cacb0ba18e1079e9688bb3dca943.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmalloc.c | 12 +++++++++--- 1 file changed, 9 insertions(+), 3 deletions(-) --- a/mm/vmalloc.c~kasan-vmalloc-reset-tags-in-vmalloc-functions +++ a/mm/vmalloc.c @@ -74,7 +74,7 @@ static const bool vmap_allow_huge = fals bool is_vmalloc_addr(const void *x) { - unsigned long addr = (unsigned long)x; + unsigned long addr = (unsigned long)kasan_reset_tag(x); return addr >= VMALLOC_START && addr < VMALLOC_END; } @@ -631,7 +631,7 @@ int is_vmalloc_or_module_addr(const void * just put it in the vmalloc space. */ #if defined(CONFIG_MODULES) && defined(MODULES_VADDR) - unsigned long addr = (unsigned long)x; + unsigned long addr = (unsigned long)kasan_reset_tag(x); if (addr >= MODULES_VADDR && addr < MODULES_END) return 1; #endif @@ -795,6 +795,8 @@ static struct vmap_area *find_vmap_area_ struct vmap_area *va = NULL; struct rb_node *n = vmap_area_root.rb_node; + addr = (unsigned long)kasan_reset_tag((void *)addr); + while (n) { struct vmap_area *tmp; @@ -816,6 +818,8 @@ static struct vmap_area *__find_vmap_are { struct rb_node *n = vmap_area_root.rb_node; + addr = (unsigned long)kasan_reset_tag((void *)addr); + while (n) { struct vmap_area *va; @@ -2166,7 +2170,7 @@ EXPORT_SYMBOL_GPL(vm_unmap_aliases); void vm_unmap_ram(const void *mem, unsigned int count) { unsigned long size = (unsigned long)count << PAGE_SHIFT; - unsigned long addr = (unsigned long)mem; + unsigned long addr = (unsigned long)kasan_reset_tag(mem); struct vmap_area *va; might_sleep(); @@ -3424,6 +3428,8 @@ long vread(char *buf, char *addr, unsign unsigned long buflen = count; unsigned long n; + addr = kasan_reset_tag(addr); + /* Don't allow overflow */ if ((unsigned long) addr + count < count) count = -(unsigned long) addr; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 051/114] kasan, fork: reset pointer tags of vmapped stacks 2022-03-25 1:07 incoming Andrew Morton ` (49 preceding siblings ...) 2022-03-25 1:11 ` [patch 050/114] kasan, vmalloc: reset tags in vmalloc functions Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 052/114] kasan, arm64: " Andrew Morton ` (61 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, fork: reset pointer tags of vmapped stacks Once tag-based KASAN modes start tagging vmalloc() allocations, kernel stacks start getting tagged if CONFIG_VMAP_STACK is enabled. Reset the tag of kernel stack pointers after allocation in alloc_thread_stack_node(). For SW_TAGS KASAN, when CONFIG_KASAN_STACK is enabled, the instrumentation can't handle the SP register being tagged. For HW_TAGS KASAN, there's no instrumentation-related issues. However, the impact of having a tagged SP register needs to be properly evaluated, so keep it non-tagged for now. Note, that the memory for the stack allocation still gets tagged to catch vmalloc-into-stack out-of-bounds accesses. Link: https://lkml.kernel.org/r/c6c96f012371ecd80e1936509ebcd3b07a5956f7.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- kernel/fork.c | 2 ++ 1 file changed, 2 insertions(+) --- a/kernel/fork.c~kasan-fork-reset-pointer-tags-of-vmapped-stacks +++ a/kernel/fork.c @@ -326,6 +326,8 @@ static int alloc_thread_stack_node(struc * so cache the vm_struct. */ tsk->stack_vm_area = vm; + if (stack) + stack = kasan_reset_tag(stack); tsk->stack = stack; return 0; } _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 052/114] kasan, arm64: reset pointer tags of vmapped stacks 2022-03-25 1:07 incoming Andrew Morton ` (50 preceding siblings ...) 2022-03-25 1:11 ` [patch 051/114] kasan, fork: reset pointer tags of vmapped stacks Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 053/114] kasan, vmalloc: add vmalloc tagging for SW_TAGS Andrew Morton ` (60 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, dan.carpenter, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, arm64: reset pointer tags of vmapped stacks Once tag-based KASAN modes start tagging vmalloc() allocations, kernel stacks start getting tagged if CONFIG_VMAP_STACK is enabled. Reset the tag of kernel stack pointers after allocation in arch_alloc_vmap_stack(). For SW_TAGS KASAN, when CONFIG_KASAN_STACK is enabled, the instrumentation can't handle the SP register being tagged. For HW_TAGS KASAN, there's no instrumentation-related issues. However, the impact of having a tagged SP register needs to be properly evaluated, so keep it non-tagged for now. Note, that the memory for the stack allocation still gets tagged to catch vmalloc-into-stack out-of-bounds accesses. [andreyknvl@google.com: fix case when a stack is retrieved from cached_stacks] Link: https://lkml.kernel.org/r/f50c5f96ef896d7936192c888b0c0a7674e33184.1644943792.git.andreyknvl@google.com [dan.carpenter@oracle.com: remove unnecessary check in alloc_thread_stack_node()] Link: https://lkml.kernel.org/r/20220301080706.GB17208@kili Link: https://lkml.kernel.org/r/698c5ab21743c796d46c15d075b9481825973e34.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Signed-off-by: Dan Carpenter <dan.carpenter@oracle.com> Acked-by: Catalin Marinas <catalin.marinas@arm.com> Acked-by: Marco Elver <elver@google.com> Reviewed-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm64/include/asm/vmap_stack.h | 5 ++++- kernel/fork.c | 11 ++++++----- 2 files changed, 10 insertions(+), 6 deletions(-) --- a/arch/arm64/include/asm/vmap_stack.h~kasan-arm64-reset-pointer-tags-of-vmapped-stacks +++ a/arch/arm64/include/asm/vmap_stack.h @@ -17,10 +17,13 @@ */ static inline unsigned long *arch_alloc_vmap_stack(size_t stack_size, int node) { + void *p; + BUILD_BUG_ON(!IS_ENABLED(CONFIG_VMAP_STACK)); - return __vmalloc_node(stack_size, THREAD_ALIGN, THREADINFO_GFP, node, + p = __vmalloc_node(stack_size, THREAD_ALIGN, THREADINFO_GFP, node, __builtin_return_address(0)); + return kasan_reset_tag(p); } #endif /* __ASM_VMAP_STACK_H */ --- a/kernel/fork.c~kasan-arm64-reset-pointer-tags-of-vmapped-stacks +++ a/kernel/fork.c @@ -286,11 +286,13 @@ static int alloc_thread_stack_node(struc if (!s) continue; - /* Mark stack accessible for KASAN. */ + /* Reset stack metadata. */ kasan_unpoison_range(s->addr, THREAD_SIZE); + stack = kasan_reset_tag(s->addr); + /* Clear stale pointers from reused stack. */ - memset(s->addr, 0, THREAD_SIZE); + memset(stack, 0, THREAD_SIZE); if (memcg_charge_kernel_stack(s)) { vfree(s->addr); @@ -298,7 +300,7 @@ static int alloc_thread_stack_node(struc } tsk->stack_vm_area = s; - tsk->stack = s->addr; + tsk->stack = stack; return 0; } @@ -326,8 +328,7 @@ static int alloc_thread_stack_node(struc * so cache the vm_struct. */ tsk->stack_vm_area = vm; - if (stack) - stack = kasan_reset_tag(stack); + stack = kasan_reset_tag(stack); tsk->stack = stack; return 0; } _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 053/114] kasan, vmalloc: add vmalloc tagging for SW_TAGS 2022-03-25 1:07 incoming Andrew Morton ` (51 preceding siblings ...) 2022-03-25 1:11 ` [patch 052/114] kasan, arm64: " Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 054/114] kasan, vmalloc, arm64: mark vmalloc mappings as pgprot_tagged Andrew Morton ` (59 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, vmalloc: add vmalloc tagging for SW_TAGS Add vmalloc tagging support to SW_TAGS KASAN. - __kasan_unpoison_vmalloc() now assigns a random pointer tag, poisons the virtual mapping accordingly, and embeds the tag into the returned pointer. - __get_vm_area_node() (used by vmalloc() and vmap()) and pcpu_get_vm_areas() save the tagged pointer into vm_struct->addr (note: not into vmap_area->addr). This requires putting kasan_unpoison_vmalloc() after setup_vmalloc_vm[_locked](); otherwise the latter will overwrite the tagged pointer. The tagged pointer then is naturally propagateed to vmalloc() and vmap(). - vm_map_ram() returns the tagged pointer directly. As a result of this change, vm_struct->addr is now tagged. Enabling KASAN_VMALLOC with SW_TAGS is not yet allowed. Link: https://lkml.kernel.org/r/4a78f3c064ce905e9070c29733aca1dd254a74f1.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/kasan.h | 16 ++++++++++------ mm/kasan/shadow.c | 6 ++++-- mm/vmalloc.c | 14 ++++++++------ 3 files changed, 22 insertions(+), 14 deletions(-) --- a/include/linux/kasan.h~kasan-vmalloc-add-vmalloc-tagging-for-sw_tags +++ a/include/linux/kasan.h @@ -403,12 +403,13 @@ void kasan_release_vmalloc(unsigned long unsigned long free_region_start, unsigned long free_region_end); -void __kasan_unpoison_vmalloc(const void *start, unsigned long size); -static __always_inline void kasan_unpoison_vmalloc(const void *start, - unsigned long size) +void *__kasan_unpoison_vmalloc(const void *start, unsigned long size); +static __always_inline void *kasan_unpoison_vmalloc(const void *start, + unsigned long size) { if (kasan_enabled()) - __kasan_unpoison_vmalloc(start, size); + return __kasan_unpoison_vmalloc(start, size); + return (void *)start; } void __kasan_poison_vmalloc(const void *start, unsigned long size); @@ -433,8 +434,11 @@ static inline void kasan_release_vmalloc unsigned long free_region_start, unsigned long free_region_end) { } -static inline void kasan_unpoison_vmalloc(const void *start, unsigned long size) -{ } +static inline void *kasan_unpoison_vmalloc(const void *start, + unsigned long size) +{ + return (void *)start; +} static inline void kasan_poison_vmalloc(const void *start, unsigned long size) { } --- a/mm/kasan/shadow.c~kasan-vmalloc-add-vmalloc-tagging-for-sw_tags +++ a/mm/kasan/shadow.c @@ -475,12 +475,14 @@ void kasan_release_vmalloc(unsigned long } } -void __kasan_unpoison_vmalloc(const void *start, unsigned long size) +void *__kasan_unpoison_vmalloc(const void *start, unsigned long size) { if (!is_vmalloc_or_module_addr(start)) - return; + return (void *)start; + start = set_tag(start, kasan_random_tag()); kasan_unpoison(start, size, false); + return (void *)start; } /* --- a/mm/vmalloc.c~kasan-vmalloc-add-vmalloc-tagging-for-sw_tags +++ a/mm/vmalloc.c @@ -2231,7 +2231,7 @@ void *vm_map_ram(struct page **pages, un mem = (void *)addr; } - kasan_unpoison_vmalloc(mem, size); + mem = kasan_unpoison_vmalloc(mem, size); if (vmap_pages_range(addr, addr + size, PAGE_KERNEL, pages, PAGE_SHIFT) < 0) { @@ -2464,10 +2464,10 @@ static struct vm_struct *__get_vm_area_n return NULL; } - kasan_unpoison_vmalloc((void *)va->va_start, requested_size); - setup_vmalloc_vm(area, va, flags, caller); + area->addr = kasan_unpoison_vmalloc(area->addr, requested_size); + return area; } @@ -3815,9 +3815,6 @@ retry: for (area = 0; area < nr_vms; area++) { if (kasan_populate_vmalloc(vas[area]->va_start, sizes[area])) goto err_free_shadow; - - kasan_unpoison_vmalloc((void *)vas[area]->va_start, - sizes[area]); } /* insert all vm's */ @@ -3830,6 +3827,11 @@ retry: } spin_unlock(&vmap_area_lock); + /* mark allocated areas as accessible */ + for (area = 0; area < nr_vms; area++) + vms[area]->addr = kasan_unpoison_vmalloc(vms[area]->addr, + vms[area]->size); + kfree(vas); return vms; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 054/114] kasan, vmalloc, arm64: mark vmalloc mappings as pgprot_tagged 2022-03-25 1:07 incoming Andrew Morton ` (52 preceding siblings ...) 2022-03-25 1:11 ` [patch 053/114] kasan, vmalloc: add vmalloc tagging for SW_TAGS Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 055/114] kasan, vmalloc: unpoison VM_ALLOC pages after mapping Andrew Morton ` (58 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, vmalloc, arm64: mark vmalloc mappings as pgprot_tagged HW_TAGS KASAN relies on ARM Memory Tagging Extension (MTE). With MTE, a memory region must be mapped as MT_NORMAL_TAGGED to allow setting memory tags via MTE-specific instructions. Add proper protection bits to vmalloc() allocations. These allocations are always backed by page_alloc pages, so the tags will actually be getting set on the corresponding physical memory. Link: https://lkml.kernel.org/r/983fc33542db2f6b1e77b34ca23448d4640bbb9e.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Co-developed-by: Vincenzo Frascino <vincenzo.frascino@arm.com> Signed-off-by: Vincenzo Frascino <vincenzo.frascino@arm.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm64/include/asm/vmalloc.h | 6 ++++++ include/linux/vmalloc.h | 7 +++++++ mm/vmalloc.c | 9 +++++++++ 3 files changed, 22 insertions(+) --- a/arch/arm64/include/asm/vmalloc.h~kasan-vmalloc-arm64-mark-vmalloc-mappings-as-pgprot_tagged +++ a/arch/arm64/include/asm/vmalloc.h @@ -25,4 +25,10 @@ static inline bool arch_vmap_pmd_support #endif +#define arch_vmap_pgprot_tagged arch_vmap_pgprot_tagged +static inline pgprot_t arch_vmap_pgprot_tagged(pgprot_t prot) +{ + return pgprot_tagged(prot); +} + #endif /* _ASM_ARM64_VMALLOC_H */ --- a/include/linux/vmalloc.h~kasan-vmalloc-arm64-mark-vmalloc-mappings-as-pgprot_tagged +++ a/include/linux/vmalloc.h @@ -115,6 +115,13 @@ static inline int arch_vmap_pte_supporte } #endif +#ifndef arch_vmap_pgprot_tagged +static inline pgprot_t arch_vmap_pgprot_tagged(pgprot_t prot) +{ + return prot; +} +#endif + /* * Highlevel APIs for driver use */ --- a/mm/vmalloc.c~kasan-vmalloc-arm64-mark-vmalloc-mappings-as-pgprot_tagged +++ a/mm/vmalloc.c @@ -3128,6 +3128,15 @@ again: goto fail; } + /* + * Modify protection bits to allow tagging. + * This must be done before mapping by __vmalloc_area_node(). + */ + if (kasan_hw_tags_enabled() && + pgprot_val(prot) == pgprot_val(PAGE_KERNEL)) + prot = arch_vmap_pgprot_tagged(prot); + + /* Allocate physical pages and map them into vmalloc space. */ addr = __vmalloc_area_node(area, gfp_mask, prot, shift, node); if (!addr) goto fail; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 055/114] kasan, vmalloc: unpoison VM_ALLOC pages after mapping 2022-03-25 1:07 incoming Andrew Morton ` (53 preceding siblings ...) 2022-03-25 1:11 ` [patch 054/114] kasan, vmalloc, arm64: mark vmalloc mappings as pgprot_tagged Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 056/114] kasan, mm: only define ___GFP_SKIP_KASAN_POISON with HW_TAGS Andrew Morton ` (57 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, vmalloc: unpoison VM_ALLOC pages after mapping Make KASAN unpoison vmalloc mappings after they have been mapped in when it's possible: for vmalloc() (indentified via VM_ALLOC) and vm_map_ram(). The reasons for this are: - For vmalloc() and vm_map_ram(): pages don't get unpoisoned in case mapping them fails. - For vmalloc(): HW_TAGS KASAN needs pages to be mapped to set tags via kasan_unpoison_vmalloc(). As a part of these changes, the return value of __vmalloc_node_range() is changed to area->addr. This is a non-functional change, as __vmalloc_area_node() returns area->addr anyway. Link: https://lkml.kernel.org/r/fcb98980e6fcd3c4be6acdcb5d6110898ef28548.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmalloc.c | 30 ++++++++++++++++++++++-------- 1 file changed, 22 insertions(+), 8 deletions(-) --- a/mm/vmalloc.c~kasan-vmalloc-unpoison-vm_alloc-pages-after-mapping +++ a/mm/vmalloc.c @@ -2231,14 +2231,15 @@ void *vm_map_ram(struct page **pages, un mem = (void *)addr; } - mem = kasan_unpoison_vmalloc(mem, size); - if (vmap_pages_range(addr, addr + size, PAGE_KERNEL, pages, PAGE_SHIFT) < 0) { vm_unmap_ram(mem, count); return NULL; } + /* Mark the pages as accessible, now that they are mapped. */ + mem = kasan_unpoison_vmalloc(mem, size); + return mem; } EXPORT_SYMBOL(vm_map_ram); @@ -2466,7 +2467,14 @@ static struct vm_struct *__get_vm_area_n setup_vmalloc_vm(area, va, flags, caller); - area->addr = kasan_unpoison_vmalloc(area->addr, requested_size); + /* + * Mark pages for non-VM_ALLOC mappings as accessible. Do it now as a + * best-effort approach, as they can be mapped outside of vmalloc code. + * For VM_ALLOC mappings, the pages are marked as accessible after + * getting mapped in __vmalloc_node_range(). + */ + if (!(flags & VM_ALLOC)) + area->addr = kasan_unpoison_vmalloc(area->addr, requested_size); return area; } @@ -3075,7 +3083,7 @@ void *__vmalloc_node_range(unsigned long const void *caller) { struct vm_struct *area; - void *addr; + void *ret; unsigned long real_size = size; unsigned long real_align = align; unsigned int shift = PAGE_SHIFT; @@ -3137,10 +3145,13 @@ again: prot = arch_vmap_pgprot_tagged(prot); /* Allocate physical pages and map them into vmalloc space. */ - addr = __vmalloc_area_node(area, gfp_mask, prot, shift, node); - if (!addr) + ret = __vmalloc_area_node(area, gfp_mask, prot, shift, node); + if (!ret) goto fail; + /* Mark the pages as accessible, now that they are mapped. */ + area->addr = kasan_unpoison_vmalloc(area->addr, real_size); + /* * In this function, newly allocated vm_struct has VM_UNINITIALIZED * flag. It means that vm_struct is not fully initialized. @@ -3152,7 +3163,7 @@ again: if (!(vm_flags & VM_DEFER_KMEMLEAK)) kmemleak_vmalloc(area, size, gfp_mask); - return addr; + return area->addr; fail: if (shift > PAGE_SHIFT) { @@ -3836,7 +3847,10 @@ retry: } spin_unlock(&vmap_area_lock); - /* mark allocated areas as accessible */ + /* + * Mark allocated areas as accessible. Do it now as a best-effort + * approach, as they can be mapped outside of vmalloc code. + */ for (area = 0; area < nr_vms; area++) vms[area]->addr = kasan_unpoison_vmalloc(vms[area]->addr, vms[area]->size); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 056/114] kasan, mm: only define ___GFP_SKIP_KASAN_POISON with HW_TAGS 2022-03-25 1:07 incoming Andrew Morton ` (54 preceding siblings ...) 2022-03-25 1:11 ` [patch 055/114] kasan, vmalloc: unpoison VM_ALLOC pages after mapping Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 057/114] kasan, page_alloc: allow skipping unpoisoning for HW_TAGS Andrew Morton ` (56 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, mm: only define ___GFP_SKIP_KASAN_POISON with HW_TAGS Only define the ___GFP_SKIP_KASAN_POISON flag when CONFIG_KASAN_HW_TAGS is enabled. This patch it not useful by itself, but it prepares the code for additions of new KASAN-specific GFP patches. Link: https://lkml.kernel.org/r/44e5738a584c11801b2b8f1231898918efc8634a.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/gfp.h | 8 +++++++- include/trace/events/mmflags.h | 12 +++++++++--- 2 files changed, 16 insertions(+), 4 deletions(-) --- a/include/linux/gfp.h~kasan-mm-only-define-___gfp_skip_kasan_poison-with-hw_tags +++ a/include/linux/gfp.h @@ -54,7 +54,11 @@ struct vm_area_struct; #define ___GFP_THISNODE 0x200000u #define ___GFP_ACCOUNT 0x400000u #define ___GFP_ZEROTAGS 0x800000u +#ifdef CONFIG_KASAN_HW_TAGS #define ___GFP_SKIP_KASAN_POISON 0x1000000u +#else +#define ___GFP_SKIP_KASAN_POISON 0 +#endif #ifdef CONFIG_LOCKDEP #define ___GFP_NOLOCKDEP 0x2000000u #else @@ -251,7 +255,9 @@ struct vm_area_struct; #define __GFP_NOLOCKDEP ((__force gfp_t)___GFP_NOLOCKDEP) /* Room for N __GFP_FOO bits */ -#define __GFP_BITS_SHIFT (25 + IS_ENABLED(CONFIG_LOCKDEP)) +#define __GFP_BITS_SHIFT (24 + \ + IS_ENABLED(CONFIG_KASAN_HW_TAGS) + \ + IS_ENABLED(CONFIG_LOCKDEP)) #define __GFP_BITS_MASK ((__force gfp_t)((1 << __GFP_BITS_SHIFT) - 1)) /** --- a/include/trace/events/mmflags.h~kasan-mm-only-define-___gfp_skip_kasan_poison-with-hw_tags +++ a/include/trace/events/mmflags.h @@ -49,12 +49,18 @@ {(unsigned long)__GFP_RECLAIM, "__GFP_RECLAIM"}, \ {(unsigned long)__GFP_DIRECT_RECLAIM, "__GFP_DIRECT_RECLAIM"},\ {(unsigned long)__GFP_KSWAPD_RECLAIM, "__GFP_KSWAPD_RECLAIM"},\ - {(unsigned long)__GFP_ZEROTAGS, "__GFP_ZEROTAGS"}, \ - {(unsigned long)__GFP_SKIP_KASAN_POISON,"__GFP_SKIP_KASAN_POISON"}\ + {(unsigned long)__GFP_ZEROTAGS, "__GFP_ZEROTAGS"} \ + +#ifdef CONFIG_KASAN_HW_TAGS +#define __def_gfpflag_names_kasan \ + , {(unsigned long)__GFP_SKIP_KASAN_POISON, "__GFP_SKIP_KASAN_POISON"} +#else +#define __def_gfpflag_names_kasan +#endif #define show_gfp_flags(flags) \ (flags) ? __print_flags(flags, "|", \ - __def_gfpflag_names \ + __def_gfpflag_names __def_gfpflag_names_kasan \ ) : "none" #ifdef CONFIG_MMU _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 057/114] kasan, page_alloc: allow skipping unpoisoning for HW_TAGS 2022-03-25 1:07 incoming Andrew Morton ` (55 preceding siblings ...) 2022-03-25 1:11 ` [patch 056/114] kasan, mm: only define ___GFP_SKIP_KASAN_POISON with HW_TAGS Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 058/114] kasan, page_alloc: allow skipping memory init " Andrew Morton ` (55 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, page_alloc: allow skipping unpoisoning for HW_TAGS Add a new GFP flag __GFP_SKIP_KASAN_UNPOISON that allows skipping KASAN poisoning for page_alloc allocations. The flag is only effective with HW_TAGS KASAN. This flag will be used by vmalloc code for page_alloc allocations backing vmalloc() mappings in a following patch. The reason to skip KASAN poisoning for these pages in page_alloc is because vmalloc code will be poisoning them instead. Also reword the comment for __GFP_SKIP_KASAN_POISON. Link: https://lkml.kernel.org/r/35c97d77a704f6ff971dd3bfe4be95855744108e.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/gfp.h | 21 +++++++++++++-------- include/trace/events/mmflags.h | 5 +++-- mm/page_alloc.c | 31 ++++++++++++++++++++++--------- 3 files changed, 38 insertions(+), 19 deletions(-) --- a/include/linux/gfp.h~kasan-page_alloc-allow-skipping-unpoisoning-for-hw_tags +++ a/include/linux/gfp.h @@ -55,12 +55,14 @@ struct vm_area_struct; #define ___GFP_ACCOUNT 0x400000u #define ___GFP_ZEROTAGS 0x800000u #ifdef CONFIG_KASAN_HW_TAGS -#define ___GFP_SKIP_KASAN_POISON 0x1000000u +#define ___GFP_SKIP_KASAN_UNPOISON 0x1000000u +#define ___GFP_SKIP_KASAN_POISON 0x2000000u #else +#define ___GFP_SKIP_KASAN_UNPOISON 0 #define ___GFP_SKIP_KASAN_POISON 0 #endif #ifdef CONFIG_LOCKDEP -#define ___GFP_NOLOCKDEP 0x2000000u +#define ___GFP_NOLOCKDEP 0x4000000u #else #define ___GFP_NOLOCKDEP 0 #endif @@ -241,22 +243,25 @@ struct vm_area_struct; * intended for optimization: setting memory tags at the same time as zeroing * memory has minimal additional performace impact. * - * %__GFP_SKIP_KASAN_POISON returns a page which does not need to be poisoned - * on deallocation. Typically used for userspace pages. Currently only has an - * effect in HW tags mode. + * %__GFP_SKIP_KASAN_UNPOISON makes KASAN skip unpoisoning on page allocation. + * Only effective in HW_TAGS mode. + * + * %__GFP_SKIP_KASAN_POISON makes KASAN skip poisoning on page deallocation. + * Typically, used for userspace pages. Only effective in HW_TAGS mode. */ #define __GFP_NOWARN ((__force gfp_t)___GFP_NOWARN) #define __GFP_COMP ((__force gfp_t)___GFP_COMP) #define __GFP_ZERO ((__force gfp_t)___GFP_ZERO) #define __GFP_ZEROTAGS ((__force gfp_t)___GFP_ZEROTAGS) -#define __GFP_SKIP_KASAN_POISON ((__force gfp_t)___GFP_SKIP_KASAN_POISON) +#define __GFP_SKIP_KASAN_UNPOISON ((__force gfp_t)___GFP_SKIP_KASAN_UNPOISON) +#define __GFP_SKIP_KASAN_POISON ((__force gfp_t)___GFP_SKIP_KASAN_POISON) /* Disable lockdep for GFP context tracking */ #define __GFP_NOLOCKDEP ((__force gfp_t)___GFP_NOLOCKDEP) /* Room for N __GFP_FOO bits */ -#define __GFP_BITS_SHIFT (24 + \ - IS_ENABLED(CONFIG_KASAN_HW_TAGS) + \ +#define __GFP_BITS_SHIFT (24 + \ + 2 * IS_ENABLED(CONFIG_KASAN_HW_TAGS) + \ IS_ENABLED(CONFIG_LOCKDEP)) #define __GFP_BITS_MASK ((__force gfp_t)((1 << __GFP_BITS_SHIFT) - 1)) --- a/include/trace/events/mmflags.h~kasan-page_alloc-allow-skipping-unpoisoning-for-hw_tags +++ a/include/trace/events/mmflags.h @@ -52,8 +52,9 @@ {(unsigned long)__GFP_ZEROTAGS, "__GFP_ZEROTAGS"} \ #ifdef CONFIG_KASAN_HW_TAGS -#define __def_gfpflag_names_kasan \ - , {(unsigned long)__GFP_SKIP_KASAN_POISON, "__GFP_SKIP_KASAN_POISON"} +#define __def_gfpflag_names_kasan , \ + {(unsigned long)__GFP_SKIP_KASAN_POISON, "__GFP_SKIP_KASAN_POISON"}, \ + {(unsigned long)__GFP_SKIP_KASAN_UNPOISON, "__GFP_SKIP_KASAN_UNPOISON"} #else #define __def_gfpflag_names_kasan #endif --- a/mm/page_alloc.c~kasan-page_alloc-allow-skipping-unpoisoning-for-hw_tags +++ a/mm/page_alloc.c @@ -2343,6 +2343,26 @@ static inline bool check_new_pcp(struct } #endif /* CONFIG_DEBUG_VM */ +static inline bool should_skip_kasan_unpoison(gfp_t flags, bool init_tags) +{ + /* Don't skip if a software KASAN mode is enabled. */ + if (IS_ENABLED(CONFIG_KASAN_GENERIC) || + IS_ENABLED(CONFIG_KASAN_SW_TAGS)) + return false; + + /* Skip, if hardware tag-based KASAN is not enabled. */ + if (!kasan_hw_tags_enabled()) + return true; + + /* + * With hardware tag-based KASAN enabled, skip if either: + * + * 1. Memory tags have already been cleared via tag_clear_highpage(). + * 2. Skipping has been requested via __GFP_SKIP_KASAN_UNPOISON. + */ + return init_tags || (flags & __GFP_SKIP_KASAN_UNPOISON); +} + inline void post_alloc_hook(struct page *page, unsigned int order, gfp_t gfp_flags) { @@ -2382,15 +2402,8 @@ inline void post_alloc_hook(struct page /* Note that memory is already initialized by the loop above. */ init = false; } - /* - * If either a software KASAN mode is enabled, or, - * in the case of hardware tag-based KASAN, - * if memory tags have not been cleared via tag_clear_highpage(). - */ - if (IS_ENABLED(CONFIG_KASAN_GENERIC) || - IS_ENABLED(CONFIG_KASAN_SW_TAGS) || - kasan_hw_tags_enabled() && !init_tags) { - /* Mark shadow memory or set memory tags. */ + if (!should_skip_kasan_unpoison(gfp_flags, init_tags)) { + /* Unpoison shadow memory or set memory tags. */ kasan_unpoison_pages(page, order, init); /* Note that memory is already initialized by KASAN. */ _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 058/114] kasan, page_alloc: allow skipping memory init for HW_TAGS 2022-03-25 1:07 incoming Andrew Morton ` (56 preceding siblings ...) 2022-03-25 1:11 ` [patch 057/114] kasan, page_alloc: allow skipping unpoisoning for HW_TAGS Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 059/114] kasan, vmalloc: add vmalloc tagging " Andrew Morton ` (54 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, page_alloc: allow skipping memory init for HW_TAGS Add a new GFP flag __GFP_SKIP_ZERO that allows to skip memory initialization. The flag is only effective with HW_TAGS KASAN. This flag will be used by vmalloc code for page_alloc allocations backing vmalloc() mappings in a following patch. The reason to skip memory initialization for these pages in page_alloc is because vmalloc code will be initializing them instead. With the current implementation, when __GFP_SKIP_ZERO is provided, __GFP_ZEROTAGS is ignored. This doesn't matter, as these two flags are never provided at the same time. However, if this is changed in the future, this particular implementation detail can be changed as well. Link: https://lkml.kernel.org/r/0d53efeff345de7d708e0baa0d8829167772521e.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/gfp.h | 18 +++++++++++------- include/trace/events/mmflags.h | 1 + mm/page_alloc.c | 13 ++++++++++++- 3 files changed, 24 insertions(+), 8 deletions(-) --- a/include/linux/gfp.h~kasan-page_alloc-allow-skipping-memory-init-for-hw_tags +++ a/include/linux/gfp.h @@ -55,14 +55,16 @@ struct vm_area_struct; #define ___GFP_ACCOUNT 0x400000u #define ___GFP_ZEROTAGS 0x800000u #ifdef CONFIG_KASAN_HW_TAGS -#define ___GFP_SKIP_KASAN_UNPOISON 0x1000000u -#define ___GFP_SKIP_KASAN_POISON 0x2000000u +#define ___GFP_SKIP_ZERO 0x1000000u +#define ___GFP_SKIP_KASAN_UNPOISON 0x2000000u +#define ___GFP_SKIP_KASAN_POISON 0x4000000u #else +#define ___GFP_SKIP_ZERO 0 #define ___GFP_SKIP_KASAN_UNPOISON 0 #define ___GFP_SKIP_KASAN_POISON 0 #endif #ifdef CONFIG_LOCKDEP -#define ___GFP_NOLOCKDEP 0x4000000u +#define ___GFP_NOLOCKDEP 0x8000000u #else #define ___GFP_NOLOCKDEP 0 #endif @@ -239,9 +241,10 @@ struct vm_area_struct; * %__GFP_ZERO returns a zeroed page on success. * * %__GFP_ZEROTAGS zeroes memory tags at allocation time if the memory itself - * is being zeroed (either via __GFP_ZERO or via init_on_alloc). This flag is - * intended for optimization: setting memory tags at the same time as zeroing - * memory has minimal additional performace impact. + * is being zeroed (either via __GFP_ZERO or via init_on_alloc, provided that + * __GFP_SKIP_ZERO is not set). This flag is intended for optimization: setting + * memory tags at the same time as zeroing memory has minimal additional + * performace impact. * * %__GFP_SKIP_KASAN_UNPOISON makes KASAN skip unpoisoning on page allocation. * Only effective in HW_TAGS mode. @@ -253,6 +256,7 @@ struct vm_area_struct; #define __GFP_COMP ((__force gfp_t)___GFP_COMP) #define __GFP_ZERO ((__force gfp_t)___GFP_ZERO) #define __GFP_ZEROTAGS ((__force gfp_t)___GFP_ZEROTAGS) +#define __GFP_SKIP_ZERO ((__force gfp_t)___GFP_SKIP_ZERO) #define __GFP_SKIP_KASAN_UNPOISON ((__force gfp_t)___GFP_SKIP_KASAN_UNPOISON) #define __GFP_SKIP_KASAN_POISON ((__force gfp_t)___GFP_SKIP_KASAN_POISON) @@ -261,7 +265,7 @@ struct vm_area_struct; /* Room for N __GFP_FOO bits */ #define __GFP_BITS_SHIFT (24 + \ - 2 * IS_ENABLED(CONFIG_KASAN_HW_TAGS) + \ + 3 * IS_ENABLED(CONFIG_KASAN_HW_TAGS) + \ IS_ENABLED(CONFIG_LOCKDEP)) #define __GFP_BITS_MASK ((__force gfp_t)((1 << __GFP_BITS_SHIFT) - 1)) --- a/include/trace/events/mmflags.h~kasan-page_alloc-allow-skipping-memory-init-for-hw_tags +++ a/include/trace/events/mmflags.h @@ -53,6 +53,7 @@ #ifdef CONFIG_KASAN_HW_TAGS #define __def_gfpflag_names_kasan , \ + {(unsigned long)__GFP_SKIP_ZERO, "__GFP_SKIP_ZERO"}, \ {(unsigned long)__GFP_SKIP_KASAN_POISON, "__GFP_SKIP_KASAN_POISON"}, \ {(unsigned long)__GFP_SKIP_KASAN_UNPOISON, "__GFP_SKIP_KASAN_UNPOISON"} #else --- a/mm/page_alloc.c~kasan-page_alloc-allow-skipping-memory-init-for-hw_tags +++ a/mm/page_alloc.c @@ -2363,10 +2363,21 @@ static inline bool should_skip_kasan_unp return init_tags || (flags & __GFP_SKIP_KASAN_UNPOISON); } +static inline bool should_skip_init(gfp_t flags) +{ + /* Don't skip, if hardware tag-based KASAN is not enabled. */ + if (!kasan_hw_tags_enabled()) + return false; + + /* For hardware tag-based KASAN, skip if requested. */ + return (flags & __GFP_SKIP_ZERO); +} + inline void post_alloc_hook(struct page *page, unsigned int order, gfp_t gfp_flags) { - bool init = !want_init_on_free() && want_init_on_alloc(gfp_flags); + bool init = !want_init_on_free() && want_init_on_alloc(gfp_flags) && + !should_skip_init(gfp_flags); bool init_tags = init && (gfp_flags & __GFP_ZEROTAGS); set_page_private(page, 0); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 059/114] kasan, vmalloc: add vmalloc tagging for HW_TAGS 2022-03-25 1:07 incoming Andrew Morton ` (57 preceding siblings ...) 2022-03-25 1:11 ` [patch 058/114] kasan, page_alloc: allow skipping memory init " Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 060/114] kasan, vmalloc: only tag normal vmalloc allocations Andrew Morton ` (53 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, vmalloc: add vmalloc tagging for HW_TAGS Add vmalloc tagging support to HW_TAGS KASAN. The key difference between HW_TAGS and the other two KASAN modes when it comes to vmalloc: HW_TAGS KASAN can only assign tags to physical memory. The other two modes have shadow memory covering every mapped virtual memory region. Make __kasan_unpoison_vmalloc() for HW_TAGS KASAN: - Skip non-VM_ALLOC mappings as HW_TAGS KASAN can only tag a single mapping of normal physical memory; see the comment in the function. - Generate a random tag, tag the returned pointer and the allocation, and initialize the allocation at the same time. - Propagate the tag into the page stucts to allow accesses through page_address(vmalloc_to_page()). The rest of vmalloc-related KASAN hooks are not needed: - The shadow-related ones are fully skipped. - __kasan_poison_vmalloc() is kept as a no-op with a comment. Poisoning and zeroing of physical pages that are backing vmalloc() allocations are skipped via __GFP_SKIP_KASAN_UNPOISON and __GFP_SKIP_ZERO: __kasan_unpoison_vmalloc() does that instead. Enabling CONFIG_KASAN_VMALLOC with HW_TAGS is not yet allowed. Link: https://lkml.kernel.org/r/d19b2e9e59a9abc59d05b72dea8429dcaea739c6.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Co-developed-by: Vincenzo Frascino <vincenzo.frascino@arm.com> Signed-off-by: Vincenzo Frascino <vincenzo.frascino@arm.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/kasan.h | 36 +++++++++++++-- kernel/scs.c | 4 - mm/kasan/hw_tags.c | 92 ++++++++++++++++++++++++++++++++++++++++ mm/kasan/shadow.c | 10 +++- mm/vmalloc.c | 51 +++++++++++++++++----- 5 files changed, 175 insertions(+), 18 deletions(-) --- a/include/linux/kasan.h~kasan-vmalloc-add-vmalloc-tagging-for-hw_tags +++ a/include/linux/kasan.h @@ -26,6 +26,12 @@ struct kunit_kasan_expectation { #endif +typedef unsigned int __bitwise kasan_vmalloc_flags_t; + +#define KASAN_VMALLOC_NONE 0x00u +#define KASAN_VMALLOC_INIT 0x01u +#define KASAN_VMALLOC_VM_ALLOC 0x02u + #if defined(CONFIG_KASAN_GENERIC) || defined(CONFIG_KASAN_SW_TAGS) #include <linux/pgtable.h> @@ -397,18 +403,39 @@ static inline void kasan_init_hw_tags(vo #ifdef CONFIG_KASAN_VMALLOC +#if defined(CONFIG_KASAN_GENERIC) || defined(CONFIG_KASAN_SW_TAGS) + void kasan_populate_early_vm_area_shadow(void *start, unsigned long size); int kasan_populate_vmalloc(unsigned long addr, unsigned long size); void kasan_release_vmalloc(unsigned long start, unsigned long end, unsigned long free_region_start, unsigned long free_region_end); -void *__kasan_unpoison_vmalloc(const void *start, unsigned long size); +#else /* CONFIG_KASAN_GENERIC || CONFIG_KASAN_SW_TAGS */ + +static inline void kasan_populate_early_vm_area_shadow(void *start, + unsigned long size) +{ } +static inline int kasan_populate_vmalloc(unsigned long start, + unsigned long size) +{ + return 0; +} +static inline void kasan_release_vmalloc(unsigned long start, + unsigned long end, + unsigned long free_region_start, + unsigned long free_region_end) { } + +#endif /* CONFIG_KASAN_GENERIC || CONFIG_KASAN_SW_TAGS */ + +void *__kasan_unpoison_vmalloc(const void *start, unsigned long size, + kasan_vmalloc_flags_t flags); static __always_inline void *kasan_unpoison_vmalloc(const void *start, - unsigned long size) + unsigned long size, + kasan_vmalloc_flags_t flags) { if (kasan_enabled()) - return __kasan_unpoison_vmalloc(start, size); + return __kasan_unpoison_vmalloc(start, size, flags); return (void *)start; } @@ -435,7 +462,8 @@ static inline void kasan_release_vmalloc unsigned long free_region_end) { } static inline void *kasan_unpoison_vmalloc(const void *start, - unsigned long size) + unsigned long size, + kasan_vmalloc_flags_t flags) { return (void *)start; } --- a/kernel/scs.c~kasan-vmalloc-add-vmalloc-tagging-for-hw_tags +++ a/kernel/scs.c @@ -32,7 +32,7 @@ static void *__scs_alloc(int node) for (i = 0; i < NR_CACHED_SCS; i++) { s = this_cpu_xchg(scs_cache[i], NULL); if (s) { - kasan_unpoison_vmalloc(s, SCS_SIZE); + kasan_unpoison_vmalloc(s, SCS_SIZE, KASAN_VMALLOC_NONE); memset(s, 0, SCS_SIZE); return s; } @@ -78,7 +78,7 @@ void scs_free(void *s) if (this_cpu_cmpxchg(scs_cache[i], 0, s) == NULL) return; - kasan_unpoison_vmalloc(s, SCS_SIZE); + kasan_unpoison_vmalloc(s, SCS_SIZE, KASAN_VMALLOC_NONE); vfree_atomic(s); } --- a/mm/kasan/hw_tags.c~kasan-vmalloc-add-vmalloc-tagging-for-hw_tags +++ a/mm/kasan/hw_tags.c @@ -192,6 +192,98 @@ void __init kasan_init_hw_tags(void) kasan_stack_collection_enabled() ? "on" : "off"); } +#ifdef CONFIG_KASAN_VMALLOC + +static void unpoison_vmalloc_pages(const void *addr, u8 tag) +{ + struct vm_struct *area; + int i; + + /* + * As hardware tag-based KASAN only tags VM_ALLOC vmalloc allocations + * (see the comment in __kasan_unpoison_vmalloc), all of the pages + * should belong to a single area. + */ + area = find_vm_area((void *)addr); + if (WARN_ON(!area)) + return; + + for (i = 0; i < area->nr_pages; i++) { + struct page *page = area->pages[i]; + + page_kasan_tag_set(page, tag); + } +} + +void *__kasan_unpoison_vmalloc(const void *start, unsigned long size, + kasan_vmalloc_flags_t flags) +{ + u8 tag; + unsigned long redzone_start, redzone_size; + + if (!is_vmalloc_or_module_addr(start)) + return (void *)start; + + /* + * Skip unpoisoning and assigning a pointer tag for non-VM_ALLOC + * mappings as: + * + * 1. Unlike the software KASAN modes, hardware tag-based KASAN only + * supports tagging physical memory. Therefore, it can only tag a + * single mapping of normal physical pages. + * 2. Hardware tag-based KASAN can only tag memory mapped with special + * mapping protection bits, see arch_vmalloc_pgprot_modify(). + * As non-VM_ALLOC mappings can be mapped outside of vmalloc code, + * providing these bits would require tracking all non-VM_ALLOC + * mappers. + * + * Thus, for VM_ALLOC mappings, hardware tag-based KASAN only tags + * the first virtual mapping, which is created by vmalloc(). + * Tagging the page_alloc memory backing that vmalloc() allocation is + * skipped, see ___GFP_SKIP_KASAN_UNPOISON. + * + * For non-VM_ALLOC allocations, page_alloc memory is tagged as usual. + */ + if (!(flags & KASAN_VMALLOC_VM_ALLOC)) + return (void *)start; + + tag = kasan_random_tag(); + start = set_tag(start, tag); + + /* Unpoison and initialize memory up to size. */ + kasan_unpoison(start, size, flags & KASAN_VMALLOC_INIT); + + /* + * Explicitly poison and initialize the in-page vmalloc() redzone. + * Unlike software KASAN modes, hardware tag-based KASAN doesn't + * unpoison memory when populating shadow for vmalloc() space. + */ + redzone_start = round_up((unsigned long)start + size, + KASAN_GRANULE_SIZE); + redzone_size = round_up(redzone_start, PAGE_SIZE) - redzone_start; + kasan_poison((void *)redzone_start, redzone_size, KASAN_TAG_INVALID, + flags & KASAN_VMALLOC_INIT); + + /* + * Set per-page tag flags to allow accessing physical memory for the + * vmalloc() mapping through page_address(vmalloc_to_page()). + */ + unpoison_vmalloc_pages(start, tag); + + return (void *)start; +} + +void __kasan_poison_vmalloc(const void *start, unsigned long size) +{ + /* + * No tagging here. + * The physical pages backing the vmalloc() allocation are poisoned + * through the usual page_alloc paths. + */ +} + +#endif + #if IS_ENABLED(CONFIG_KASAN_KUNIT_TEST) void kasan_enable_tagging_sync(void) --- a/mm/kasan/shadow.c~kasan-vmalloc-add-vmalloc-tagging-for-hw_tags +++ a/mm/kasan/shadow.c @@ -475,8 +475,16 @@ void kasan_release_vmalloc(unsigned long } } -void *__kasan_unpoison_vmalloc(const void *start, unsigned long size) +void *__kasan_unpoison_vmalloc(const void *start, unsigned long size, + kasan_vmalloc_flags_t flags) { + /* + * Software KASAN modes unpoison both VM_ALLOC and non-VM_ALLOC + * mappings, so the KASAN_VMALLOC_VM_ALLOC flag is ignored. + * Software KASAN modes can't optimize zeroing memory by combining it + * with setting memory tags, so the KASAN_VMALLOC_INIT flag is ignored. + */ + if (!is_vmalloc_or_module_addr(start)) return (void *)start; --- a/mm/vmalloc.c~kasan-vmalloc-add-vmalloc-tagging-for-hw_tags +++ a/mm/vmalloc.c @@ -2237,8 +2237,12 @@ void *vm_map_ram(struct page **pages, un return NULL; } - /* Mark the pages as accessible, now that they are mapped. */ - mem = kasan_unpoison_vmalloc(mem, size); + /* + * Mark the pages as accessible, now that they are mapped. + * With hardware tag-based KASAN, marking is skipped for + * non-VM_ALLOC mappings, see __kasan_unpoison_vmalloc(). + */ + mem = kasan_unpoison_vmalloc(mem, size, KASAN_VMALLOC_NONE); return mem; } @@ -2472,9 +2476,12 @@ static struct vm_struct *__get_vm_area_n * best-effort approach, as they can be mapped outside of vmalloc code. * For VM_ALLOC mappings, the pages are marked as accessible after * getting mapped in __vmalloc_node_range(). + * With hardware tag-based KASAN, marking is skipped for + * non-VM_ALLOC mappings, see __kasan_unpoison_vmalloc(). */ if (!(flags & VM_ALLOC)) - area->addr = kasan_unpoison_vmalloc(area->addr, requested_size); + area->addr = kasan_unpoison_vmalloc(area->addr, requested_size, + KASAN_VMALLOC_NONE); return area; } @@ -3084,6 +3091,7 @@ void *__vmalloc_node_range(unsigned long { struct vm_struct *area; void *ret; + kasan_vmalloc_flags_t kasan_flags; unsigned long real_size = size; unsigned long real_align = align; unsigned int shift = PAGE_SHIFT; @@ -3136,21 +3144,39 @@ again: goto fail; } - /* - * Modify protection bits to allow tagging. - * This must be done before mapping by __vmalloc_area_node(). - */ + /* Prepare arguments for __vmalloc_area_node(). */ if (kasan_hw_tags_enabled() && - pgprot_val(prot) == pgprot_val(PAGE_KERNEL)) + pgprot_val(prot) == pgprot_val(PAGE_KERNEL)) { + /* + * Modify protection bits to allow tagging. + * This must be done before mapping in __vmalloc_area_node(). + */ prot = arch_vmap_pgprot_tagged(prot); + /* + * Skip page_alloc poisoning and zeroing for physical pages + * backing VM_ALLOC mapping. Memory is instead poisoned and + * zeroed by kasan_unpoison_vmalloc(). + */ + gfp_mask |= __GFP_SKIP_KASAN_UNPOISON | __GFP_SKIP_ZERO; + } + /* Allocate physical pages and map them into vmalloc space. */ ret = __vmalloc_area_node(area, gfp_mask, prot, shift, node); if (!ret) goto fail; - /* Mark the pages as accessible, now that they are mapped. */ - area->addr = kasan_unpoison_vmalloc(area->addr, real_size); + /* + * Mark the pages as accessible, now that they are mapped. + * The init condition should match the one in post_alloc_hook() + * (except for the should_skip_init() check) to make sure that memory + * is initialized under the same conditions regardless of the enabled + * KASAN mode. + */ + kasan_flags = KASAN_VMALLOC_VM_ALLOC; + if (!want_init_on_free() && want_init_on_alloc(gfp_mask)) + kasan_flags |= KASAN_VMALLOC_INIT; + area->addr = kasan_unpoison_vmalloc(area->addr, real_size, kasan_flags); /* * In this function, newly allocated vm_struct has VM_UNINITIALIZED @@ -3850,10 +3876,13 @@ retry: /* * Mark allocated areas as accessible. Do it now as a best-effort * approach, as they can be mapped outside of vmalloc code. + * With hardware tag-based KASAN, marking is skipped for + * non-VM_ALLOC mappings, see __kasan_unpoison_vmalloc(). */ for (area = 0; area < nr_vms; area++) vms[area]->addr = kasan_unpoison_vmalloc(vms[area]->addr, - vms[area]->size); + vms[area]->size, + KASAN_VMALLOC_NONE); kfree(vas); return vms; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 060/114] kasan, vmalloc: only tag normal vmalloc allocations 2022-03-25 1:07 incoming Andrew Morton ` (58 preceding siblings ...) 2022-03-25 1:11 ` [patch 059/114] kasan, vmalloc: add vmalloc tagging " Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 061/114] kasan, arm64: don't tag executable " Andrew Morton ` (52 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, vmalloc: only tag normal vmalloc allocations The kernel can use to allocate executable memory. The only supported way to do that is via __vmalloc_node_range() with the executable bit set in the prot argument. (vmap() resets the bit via pgprot_nx()). Once tag-based KASAN modes start tagging vmalloc allocations, executing code from such allocations will lead to the PC register getting a tag, which is not tolerated by the kernel. Only tag the allocations for normal kernel pages. [andreyknvl@google.com: pass KASAN_VMALLOC_PROT_NORMAL to kasan_unpoison_vmalloc()] Link: https://lkml.kernel.org/r/9230ca3d3e40ffca041c133a524191fd71969a8d.1646233925.git.andreyknvl@google.com [andreyknvl@google.com: support tagged vmalloc mappings] Link: https://lkml.kernel.org/r/2f6605e3a358cf64d73a05710cb3da356886ad29.1646233925.git.andreyknvl@google.com [andreyknvl@google.com: don't unintentionally disabled poisoning] Link: https://lkml.kernel.org/r/de4587d6a719232e83c760113e46ed2d4d8da61e.1646757322.git.andreyknvl@google.com Link: https://lkml.kernel.org/r/fbfd9939a4dc375923c9a5c6b9e7ab05c26b8c6b.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/kasan.h | 7 +++-- kernel/scs.c | 12 ++++++--- mm/kasan/hw_tags.c | 7 +++++ mm/kasan/shadow.c | 8 ++++++ mm/vmalloc.c | 49 +++++++++++++++++++++++----------------- 5 files changed, 56 insertions(+), 27 deletions(-) --- a/include/linux/kasan.h~kasan-vmalloc-only-tag-normal-vmalloc-allocations +++ a/include/linux/kasan.h @@ -28,9 +28,10 @@ struct kunit_kasan_expectation { typedef unsigned int __bitwise kasan_vmalloc_flags_t; -#define KASAN_VMALLOC_NONE 0x00u -#define KASAN_VMALLOC_INIT 0x01u -#define KASAN_VMALLOC_VM_ALLOC 0x02u +#define KASAN_VMALLOC_NONE 0x00u +#define KASAN_VMALLOC_INIT 0x01u +#define KASAN_VMALLOC_VM_ALLOC 0x02u +#define KASAN_VMALLOC_PROT_NORMAL 0x04u #if defined(CONFIG_KASAN_GENERIC) || defined(CONFIG_KASAN_SW_TAGS) --- a/kernel/scs.c~kasan-vmalloc-only-tag-normal-vmalloc-allocations +++ a/kernel/scs.c @@ -32,15 +32,19 @@ static void *__scs_alloc(int node) for (i = 0; i < NR_CACHED_SCS; i++) { s = this_cpu_xchg(scs_cache[i], NULL); if (s) { - kasan_unpoison_vmalloc(s, SCS_SIZE, KASAN_VMALLOC_NONE); + s = kasan_unpoison_vmalloc(s, SCS_SIZE, + KASAN_VMALLOC_PROT_NORMAL); memset(s, 0, SCS_SIZE); - return s; + goto out; } } - return __vmalloc_node_range(SCS_SIZE, 1, VMALLOC_START, VMALLOC_END, + s = __vmalloc_node_range(SCS_SIZE, 1, VMALLOC_START, VMALLOC_END, GFP_SCS, PAGE_KERNEL, 0, node, __builtin_return_address(0)); + +out: + return kasan_reset_tag(s); } void *scs_alloc(int node) @@ -78,7 +82,7 @@ void scs_free(void *s) if (this_cpu_cmpxchg(scs_cache[i], 0, s) == NULL) return; - kasan_unpoison_vmalloc(s, SCS_SIZE, KASAN_VMALLOC_NONE); + kasan_unpoison_vmalloc(s, SCS_SIZE, KASAN_VMALLOC_PROT_NORMAL); vfree_atomic(s); } --- a/mm/kasan/hw_tags.c~kasan-vmalloc-only-tag-normal-vmalloc-allocations +++ a/mm/kasan/hw_tags.c @@ -247,6 +247,13 @@ void *__kasan_unpoison_vmalloc(const voi if (!(flags & KASAN_VMALLOC_VM_ALLOC)) return (void *)start; + /* + * Don't tag executable memory. + * The kernel doesn't tolerate having the PC register tagged. + */ + if (!(flags & KASAN_VMALLOC_PROT_NORMAL)) + return (void *)start; + tag = kasan_random_tag(); start = set_tag(start, tag); --- a/mm/kasan/shadow.c~kasan-vmalloc-only-tag-normal-vmalloc-allocations +++ a/mm/kasan/shadow.c @@ -488,6 +488,14 @@ void *__kasan_unpoison_vmalloc(const voi if (!is_vmalloc_or_module_addr(start)) return (void *)start; + /* + * Don't tag executable memory with the tag-based mode. + * The kernel doesn't tolerate having the PC register tagged. + */ + if (IS_ENABLED(CONFIG_KASAN_SW_TAGS) && + !(flags & KASAN_VMALLOC_PROT_NORMAL)) + return (void *)start; + start = set_tag(start, kasan_random_tag()); kasan_unpoison(start, size, false); return (void *)start; --- a/mm/vmalloc.c~kasan-vmalloc-only-tag-normal-vmalloc-allocations +++ a/mm/vmalloc.c @@ -2242,7 +2242,7 @@ void *vm_map_ram(struct page **pages, un * With hardware tag-based KASAN, marking is skipped for * non-VM_ALLOC mappings, see __kasan_unpoison_vmalloc(). */ - mem = kasan_unpoison_vmalloc(mem, size, KASAN_VMALLOC_NONE); + mem = kasan_unpoison_vmalloc(mem, size, KASAN_VMALLOC_PROT_NORMAL); return mem; } @@ -2481,7 +2481,7 @@ static struct vm_struct *__get_vm_area_n */ if (!(flags & VM_ALLOC)) area->addr = kasan_unpoison_vmalloc(area->addr, requested_size, - KASAN_VMALLOC_NONE); + KASAN_VMALLOC_PROT_NORMAL); return area; } @@ -3091,7 +3091,7 @@ void *__vmalloc_node_range(unsigned long { struct vm_struct *area; void *ret; - kasan_vmalloc_flags_t kasan_flags; + kasan_vmalloc_flags_t kasan_flags = KASAN_VMALLOC_NONE; unsigned long real_size = size; unsigned long real_align = align; unsigned int shift = PAGE_SHIFT; @@ -3144,21 +3144,28 @@ again: goto fail; } - /* Prepare arguments for __vmalloc_area_node(). */ - if (kasan_hw_tags_enabled() && - pgprot_val(prot) == pgprot_val(PAGE_KERNEL)) { - /* - * Modify protection bits to allow tagging. - * This must be done before mapping in __vmalloc_area_node(). - */ - prot = arch_vmap_pgprot_tagged(prot); + /* + * Prepare arguments for __vmalloc_area_node() and + * kasan_unpoison_vmalloc(). + */ + if (pgprot_val(prot) == pgprot_val(PAGE_KERNEL)) { + if (kasan_hw_tags_enabled()) { + /* + * Modify protection bits to allow tagging. + * This must be done before mapping. + */ + prot = arch_vmap_pgprot_tagged(prot); - /* - * Skip page_alloc poisoning and zeroing for physical pages - * backing VM_ALLOC mapping. Memory is instead poisoned and - * zeroed by kasan_unpoison_vmalloc(). - */ - gfp_mask |= __GFP_SKIP_KASAN_UNPOISON | __GFP_SKIP_ZERO; + /* + * Skip page_alloc poisoning and zeroing for physical + * pages backing VM_ALLOC mapping. Memory is instead + * poisoned and zeroed by kasan_unpoison_vmalloc(). + */ + gfp_mask |= __GFP_SKIP_KASAN_UNPOISON | __GFP_SKIP_ZERO; + } + + /* Take note that the mapping is PAGE_KERNEL. */ + kasan_flags |= KASAN_VMALLOC_PROT_NORMAL; } /* Allocate physical pages and map them into vmalloc space. */ @@ -3172,10 +3179,13 @@ again: * (except for the should_skip_init() check) to make sure that memory * is initialized under the same conditions regardless of the enabled * KASAN mode. + * Tag-based KASAN modes only assign tags to normal non-executable + * allocations, see __kasan_unpoison_vmalloc(). */ - kasan_flags = KASAN_VMALLOC_VM_ALLOC; + kasan_flags |= KASAN_VMALLOC_VM_ALLOC; if (!want_init_on_free() && want_init_on_alloc(gfp_mask)) kasan_flags |= KASAN_VMALLOC_INIT; + /* KASAN_VMALLOC_PROT_NORMAL already set if required. */ area->addr = kasan_unpoison_vmalloc(area->addr, real_size, kasan_flags); /* @@ -3881,8 +3891,7 @@ retry: */ for (area = 0; area < nr_vms; area++) vms[area]->addr = kasan_unpoison_vmalloc(vms[area]->addr, - vms[area]->size, - KASAN_VMALLOC_NONE); + vms[area]->size, KASAN_VMALLOC_PROT_NORMAL); kfree(vas); return vms; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 061/114] kasan, arm64: don't tag executable vmalloc allocations 2022-03-25 1:07 incoming Andrew Morton ` (59 preceding siblings ...) 2022-03-25 1:11 ` [patch 060/114] kasan, vmalloc: only tag normal vmalloc allocations Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 062/114] kasan: mark kasan_arg_stacktrace as __initdata Andrew Morton ` (51 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan, arm64: don't tag executable vmalloc allocations Besides asking vmalloc memory to be executable via the prot argument of __vmalloc_node_range() (see the previous patch), the kernel can skip that bit and instead mark memory as executable via set_memory_x(). Once tag-based KASAN modes start tagging vmalloc allocations, executing code from such allocations will lead to the PC register getting a tag, which is not tolerated by the kernel. Generic kernel code typically allocates memory via module_alloc() if it intends to mark memory as executable. (On arm64 module_alloc() uses __vmalloc_node_range() without setting the executable bit). Thus, reset pointer tags of pointers returned from module_alloc(). However, on arm64 there's an exception: the eBPF subsystem. Instead of using module_alloc(), it uses vmalloc() (via bpf_jit_alloc_exec()) to allocate its JIT region. Thus, reset pointer tags of pointers returned from bpf_jit_alloc_exec(). Resetting tags for these pointers results in untagged pointers being passed to set_memory_x(). This causes conflicts in arithmetic checks in change_memory_common(), as vm_struct->addr pointer returned by find_vm_area() is tagged. Reset pointer tag of find_vm_area(addr)->addr in change_memory_common(). Link: https://lkml.kernel.org/r/b7b2595423340cd7d76b770e5d519acf3b72f0ab.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Catalin Marinas <catalin.marinas@arm.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm64/kernel/module.c | 3 ++- arch/arm64/mm/pageattr.c | 2 +- arch/arm64/net/bpf_jit_comp.c | 3 ++- 3 files changed, 5 insertions(+), 3 deletions(-) --- a/arch/arm64/kernel/module.c~kasan-arm64-dont-tag-executable-vmalloc-allocations +++ a/arch/arm64/kernel/module.c @@ -63,7 +63,8 @@ void *module_alloc(unsigned long size) return NULL; } - return p; + /* Memory is intended to be executable, reset the pointer tag. */ + return kasan_reset_tag(p); } enum aarch64_reloc_op { --- a/arch/arm64/mm/pageattr.c~kasan-arm64-dont-tag-executable-vmalloc-allocations +++ a/arch/arm64/mm/pageattr.c @@ -85,7 +85,7 @@ static int change_memory_common(unsigned */ area = find_vm_area((void *)addr); if (!area || - end > (unsigned long)area->addr + area->size || + end > (unsigned long)kasan_reset_tag(area->addr) + area->size || !(area->flags & VM_ALLOC)) return -EINVAL; --- a/arch/arm64/net/bpf_jit_comp.c~kasan-arm64-dont-tag-executable-vmalloc-allocations +++ a/arch/arm64/net/bpf_jit_comp.c @@ -1304,7 +1304,8 @@ u64 bpf_jit_alloc_exec_limit(void) void *bpf_jit_alloc_exec(unsigned long size) { - return vmalloc(size); + /* Memory is intended to be executable, reset the pointer tag. */ + return kasan_reset_tag(vmalloc(size)); } void bpf_jit_free_exec(void *addr) _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 062/114] kasan: mark kasan_arg_stacktrace as __initdata 2022-03-25 1:07 incoming Andrew Morton ` (60 preceding siblings ...) 2022-03-25 1:11 ` [patch 061/114] kasan, arm64: don't tag executable " Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 063/114] kasan: clean up feature flags for HW_TAGS mode Andrew Morton ` (50 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: mark kasan_arg_stacktrace as __initdata As kasan_arg_stacktrace is only used in __init functions, mark it as __initdata instead of __ro_after_init to allow it be freed after boot. The other enums for KASAN args are used in kasan_init_hw_tags_cpu(), which is not marked as __init as a CPU can be hot-plugged after boot. Clarify this in a comment. Link: https://lkml.kernel.org/r/7fa090865614f8e0c6c1265508efb1d429afaa50.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Suggested-by: Marco Elver <elver@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/hw_tags.c | 7 +++++-- 1 file changed, 5 insertions(+), 2 deletions(-) --- a/mm/kasan/hw_tags.c~kasan-mark-kasan_arg_stacktrace-as-__initdata +++ a/mm/kasan/hw_tags.c @@ -40,7 +40,7 @@ enum kasan_arg_stacktrace { static enum kasan_arg kasan_arg __ro_after_init; static enum kasan_arg_mode kasan_arg_mode __ro_after_init; -static enum kasan_arg_stacktrace kasan_arg_stacktrace __ro_after_init; +static enum kasan_arg_stacktrace kasan_arg_stacktrace __initdata; /* Whether KASAN is enabled at all. */ DEFINE_STATIC_KEY_FALSE(kasan_flag_enabled); @@ -116,7 +116,10 @@ static inline const char *kasan_mode_inf return "sync"; } -/* kasan_init_hw_tags_cpu() is called for each CPU. */ +/* + * kasan_init_hw_tags_cpu() is called for each CPU. + * Not marked as __init as a CPU can be hot-plugged after boot. + */ void kasan_init_hw_tags_cpu(void) { /* _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 063/114] kasan: clean up feature flags for HW_TAGS mode 2022-03-25 1:07 incoming Andrew Morton ` (61 preceding siblings ...) 2022-03-25 1:11 ` [patch 062/114] kasan: mark kasan_arg_stacktrace as __initdata Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 064/114] kasan: add kasan.vmalloc command line flag Andrew Morton ` (49 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: clean up feature flags for HW_TAGS mode - Untie kasan_init_hw_tags() code from the default values of kasan_arg_mode and kasan_arg_stacktrace. - Move static_branch_enable(&kasan_flag_enabled) to the end of kasan_init_hw_tags_cpu(). - Remove excessive comments in kasan_arg_mode switch. - Add new comments. Link: https://lkml.kernel.org/r/76ebb340265be57a218564a497e1f52ff36a3879.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/hw_tags.c | 38 +++++++++++++++++++++----------------- mm/kasan/kasan.h | 2 +- 2 files changed, 22 insertions(+), 18 deletions(-) --- a/mm/kasan/hw_tags.c~kasan-clean-up-feature-flags-for-hw_tags-mode +++ a/mm/kasan/hw_tags.c @@ -42,16 +42,22 @@ static enum kasan_arg kasan_arg __ro_aft static enum kasan_arg_mode kasan_arg_mode __ro_after_init; static enum kasan_arg_stacktrace kasan_arg_stacktrace __initdata; -/* Whether KASAN is enabled at all. */ +/* + * Whether KASAN is enabled at all. + * The value remains false until KASAN is initialized by kasan_init_hw_tags(). + */ DEFINE_STATIC_KEY_FALSE(kasan_flag_enabled); EXPORT_SYMBOL(kasan_flag_enabled); -/* Whether the selected mode is synchronous/asynchronous/asymmetric.*/ +/* + * Whether the selected mode is synchronous, asynchronous, or asymmetric. + * Defaults to KASAN_MODE_SYNC. + */ enum kasan_mode kasan_mode __ro_after_init; EXPORT_SYMBOL_GPL(kasan_mode); /* Whether to collect alloc/free stack traces. */ -DEFINE_STATIC_KEY_FALSE(kasan_flag_stacktrace); +DEFINE_STATIC_KEY_TRUE(kasan_flag_stacktrace); /* kasan=off/on */ static int __init early_kasan_flag(char *arg) @@ -127,7 +133,11 @@ void kasan_init_hw_tags_cpu(void) * as this function is only called for MTE-capable hardware. */ - /* If KASAN is disabled via command line, don't initialize it. */ + /* + * If KASAN is disabled via command line, don't initialize it. + * When this function is called, kasan_flag_enabled is not yet + * set by kasan_init_hw_tags(). Thus, check kasan_arg instead. + */ if (kasan_arg == KASAN_ARG_OFF) return; @@ -154,42 +164,36 @@ void __init kasan_init_hw_tags(void) if (kasan_arg == KASAN_ARG_OFF) return; - /* Enable KASAN. */ - static_branch_enable(&kasan_flag_enabled); - switch (kasan_arg_mode) { case KASAN_ARG_MODE_DEFAULT: - /* - * Default to sync mode. - */ - fallthrough; + /* Default is specified by kasan_mode definition. */ + break; case KASAN_ARG_MODE_SYNC: - /* Sync mode enabled. */ kasan_mode = KASAN_MODE_SYNC; break; case KASAN_ARG_MODE_ASYNC: - /* Async mode enabled. */ kasan_mode = KASAN_MODE_ASYNC; break; case KASAN_ARG_MODE_ASYMM: - /* Asymm mode enabled. */ kasan_mode = KASAN_MODE_ASYMM; break; } switch (kasan_arg_stacktrace) { case KASAN_ARG_STACKTRACE_DEFAULT: - /* Default to enabling stack trace collection. */ - static_branch_enable(&kasan_flag_stacktrace); + /* Default is specified by kasan_flag_stacktrace definition. */ break; case KASAN_ARG_STACKTRACE_OFF: - /* Do nothing, kasan_flag_stacktrace keeps its default value. */ + static_branch_disable(&kasan_flag_stacktrace); break; case KASAN_ARG_STACKTRACE_ON: static_branch_enable(&kasan_flag_stacktrace); break; } + /* KASAN is now initialized, enable it. */ + static_branch_enable(&kasan_flag_enabled); + pr_info("KernelAddressSanitizer initialized (hw-tags, mode=%s, stacktrace=%s)\n", kasan_mode_info(), kasan_stack_collection_enabled() ? "on" : "off"); --- a/mm/kasan/kasan.h~kasan-clean-up-feature-flags-for-hw_tags-mode +++ a/mm/kasan/kasan.h @@ -12,7 +12,7 @@ #include <linux/static_key.h> #include "../slab.h" -DECLARE_STATIC_KEY_FALSE(kasan_flag_stacktrace); +DECLARE_STATIC_KEY_TRUE(kasan_flag_stacktrace); enum kasan_mode { KASAN_MODE_SYNC, _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 064/114] kasan: add kasan.vmalloc command line flag 2022-03-25 1:07 incoming Andrew Morton ` (62 preceding siblings ...) 2022-03-25 1:11 ` [patch 063/114] kasan: clean up feature flags for HW_TAGS mode Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 065/114] kasan: allow enabling KASAN_VMALLOC and SW/HW_TAGS Andrew Morton ` (48 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: add kasan.vmalloc command line flag Allow disabling vmalloc() tagging for HW_TAGS KASAN via a kasan.vmalloc command line switch. This is a fail-safe switch intended for production systems that enable HW_TAGS KASAN. In case vmalloc() tagging ends up having an issue not detected during testing but that manifests in production, kasan.vmalloc allows to turn vmalloc() tagging off while leaving page_alloc/slab tagging on. Link: https://lkml.kernel.org/r/904f6d4dfa94870cc5fc2660809e093fd0d27c3b.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/hw_tags.c | 45 ++++++++++++++++++++++++++++++++++++++++++- mm/kasan/kasan.h | 6 +++++ 2 files changed, 50 insertions(+), 1 deletion(-) --- a/mm/kasan/hw_tags.c~kasan-add-kasanvmalloc-command-line-flag +++ a/mm/kasan/hw_tags.c @@ -32,6 +32,12 @@ enum kasan_arg_mode { KASAN_ARG_MODE_ASYMM, }; +enum kasan_arg_vmalloc { + KASAN_ARG_VMALLOC_DEFAULT, + KASAN_ARG_VMALLOC_OFF, + KASAN_ARG_VMALLOC_ON, +}; + enum kasan_arg_stacktrace { KASAN_ARG_STACKTRACE_DEFAULT, KASAN_ARG_STACKTRACE_OFF, @@ -40,6 +46,7 @@ enum kasan_arg_stacktrace { static enum kasan_arg kasan_arg __ro_after_init; static enum kasan_arg_mode kasan_arg_mode __ro_after_init; +static enum kasan_arg_vmalloc kasan_arg_vmalloc __initdata; static enum kasan_arg_stacktrace kasan_arg_stacktrace __initdata; /* @@ -56,6 +63,9 @@ EXPORT_SYMBOL(kasan_flag_enabled); enum kasan_mode kasan_mode __ro_after_init; EXPORT_SYMBOL_GPL(kasan_mode); +/* Whether to enable vmalloc tagging. */ +DEFINE_STATIC_KEY_TRUE(kasan_flag_vmalloc); + /* Whether to collect alloc/free stack traces. */ DEFINE_STATIC_KEY_TRUE(kasan_flag_stacktrace); @@ -95,6 +105,23 @@ static int __init early_kasan_mode(char } early_param("kasan.mode", early_kasan_mode); +/* kasan.vmalloc=off/on */ +static int __init early_kasan_flag_vmalloc(char *arg) +{ + if (!arg) + return -EINVAL; + + if (!strcmp(arg, "off")) + kasan_arg_vmalloc = KASAN_ARG_VMALLOC_OFF; + else if (!strcmp(arg, "on")) + kasan_arg_vmalloc = KASAN_ARG_VMALLOC_ON; + else + return -EINVAL; + + return 0; +} +early_param("kasan.vmalloc", early_kasan_flag_vmalloc); + /* kasan.stacktrace=off/on */ static int __init early_kasan_flag_stacktrace(char *arg) { @@ -179,6 +206,18 @@ void __init kasan_init_hw_tags(void) break; } + switch (kasan_arg_vmalloc) { + case KASAN_ARG_VMALLOC_DEFAULT: + /* Default is specified by kasan_flag_vmalloc definition. */ + break; + case KASAN_ARG_VMALLOC_OFF: + static_branch_disable(&kasan_flag_vmalloc); + break; + case KASAN_ARG_VMALLOC_ON: + static_branch_enable(&kasan_flag_vmalloc); + break; + } + switch (kasan_arg_stacktrace) { case KASAN_ARG_STACKTRACE_DEFAULT: /* Default is specified by kasan_flag_stacktrace definition. */ @@ -194,8 +233,9 @@ void __init kasan_init_hw_tags(void) /* KASAN is now initialized, enable it. */ static_branch_enable(&kasan_flag_enabled); - pr_info("KernelAddressSanitizer initialized (hw-tags, mode=%s, stacktrace=%s)\n", + pr_info("KernelAddressSanitizer initialized (hw-tags, mode=%s, vmalloc=%s, stacktrace=%s)\n", kasan_mode_info(), + kasan_vmalloc_enabled() ? "on" : "off", kasan_stack_collection_enabled() ? "on" : "off"); } @@ -228,6 +268,9 @@ void *__kasan_unpoison_vmalloc(const voi u8 tag; unsigned long redzone_start, redzone_size; + if (!kasan_vmalloc_enabled()) + return (void *)start; + if (!is_vmalloc_or_module_addr(start)) return (void *)start; --- a/mm/kasan/kasan.h~kasan-add-kasanvmalloc-command-line-flag +++ a/mm/kasan/kasan.h @@ -12,6 +12,7 @@ #include <linux/static_key.h> #include "../slab.h" +DECLARE_STATIC_KEY_TRUE(kasan_flag_vmalloc); DECLARE_STATIC_KEY_TRUE(kasan_flag_stacktrace); enum kasan_mode { @@ -22,6 +23,11 @@ enum kasan_mode { extern enum kasan_mode kasan_mode __ro_after_init; +static inline bool kasan_vmalloc_enabled(void) +{ + return static_branch_likely(&kasan_flag_vmalloc); +} + static inline bool kasan_stack_collection_enabled(void) { return static_branch_unlikely(&kasan_flag_stacktrace); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 065/114] kasan: allow enabling KASAN_VMALLOC and SW/HW_TAGS 2022-03-25 1:07 incoming Andrew Morton ` (63 preceding siblings ...) 2022-03-25 1:11 ` [patch 064/114] kasan: add kasan.vmalloc command line flag Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 066/114] arm64: select KASAN_VMALLOC for SW/HW_TAGS modes Andrew Morton ` (47 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: allow enabling KASAN_VMALLOC and SW/HW_TAGS Allow enabling CONFIG_KASAN_VMALLOC with SW_TAGS and HW_TAGS KASAN modes. Also adjust CONFIG_KASAN_VMALLOC description: - Mention HW_TAGS support. - Remove unneeded internal details: they have no place in Kconfig description and are already explained in the documentation. Link: https://lkml.kernel.org/r/bfa0fdedfe25f65e5caa4e410f074ddbac7a0b59.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- lib/Kconfig.kasan | 18 +++++++++--------- 1 file changed, 9 insertions(+), 9 deletions(-) --- a/lib/Kconfig.kasan~kasan-allow-enabling-kasan_vmalloc-and-sw-hw_tags +++ a/lib/Kconfig.kasan @@ -178,17 +178,17 @@ config KASAN_TAGS_IDENTIFY memory consumption. config KASAN_VMALLOC - bool "Back mappings in vmalloc space with real shadow memory" - depends on KASAN_GENERIC && HAVE_ARCH_KASAN_VMALLOC + bool "Check accesses to vmalloc allocations" + depends on HAVE_ARCH_KASAN_VMALLOC help - By default, the shadow region for vmalloc space is the read-only - zero page. This means that KASAN cannot detect errors involving - vmalloc space. + This mode makes KASAN check accesses to vmalloc allocations for + validity. - Enabling this option will hook in to vmap/vmalloc and back those - mappings with real shadow memory allocated on demand. This allows - for KASAN to detect more sorts of errors (and to support vmapped - stacks), but at the cost of higher memory usage. + With software KASAN modes, checking is done for all types of vmalloc + allocations. Enabling this option leads to higher memory usage. + + With hardware tag-based KASAN, only VM_ALLOC mappings are checked. + There is no additional memory usage. config KASAN_KUNIT_TEST tristate "KUnit-compatible tests of KASAN bug detection capabilities" if !KUNIT_ALL_TESTS _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 066/114] arm64: select KASAN_VMALLOC for SW/HW_TAGS modes 2022-03-25 1:07 incoming Andrew Morton ` (64 preceding siblings ...) 2022-03-25 1:11 ` [patch 065/114] kasan: allow enabling KASAN_VMALLOC and SW/HW_TAGS Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 067/114] kasan: documentation updates Andrew Morton ` (46 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: arm64: select KASAN_VMALLOC for SW/HW_TAGS modes Generic KASAN already selects KASAN_VMALLOC to allow VMAP_STACK to be selected unconditionally, see commit acc3042d62cb9 ("arm64: Kconfig: select KASAN_VMALLOC if KANSAN_GENERIC is enabled"). The same change is needed for SW_TAGS KASAN. HW_TAGS KASAN does not require enabling KASAN_VMALLOC for VMAP_STACK, they already work together as is. Still, selecting KASAN_VMALLOC still makes sense to make vmalloc() always protected. In case any bugs in KASAN's vmalloc() support are discovered, the command line kasan.vmalloc flag can be used to disable vmalloc() checking. Select KASAN_VMALLOC for all KASAN modes for arm64. Link: https://lkml.kernel.org/r/99d6b3ebf57fc1930ff71f9a4a71eea19881b270.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Catalin Marinas <catalin.marinas@arm.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm64/Kconfig | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/arch/arm64/Kconfig~arm64-select-kasan_vmalloc-for-sw-hw_tags-modes +++ a/arch/arm64/Kconfig @@ -208,7 +208,7 @@ config ARM64 select IOMMU_DMA if IOMMU_SUPPORT select IRQ_DOMAIN select IRQ_FORCED_THREADING - select KASAN_VMALLOC if KASAN_GENERIC + select KASAN_VMALLOC if KASAN select MODULES_USE_ELF_RELA select NEED_DMA_MAP_STATE select NEED_SG_DMA_LENGTH _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 067/114] kasan: documentation updates 2022-03-25 1:07 incoming Andrew Morton ` (65 preceding siblings ...) 2022-03-25 1:11 ` [patch 066/114] arm64: select KASAN_VMALLOC for SW/HW_TAGS modes Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:11 ` [patch 068/114] kasan: improve vmalloc tests Andrew Morton ` (45 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: documentation updates Update KASAN documentation: - Bump Clang version requirement for HW_TAGS as ARM64_MTE depends on AS_HAS_LSE_ATOMICS as of commit 2decad92f4731 ("arm64: mte: Ensure TIF_MTE_ASYNC_FAULT is set atomically"), which requires Clang 12. - Add description of the new kasan.vmalloc command line flag. - Mention that SW_TAGS and HW_TAGS modes now support vmalloc tagging. - Explicitly say that the "Shadow memory" section is only applicable to software KASAN modes. - Mention that shadow-based KASAN_VMALLOC is supported on arm64. Link: https://lkml.kernel.org/r/a61189128fa3f9fbcfd9884ff653d401864b8e74.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/dev-tools/kasan.rst | 17 +++++++++++------ 1 file changed, 11 insertions(+), 6 deletions(-) --- a/Documentation/dev-tools/kasan.rst~kasan-documentation-updates +++ a/Documentation/dev-tools/kasan.rst @@ -30,7 +30,7 @@ Software tag-based KASAN mode is only su The hardware KASAN mode (#3) relies on hardware to perform the checks but still requires a compiler version that supports memory tagging instructions. -This mode is supported in GCC 10+ and Clang 11+. +This mode is supported in GCC 10+ and Clang 12+. Both software KASAN modes work with SLUB and SLAB memory allocators, while the hardware tag-based KASAN currently only supports SLUB. @@ -206,6 +206,9 @@ additional boot parameters that allow di Asymmetric mode: a bad access is detected synchronously on reads and asynchronously on writes. +- ``kasan.vmalloc=off`` or ``=on`` disables or enables tagging of vmalloc + allocations (default: ``on``). + - ``kasan.stacktrace=off`` or ``=on`` disables or enables alloc and free stack traces collection (default: ``on``). @@ -279,8 +282,8 @@ Software tag-based KASAN uses 0xFF as a pointers with the 0xFF pointer tag are not checked). The value 0xFE is currently reserved to tag freed memory regions. -Software tag-based KASAN currently only supports tagging of slab and page_alloc -memory. +Software tag-based KASAN currently only supports tagging of slab, page_alloc, +and vmalloc memory. Hardware tag-based KASAN ~~~~~~~~~~~~~~~~~~~~~~~~ @@ -303,8 +306,8 @@ Hardware tag-based KASAN uses 0xFF as a pointers with the 0xFF pointer tag are not checked). The value 0xFE is currently reserved to tag freed memory regions. -Hardware tag-based KASAN currently only supports tagging of slab and page_alloc -memory. +Hardware tag-based KASAN currently only supports tagging of slab, page_alloc, +and VM_ALLOC-based vmalloc memory. If the hardware does not support MTE (pre ARMv8.5), hardware tag-based KASAN will not be enabled. In this case, all KASAN boot parameters are ignored. @@ -319,6 +322,8 @@ checking gets disabled. Shadow memory ------------- +The contents of this section are only applicable to software KASAN modes. + The kernel maps memory in several different parts of the address space. The range of kernel virtual addresses is large: there is not enough real memory to support a real shadow region for every address that could be @@ -349,7 +354,7 @@ CONFIG_KASAN_VMALLOC With ``CONFIG_KASAN_VMALLOC``, KASAN can cover vmalloc space at the cost of greater memory usage. Currently, this is supported on x86, -riscv, s390, and powerpc. +arm64, riscv, s390, and powerpc. This works by hooking into vmalloc and vmap and dynamically allocating real shadow memory to back the mappings. _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 068/114] kasan: improve vmalloc tests 2022-03-25 1:07 incoming Andrew Morton ` (66 preceding siblings ...) 2022-03-25 1:11 ` [patch 067/114] kasan: documentation updates Andrew Morton @ 2022-03-25 1:11 ` Andrew Morton 2022-03-25 1:12 ` [patch 069/114] kasan: test: support async (again) and asymm modes for HW_TAGS Andrew Morton ` (44 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:11 UTC (permalink / raw) To: will, vincenzo.frascino, sfr, ryabinin.a.a, pcc, mark.rutland, glider, eugenis, elver, dvyukov, catalin.marinas, andreyknvl, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: improve vmalloc tests Update the existing vmalloc_oob() test to account for the specifics of the tag-based modes. Also add a few new checks and comments. Add new vmalloc-related tests: - vmalloc_helpers_tags() to check that exported vmalloc helpers can handle tagged pointers. - vmap_tags() to check that SW_TAGS mode properly tags vmap() mappings. - vm_map_ram_tags() to check that SW_TAGS mode properly tags vm_map_ram() mappings. - vmalloc_percpu() to check that SW_TAGS mode tags regions allocated for __alloc_percpu(). The tagging of per-cpu mappings is best-effort; proper tagging is tracked in [1]. [1] https://bugzilla.kernel.org/show_bug.cgi?id=215019 [sfr@canb.auug.org.au: similar to "kasan: test: fix compatibility with FORTIFY_SOURCE"] Link: https://lkml.kernel.org/r/20220128144801.73f5ced0@canb.auug.org.au Cc: Andrey Konovalov <andreyknvl@gmail.com> [andreyknvl@google.com: vmap_tags() and vm_map_ram_tags() pass invalid page array size] Link: https://lkml.kernel.org/r/865c91ba49b90623ab50c7526b79ccb955f544f0.1644950160.git.andreyknvl@google.com [andreyknvl@google.com: set_memory_rw/ro() are not exported to modules] Link: https://lkml.kernel.org/r/019ac41602e0c4a7dfe96dc8158a95097c2b2ebd.1645554036.git.andreyknvl@google.com [akpm@linux-foundation.org: fix build] Link: https://lkml.kernel.org/r/bbdc1c0501c5275e7f26fdb8e2a7b14a40a9f36b.1643047180.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Signed-off-by: Stephen Rothwell <sfr@canb.auug.org.au> Acked-by: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Evgenii Stepanov <eugenis@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Peter Collingbourne <pcc@google.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- lib/test_kasan.c | 194 +++++++++++++++++++++++++++++++++++++++++++-- 1 file changed, 188 insertions(+), 6 deletions(-) --- a/lib/test_kasan.c~kasan-improve-vmalloc-tests +++ a/lib/test_kasan.c @@ -19,6 +19,7 @@ #include <linux/uaccess.h> #include <linux/io.h> #include <linux/vmalloc.h> +#include <linux/set_memory.h> #include <asm/page.h> @@ -1057,21 +1058,186 @@ static void kmalloc_double_kzfree(struct KUNIT_EXPECT_KASAN_FAIL(test, kfree_sensitive(ptr)); } +static void vmalloc_helpers_tags(struct kunit *test) +{ + void *ptr; + + /* This test is intended for tag-based modes. */ + KASAN_TEST_NEEDS_CONFIG_OFF(test, CONFIG_KASAN_GENERIC); + + KASAN_TEST_NEEDS_CONFIG_ON(test, CONFIG_KASAN_VMALLOC); + + ptr = vmalloc(PAGE_SIZE); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); + + /* Check that the returned pointer is tagged. */ + KUNIT_EXPECT_GE(test, (u8)get_tag(ptr), (u8)KASAN_TAG_MIN); + KUNIT_EXPECT_LT(test, (u8)get_tag(ptr), (u8)KASAN_TAG_KERNEL); + + /* Make sure exported vmalloc helpers handle tagged pointers. */ + KUNIT_ASSERT_TRUE(test, is_vmalloc_addr(ptr)); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, vmalloc_to_page(ptr)); + +#if !IS_MODULE(CONFIG_KASAN_KUNIT_TEST) + { + int rv; + + /* Make sure vmalloc'ed memory permissions can be changed. */ + rv = set_memory_ro((unsigned long)ptr, 1); + KUNIT_ASSERT_GE(test, rv, 0); + rv = set_memory_rw((unsigned long)ptr, 1); + KUNIT_ASSERT_GE(test, rv, 0); + } +#endif + + vfree(ptr); +} + static void vmalloc_oob(struct kunit *test) { - void *area; + char *v_ptr, *p_ptr; + struct page *page; + size_t size = PAGE_SIZE / 2 - KASAN_GRANULE_SIZE - 5; KASAN_TEST_NEEDS_CONFIG_ON(test, CONFIG_KASAN_VMALLOC); + v_ptr = vmalloc(size); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, v_ptr); + + OPTIMIZER_HIDE_VAR(v_ptr); + /* - * We have to be careful not to hit the guard page. + * We have to be careful not to hit the guard page in vmalloc tests. * The MMU will catch that and crash us. */ - area = vmalloc(3000); - KUNIT_ASSERT_NOT_ERR_OR_NULL(test, area); - KUNIT_EXPECT_KASAN_FAIL(test, ((volatile char *)area)[3100]); - vfree(area); + /* Make sure in-bounds accesses are valid. */ + v_ptr[0] = 0; + v_ptr[size - 1] = 0; + + /* + * An unaligned access past the requested vmalloc size. + * Only generic KASAN can precisely detect these. + */ + if (IS_ENABLED(CONFIG_KASAN_GENERIC)) + KUNIT_EXPECT_KASAN_FAIL(test, ((volatile char *)v_ptr)[size]); + + /* An aligned access into the first out-of-bounds granule. */ + KUNIT_EXPECT_KASAN_FAIL(test, ((volatile char *)v_ptr)[size + 5]); + + /* Check that in-bounds accesses to the physical page are valid. */ + page = vmalloc_to_page(v_ptr); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, page); + p_ptr = page_address(page); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, p_ptr); + p_ptr[0] = 0; + + vfree(v_ptr); + + /* + * We can't check for use-after-unmap bugs in this nor in the following + * vmalloc tests, as the page might be fully unmapped and accessing it + * will crash the kernel. + */ +} + +static void vmap_tags(struct kunit *test) +{ + char *p_ptr, *v_ptr; + struct page *p_page, *v_page; + + /* + * This test is specifically crafted for the software tag-based mode, + * the only tag-based mode that poisons vmap mappings. + */ + KASAN_TEST_NEEDS_CONFIG_ON(test, CONFIG_KASAN_SW_TAGS); + + KASAN_TEST_NEEDS_CONFIG_ON(test, CONFIG_KASAN_VMALLOC); + + p_page = alloc_pages(GFP_KERNEL, 1); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, p_page); + p_ptr = page_address(p_page); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, p_ptr); + + v_ptr = vmap(&p_page, 1, VM_MAP, PAGE_KERNEL); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, v_ptr); + + /* + * We can't check for out-of-bounds bugs in this nor in the following + * vmalloc tests, as allocations have page granularity and accessing + * the guard page will crash the kernel. + */ + + KUNIT_EXPECT_GE(test, (u8)get_tag(v_ptr), (u8)KASAN_TAG_MIN); + KUNIT_EXPECT_LT(test, (u8)get_tag(v_ptr), (u8)KASAN_TAG_KERNEL); + + /* Make sure that in-bounds accesses through both pointers work. */ + *p_ptr = 0; + *v_ptr = 0; + + /* Make sure vmalloc_to_page() correctly recovers the page pointer. */ + v_page = vmalloc_to_page(v_ptr); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, v_page); + KUNIT_EXPECT_PTR_EQ(test, p_page, v_page); + + vunmap(v_ptr); + free_pages((unsigned long)p_ptr, 1); +} + +static void vm_map_ram_tags(struct kunit *test) +{ + char *p_ptr, *v_ptr; + struct page *page; + + /* + * This test is specifically crafted for the software tag-based mode, + * the only tag-based mode that poisons vm_map_ram mappings. + */ + KASAN_TEST_NEEDS_CONFIG_ON(test, CONFIG_KASAN_SW_TAGS); + + page = alloc_pages(GFP_KERNEL, 1); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, page); + p_ptr = page_address(page); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, p_ptr); + + v_ptr = vm_map_ram(&page, 1, -1); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, v_ptr); + + KUNIT_EXPECT_GE(test, (u8)get_tag(v_ptr), (u8)KASAN_TAG_MIN); + KUNIT_EXPECT_LT(test, (u8)get_tag(v_ptr), (u8)KASAN_TAG_KERNEL); + + /* Make sure that in-bounds accesses through both pointers work. */ + *p_ptr = 0; + *v_ptr = 0; + + vm_unmap_ram(v_ptr, 1); + free_pages((unsigned long)p_ptr, 1); +} + +static void vmalloc_percpu(struct kunit *test) +{ + char __percpu *ptr; + int cpu; + + /* + * This test is specifically crafted for the software tag-based mode, + * the only tag-based mode that poisons percpu mappings. + */ + KASAN_TEST_NEEDS_CONFIG_ON(test, CONFIG_KASAN_SW_TAGS); + + ptr = __alloc_percpu(PAGE_SIZE, PAGE_SIZE); + + for_each_possible_cpu(cpu) { + char *c_ptr = per_cpu_ptr(ptr, cpu); + + KUNIT_EXPECT_GE(test, (u8)get_tag(c_ptr), (u8)KASAN_TAG_MIN); + KUNIT_EXPECT_LT(test, (u8)get_tag(c_ptr), (u8)KASAN_TAG_KERNEL); + + /* Make sure that in-bounds accesses don't crash the kernel. */ + *c_ptr = 0; + } + + free_percpu(ptr); } /* @@ -1105,6 +1271,18 @@ static void match_all_not_assigned(struc KUNIT_EXPECT_LT(test, (u8)get_tag(ptr), (u8)KASAN_TAG_KERNEL); free_pages((unsigned long)ptr, order); } + + if (!IS_ENABLED(CONFIG_KASAN_VMALLOC)) + return; + + for (i = 0; i < 256; i++) { + size = (get_random_int() % 1024) + 1; + ptr = vmalloc(size); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); + KUNIT_EXPECT_GE(test, (u8)get_tag(ptr), (u8)KASAN_TAG_MIN); + KUNIT_EXPECT_LT(test, (u8)get_tag(ptr), (u8)KASAN_TAG_KERNEL); + vfree(ptr); + } } /* Check that 0xff works as a match-all pointer tag for tag-based modes. */ @@ -1210,7 +1388,11 @@ static struct kunit_case kasan_kunit_tes KUNIT_CASE(kasan_bitops_generic), KUNIT_CASE(kasan_bitops_tags), KUNIT_CASE(kmalloc_double_kzfree), + KUNIT_CASE(vmalloc_helpers_tags), KUNIT_CASE(vmalloc_oob), + KUNIT_CASE(vmap_tags), + KUNIT_CASE(vm_map_ram_tags), + KUNIT_CASE(vmalloc_percpu), KUNIT_CASE(match_all_not_assigned), KUNIT_CASE(match_all_ptr_tag), KUNIT_CASE(match_all_mem_tag), _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 069/114] kasan: test: support async (again) and asymm modes for HW_TAGS 2022-03-25 1:07 incoming Andrew Morton ` (67 preceding siblings ...) 2022-03-25 1:11 ` [patch 068/114] kasan: improve vmalloc tests Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 070/114] mm/kasan: remove unnecessary CONFIG_KASAN option Andrew Morton ` (43 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: vincenzo.frascino, ryabinin.a.a, glider, elver, dvyukov, catalin.marinas, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: test: support async (again) and asymm modes for HW_TAGS Async mode support has already been implemented in commit e80a76aa1a91 ("kasan, arm64: tests supports for HW_TAGS async mode") but then got accidentally broken in commit 99734b535d9b ("kasan: detect false-positives in tests"). Restore the changes removed by the latter patch and adapt them for asymm mode: add a sync_fault flag to kunit_kasan_expectation that only get set if the MTE fault was synchronous, and reenable MTE on such faults in tests. Also rename kunit_kasan_expectation to kunit_kasan_status and move its definition to mm/kasan/kasan.h from include/linux/kasan.h, as this structure is only internally used by KASAN. Also put the structure definition under IS_ENABLED(CONFIG_KUNIT). Link: https://lkml.kernel.org/r/133970562ccacc93ba19d754012c562351d4a8c8.1645033139.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/kasan.h | 5 ----- lib/test_kasan.c | 39 ++++++++++++++++++++++----------------- mm/kasan/hw_tags.c | 18 +++++++++--------- mm/kasan/kasan.h | 14 ++++++++++++-- mm/kasan/report.c | 17 +++++++++-------- 5 files changed, 52 insertions(+), 41 deletions(-) --- a/include/linux/kasan.h~kasan-test-support-async-again-and-asymm-modes-for-hw_tags +++ a/include/linux/kasan.h @@ -19,11 +19,6 @@ struct task_struct; #include <linux/linkage.h> #include <asm/kasan.h> -/* kasan_data struct is used in KUnit tests for KASAN expected failures */ -struct kunit_kasan_expectation { - bool report_found; -}; - #endif typedef unsigned int __bitwise kasan_vmalloc_flags_t; --- a/lib/test_kasan.c~kasan-test-support-async-again-and-asymm-modes-for-hw_tags +++ a/lib/test_kasan.c @@ -37,7 +37,7 @@ void *kasan_ptr_result; int kasan_int_result; static struct kunit_resource resource; -static struct kunit_kasan_expectation fail_data; +static struct kunit_kasan_status test_status; static bool multishot; /* @@ -54,58 +54,63 @@ static int kasan_test_init(struct kunit } multishot = kasan_save_enable_multi_shot(); - fail_data.report_found = false; + test_status.report_found = false; + test_status.sync_fault = false; kunit_add_named_resource(test, NULL, NULL, &resource, - "kasan_data", &fail_data); + "kasan_status", &test_status); return 0; } static void kasan_test_exit(struct kunit *test) { kasan_restore_multi_shot(multishot); - KUNIT_EXPECT_FALSE(test, fail_data.report_found); + KUNIT_EXPECT_FALSE(test, test_status.report_found); } /** * KUNIT_EXPECT_KASAN_FAIL() - check that the executed expression produces a * KASAN report; causes a test failure otherwise. This relies on a KUnit - * resource named "kasan_data". Do not use this name for KUnit resources + * resource named "kasan_status". Do not use this name for KUnit resources * outside of KASAN tests. * - * For hardware tag-based KASAN in sync mode, when a tag fault happens, tag + * For hardware tag-based KASAN, when a synchronous tag fault happens, tag * checking is auto-disabled. When this happens, this test handler reenables * tag checking. As tag checking can be only disabled or enabled per CPU, * this handler disables migration (preemption). * - * Since the compiler doesn't see that the expression can change the fail_data + * Since the compiler doesn't see that the expression can change the test_status * fields, it can reorder or optimize away the accesses to those fields. * Use READ/WRITE_ONCE() for the accesses and compiler barriers around the * expression to prevent that. * - * In between KUNIT_EXPECT_KASAN_FAIL checks, fail_data.report_found is kept as - * false. This allows detecting KASAN reports that happen outside of the checks - * by asserting !fail_data.report_found at the start of KUNIT_EXPECT_KASAN_FAIL - * and in kasan_test_exit. + * In between KUNIT_EXPECT_KASAN_FAIL checks, test_status.report_found is kept + * as false. This allows detecting KASAN reports that happen outside of the + * checks by asserting !test_status.report_found at the start of + * KUNIT_EXPECT_KASAN_FAIL and in kasan_test_exit. */ #define KUNIT_EXPECT_KASAN_FAIL(test, expression) do { \ if (IS_ENABLED(CONFIG_KASAN_HW_TAGS) && \ kasan_sync_fault_possible()) \ migrate_disable(); \ - KUNIT_EXPECT_FALSE(test, READ_ONCE(fail_data.report_found)); \ + KUNIT_EXPECT_FALSE(test, READ_ONCE(test_status.report_found)); \ barrier(); \ expression; \ barrier(); \ - if (!READ_ONCE(fail_data.report_found)) { \ + if (kasan_async_fault_possible()) \ + kasan_force_async_fault(); \ + if (!READ_ONCE(test_status.report_found)) { \ KUNIT_FAIL(test, KUNIT_SUBTEST_INDENT "KASAN failure " \ "expected in \"" #expression \ "\", but none occurred"); \ } \ - if (IS_ENABLED(CONFIG_KASAN_HW_TAGS)) { \ - if (READ_ONCE(fail_data.report_found)) \ - kasan_enable_tagging_sync(); \ + if (IS_ENABLED(CONFIG_KASAN_HW_TAGS) && \ + kasan_sync_fault_possible()) { \ + if (READ_ONCE(test_status.report_found) && \ + READ_ONCE(test_status.sync_fault)) \ + kasan_enable_tagging(); \ migrate_enable(); \ } \ - WRITE_ONCE(fail_data.report_found, false); \ + WRITE_ONCE(test_status.report_found, false); \ } while (0) #define KASAN_TEST_NEEDS_CONFIG_ON(test, config) do { \ --- a/mm/kasan/hw_tags.c~kasan-test-support-async-again-and-asymm-modes-for-hw_tags +++ a/mm/kasan/hw_tags.c @@ -172,12 +172,7 @@ void kasan_init_hw_tags_cpu(void) * Enable async or asymm modes only when explicitly requested * through the command line. */ - if (kasan_arg_mode == KASAN_ARG_MODE_ASYNC) - hw_enable_tagging_async(); - else if (kasan_arg_mode == KASAN_ARG_MODE_ASYMM) - hw_enable_tagging_asymm(); - else - hw_enable_tagging_sync(); + kasan_enable_tagging(); } /* kasan_init_hw_tags() is called once on boot CPU. */ @@ -343,11 +338,16 @@ void __kasan_poison_vmalloc(const void * #if IS_ENABLED(CONFIG_KASAN_KUNIT_TEST) -void kasan_enable_tagging_sync(void) +void kasan_enable_tagging(void) { - hw_enable_tagging_sync(); + if (kasan_arg_mode == KASAN_ARG_MODE_ASYNC) + hw_enable_tagging_async(); + else if (kasan_arg_mode == KASAN_ARG_MODE_ASYMM) + hw_enable_tagging_asymm(); + else + hw_enable_tagging_sync(); } -EXPORT_SYMBOL_GPL(kasan_enable_tagging_sync); +EXPORT_SYMBOL_GPL(kasan_enable_tagging); void kasan_force_async_fault(void) { --- a/mm/kasan/kasan.h~kasan-test-support-async-again-and-asymm-modes-for-hw_tags +++ a/mm/kasan/kasan.h @@ -7,6 +7,16 @@ #include <linux/kfence.h> #include <linux/stackdepot.h> +#if IS_ENABLED(CONFIG_KUNIT) + +/* Used in KUnit-compatible KASAN tests. */ +struct kunit_kasan_status { + bool report_found; + bool sync_fault; +}; + +#endif + #ifdef CONFIG_KASAN_HW_TAGS #include <linux/static_key.h> @@ -350,12 +360,12 @@ static inline const void *arch_kasan_set #if defined(CONFIG_KASAN_HW_TAGS) && IS_ENABLED(CONFIG_KASAN_KUNIT_TEST) -void kasan_enable_tagging_sync(void); +void kasan_enable_tagging(void); void kasan_force_async_fault(void); #else /* CONFIG_KASAN_HW_TAGS || CONFIG_KASAN_KUNIT_TEST */ -static inline void kasan_enable_tagging_sync(void) { } +static inline void kasan_enable_tagging(void) { } static inline void kasan_force_async_fault(void) { } #endif /* CONFIG_KASAN_HW_TAGS || CONFIG_KASAN_KUNIT_TEST */ --- a/mm/kasan/report.c~kasan-test-support-async-again-and-asymm-modes-for-hw_tags +++ a/mm/kasan/report.c @@ -336,20 +336,21 @@ static bool report_enabled(void) } #if IS_ENABLED(CONFIG_KUNIT) -static void kasan_update_kunit_status(struct kunit *cur_test) +static void kasan_update_kunit_status(struct kunit *cur_test, bool sync) { struct kunit_resource *resource; - struct kunit_kasan_expectation *kasan_data; + struct kunit_kasan_status *status; - resource = kunit_find_named_resource(cur_test, "kasan_data"); + resource = kunit_find_named_resource(cur_test, "kasan_status"); if (!resource) { kunit_set_failure(cur_test); return; } - kasan_data = (struct kunit_kasan_expectation *)resource->data; - WRITE_ONCE(kasan_data->report_found, true); + status = (struct kunit_kasan_status *)resource->data; + WRITE_ONCE(status->report_found, true); + WRITE_ONCE(status->sync_fault, sync); kunit_put_resource(resource); } #endif /* IS_ENABLED(CONFIG_KUNIT) */ @@ -363,7 +364,7 @@ void kasan_report_invalid_free(void *obj #if IS_ENABLED(CONFIG_KUNIT) if (current->kunit_test) - kasan_update_kunit_status(current->kunit_test); + kasan_update_kunit_status(current->kunit_test, true); #endif /* IS_ENABLED(CONFIG_KUNIT) */ start_report(&flags); @@ -383,7 +384,7 @@ void kasan_report_async(void) #if IS_ENABLED(CONFIG_KUNIT) if (current->kunit_test) - kasan_update_kunit_status(current->kunit_test); + kasan_update_kunit_status(current->kunit_test, false); #endif /* IS_ENABLED(CONFIG_KUNIT) */ start_report(&flags); @@ -405,7 +406,7 @@ static void __kasan_report(unsigned long #if IS_ENABLED(CONFIG_KUNIT) if (current->kunit_test) - kasan_update_kunit_status(current->kunit_test); + kasan_update_kunit_status(current->kunit_test, true); #endif /* IS_ENABLED(CONFIG_KUNIT) */ disable_trace_on_warning(); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 070/114] mm/kasan: remove unnecessary CONFIG_KASAN option 2022-03-25 1:07 incoming Andrew Morton ` (68 preceding siblings ...) 2022-03-25 1:12 ` [patch 069/114] kasan: test: support async (again) and asymm modes for HW_TAGS Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 071/114] kasan: update function name in comments Andrew Morton ` (42 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, tangmeng, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: tangmeng <tangmeng@uniontech.com> Subject: mm/kasan: remove unnecessary CONFIG_KASAN option In mm/Makefile has: obj-$(CONFIG_KASAN) += kasan/ So that we don't need 'obj-$(CONFIG_KASAN) :=' in mm/kasan/Makefile, delete it from mm/kasan/Makefile. Link: https://lkml.kernel.org/r/20220221065421.20689-1-tangmeng@uniontech.com Signed-off-by: tangmeng <tangmeng@uniontech.com> Reviewed-by: Marco Elver <elver@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Konovalov <andreyknvl@gmail.com> Cc: Dmitriy Vyukov <dvyukov@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/Makefile | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/kasan/Makefile~mm-kasan-remove-unnecessary-config_kasan-option +++ a/mm/kasan/Makefile @@ -35,7 +35,7 @@ CFLAGS_shadow.o := $(CC_FLAGS_KASAN_RUNT CFLAGS_hw_tags.o := $(CC_FLAGS_KASAN_RUNTIME) CFLAGS_sw_tags.o := $(CC_FLAGS_KASAN_RUNTIME) -obj-$(CONFIG_KASAN) := common.o report.o +obj-y := common.o report.o obj-$(CONFIG_KASAN_GENERIC) += init.o generic.o report_generic.o shadow.o quarantine.o obj-$(CONFIG_KASAN_HW_TAGS) += hw_tags.o report_hw_tags.o tags.o report_tags.o obj-$(CONFIG_KASAN_SW_TAGS) += init.o report_sw_tags.o shadow.o sw_tags.o tags.o report_tags.o _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 071/114] kasan: update function name in comments 2022-03-25 1:07 incoming Andrew Morton ` (69 preceding siblings ...) 2022-03-25 1:12 ` [patch 070/114] mm/kasan: remove unnecessary CONFIG_KASAN option Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 072/114] kasan: print virtual mapping info in reports Andrew Morton ` (41 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: linmiaohe, elver, andreyknvl, pcc, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Peter Collingbourne <pcc@google.com> Subject: kasan: update function name in comments The function kasan_global_oob was renamed to kasan_global_oob_right, but the comments referring to it were not updated. Do so. Link: https://linux-review.googlesource.com/id/I20faa90126937bbee77d9d44709556c3dd4b40be Link: https://lkml.kernel.org/r/20220219012433.890941-1-pcc@google.com Signed-off-by: Peter Collingbourne <pcc@google.com> Reviewed-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Marco Elver <elver@google.com> Reviewed-by: Andrey Konovalov <andreyknvl@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- lib/test_kasan.c | 6 +++--- 1 file changed, 3 insertions(+), 3 deletions(-) --- a/lib/test_kasan.c~kasan-update-function-name-in-comments +++ a/lib/test_kasan.c @@ -786,7 +786,7 @@ static void ksize_uaf(struct kunit *test static void kasan_stack_oob(struct kunit *test) { char stack_array[10]; - /* See comment in kasan_global_oob. */ + /* See comment in kasan_global_oob_right. */ char *volatile array = stack_array; char *p = &array[ARRAY_SIZE(stack_array) + OOB_TAG_OFF]; @@ -799,7 +799,7 @@ static void kasan_alloca_oob_left(struct { volatile int i = 10; char alloca_array[i]; - /* See comment in kasan_global_oob. */ + /* See comment in kasan_global_oob_right. */ char *volatile array = alloca_array; char *p = array - 1; @@ -814,7 +814,7 @@ static void kasan_alloca_oob_right(struc { volatile int i = 10; char alloca_array[i]; - /* See comment in kasan_global_oob. */ + /* See comment in kasan_global_oob_right. */ char *volatile array = alloca_array; char *p = array + i; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 072/114] kasan: print virtual mapping info in reports 2022-03-25 1:07 incoming Andrew Morton ` (70 preceding siblings ...) 2022-03-25 1:12 ` [patch 071/114] kasan: update function name in comments Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 073/114] kasan: drop addr check from describe_object_addr Andrew Morton ` (40 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, mark.rutland, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: print virtual mapping info in reports Print virtual mapping range and its creator in reports affecting virtual mappings. Also get physical page pointer for such mappings, so page information gets printed as well. Link: https://lkml.kernel.org/r/6ebb11210ae21253198e264d4bb0752c1fad67d7.1645548178.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Mark Rutland <mark.rutland@arm.com> Cc: Marco Elver <elver@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Dmitriy Vyukov <dvyukov@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 15 ++++++++++++++- 1 file changed, 14 insertions(+), 1 deletion(-) --- a/mm/kasan/report.c~kasan-print-virtual-mapping-info-in-reports +++ a/mm/kasan/report.c @@ -260,8 +260,21 @@ static void print_address_description(vo pr_err(" %pS\n", addr); } + if (is_vmalloc_addr(addr)) { + struct vm_struct *va = find_vm_area(addr); + + if (va) { + pr_err("The buggy address belongs to the virtual mapping at\n" + " [%px, %px) created by:\n" + " %pS\n", + va->addr, va->addr + va->size, va->caller); + + page = vmalloc_to_page(page); + } + } + if (page) { - pr_err("The buggy address belongs to the page:\n"); + pr_err("The buggy address belongs to the physical page:\n"); dump_page(page, "kasan: bad access detected"); } _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 073/114] kasan: drop addr check from describe_object_addr 2022-03-25 1:07 incoming Andrew Morton ` (71 preceding siblings ...) 2022-03-25 1:12 ` [patch 072/114] kasan: print virtual mapping info in reports Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 074/114] kasan: more line breaks in reports Andrew Morton ` (39 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: drop addr check from describe_object_addr Patch series "kasan: report clean-ups and improvements". A number of clean-up patches for KASAN reporting code. Most are non-functional and only improve readability. This patch (of 22): describe_object_addr() used to be called with NULL addr in the early days of KASAN. This no longer happens, so drop the check. Link: https://lkml.kernel.org/r/cover.1646237226.git.andreyknvl@google.com Link: https://lkml.kernel.org/r/761f8e5a6ee040d665934d916a90afe9f322f745.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Cc: Marco Elver <elver@google.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 3 --- 1 file changed, 3 deletions(-) --- a/mm/kasan/report.c~kasan-drop-addr-check-from-describe_object_addr +++ a/mm/kasan/report.c @@ -162,9 +162,6 @@ static void describe_object_addr(struct " which belongs to the cache %s of size %d\n", object, cache->name, cache->object_size); - if (!addr) - return; - if (access_addr < object_addr) { rel_type = "to the left"; rel_bytes = object_addr - access_addr; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 074/114] kasan: more line breaks in reports 2022-03-25 1:07 incoming Andrew Morton ` (72 preceding siblings ...) 2022-03-25 1:12 ` [patch 073/114] kasan: drop addr check from describe_object_addr Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 075/114] kasan: rearrange stack frame info " Andrew Morton ` (38 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: more line breaks in reports Add a line break after each part that describes the buggy address. Improves readability of reports. Link: https://lkml.kernel.org/r/8682c4558e533cd0f99bdb964ce2fe741f2a9212.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 7 +++++-- 1 file changed, 5 insertions(+), 2 deletions(-) --- a/mm/kasan/report.c~kasan-more-line-breaks-in-reports +++ a/mm/kasan/report.c @@ -250,11 +250,13 @@ static void print_address_description(vo void *object = nearest_obj(cache, slab, addr); describe_object(cache, object, addr, tag); + pr_err("\n"); } if (kernel_or_module_addr(addr) && !init_task_stack_addr(addr)) { pr_err("The buggy address belongs to the variable:\n"); pr_err(" %pS\n", addr); + pr_err("\n"); } if (is_vmalloc_addr(addr)) { @@ -265,6 +267,7 @@ static void print_address_description(vo " [%px, %px) created by:\n" " %pS\n", va->addr, va->addr + va->size, va->caller); + pr_err("\n"); page = vmalloc_to_page(page); } @@ -273,9 +276,11 @@ static void print_address_description(vo if (page) { pr_err("The buggy address belongs to the physical page:\n"); dump_page(page, "kasan: bad access detected"); + pr_err("\n"); } kasan_print_address_stack_frame(addr); + pr_err("\n"); } static bool meta_row_is_guilty(const void *row, const void *addr) @@ -382,7 +387,6 @@ void kasan_report_invalid_free(void *obj kasan_print_tags(tag, object); pr_err("\n"); print_address_description(object, tag); - pr_err("\n"); print_memory_metadata(object); end_report(&flags, (unsigned long)object); } @@ -443,7 +447,6 @@ static void __kasan_report(unsigned long if (addr_has_metadata(untagged_addr)) { print_address_description(untagged_addr, get_tag(tagged_addr)); - pr_err("\n"); print_memory_metadata(info.first_bad_addr); } else { dump_stack_lvl(KERN_ERR); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 075/114] kasan: rearrange stack frame info in reports 2022-03-25 1:07 incoming Andrew Morton ` (73 preceding siblings ...) 2022-03-25 1:12 ` [patch 074/114] kasan: more line breaks in reports Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 076/114] kasan: improve " Andrew Morton ` (37 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: rearrange stack frame info in reports - Move printing stack frame info before printing page info. - Add object_is_on_stack() check to print_address_description() and add a corresponding WARNING to kasan_print_address_stack_frame(). This looks more in line with the rest of the checks in this function and also allows to avoid complicating code logic wrt line breaks. - Clean up comments related to get_address_stack_frame_info(). Link: https://lkml.kernel.org/r/1ee113a4c111df97d168c820b527cda77a3cac40.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 12 +++++++++--- mm/kasan/report_generic.c | 15 ++++----------- 2 files changed, 13 insertions(+), 14 deletions(-) --- a/mm/kasan/report.c~kasan-rearrange-stack-frame-info-in-reports +++ a/mm/kasan/report.c @@ -259,6 +259,15 @@ static void print_address_description(vo pr_err("\n"); } + if (object_is_on_stack(addr)) { + /* + * Currently, KASAN supports printing frame information only + * for accesses to the task's own stack. + */ + kasan_print_address_stack_frame(addr); + pr_err("\n"); + } + if (is_vmalloc_addr(addr)) { struct vm_struct *va = find_vm_area(addr); @@ -278,9 +287,6 @@ static void print_address_description(vo dump_page(page, "kasan: bad access detected"); pr_err("\n"); } - - kasan_print_address_stack_frame(addr); - pr_err("\n"); } static bool meta_row_is_guilty(const void *row, const void *addr) --- a/mm/kasan/report_generic.c~kasan-rearrange-stack-frame-info-in-reports +++ a/mm/kasan/report_generic.c @@ -211,6 +211,7 @@ static void print_decoded_frame_descr(co } } +/* Returns true only if the address is on the current task's stack. */ static bool __must_check get_address_stack_frame_info(const void *addr, unsigned long *offset, const char **frame_descr, @@ -224,13 +225,6 @@ static bool __must_check get_address_sta BUILD_BUG_ON(IS_ENABLED(CONFIG_STACK_GROWSUP)); - /* - * NOTE: We currently only support printing frame information for - * accesses to the task's own stack. - */ - if (!object_is_on_stack(addr)) - return false; - aligned_addr = round_down((unsigned long)addr, sizeof(long)); mem_ptr = round_down(aligned_addr, KASAN_GRANULE_SIZE); shadow_ptr = kasan_mem_to_shadow((void *)aligned_addr); @@ -269,14 +263,13 @@ void kasan_print_address_stack_frame(con const char *frame_descr; const void *frame_pc; + if (WARN_ON(!object_is_on_stack(addr))) + return; + if (!get_address_stack_frame_info(addr, &offset, &frame_descr, &frame_pc)) return; - /* - * get_address_stack_frame_info only returns true if the given addr is - * on the current task's stack. - */ pr_err("\n"); pr_err("addr %px is located in stack of task %s/%d at offset %lu in frame:\n", addr, current->comm, task_pid_nr(current), offset); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 076/114] kasan: improve stack frame info in reports 2022-03-25 1:07 incoming Andrew Morton ` (74 preceding siblings ...) 2022-03-25 1:12 ` [patch 075/114] kasan: rearrange stack frame info " Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 077/114] kasan: print basic stack frame info for SW_TAGS Andrew Morton ` (36 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: improve stack frame info in reports - Print at least task name and id for reports affecting allocas (get_address_stack_frame_info() does not support them). - Capitalize first letter of each sentence. Link: https://lkml.kernel.org/r/aa613f097c12f7b75efb17f2618ae00480fb4bc3.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report_generic.c | 9 +++++---- 1 file changed, 5 insertions(+), 4 deletions(-) --- a/mm/kasan/report_generic.c~kasan-improve-stack-frame-info-in-reports +++ a/mm/kasan/report_generic.c @@ -180,7 +180,7 @@ static void print_decoded_frame_descr(co return; pr_err("\n"); - pr_err("this frame has %lu %s:\n", num_objects, + pr_err("This frame has %lu %s:\n", num_objects, num_objects == 1 ? "object" : "objects"); while (num_objects--) { @@ -266,13 +266,14 @@ void kasan_print_address_stack_frame(con if (WARN_ON(!object_is_on_stack(addr))) return; + pr_err("The buggy address belongs to stack of task %s/%d\n", + current->comm, task_pid_nr(current)); + if (!get_address_stack_frame_info(addr, &offset, &frame_descr, &frame_pc)) return; - pr_err("\n"); - pr_err("addr %px is located in stack of task %s/%d at offset %lu in frame:\n", - addr, current->comm, task_pid_nr(current), offset); + pr_err(" and is located at offset %lu in frame:\n", offset); pr_err(" %pS\n", frame_pc); if (!frame_descr) _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 077/114] kasan: print basic stack frame info for SW_TAGS 2022-03-25 1:07 incoming Andrew Morton ` (75 preceding siblings ...) 2022-03-25 1:12 ` [patch 076/114] kasan: improve " Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 078/114] kasan: simplify async check in end_report() Andrew Morton ` (35 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: print basic stack frame info for SW_TAGS Software Tag-Based mode tags stack allocations when CONFIG_KASAN_STACK is enabled. Print task name and id in reports for stack-related bugs. [andreyknvl@google.com: include linux/sched/task_stack.h] Link: https://lkml.kernel.org/r/d7598f11a34ed96e508f7640fa038662ed2305ec.1647099922.git.andreyknvl@google.com Link: https://lkml.kernel.org/r/029aaa87ceadde0702f3312a34697c9139c9fb53.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/kasan.h | 2 +- mm/kasan/report_sw_tags.c | 12 ++++++++++++ 2 files changed, 13 insertions(+), 1 deletion(-) --- a/mm/kasan/kasan.h~kasan-print-basic-stack-frame-info-for-sw_tags +++ a/mm/kasan/kasan.h @@ -274,7 +274,7 @@ void *kasan_find_first_bad_addr(void *ad const char *kasan_get_bug_type(struct kasan_access_info *info); void kasan_metadata_fetch_row(char *buffer, void *row); -#if defined(CONFIG_KASAN_GENERIC) && defined(CONFIG_KASAN_STACK) +#if defined(CONFIG_KASAN_STACK) void kasan_print_address_stack_frame(const void *addr); #else static inline void kasan_print_address_stack_frame(const void *addr) { } --- a/mm/kasan/report_sw_tags.c~kasan-print-basic-stack-frame-info-for-sw_tags +++ a/mm/kasan/report_sw_tags.c @@ -16,6 +16,7 @@ #include <linux/mm.h> #include <linux/printk.h> #include <linux/sched.h> +#include <linux/sched/task_stack.h> #include <linux/slab.h> #include <linux/stackdepot.h> #include <linux/stacktrace.h> @@ -51,3 +52,14 @@ void kasan_print_tags(u8 addr_tag, const pr_err("Pointer tag: [%02x], memory tag: [%02x]\n", addr_tag, *shadow); } + +#ifdef CONFIG_KASAN_STACK +void kasan_print_address_stack_frame(const void *addr) +{ + if (WARN_ON(!object_is_on_stack(addr))) + return; + + pr_err("The buggy address belongs to stack of task %s/%d\n", + current->comm, task_pid_nr(current)); +} +#endif _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 078/114] kasan: simplify async check in end_report() 2022-03-25 1:07 incoming Andrew Morton ` (76 preceding siblings ...) 2022-03-25 1:12 ` [patch 077/114] kasan: print basic stack frame info for SW_TAGS Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 079/114] kasan: simplify kasan_update_kunit_status() and call sites Andrew Morton ` (34 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: simplify async check in end_report() Currently, end_report() does not call trace_error_report_end() for bugs detected in either async or asymm mode (when kasan_async_fault_possible() returns true), as the address of the bad access might be unknown. However, for asymm mode, the address is known for faults triggered by read operations. Instead of using kasan_async_fault_possible(), simply check that the addr is not NULL when calling trace_error_report_end(). Link: https://lkml.kernel.org/r/1c8ce43f97300300e62c941181afa2eb738965c5.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/kasan/report.c~kasan-simplify-async-check-in-end_report +++ a/mm/kasan/report.c @@ -112,7 +112,7 @@ static void start_report(unsigned long * static void end_report(unsigned long *flags, unsigned long addr) { - if (!kasan_async_fault_possible()) + if (addr) trace_error_report_end(ERROR_DETECTOR_KASAN, addr); pr_err("==================================================================\n"); add_taint(TAINT_BAD_PAGE, LOCKDEP_NOW_UNRELIABLE); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 079/114] kasan: simplify kasan_update_kunit_status() and call sites 2022-03-25 1:07 incoming Andrew Morton ` (77 preceding siblings ...) 2022-03-25 1:12 ` [patch 078/114] kasan: simplify async check in end_report() Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 080/114] kasan: check CONFIG_KASAN_KUNIT_TEST instead of CONFIG_KUNIT Andrew Morton ` (33 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: simplify kasan_update_kunit_status() and call sites - Rename kasan_update_kunit_status() to update_kunit_status() (the function is static). - Move the IS_ENABLED(CONFIG_KUNIT) to the function's definition instead of duplicating it at call sites. - Obtain and check current->kunit_test within the function. Link: https://lkml.kernel.org/r/dac26d811ae31856c3d7666de0b108a3735d962d.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 30 ++++++++++++++---------------- 1 file changed, 14 insertions(+), 16 deletions(-) --- a/mm/kasan/report.c~kasan-simplify-kasan_update_kunit_status-and-call-sites +++ a/mm/kasan/report.c @@ -357,24 +357,31 @@ static bool report_enabled(void) } #if IS_ENABLED(CONFIG_KUNIT) -static void kasan_update_kunit_status(struct kunit *cur_test, bool sync) +static void update_kunit_status(bool sync) { + struct kunit *test; struct kunit_resource *resource; struct kunit_kasan_status *status; - resource = kunit_find_named_resource(cur_test, "kasan_status"); + test = current->kunit_test; + if (!test) + return; + resource = kunit_find_named_resource(test, "kasan_status"); if (!resource) { - kunit_set_failure(cur_test); + kunit_set_failure(test); return; } status = (struct kunit_kasan_status *)resource->data; WRITE_ONCE(status->report_found, true); WRITE_ONCE(status->sync_fault, sync); + kunit_put_resource(resource); } -#endif /* IS_ENABLED(CONFIG_KUNIT) */ +#else +static void update_kunit_status(bool sync) { } +#endif void kasan_report_invalid_free(void *object, unsigned long ip) { @@ -383,10 +390,7 @@ void kasan_report_invalid_free(void *obj object = kasan_reset_tag(object); -#if IS_ENABLED(CONFIG_KUNIT) - if (current->kunit_test) - kasan_update_kunit_status(current->kunit_test, true); -#endif /* IS_ENABLED(CONFIG_KUNIT) */ + update_kunit_status(true); start_report(&flags); pr_err("BUG: KASAN: double-free or invalid-free in %pS\n", (void *)ip); @@ -402,10 +406,7 @@ void kasan_report_async(void) { unsigned long flags; -#if IS_ENABLED(CONFIG_KUNIT) - if (current->kunit_test) - kasan_update_kunit_status(current->kunit_test, false); -#endif /* IS_ENABLED(CONFIG_KUNIT) */ + update_kunit_status(false); start_report(&flags); pr_err("BUG: KASAN: invalid-access\n"); @@ -424,10 +425,7 @@ static void __kasan_report(unsigned long void *untagged_addr; unsigned long flags; -#if IS_ENABLED(CONFIG_KUNIT) - if (current->kunit_test) - kasan_update_kunit_status(current->kunit_test, true); -#endif /* IS_ENABLED(CONFIG_KUNIT) */ + update_kunit_status(true); disable_trace_on_warning(); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 080/114] kasan: check CONFIG_KASAN_KUNIT_TEST instead of CONFIG_KUNIT 2022-03-25 1:07 incoming Andrew Morton ` (78 preceding siblings ...) 2022-03-25 1:12 ` [patch 079/114] kasan: simplify kasan_update_kunit_status() and call sites Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 081/114] kasan: move update_kunit_status to start_report Andrew Morton ` (32 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: check CONFIG_KASAN_KUNIT_TEST instead of CONFIG_KUNIT Check the more specific CONFIG_KASAN_KUNIT_TEST config option when defining things related to KUnit-compatible KASAN tests instead of CONFIG_KUNIT. Also put the kunit_kasan_status definition next to the definitons of other KASAN-related structs. Link: https://lkml.kernel.org/r/223592d38d2a601a160a3b2b3d5a9f9090350e62.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/kasan.h | 18 ++++++++---------- mm/kasan/report.c | 2 +- 2 files changed, 9 insertions(+), 11 deletions(-) --- a/mm/kasan/kasan.h~kasan-check-config_kasan_kunit_test-instead-of-config_kunit +++ a/mm/kasan/kasan.h @@ -7,16 +7,6 @@ #include <linux/kfence.h> #include <linux/stackdepot.h> -#if IS_ENABLED(CONFIG_KUNIT) - -/* Used in KUnit-compatible KASAN tests. */ -struct kunit_kasan_status { - bool report_found; - bool sync_fault; -}; - -#endif - #ifdef CONFIG_KASAN_HW_TAGS #include <linux/static_key.h> @@ -224,6 +214,14 @@ struct kasan_free_meta { #endif }; +#if IS_ENABLED(CONFIG_KASAN_KUNIT_TEST) +/* Used in KUnit-compatible KASAN tests. */ +struct kunit_kasan_status { + bool report_found; + bool sync_fault; +}; +#endif + struct kasan_alloc_meta *kasan_get_alloc_meta(struct kmem_cache *cache, const void *object); #ifdef CONFIG_KASAN_GENERIC --- a/mm/kasan/report.c~kasan-check-config_kasan_kunit_test-instead-of-config_kunit +++ a/mm/kasan/report.c @@ -356,7 +356,7 @@ static bool report_enabled(void) return !test_and_set_bit(KASAN_BIT_REPORTED, &kasan_flags); } -#if IS_ENABLED(CONFIG_KUNIT) +#if IS_ENABLED(CONFIG_KASAN_KUNIT_TEST) static void update_kunit_status(bool sync) { struct kunit *test; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 081/114] kasan: move update_kunit_status to start_report 2022-03-25 1:07 incoming Andrew Morton ` (79 preceding siblings ...) 2022-03-25 1:12 ` [patch 080/114] kasan: check CONFIG_KASAN_KUNIT_TEST instead of CONFIG_KUNIT Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 082/114] kasan: move disable_trace_on_warning " Andrew Morton ` (31 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: move update_kunit_status to start_report Instead of duplicating calls to update_kunit_status() in every error report routine, call it once in start_report(). Pass the sync flag as an additional argument to start_report(). Link: https://lkml.kernel.org/r/cae5c845a0b6f3c867014e53737cdac56b11edc7.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 75 +++++++++++++++++++------------------------- 1 file changed, 34 insertions(+), 41 deletions(-) --- a/mm/kasan/report.c~kasan-move-update_kunit_status-to-start_report +++ a/mm/kasan/report.c @@ -98,13 +98,40 @@ static void print_error_description(stru info->access_addr, current->comm, task_pid_nr(current)); } +#if IS_ENABLED(CONFIG_KASAN_KUNIT_TEST) +static void update_kunit_status(bool sync) +{ + struct kunit *test; + struct kunit_resource *resource; + struct kunit_kasan_status *status; + + test = current->kunit_test; + if (!test) + return; + + resource = kunit_find_named_resource(test, "kasan_status"); + if (!resource) { + kunit_set_failure(test); + return; + } + + status = (struct kunit_kasan_status *)resource->data; + WRITE_ONCE(status->report_found, true); + WRITE_ONCE(status->sync_fault, sync); + + kunit_put_resource(resource); +} +#else +static void update_kunit_status(bool sync) { } +#endif + static DEFINE_SPINLOCK(report_lock); -static void start_report(unsigned long *flags) +static void start_report(unsigned long *flags, bool sync) { - /* - * Make sure we don't end up in loop. - */ + /* Update status of the currently running KASAN test. */ + update_kunit_status(sync); + /* Make sure we don't end up in loop. */ kasan_disable_current(); spin_lock_irqsave(&report_lock, *flags); pr_err("==================================================================\n"); @@ -356,33 +383,6 @@ static bool report_enabled(void) return !test_and_set_bit(KASAN_BIT_REPORTED, &kasan_flags); } -#if IS_ENABLED(CONFIG_KASAN_KUNIT_TEST) -static void update_kunit_status(bool sync) -{ - struct kunit *test; - struct kunit_resource *resource; - struct kunit_kasan_status *status; - - test = current->kunit_test; - if (!test) - return; - - resource = kunit_find_named_resource(test, "kasan_status"); - if (!resource) { - kunit_set_failure(test); - return; - } - - status = (struct kunit_kasan_status *)resource->data; - WRITE_ONCE(status->report_found, true); - WRITE_ONCE(status->sync_fault, sync); - - kunit_put_resource(resource); -} -#else -static void update_kunit_status(bool sync) { } -#endif - void kasan_report_invalid_free(void *object, unsigned long ip) { unsigned long flags; @@ -390,9 +390,7 @@ void kasan_report_invalid_free(void *obj object = kasan_reset_tag(object); - update_kunit_status(true); - - start_report(&flags); + start_report(&flags, true); pr_err("BUG: KASAN: double-free or invalid-free in %pS\n", (void *)ip); kasan_print_tags(tag, object); pr_err("\n"); @@ -406,9 +404,7 @@ void kasan_report_async(void) { unsigned long flags; - update_kunit_status(false); - - start_report(&flags); + start_report(&flags, false); pr_err("BUG: KASAN: invalid-access\n"); pr_err("Asynchronous mode enabled: no access details available\n"); pr_err("\n"); @@ -425,9 +421,8 @@ static void __kasan_report(unsigned long void *untagged_addr; unsigned long flags; - update_kunit_status(true); - disable_trace_on_warning(); + start_report(&flags, true); tagged_addr = (void *)addr; untagged_addr = kasan_reset_tag(tagged_addr); @@ -442,8 +437,6 @@ static void __kasan_report(unsigned long info.is_write = is_write; info.ip = ip; - start_report(&flags); - print_error_description(&info); if (addr_has_metadata(untagged_addr)) kasan_print_tags(get_tag(tagged_addr), info.first_bad_addr); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 082/114] kasan: move disable_trace_on_warning to start_report 2022-03-25 1:07 incoming Andrew Morton ` (80 preceding siblings ...) 2022-03-25 1:12 ` [patch 081/114] kasan: move update_kunit_status to start_report Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 083/114] kasan: split out print_report from __kasan_report Andrew Morton ` (30 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: move disable_trace_on_warning to start_report Move the disable_trace_on_warning() call, which enables the /proc/sys/kernel/traceoff_on_warning interface for KASAN bugs, to start_report(), so that it functions for all types of KASAN reports. Link: https://lkml.kernel.org/r/7c066c5de26234ad2cebdd931adfe437f8a95d58.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 3 ++- 1 file changed, 2 insertions(+), 1 deletion(-) --- a/mm/kasan/report.c~kasan-move-disable_trace_on_warning-to-start_report +++ a/mm/kasan/report.c @@ -129,6 +129,8 @@ static DEFINE_SPINLOCK(report_lock); static void start_report(unsigned long *flags, bool sync) { + /* Respect the /proc/sys/kernel/traceoff_on_warning interface. */ + disable_trace_on_warning(); /* Update status of the currently running KASAN test. */ update_kunit_status(sync); /* Make sure we don't end up in loop. */ @@ -421,7 +423,6 @@ static void __kasan_report(unsigned long void *untagged_addr; unsigned long flags; - disable_trace_on_warning(); start_report(&flags, true); tagged_addr = (void *)addr; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 083/114] kasan: split out print_report from __kasan_report 2022-03-25 1:07 incoming Andrew Morton ` (81 preceding siblings ...) 2022-03-25 1:12 ` [patch 082/114] kasan: move disable_trace_on_warning " Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 084/114] kasan: simplify kasan_find_first_bad_addr call sites Andrew Morton ` (29 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: split out print_report from __kasan_report Split out the part of __kasan_report() that prints things into print_report(). One of the subsequent patches makes another error handler use print_report() as well. Includes lower-level changes: - Allow addr_has_metadata() accepting a tagged address. - Drop the const qualifier from the fields of kasan_access_info to avoid excessive type casts. - Change the type of the address argument of __kasan_report() and end_report() to void * to reduce the number of type casts. Link: https://lkml.kernel.org/r/9be3ed99dd24b9c4e1c4a848b69a0c6ecefd845e.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/kasan.h | 7 +++-- mm/kasan/report.c | 58 +++++++++++++++++++++++--------------------- 2 files changed, 35 insertions(+), 30 deletions(-) --- a/mm/kasan/kasan.h~kasan-split-out-print_report-from-__kasan_report +++ a/mm/kasan/kasan.h @@ -128,8 +128,8 @@ static inline bool kasan_sync_fault_poss #define META_ROWS_AROUND_ADDR 2 struct kasan_access_info { - const void *access_addr; - const void *first_bad_addr; + void *access_addr; + void *first_bad_addr; size_t access_size; bool is_write; unsigned long ip; @@ -239,7 +239,8 @@ static inline const void *kasan_shadow_t static inline bool addr_has_metadata(const void *addr) { - return (addr >= kasan_shadow_to_mem((void *)KASAN_SHADOW_START)); + return (kasan_reset_tag(addr) >= + kasan_shadow_to_mem((void *)KASAN_SHADOW_START)); } /** --- a/mm/kasan/report.c~kasan-split-out-print_report-from-__kasan_report +++ a/mm/kasan/report.c @@ -139,10 +139,11 @@ static void start_report(unsigned long * pr_err("==================================================================\n"); } -static void end_report(unsigned long *flags, unsigned long addr) +static void end_report(unsigned long *flags, void *addr) { if (addr) - trace_error_report_end(ERROR_DETECTOR_KASAN, addr); + trace_error_report_end(ERROR_DETECTOR_KASAN, + (unsigned long)addr); pr_err("==================================================================\n"); add_taint(TAINT_BAD_PAGE, LOCKDEP_NOW_UNRELIABLE); spin_unlock_irqrestore(&report_lock, *flags); @@ -398,7 +399,7 @@ void kasan_report_invalid_free(void *obj pr_err("\n"); print_address_description(object, tag); print_memory_metadata(object); - end_report(&flags, (unsigned long)object); + end_report(&flags, object); } #ifdef CONFIG_KASAN_HW_TAGS @@ -411,44 +412,47 @@ void kasan_report_async(void) pr_err("Asynchronous mode enabled: no access details available\n"); pr_err("\n"); dump_stack_lvl(KERN_ERR); - end_report(&flags, 0); + end_report(&flags, NULL); } #endif /* CONFIG_KASAN_HW_TAGS */ -static void __kasan_report(unsigned long addr, size_t size, bool is_write, +static void print_report(struct kasan_access_info *info) +{ + void *tagged_addr = info->access_addr; + void *untagged_addr = kasan_reset_tag(tagged_addr); + u8 tag = get_tag(tagged_addr); + + print_error_description(info); + if (addr_has_metadata(untagged_addr)) + kasan_print_tags(tag, info->first_bad_addr); + pr_err("\n"); + + if (addr_has_metadata(untagged_addr)) { + print_address_description(untagged_addr, tag); + print_memory_metadata(info->first_bad_addr); + } else { + dump_stack_lvl(KERN_ERR); + } +} + +static void __kasan_report(void *addr, size_t size, bool is_write, unsigned long ip) { struct kasan_access_info info; - void *tagged_addr; - void *untagged_addr; unsigned long flags; start_report(&flags, true); - tagged_addr = (void *)addr; - untagged_addr = kasan_reset_tag(tagged_addr); - - info.access_addr = tagged_addr; - if (addr_has_metadata(untagged_addr)) - info.first_bad_addr = - kasan_find_first_bad_addr(tagged_addr, size); + info.access_addr = addr; + if (addr_has_metadata(addr)) + info.first_bad_addr = kasan_find_first_bad_addr(addr, size); else - info.first_bad_addr = untagged_addr; + info.first_bad_addr = addr; info.access_size = size; info.is_write = is_write; info.ip = ip; - print_error_description(&info); - if (addr_has_metadata(untagged_addr)) - kasan_print_tags(get_tag(tagged_addr), info.first_bad_addr); - pr_err("\n"); - - if (addr_has_metadata(untagged_addr)) { - print_address_description(untagged_addr, get_tag(tagged_addr)); - print_memory_metadata(info.first_bad_addr); - } else { - dump_stack_lvl(KERN_ERR); - } + print_report(&info); end_report(&flags, addr); } @@ -460,7 +464,7 @@ bool kasan_report(unsigned long addr, si bool ret = false; if (likely(report_enabled())) { - __kasan_report(addr, size, is_write, ip); + __kasan_report((void *)addr, size, is_write, ip); ret = true; } _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 084/114] kasan: simplify kasan_find_first_bad_addr call sites 2022-03-25 1:07 incoming Andrew Morton ` (82 preceding siblings ...) 2022-03-25 1:12 ` [patch 083/114] kasan: split out print_report from __kasan_report Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 085/114] kasan: restructure kasan_report Andrew Morton ` (28 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: simplify kasan_find_first_bad_addr call sites Move the addr_has_metadata() check into kasan_find_first_bad_addr(). Link: https://lkml.kernel.org/r/a49576f7a23283d786ba61579cb0c5057e8f0b9b.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 5 +---- mm/kasan/report_generic.c | 4 ++++ mm/kasan/report_hw_tags.c | 1 + mm/kasan/report_sw_tags.c | 4 ++++ 4 files changed, 10 insertions(+), 4 deletions(-) --- a/mm/kasan/report.c~kasan-simplify-kasan_find_first_bad_addr-call-sites +++ a/mm/kasan/report.c @@ -444,10 +444,7 @@ static void __kasan_report(void *addr, s start_report(&flags, true); info.access_addr = addr; - if (addr_has_metadata(addr)) - info.first_bad_addr = kasan_find_first_bad_addr(addr, size); - else - info.first_bad_addr = addr; + info.first_bad_addr = kasan_find_first_bad_addr(addr, size); info.access_size = size; info.is_write = is_write; info.ip = ip; --- a/mm/kasan/report_generic.c~kasan-simplify-kasan_find_first_bad_addr-call-sites +++ a/mm/kasan/report_generic.c @@ -34,8 +34,12 @@ void *kasan_find_first_bad_addr(void *ad { void *p = addr; + if (!addr_has_metadata(p)) + return p; + while (p < addr + size && !(*(u8 *)kasan_mem_to_shadow(p))) p += KASAN_GRANULE_SIZE; + return p; } --- a/mm/kasan/report_hw_tags.c~kasan-simplify-kasan_find_first_bad_addr-call-sites +++ a/mm/kasan/report_hw_tags.c @@ -17,6 +17,7 @@ void *kasan_find_first_bad_addr(void *addr, size_t size) { + /* Return the same value regardless of whether addr_has_metadata(). */ return kasan_reset_tag(addr); } --- a/mm/kasan/report_sw_tags.c~kasan-simplify-kasan_find_first_bad_addr-call-sites +++ a/mm/kasan/report_sw_tags.c @@ -36,8 +36,12 @@ void *kasan_find_first_bad_addr(void *ad void *p = kasan_reset_tag(addr); void *end = p + size; + if (!addr_has_metadata(p)) + return p; + while (p < end && tag == *(u8 *)kasan_mem_to_shadow(p)) p += KASAN_GRANULE_SIZE; + return p; } _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 085/114] kasan: restructure kasan_report 2022-03-25 1:07 incoming Andrew Morton ` (83 preceding siblings ...) 2022-03-25 1:12 ` [patch 084/114] kasan: simplify kasan_find_first_bad_addr call sites Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 086/114] kasan: merge __kasan_report into kasan_report Andrew Morton ` (27 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: restructure kasan_report Restructure kasan_report() to make reviewing the subsequent patches easier. Link: https://lkml.kernel.org/r/ca28042889858b8cc4724d3d4378387f90d7a59d.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 15 +++++++++------ 1 file changed, 9 insertions(+), 6 deletions(-) --- a/mm/kasan/report.c~kasan-restructure-kasan_report +++ a/mm/kasan/report.c @@ -457,15 +457,18 @@ static void __kasan_report(void *addr, s bool kasan_report(unsigned long addr, size_t size, bool is_write, unsigned long ip) { - unsigned long flags = user_access_save(); - bool ret = false; + unsigned long ua_flags = user_access_save(); + bool ret = true; - if (likely(report_enabled())) { - __kasan_report((void *)addr, size, is_write, ip); - ret = true; + if (unlikely(!report_enabled())) { + ret = false; + goto out; } - user_access_restore(flags); + __kasan_report((void *)addr, size, is_write, ip); + +out: + user_access_restore(ua_flags); return ret; } _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 086/114] kasan: merge __kasan_report into kasan_report 2022-03-25 1:07 incoming Andrew Morton ` (84 preceding siblings ...) 2022-03-25 1:12 ` [patch 085/114] kasan: restructure kasan_report Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 087/114] kasan: call print_report from kasan_report_invalid_free Andrew Morton ` (26 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: merge __kasan_report into kasan_report Merge __kasan_report() into kasan_report(). The code is simple enough to be readable without the __kasan_report() helper. Link: https://lkml.kernel.org/r/c8a125497ef82f7042b3795918dffb81a85a878e.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 36 +++++++++++++++--------------------- 1 file changed, 15 insertions(+), 21 deletions(-) --- a/mm/kasan/report.c~kasan-merge-__kasan_report-into-kasan_report +++ a/mm/kasan/report.c @@ -435,37 +435,31 @@ static void print_report(struct kasan_ac } } -static void __kasan_report(void *addr, size_t size, bool is_write, - unsigned long ip) -{ - struct kasan_access_info info; - unsigned long flags; - - start_report(&flags, true); - - info.access_addr = addr; - info.first_bad_addr = kasan_find_first_bad_addr(addr, size); - info.access_size = size; - info.is_write = is_write; - info.ip = ip; - - print_report(&info); - - end_report(&flags, addr); -} - bool kasan_report(unsigned long addr, size_t size, bool is_write, unsigned long ip) { - unsigned long ua_flags = user_access_save(); bool ret = true; + void *ptr = (void *)addr; + unsigned long ua_flags = user_access_save(); + unsigned long irq_flags; + struct kasan_access_info info; if (unlikely(!report_enabled())) { ret = false; goto out; } - __kasan_report((void *)addr, size, is_write, ip); + start_report(&irq_flags, true); + + info.access_addr = ptr; + info.first_bad_addr = kasan_find_first_bad_addr(ptr, size); + info.access_size = size; + info.is_write = is_write; + info.ip = ip; + + print_report(&info); + + end_report(&irq_flags, ptr); out: user_access_restore(ua_flags); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 087/114] kasan: call print_report from kasan_report_invalid_free 2022-03-25 1:07 incoming Andrew Morton ` (85 preceding siblings ...) 2022-03-25 1:12 ` [patch 086/114] kasan: merge __kasan_report into kasan_report Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:12 ` [patch 088/114] kasan: move and simplify kasan_report_async Andrew Morton ` (25 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: call print_report from kasan_report_invalid_free Call print_report() in kasan_report_invalid_free() instead of calling printing functions directly. Compared to the existing implementation of kasan_report_invalid_free(), print_report() makes sure that the buggy address has metadata before printing it. The change requires adding a report type field into kasan_access_info and using it accordingly. kasan_report_async() is left as is, as using print_report() will only complicate the code. Link: https://lkml.kernel.org/r/9ea6f0604c5d2e1fb28d93dc6c44232c1f8017fe.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/kasan.h | 6 ++++++ mm/kasan/report.c | 42 ++++++++++++++++++++++++++---------------- 2 files changed, 32 insertions(+), 16 deletions(-) --- a/mm/kasan/kasan.h~kasan-call-print_report-from-kasan_report_invalid_free +++ a/mm/kasan/kasan.h @@ -127,7 +127,13 @@ static inline bool kasan_sync_fault_poss #define META_MEM_BYTES_PER_ROW (META_BYTES_PER_ROW * KASAN_GRANULE_SIZE) #define META_ROWS_AROUND_ADDR 2 +enum kasan_report_type { + KASAN_REPORT_ACCESS, + KASAN_REPORT_INVALID_FREE, +}; + struct kasan_access_info { + enum kasan_report_type type; void *access_addr; void *first_bad_addr; size_t access_size; --- a/mm/kasan/report.c~kasan-call-print_report-from-kasan_report_invalid_free +++ a/mm/kasan/report.c @@ -86,6 +86,12 @@ __setup("kasan_multi_shot", kasan_set_mu static void print_error_description(struct kasan_access_info *info) { + if (info->type == KASAN_REPORT_INVALID_FREE) { + pr_err("BUG: KASAN: double-free or invalid-free in %pS\n", + (void *)info->ip); + return; + } + pr_err("BUG: KASAN: %s in %pS\n", kasan_get_bug_type(info), (void *)info->ip); if (info->access_size) @@ -386,22 +392,6 @@ static bool report_enabled(void) return !test_and_set_bit(KASAN_BIT_REPORTED, &kasan_flags); } -void kasan_report_invalid_free(void *object, unsigned long ip) -{ - unsigned long flags; - u8 tag = get_tag(object); - - object = kasan_reset_tag(object); - - start_report(&flags, true); - pr_err("BUG: KASAN: double-free or invalid-free in %pS\n", (void *)ip); - kasan_print_tags(tag, object); - pr_err("\n"); - print_address_description(object, tag); - print_memory_metadata(object); - end_report(&flags, object); -} - #ifdef CONFIG_KASAN_HW_TAGS void kasan_report_async(void) { @@ -435,6 +425,25 @@ static void print_report(struct kasan_ac } } +void kasan_report_invalid_free(void *ptr, unsigned long ip) +{ + unsigned long flags; + struct kasan_access_info info; + + start_report(&flags, true); + + info.type = KASAN_REPORT_INVALID_FREE; + info.access_addr = ptr; + info.first_bad_addr = kasan_reset_tag(ptr); + info.access_size = 0; + info.is_write = false; + info.ip = ip; + + print_report(&info); + + end_report(&flags, ptr); +} + bool kasan_report(unsigned long addr, size_t size, bool is_write, unsigned long ip) { @@ -451,6 +460,7 @@ bool kasan_report(unsigned long addr, si start_report(&irq_flags, true); + info.type = KASAN_REPORT_ACCESS; info.access_addr = ptr; info.first_bad_addr = kasan_find_first_bad_addr(ptr, size); info.access_size = size; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 088/114] kasan: move and simplify kasan_report_async 2022-03-25 1:07 incoming Andrew Morton ` (86 preceding siblings ...) 2022-03-25 1:12 ` [patch 087/114] kasan: call print_report from kasan_report_invalid_free Andrew Morton @ 2022-03-25 1:12 ` Andrew Morton 2022-03-25 1:13 ` [patch 089/114] kasan: rename kasan_access_info to kasan_report_info Andrew Morton ` (24 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:12 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: move and simplify kasan_report_async Place kasan_report_async() next to the other main reporting routines. Also simplify printed information. Link: https://lkml.kernel.org/r/52d942ef3ffd29bdfa225bbe8e327bc5bda7ab09.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 28 ++++++++++++++-------------- 1 file changed, 14 insertions(+), 14 deletions(-) --- a/mm/kasan/report.c~kasan-move-and-simplify-kasan_report_async +++ a/mm/kasan/report.c @@ -392,20 +392,6 @@ static bool report_enabled(void) return !test_and_set_bit(KASAN_BIT_REPORTED, &kasan_flags); } -#ifdef CONFIG_KASAN_HW_TAGS -void kasan_report_async(void) -{ - unsigned long flags; - - start_report(&flags, false); - pr_err("BUG: KASAN: invalid-access\n"); - pr_err("Asynchronous mode enabled: no access details available\n"); - pr_err("\n"); - dump_stack_lvl(KERN_ERR); - end_report(&flags, NULL); -} -#endif /* CONFIG_KASAN_HW_TAGS */ - static void print_report(struct kasan_access_info *info) { void *tagged_addr = info->access_addr; @@ -477,6 +463,20 @@ out: return ret; } +#ifdef CONFIG_KASAN_HW_TAGS +void kasan_report_async(void) +{ + unsigned long flags; + + start_report(&flags, false); + pr_err("BUG: KASAN: invalid-access\n"); + pr_err("Asynchronous fault: no details available\n"); + pr_err("\n"); + dump_stack_lvl(KERN_ERR); + end_report(&flags, NULL); +} +#endif /* CONFIG_KASAN_HW_TAGS */ + #ifdef CONFIG_KASAN_INLINE /* * With CONFIG_KASAN_INLINE, accesses to bogus pointers (outside the high _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 089/114] kasan: rename kasan_access_info to kasan_report_info 2022-03-25 1:07 incoming Andrew Morton ` (87 preceding siblings ...) 2022-03-25 1:12 ` [patch 088/114] kasan: move and simplify kasan_report_async Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 090/114] kasan: add comment about UACCESS regions to kasan_report Andrew Morton ` (23 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: rename kasan_access_info to kasan_report_info Rename kasan_access_info to kasan_report_info, as the latter name better reflects the struct's purpose. Link: https://lkml.kernel.org/r/158a4219a5d356901d017352558c989533a0782c.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/kasan.h | 4 ++-- mm/kasan/report.c | 8 ++++---- mm/kasan/report_generic.c | 6 +++--- mm/kasan/report_tags.c | 2 +- 4 files changed, 10 insertions(+), 10 deletions(-) --- a/mm/kasan/kasan.h~kasan-rename-kasan_access_info-to-kasan_report_info +++ a/mm/kasan/kasan.h @@ -132,7 +132,7 @@ enum kasan_report_type { KASAN_REPORT_INVALID_FREE, }; -struct kasan_access_info { +struct kasan_report_info { enum kasan_report_type type; void *access_addr; void *first_bad_addr; @@ -276,7 +276,7 @@ static inline void kasan_print_tags(u8 a #endif void *kasan_find_first_bad_addr(void *addr, size_t size); -const char *kasan_get_bug_type(struct kasan_access_info *info); +const char *kasan_get_bug_type(struct kasan_report_info *info); void kasan_metadata_fetch_row(char *buffer, void *row); #if defined(CONFIG_KASAN_STACK) --- a/mm/kasan/report.c~kasan-rename-kasan_access_info-to-kasan_report_info +++ a/mm/kasan/report.c @@ -84,7 +84,7 @@ static int __init kasan_set_multi_shot(c } __setup("kasan_multi_shot", kasan_set_multi_shot); -static void print_error_description(struct kasan_access_info *info) +static void print_error_description(struct kasan_report_info *info) { if (info->type == KASAN_REPORT_INVALID_FREE) { pr_err("BUG: KASAN: double-free or invalid-free in %pS\n", @@ -392,7 +392,7 @@ static bool report_enabled(void) return !test_and_set_bit(KASAN_BIT_REPORTED, &kasan_flags); } -static void print_report(struct kasan_access_info *info) +static void print_report(struct kasan_report_info *info) { void *tagged_addr = info->access_addr; void *untagged_addr = kasan_reset_tag(tagged_addr); @@ -414,7 +414,7 @@ static void print_report(struct kasan_ac void kasan_report_invalid_free(void *ptr, unsigned long ip) { unsigned long flags; - struct kasan_access_info info; + struct kasan_report_info info; start_report(&flags, true); @@ -437,7 +437,7 @@ bool kasan_report(unsigned long addr, si void *ptr = (void *)addr; unsigned long ua_flags = user_access_save(); unsigned long irq_flags; - struct kasan_access_info info; + struct kasan_report_info info; if (unlikely(!report_enabled())) { ret = false; --- a/mm/kasan/report_generic.c~kasan-rename-kasan_access_info-to-kasan_report_info +++ a/mm/kasan/report_generic.c @@ -43,7 +43,7 @@ void *kasan_find_first_bad_addr(void *ad return p; } -static const char *get_shadow_bug_type(struct kasan_access_info *info) +static const char *get_shadow_bug_type(struct kasan_report_info *info) { const char *bug_type = "unknown-crash"; u8 *shadow_addr; @@ -95,7 +95,7 @@ static const char *get_shadow_bug_type(s return bug_type; } -static const char *get_wild_bug_type(struct kasan_access_info *info) +static const char *get_wild_bug_type(struct kasan_report_info *info) { const char *bug_type = "unknown-crash"; @@ -109,7 +109,7 @@ static const char *get_wild_bug_type(str return bug_type; } -const char *kasan_get_bug_type(struct kasan_access_info *info) +const char *kasan_get_bug_type(struct kasan_report_info *info) { /* * If access_size is a negative number, then it has reason to be --- a/mm/kasan/report_tags.c~kasan-rename-kasan_access_info-to-kasan_report_info +++ a/mm/kasan/report_tags.c @@ -7,7 +7,7 @@ #include "kasan.h" #include "../slab.h" -const char *kasan_get_bug_type(struct kasan_access_info *info) +const char *kasan_get_bug_type(struct kasan_report_info *info) { #ifdef CONFIG_KASAN_TAGS_IDENTIFY struct kasan_alloc_meta *alloc_meta; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 090/114] kasan: add comment about UACCESS regions to kasan_report 2022-03-25 1:07 incoming Andrew Morton ` (88 preceding siblings ...) 2022-03-25 1:13 ` [patch 089/114] kasan: rename kasan_access_info to kasan_report_info Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 091/114] kasan: respect KASAN_BIT_REPORTED in all reporting routines Andrew Morton ` (22 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: add comment about UACCESS regions to kasan_report Add a comment explaining why kasan_report() is the only reporting function that uses user_access_save/restore(). Link: https://lkml.kernel.org/r/1201ca3c2be42c7bd077c53d2e46f4a51dd1476a.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 5 +++++ 1 file changed, 5 insertions(+) --- a/mm/kasan/report.c~kasan-add-comment-about-uaccess-regions-to-kasan_report +++ a/mm/kasan/report.c @@ -430,6 +430,11 @@ void kasan_report_invalid_free(void *ptr end_report(&flags, ptr); } +/* + * kasan_report() is the only reporting function that uses + * user_access_save/restore(): kasan_report_invalid_free() cannot be called + * from a UACCESS region, and kasan_report_async() is not used on x86. + */ bool kasan_report(unsigned long addr, size_t size, bool is_write, unsigned long ip) { _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 091/114] kasan: respect KASAN_BIT_REPORTED in all reporting routines 2022-03-25 1:07 incoming Andrew Morton ` (89 preceding siblings ...) 2022-03-25 1:13 ` [patch 090/114] kasan: add comment about UACCESS regions to kasan_report Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 092/114] kasan: reorder reporting functions Andrew Morton ` (21 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: respect KASAN_BIT_REPORTED in all reporting routines Currently, only kasan_report() checks the KASAN_BIT_REPORTED and KASAN_BIT_MULTI_SHOT flags. Make other reporting routines check these flags as well. Also add explanatory comments. Note that the current->kasan_depth check is split out into report_suppressed() and only called for kasan_report(). Link: https://lkml.kernel.org/r/715e346b10b398e29ba1b425299dcd79e29d58ce.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 35 ++++++++++++++++++++++++++++++++--- 1 file changed, 32 insertions(+), 3 deletions(-) --- a/mm/kasan/report.c~kasan-respect-kasan_bit_reported-in-all-reporting-routines +++ a/mm/kasan/report.c @@ -381,12 +381,26 @@ static void print_memory_metadata(const } } -static bool report_enabled(void) +/* + * Used to suppress reports within kasan_disable/enable_current() critical + * sections, which are used for marking accesses to slab metadata. + */ +static bool report_suppressed(void) { #if defined(CONFIG_KASAN_GENERIC) || defined(CONFIG_KASAN_SW_TAGS) if (current->kasan_depth) - return false; + return true; #endif + return false; +} + +/* + * Used to avoid reporting more than one KASAN bug unless kasan_multi_shot + * is enabled. Note that KASAN tests effectively enable kasan_multi_shot + * for their duration. + */ +static bool report_enabled(void) +{ if (test_bit(KASAN_BIT_MULTI_SHOT, &kasan_flags)) return true; return !test_and_set_bit(KASAN_BIT_REPORTED, &kasan_flags); @@ -416,6 +430,14 @@ void kasan_report_invalid_free(void *ptr unsigned long flags; struct kasan_report_info info; + /* + * Do not check report_suppressed(), as an invalid-free cannot be + * caused by accessing slab metadata and thus should not be + * suppressed by kasan_disable/enable_current() critical sections. + */ + if (unlikely(!report_enabled())) + return; + start_report(&flags, true); info.type = KASAN_REPORT_INVALID_FREE; @@ -444,7 +466,7 @@ bool kasan_report(unsigned long addr, si unsigned long irq_flags; struct kasan_report_info info; - if (unlikely(!report_enabled())) { + if (unlikely(report_suppressed()) || unlikely(!report_enabled())) { ret = false; goto out; } @@ -473,6 +495,13 @@ void kasan_report_async(void) { unsigned long flags; + /* + * Do not check report_suppressed(), as kasan_disable/enable_current() + * critical sections do not affect Hardware Tag-Based KASAN. + */ + if (unlikely(!report_enabled())) + return; + start_report(&flags, false); pr_err("BUG: KASAN: invalid-access\n"); pr_err("Asynchronous fault: no details available\n"); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 092/114] kasan: reorder reporting functions 2022-03-25 1:07 incoming Andrew Morton ` (90 preceding siblings ...) 2022-03-25 1:13 ` [patch 091/114] kasan: respect KASAN_BIT_REPORTED in all reporting routines Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 093/114] kasan: move and hide kasan_save_enable/restore_multi_shot Andrew Morton ` (20 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: reorder reporting functions Move print_error_description()'s, report_suppressed()'s, and report_enabled()'s definitions to improve the logical order of function definitions in report.c. No functional changes. Link: https://lkml.kernel.org/r/82aa926c411e00e76e97e645a551ede9ed0c5e79.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 82 ++++++++++++++++++++++---------------------- 1 file changed, 41 insertions(+), 41 deletions(-) --- a/mm/kasan/report.c~kasan-reorder-reporting-functions +++ a/mm/kasan/report.c @@ -84,24 +84,29 @@ static int __init kasan_set_multi_shot(c } __setup("kasan_multi_shot", kasan_set_multi_shot); -static void print_error_description(struct kasan_report_info *info) +/* + * Used to suppress reports within kasan_disable/enable_current() critical + * sections, which are used for marking accesses to slab metadata. + */ +static bool report_suppressed(void) { - if (info->type == KASAN_REPORT_INVALID_FREE) { - pr_err("BUG: KASAN: double-free or invalid-free in %pS\n", - (void *)info->ip); - return; - } +#if defined(CONFIG_KASAN_GENERIC) || defined(CONFIG_KASAN_SW_TAGS) + if (current->kasan_depth) + return true; +#endif + return false; +} - pr_err("BUG: KASAN: %s in %pS\n", - kasan_get_bug_type(info), (void *)info->ip); - if (info->access_size) - pr_err("%s of size %zu at addr %px by task %s/%d\n", - info->is_write ? "Write" : "Read", info->access_size, - info->access_addr, current->comm, task_pid_nr(current)); - else - pr_err("%s at addr %px by task %s/%d\n", - info->is_write ? "Write" : "Read", - info->access_addr, current->comm, task_pid_nr(current)); +/* + * Used to avoid reporting more than one KASAN bug unless kasan_multi_shot + * is enabled. Note that KASAN tests effectively enable kasan_multi_shot + * for their duration. + */ +static bool report_enabled(void) +{ + if (test_bit(KASAN_BIT_MULTI_SHOT, &kasan_flags)) + return true; + return !test_and_set_bit(KASAN_BIT_REPORTED, &kasan_flags); } #if IS_ENABLED(CONFIG_KASAN_KUNIT_TEST) @@ -160,6 +165,26 @@ static void end_report(unsigned long *fl kasan_enable_current(); } +static void print_error_description(struct kasan_report_info *info) +{ + if (info->type == KASAN_REPORT_INVALID_FREE) { + pr_err("BUG: KASAN: double-free or invalid-free in %pS\n", + (void *)info->ip); + return; + } + + pr_err("BUG: KASAN: %s in %pS\n", + kasan_get_bug_type(info), (void *)info->ip); + if (info->access_size) + pr_err("%s of size %zu at addr %px by task %s/%d\n", + info->is_write ? "Write" : "Read", info->access_size, + info->access_addr, current->comm, task_pid_nr(current)); + else + pr_err("%s at addr %px by task %s/%d\n", + info->is_write ? "Write" : "Read", + info->access_addr, current->comm, task_pid_nr(current)); +} + static void print_track(struct kasan_track *track, const char *prefix) { pr_err("%s by task %u:\n", prefix, track->pid); @@ -381,31 +406,6 @@ static void print_memory_metadata(const } } -/* - * Used to suppress reports within kasan_disable/enable_current() critical - * sections, which are used for marking accesses to slab metadata. - */ -static bool report_suppressed(void) -{ -#if defined(CONFIG_KASAN_GENERIC) || defined(CONFIG_KASAN_SW_TAGS) - if (current->kasan_depth) - return true; -#endif - return false; -} - -/* - * Used to avoid reporting more than one KASAN bug unless kasan_multi_shot - * is enabled. Note that KASAN tests effectively enable kasan_multi_shot - * for their duration. - */ -static bool report_enabled(void) -{ - if (test_bit(KASAN_BIT_MULTI_SHOT, &kasan_flags)) - return true; - return !test_and_set_bit(KASAN_BIT_REPORTED, &kasan_flags); -} - static void print_report(struct kasan_report_info *info) { void *tagged_addr = info->access_addr; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 093/114] kasan: move and hide kasan_save_enable/restore_multi_shot 2022-03-25 1:07 incoming Andrew Morton ` (91 preceding siblings ...) 2022-03-25 1:13 ` [patch 092/114] kasan: reorder reporting functions Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 094/114] kasan: disable LOCKDEP when printing reports Andrew Morton ` (19 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: move and hide kasan_save_enable/restore_multi_shot - Move kasan_save_enable/restore_multi_shot() declarations to mm/kasan/kasan.h, as there is no need for them to be visible outside of KASAN implementation. - Only define and export these functions when KASAN tests are enabled. - Move their definitions closer to other test-related code in report.c. Link: https://lkml.kernel.org/r/6ba637333b78447f027d775f2d55ab1a40f63c99.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/kasan.h | 4 ---- mm/kasan/kasan.h | 7 +++++++ mm/kasan/report.c | 30 +++++++++++++++++------------- 3 files changed, 24 insertions(+), 17 deletions(-) --- a/include/linux/kasan.h~kasan-move-and-hide-kasan_save_enable-restore_multi_shot +++ a/include/linux/kasan.h @@ -267,10 +267,6 @@ static __always_inline bool kasan_check_ return true; } - -bool kasan_save_enable_multi_shot(void); -void kasan_restore_multi_shot(bool enabled); - #else /* CONFIG_KASAN */ static inline slab_flags_t kasan_never_merge(void) --- a/mm/kasan/kasan.h~kasan-move-and-hide-kasan_save_enable-restore_multi_shot +++ a/mm/kasan/kasan.h @@ -492,6 +492,13 @@ static inline bool kasan_arch_is_ready(v #error kasan_arch_is_ready only works in KASAN generic outline mode! #endif +#if IS_ENABLED(CONFIG_KASAN_KUNIT_TEST) || IS_ENABLED(CONFIG_KASAN_MODULE_TEST) + +bool kasan_save_enable_multi_shot(void); +void kasan_restore_multi_shot(bool enabled); + +#endif + /* * Exported functions for interfaces called from assembly or from generated * code. Declarations here to avoid warning about missing declarations. --- a/mm/kasan/report.c~kasan-move-and-hide-kasan_save_enable-restore_multi_shot +++ a/mm/kasan/report.c @@ -64,19 +64,6 @@ static int __init early_kasan_fault(char } early_param("kasan.fault", early_kasan_fault); -bool kasan_save_enable_multi_shot(void) -{ - return test_and_set_bit(KASAN_BIT_MULTI_SHOT, &kasan_flags); -} -EXPORT_SYMBOL_GPL(kasan_save_enable_multi_shot); - -void kasan_restore_multi_shot(bool enabled) -{ - if (!enabled) - clear_bit(KASAN_BIT_MULTI_SHOT, &kasan_flags); -} -EXPORT_SYMBOL_GPL(kasan_restore_multi_shot); - static int __init kasan_set_multi_shot(char *str) { set_bit(KASAN_BIT_MULTI_SHOT, &kasan_flags); @@ -109,6 +96,23 @@ static bool report_enabled(void) return !test_and_set_bit(KASAN_BIT_REPORTED, &kasan_flags); } +#if IS_ENABLED(CONFIG_KASAN_KUNIT_TEST) || IS_ENABLED(CONFIG_KASAN_MODULE_TEST) + +bool kasan_save_enable_multi_shot(void) +{ + return test_and_set_bit(KASAN_BIT_MULTI_SHOT, &kasan_flags); +} +EXPORT_SYMBOL_GPL(kasan_save_enable_multi_shot); + +void kasan_restore_multi_shot(bool enabled) +{ + if (!enabled) + clear_bit(KASAN_BIT_MULTI_SHOT, &kasan_flags); +} +EXPORT_SYMBOL_GPL(kasan_restore_multi_shot); + +#endif + #if IS_ENABLED(CONFIG_KASAN_KUNIT_TEST) static void update_kunit_status(bool sync) { _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 094/114] kasan: disable LOCKDEP when printing reports 2022-03-25 1:07 incoming Andrew Morton ` (92 preceding siblings ...) 2022-03-25 1:13 ` [patch 093/114] kasan: move and hide kasan_save_enable/restore_multi_shot Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 095/114] mm: enable MADV_DONTNEED for hugetlb mappings Andrew Morton ` (18 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: ryabinin.a.a, glider, elver, dvyukov, andreyknvl, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Andrey Konovalov <andreyknvl@google.com> Subject: kasan: disable LOCKDEP when printing reports If LOCKDEP detects a bug while KASAN is printing a report and if panic_on_warn is set, KASAN will not be able to finish. Disable LOCKDEP while KASAN is printing a report. See https://bugzilla.kernel.org/show_bug.cgi?id=202115 for an example of the issue. Link: https://lkml.kernel.org/r/c48a2a3288200b07e1788b77365c2f02784cfeb4.1646237226.git.andreyknvl@google.com Signed-off-by: Andrey Konovalov <andreyknvl@google.com> Cc: Alexander Potapenko <glider@google.com> Cc: Andrey Ryabinin <ryabinin.a.a@gmail.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Marco Elver <elver@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 6 +++++- 1 file changed, 5 insertions(+), 1 deletion(-) --- a/mm/kasan/report.c~kasan-disable-lockdep-when-printing-reports +++ a/mm/kasan/report.c @@ -13,6 +13,7 @@ #include <linux/ftrace.h> #include <linux/init.h> #include <linux/kernel.h> +#include <linux/lockdep.h> #include <linux/mm.h> #include <linux/printk.h> #include <linux/sched.h> @@ -148,6 +149,8 @@ static void start_report(unsigned long * disable_trace_on_warning(); /* Update status of the currently running KASAN test. */ update_kunit_status(sync); + /* Do not allow LOCKDEP mangling KASAN reports. */ + lockdep_off(); /* Make sure we don't end up in loop. */ kasan_disable_current(); spin_lock_irqsave(&report_lock, *flags); @@ -160,12 +163,13 @@ static void end_report(unsigned long *fl trace_error_report_end(ERROR_DETECTOR_KASAN, (unsigned long)addr); pr_err("==================================================================\n"); - add_taint(TAINT_BAD_PAGE, LOCKDEP_NOW_UNRELIABLE); spin_unlock_irqrestore(&report_lock, *flags); if (panic_on_warn && !test_bit(KASAN_BIT_MULTI_SHOT, &kasan_flags)) panic("panic_on_warn set ...\n"); if (kasan_arg_fault == KASAN_ARG_FAULT_PANIC) panic("kasan.fault=panic set ...\n"); + add_taint(TAINT_BAD_PAGE, LOCKDEP_NOW_UNRELIABLE); + lockdep_on(); kasan_enable_current(); } _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 095/114] mm: enable MADV_DONTNEED for hugetlb mappings 2022-03-25 1:07 incoming Andrew Morton ` (93 preceding siblings ...) 2022-03-25 1:13 ` [patch 094/114] kasan: disable LOCKDEP when printing reports Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 096/114] selftests/vm: add hugetlb madvise MADV_DONTNEED MADV_REMOVE test Andrew Morton ` (17 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: skhan, rppt, peterx, naoya.horiguchi, mhocko, david, axelrasmussen, almasrymina, aarcange, mike.kravetz, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Mike Kravetz <mike.kravetz@oracle.com> Subject: mm: enable MADV_DONTNEED for hugetlb mappings Patch series "Add hugetlb MADV_DONTNEED support", v3. Userfaultfd selftests for hugetlb does not perform UFFD_EVENT_REMAP testing. However, mremap support was recently added in commit 550a7d60bd5e ("mm, hugepages: add mremap() support for hugepage backed vma"). While attempting to enable mremap support in the test, it was discovered that the mremap test indirectly depends on MADV_DONTNEED. madvise does not allow MADV_DONTNEED for hugetlb mappings. However, that is primarily due to the check in can_madv_lru_vma(). By simply removing the check and adding huge page alignment, MADV_DONTNEED can be made to work for hugetlb mappings. Do note that there is no compelling use case for adding this support. This was discussed in the RFC [1]. However, adding support makes sense as it is fairly trivial and brings hugetlb functionality more in line with 'normal' memory. After enabling support, add selftest for MADV_DONTNEED as well as MADV_REMOVE. Then update userfaultfd selftest. If new functionality is accepted, then madvise man page will be updated to indicate hugetlb is supported. It will also be updated to clarify what happens to the passed length argument. This patch (of 3): MADV_DONTNEED is currently disabled for hugetlb mappings. This certainly makes sense in shared file mappings as the pagecache maintains a reference to the page and it will never be freed. However, it could be useful to unmap and free pages in private mappings. In addition, userfaultfd minor fault users may be able to simplify code by using MADV_DONTNEED. The primary thing preventing MADV_DONTNEED from working on hugetlb mappings is a check in can_madv_lru_vma(). To allow support for hugetlb mappings create and use a new routine madvise_dontneed_free_valid_vma() that allows hugetlb mappings in this specific case. For normal mappings, madvise requires the start address be PAGE aligned and rounds up length to the next multiple of PAGE_SIZE. Do similarly for hugetlb mappings: require start address be huge page size aligned and round up length to the next multiple of huge page size. Use the new madvise_dontneed_free_valid_vma routine to check alignment and round up length/end. zap_page_range requires this alignment for hugetlb vmas otherwise we will hit BUGs. Link: https://lkml.kernel.org/r/20220215002348.128823-1-mike.kravetz@oracle.com Link: https://lkml.kernel.org/r/20220215002348.128823-2-mike.kravetz@oracle.com Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Naoya Horiguchi <naoya.horiguchi@linux.dev> Cc: David Hildenbrand <david@redhat.com> Cc: Axel Rasmussen <axelrasmussen@google.com> Cc: Mina Almasry <almasrymina@google.com> Cc: Michal Hocko <mhocko@suse.com> Cc: Peter Xu <peterx@redhat.com> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Shuah Khan <skhan@linuxfoundation.org> Cc: Mike Rapoport <rppt@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/madvise.c | 33 ++++++++++++++++++++++++++++++--- 1 file changed, 30 insertions(+), 3 deletions(-) --- a/mm/madvise.c~mm-enable-madv_dontneed-for-hugetlb-mappings +++ a/mm/madvise.c @@ -502,9 +502,14 @@ static void madvise_cold_page_range(stru tlb_end_vma(tlb, vma); } +static inline bool can_madv_lru_non_huge_vma(struct vm_area_struct *vma) +{ + return !(vma->vm_flags & (VM_LOCKED|VM_PFNMAP)); +} + static inline bool can_madv_lru_vma(struct vm_area_struct *vma) { - return !(vma->vm_flags & (VM_LOCKED|VM_HUGETLB|VM_PFNMAP)); + return can_madv_lru_non_huge_vma(vma) && !is_vm_hugetlb_page(vma); } static long madvise_cold(struct vm_area_struct *vma, @@ -777,6 +782,23 @@ static long madvise_dontneed_single_vma( return 0; } +static bool madvise_dontneed_free_valid_vma(struct vm_area_struct *vma, + unsigned long start, + unsigned long *end, + int behavior) +{ + if (!is_vm_hugetlb_page(vma)) + return can_madv_lru_non_huge_vma(vma); + + if (behavior != MADV_DONTNEED) + return false; + if (start & ~huge_page_mask(hstate_vma(vma))) + return false; + + *end = ALIGN(*end, huge_page_size(hstate_vma(vma))); + return true; +} + static long madvise_dontneed_free(struct vm_area_struct *vma, struct vm_area_struct **prev, unsigned long start, unsigned long end, @@ -785,7 +807,7 @@ static long madvise_dontneed_free(struct struct mm_struct *mm = vma->vm_mm; *prev = vma; - if (!can_madv_lru_vma(vma)) + if (!madvise_dontneed_free_valid_vma(vma, start, &end, behavior)) return -EINVAL; if (!userfaultfd_remove(vma, start, end)) { @@ -807,7 +829,12 @@ static long madvise_dontneed_free(struct */ return -ENOMEM; } - if (!can_madv_lru_vma(vma)) + /* + * Potential end adjustment for hugetlb vma is OK as + * the check below keeps end within vma. + */ + if (!madvise_dontneed_free_valid_vma(vma, start, &end, + behavior)) return -EINVAL; if (end > vma->vm_end) { /* _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 096/114] selftests/vm: add hugetlb madvise MADV_DONTNEED MADV_REMOVE test 2022-03-25 1:07 incoming Andrew Morton ` (94 preceding siblings ...) 2022-03-25 1:13 ` [patch 095/114] mm: enable MADV_DONTNEED for hugetlb mappings Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 097/114] userfaultfd/selftests: enable hugetlb remap and remove event testing Andrew Morton ` (16 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: skhan, rppt, peterx, naoya.horiguchi, mhocko, david, axelrasmussen, almasrymina, aarcange, mike.kravetz, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Mike Kravetz <mike.kravetz@oracle.com> Subject: selftests/vm: add hugetlb madvise MADV_DONTNEED MADV_REMOVE test Now that MADV_DONTNEED support for hugetlb is enabled, add corresponding tests. MADV_REMOVE has been enabled for some time, but no tests exist so add them as well. Link: https://lkml.kernel.org/r/20220215002348.128823-3-mike.kravetz@oracle.com Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com> Reviewed-by: Shuah Khan <skhan@linuxfoundation.org> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Axel Rasmussen <axelrasmussen@google.com> Cc: David Hildenbrand <david@redhat.com> Cc: Michal Hocko <mhocko@suse.com> Cc: Mike Rapoport <rppt@kernel.org> Cc: Mina Almasry <almasrymina@google.com> Cc: Naoya Horiguchi <naoya.horiguchi@linux.dev> Cc: Peter Xu <peterx@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 1 tools/testing/selftests/vm/hugetlb-madvise.c | 410 +++++++++++++++++ tools/testing/selftests/vm/run_vmtests.sh | 12 4 files changed, 424 insertions(+) --- a/tools/testing/selftests/vm/.gitignore~selftests-vm-add-hugetlb-madvise-madv_dontneed-madv_remove-test +++ a/tools/testing/selftests/vm/.gitignore @@ -3,6 +3,7 @@ hugepage-mmap hugepage-mremap hugepage-shm hugepage-vmemmap +hugetlb-madvise khugepaged map_hugetlb map_populate --- /dev/null +++ a/tools/testing/selftests/vm/hugetlb-madvise.c @@ -0,0 +1,410 @@ +// SPDX-License-Identifier: GPL-2.0 +/* + * hugepage-madvise: + * + * Basic functional testing of madvise MADV_DONTNEED and MADV_REMOVE + * on hugetlb mappings. + * + * Before running this test, make sure the administrator has pre-allocated + * at least MIN_FREE_PAGES hugetlb pages and they are free. In addition, + * the test takes an argument that is the path to a file in a hugetlbfs + * filesystem. Therefore, a hugetlbfs filesystem must be mounted on some + * directory. + */ + +#include <stdlib.h> +#include <stdio.h> +#include <unistd.h> +#include <sys/mman.h> +#define __USE_GNU +#include <fcntl.h> + +#define USAGE "USAGE: %s <hugepagefile_name>\n" +#define MIN_FREE_PAGES 20 +#define NR_HUGE_PAGES 10 /* common number of pages to map/allocate */ + +#define validate_free_pages(exp_free) \ + do { \ + int fhp = get_free_hugepages(); \ + if (fhp != (exp_free)) { \ + printf("Unexpected number of free huge " \ + "pages line %d\n", __LINE__); \ + exit(1); \ + } \ + } while (0) + +unsigned long huge_page_size; +unsigned long base_page_size; + +/* + * default_huge_page_size copied from mlock2-tests.c + */ +unsigned long default_huge_page_size(void) +{ + unsigned long hps = 0; + char *line = NULL; + size_t linelen = 0; + FILE *f = fopen("/proc/meminfo", "r"); + + if (!f) + return 0; + while (getline(&line, &linelen, f) > 0) { + if (sscanf(line, "Hugepagesize: %lu kB", &hps) == 1) { + hps <<= 10; + break; + } + } + + free(line); + fclose(f); + return hps; +} + +unsigned long get_free_hugepages(void) +{ + unsigned long fhp = 0; + char *line = NULL; + size_t linelen = 0; + FILE *f = fopen("/proc/meminfo", "r"); + + if (!f) + return fhp; + while (getline(&line, &linelen, f) > 0) { + if (sscanf(line, "HugePages_Free: %lu", &fhp) == 1) + break; + } + + free(line); + fclose(f); + return fhp; +} + +void write_fault_pages(void *addr, unsigned long nr_pages) +{ + unsigned long i; + + for (i = 0; i < nr_pages; i++) + *((unsigned long *)(addr + (i * huge_page_size))) = i; +} + +void read_fault_pages(void *addr, unsigned long nr_pages) +{ + unsigned long i, tmp; + + for (i = 0; i < nr_pages; i++) + tmp += *((unsigned long *)(addr + (i * huge_page_size))); +} + +int main(int argc, char **argv) +{ + unsigned long free_hugepages; + void *addr, *addr2; + int fd; + int ret; + + if (argc != 2) { + printf(USAGE, argv[0]); + exit(1); + } + + huge_page_size = default_huge_page_size(); + if (!huge_page_size) { + printf("Unable to determine huge page size, exiting!\n"); + exit(1); + } + base_page_size = sysconf(_SC_PAGE_SIZE); + if (!huge_page_size) { + printf("Unable to determine base page size, exiting!\n"); + exit(1); + } + + free_hugepages = get_free_hugepages(); + if (free_hugepages < MIN_FREE_PAGES) { + printf("Not enough free huge pages to test, exiting!\n"); + exit(1); + } + + fd = open(argv[1], O_CREAT | O_RDWR, 0755); + if (fd < 0) { + perror("Open failed"); + exit(1); + } + + /* + * Test validity of MADV_DONTNEED addr and length arguments. mmap + * size is NR_HUGE_PAGES + 2. One page at the beginning and end of + * the mapping will be unmapped so we KNOW there is nothing mapped + * there. + */ + addr = mmap(NULL, (NR_HUGE_PAGES + 2) * huge_page_size, + PROT_READ | PROT_WRITE, + MAP_PRIVATE | MAP_ANONYMOUS | MAP_HUGETLB, + -1, 0); + if (addr == MAP_FAILED) { + perror("mmap"); + exit(1); + } + if (munmap(addr, huge_page_size) || + munmap(addr + (NR_HUGE_PAGES + 1) * huge_page_size, + huge_page_size)) { + perror("munmap"); + exit(1); + } + addr = addr + huge_page_size; + + write_fault_pages(addr, NR_HUGE_PAGES); + validate_free_pages(free_hugepages - NR_HUGE_PAGES); + + /* addr before mapping should fail */ + ret = madvise(addr - base_page_size, NR_HUGE_PAGES * huge_page_size, + MADV_DONTNEED); + if (!ret) { + printf("Unexpected success of madvise call with invalid addr line %d\n", + __LINE__); + exit(1); + } + + /* addr + length after mapping should fail */ + ret = madvise(addr, (NR_HUGE_PAGES * huge_page_size) + base_page_size, + MADV_DONTNEED); + if (!ret) { + printf("Unexpected success of madvise call with invalid length line %d\n", + __LINE__); + exit(1); + } + + (void)munmap(addr, NR_HUGE_PAGES * huge_page_size); + + /* + * Test alignment of MADV_DONTNEED addr and length arguments + */ + addr = mmap(NULL, NR_HUGE_PAGES * huge_page_size, + PROT_READ | PROT_WRITE, + MAP_PRIVATE | MAP_ANONYMOUS | MAP_HUGETLB, + -1, 0); + if (addr == MAP_FAILED) { + perror("mmap"); + exit(1); + } + write_fault_pages(addr, NR_HUGE_PAGES); + validate_free_pages(free_hugepages - NR_HUGE_PAGES); + + /* addr is not huge page size aligned and should fail */ + ret = madvise(addr + base_page_size, + NR_HUGE_PAGES * huge_page_size - base_page_size, + MADV_DONTNEED); + if (!ret) { + printf("Unexpected success of madvise call with unaligned start address %d\n", + __LINE__); + exit(1); + } + + /* addr + length should be aligned up to huge page size */ + if (madvise(addr, + ((NR_HUGE_PAGES - 1) * huge_page_size) + base_page_size, + MADV_DONTNEED)) { + perror("madvise"); + exit(1); + } + + /* should free all pages in mapping */ + validate_free_pages(free_hugepages); + + (void)munmap(addr, NR_HUGE_PAGES * huge_page_size); + + /* + * Test MADV_DONTNEED on anonymous private mapping + */ + addr = mmap(NULL, NR_HUGE_PAGES * huge_page_size, + PROT_READ | PROT_WRITE, + MAP_PRIVATE | MAP_ANONYMOUS | MAP_HUGETLB, + -1, 0); + if (addr == MAP_FAILED) { + perror("mmap"); + exit(1); + } + write_fault_pages(addr, NR_HUGE_PAGES); + validate_free_pages(free_hugepages - NR_HUGE_PAGES); + + if (madvise(addr, NR_HUGE_PAGES * huge_page_size, MADV_DONTNEED)) { + perror("madvise"); + exit(1); + } + + /* should free all pages in mapping */ + validate_free_pages(free_hugepages); + + (void)munmap(addr, NR_HUGE_PAGES * huge_page_size); + + /* + * Test MADV_DONTNEED on private mapping of hugetlb file + */ + if (fallocate(fd, 0, 0, NR_HUGE_PAGES * huge_page_size)) { + perror("fallocate"); + exit(1); + } + validate_free_pages(free_hugepages - NR_HUGE_PAGES); + + addr = mmap(NULL, NR_HUGE_PAGES * huge_page_size, + PROT_READ | PROT_WRITE, + MAP_PRIVATE, fd, 0); + if (addr == MAP_FAILED) { + perror("mmap"); + exit(1); + } + + /* read should not consume any pages */ + read_fault_pages(addr, NR_HUGE_PAGES); + validate_free_pages(free_hugepages - NR_HUGE_PAGES); + + /* madvise should not free any pages */ + if (madvise(addr, NR_HUGE_PAGES * huge_page_size, MADV_DONTNEED)) { + perror("madvise"); + exit(1); + } + validate_free_pages(free_hugepages - NR_HUGE_PAGES); + + /* writes should allocate private pages */ + write_fault_pages(addr, NR_HUGE_PAGES); + validate_free_pages(free_hugepages - (2 * NR_HUGE_PAGES)); + + /* madvise should free private pages */ + if (madvise(addr, NR_HUGE_PAGES * huge_page_size, MADV_DONTNEED)) { + perror("madvise"); + exit(1); + } + validate_free_pages(free_hugepages - NR_HUGE_PAGES); + + /* writes should allocate private pages */ + write_fault_pages(addr, NR_HUGE_PAGES); + validate_free_pages(free_hugepages - (2 * NR_HUGE_PAGES)); + + /* + * The fallocate below certainly should free the pages associated + * with the file. However, pages in the private mapping are also + * freed. This is not the 'correct' behavior, but is expected + * because this is how it has worked since the initial hugetlb + * implementation. + */ + if (fallocate(fd, FALLOC_FL_PUNCH_HOLE | FALLOC_FL_KEEP_SIZE, + 0, NR_HUGE_PAGES * huge_page_size)) { + perror("fallocate"); + exit(1); + } + validate_free_pages(free_hugepages); + + (void)munmap(addr, NR_HUGE_PAGES * huge_page_size); + + /* + * Test MADV_DONTNEED on shared mapping of hugetlb file + */ + if (fallocate(fd, 0, 0, NR_HUGE_PAGES * huge_page_size)) { + perror("fallocate"); + exit(1); + } + validate_free_pages(free_hugepages - NR_HUGE_PAGES); + + addr = mmap(NULL, NR_HUGE_PAGES * huge_page_size, + PROT_READ | PROT_WRITE, + MAP_SHARED, fd, 0); + if (addr == MAP_FAILED) { + perror("mmap"); + exit(1); + } + + /* write should not consume any pages */ + write_fault_pages(addr, NR_HUGE_PAGES); + validate_free_pages(free_hugepages - NR_HUGE_PAGES); + + /* madvise should not free any pages */ + if (madvise(addr, NR_HUGE_PAGES * huge_page_size, MADV_DONTNEED)) { + perror("madvise"); + exit(1); + } + validate_free_pages(free_hugepages - NR_HUGE_PAGES); + + /* + * Test MADV_REMOVE on shared mapping of hugetlb file + * + * madvise is same as hole punch and should free all pages. + */ + if (madvise(addr, NR_HUGE_PAGES * huge_page_size, MADV_REMOVE)) { + perror("madvise"); + exit(1); + } + validate_free_pages(free_hugepages); + (void)munmap(addr, NR_HUGE_PAGES * huge_page_size); + + /* + * Test MADV_REMOVE on shared and private mapping of hugetlb file + */ + if (fallocate(fd, 0, 0, NR_HUGE_PAGES * huge_page_size)) { + perror("fallocate"); + exit(1); + } + validate_free_pages(free_hugepages - NR_HUGE_PAGES); + + addr = mmap(NULL, NR_HUGE_PAGES * huge_page_size, + PROT_READ | PROT_WRITE, + MAP_SHARED, fd, 0); + if (addr == MAP_FAILED) { + perror("mmap"); + exit(1); + } + + /* shared write should not consume any additional pages */ + write_fault_pages(addr, NR_HUGE_PAGES); + validate_free_pages(free_hugepages - NR_HUGE_PAGES); + + addr2 = mmap(NULL, NR_HUGE_PAGES * huge_page_size, + PROT_READ | PROT_WRITE, + MAP_PRIVATE, fd, 0); + if (addr2 == MAP_FAILED) { + perror("mmap"); + exit(1); + } + + /* private read should not consume any pages */ + read_fault_pages(addr2, NR_HUGE_PAGES); + validate_free_pages(free_hugepages - NR_HUGE_PAGES); + + /* private write should consume additional pages */ + write_fault_pages(addr2, NR_HUGE_PAGES); + validate_free_pages(free_hugepages - (2 * NR_HUGE_PAGES)); + + /* madvise of shared mapping should not free any pages */ + if (madvise(addr, NR_HUGE_PAGES * huge_page_size, MADV_DONTNEED)) { + perror("madvise"); + exit(1); + } + validate_free_pages(free_hugepages - (2 * NR_HUGE_PAGES)); + + /* madvise of private mapping should free private pages */ + if (madvise(addr2, NR_HUGE_PAGES * huge_page_size, MADV_DONTNEED)) { + perror("madvise"); + exit(1); + } + validate_free_pages(free_hugepages - NR_HUGE_PAGES); + + /* private write should consume additional pages again */ + write_fault_pages(addr2, NR_HUGE_PAGES); + validate_free_pages(free_hugepages - (2 * NR_HUGE_PAGES)); + + /* + * madvise should free both file and private pages although this is + * not correct. private pages should not be freed, but this is + * expected. See comment associated with FALLOC_FL_PUNCH_HOLE call. + */ + if (madvise(addr, NR_HUGE_PAGES * huge_page_size, MADV_REMOVE)) { + perror("madvise"); + exit(1); + } + validate_free_pages(free_hugepages); + + (void)munmap(addr, NR_HUGE_PAGES * huge_page_size); + (void)munmap(addr2, NR_HUGE_PAGES * huge_page_size); + + close(fd); + unlink(argv[1]); + return 0; +} --- a/tools/testing/selftests/vm/Makefile~selftests-vm-add-hugetlb-madvise-madv_dontneed-madv_remove-test +++ a/tools/testing/selftests/vm/Makefile @@ -30,6 +30,7 @@ LDLIBS = -lrt -lpthread TEST_GEN_FILES = compaction_test TEST_GEN_FILES += gup_test TEST_GEN_FILES += hmm-tests +TEST_GEN_FILES += hugetlb-madvise TEST_GEN_FILES += hugepage-mmap TEST_GEN_FILES += hugepage-mremap TEST_GEN_FILES += hugepage-shm --- a/tools/testing/selftests/vm/run_vmtests.sh~selftests-vm-add-hugetlb-madvise-madv_dontneed-madv_remove-test +++ a/tools/testing/selftests/vm/run_vmtests.sh @@ -131,6 +131,18 @@ else echo "[PASS]" fi +echo "-----------------------" +echo "running hugetlb-madvise" +echo "-----------------------" +./hugetlb-madvise $mnt/madvise-test +if [ $? -ne 0 ]; then + echo "[FAIL]" + exitcode=1 +else + echo "[PASS]" +fi +rm -f $mnt/madvise-test + echo "NOTE: The above hugetlb tests provide minimal coverage. Use" echo " https://github.com/libhugetlbfs/libhugetlbfs.git for" echo " hugetlb regression testing." _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 097/114] userfaultfd/selftests: enable hugetlb remap and remove event testing 2022-03-25 1:07 incoming Andrew Morton ` (95 preceding siblings ...) 2022-03-25 1:13 ` [patch 096/114] selftests/vm: add hugetlb madvise MADV_DONTNEED MADV_REMOVE test Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 098/114] mm/huge_memory: make is_transparent_hugepage() static Andrew Morton ` (15 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: skhan, rppt, peterx, naoya.horiguchi, mhocko, david, axelrasmussen, almasrymina, aarcange, mike.kravetz, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Mike Kravetz <mike.kravetz@oracle.com> Subject: userfaultfd/selftests: enable hugetlb remap and remove event testing With MADV_DONTNEED support added to hugetlb mappings, mremap testing can also be enabled for hugetlb. Modify the tests to use madvise MADV_DONTNEED and MADV_REMOVE instead of fallocate hole puch for releasing hugetlb pages. Link: https://lkml.kernel.org/r/20220215002348.128823-4-mike.kravetz@oracle.com Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com> Reviewed-by: Axel Rasmussen <axelrasmussen@google.com> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: David Hildenbrand <david@redhat.com> Cc: Michal Hocko <mhocko@suse.com> Cc: Mike Rapoport <rppt@kernel.org> Cc: Mina Almasry <almasrymina@google.com> Cc: Naoya Horiguchi <naoya.horiguchi@linux.dev> Cc: Peter Xu <peterx@redhat.com> Cc: Shuah Khan <skhan@linuxfoundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/testing/selftests/vm/run_vmtests.sh | 3 tools/testing/selftests/vm/userfaultfd.c | 69 ++++++++++---------- 2 files changed, 36 insertions(+), 36 deletions(-) --- a/tools/testing/selftests/vm/run_vmtests.sh~userfaultfd-selftests-enable-hugetlb-remap-and-remove-event-testing +++ a/tools/testing/selftests/vm/run_vmtests.sh @@ -208,14 +208,13 @@ echo "running userfaultfd_hugetlb" echo "---------------------------" # Test requires source and destination huge pages. Size of source # (half_ufd_size_MB) is passed as argument to test. -./userfaultfd hugetlb $half_ufd_size_MB 32 $mnt/ufd_test_file +./userfaultfd hugetlb $half_ufd_size_MB 32 if [ $? -ne 0 ]; then echo "[FAIL]" exitcode=1 else echo "[PASS]" fi -rm -f $mnt/ufd_test_file echo "-------------------------" echo "running userfaultfd_shmem" --- a/tools/testing/selftests/vm/userfaultfd.c~userfaultfd-selftests-enable-hugetlb-remap-and-remove-event-testing +++ a/tools/testing/selftests/vm/userfaultfd.c @@ -89,7 +89,6 @@ static bool test_uffdio_minor = false; static bool map_shared; static int shm_fd; static int huge_fd; -static char *huge_fd_off0; static unsigned long long *count_verify; static int uffd = -1; static int uffd_flags, finished, *pipefd; @@ -128,9 +127,9 @@ const char *examples = "./userfaultfd anon 100 99999\n\n" "# Run share memory test on 1GiB region with 99 bounces:\n" "./userfaultfd shmem 1000 99\n\n" - "# Run hugetlb memory test on 256MiB region with 50 bounces (using /dev/hugepages/hugefile):\n" - "./userfaultfd hugetlb 256 50 /dev/hugepages/hugefile\n\n" - "# Run the same hugetlb test but using shmem:\n" + "# Run hugetlb memory test on 256MiB region with 50 bounces:\n" + "./userfaultfd hugetlb 256 50\n\n" + "# Run the same hugetlb test but using shared file:\n" "./userfaultfd hugetlb_shared 256 50 /dev/hugepages/hugefile\n\n" "# 10MiB-~6GiB 999 bounces anonymous test, " "continue forever unless an error triggers\n" @@ -227,10 +226,13 @@ static void noop_alias_mapping(__u64 *st static void hugetlb_release_pages(char *rel_area) { - if (fallocate(huge_fd, FALLOC_FL_PUNCH_HOLE | FALLOC_FL_KEEP_SIZE, - rel_area == huge_fd_off0 ? 0 : nr_pages * page_size, - nr_pages * page_size)) - err("fallocate() failed"); + if (!map_shared) { + if (madvise(rel_area, nr_pages * page_size, MADV_DONTNEED)) + err("madvise(MADV_DONTNEED) failed"); + } else { + if (madvise(rel_area, nr_pages * page_size, MADV_REMOVE)) + err("madvise(MADV_REMOVE) failed"); + } } static void hugetlb_allocate_area(void **alloc_area) @@ -238,26 +240,37 @@ static void hugetlb_allocate_area(void * void *area_alias = NULL; char **alloc_area_alias; - *alloc_area = mmap(NULL, nr_pages * page_size, PROT_READ | PROT_WRITE, - (map_shared ? MAP_SHARED : MAP_PRIVATE) | - MAP_HUGETLB | - (*alloc_area == area_src ? 0 : MAP_NORESERVE), - huge_fd, *alloc_area == area_src ? 0 : - nr_pages * page_size); + if (!map_shared) + *alloc_area = mmap(NULL, + nr_pages * page_size, + PROT_READ | PROT_WRITE, + MAP_PRIVATE | MAP_ANONYMOUS | MAP_HUGETLB | + (*alloc_area == area_src ? 0 : MAP_NORESERVE), + -1, + 0); + else + *alloc_area = mmap(NULL, + nr_pages * page_size, + PROT_READ | PROT_WRITE, + MAP_SHARED | + (*alloc_area == area_src ? 0 : MAP_NORESERVE), + huge_fd, + *alloc_area == area_src ? 0 : nr_pages * page_size); if (*alloc_area == MAP_FAILED) err("mmap of hugetlbfs file failed"); if (map_shared) { - area_alias = mmap(NULL, nr_pages * page_size, PROT_READ | PROT_WRITE, - MAP_SHARED | MAP_HUGETLB, - huge_fd, *alloc_area == area_src ? 0 : - nr_pages * page_size); + area_alias = mmap(NULL, + nr_pages * page_size, + PROT_READ | PROT_WRITE, + MAP_SHARED, + huge_fd, + *alloc_area == area_src ? 0 : nr_pages * page_size); if (area_alias == MAP_FAILED) err("mmap of hugetlb file alias failed"); } if (*alloc_area == area_src) { - huge_fd_off0 = *alloc_area; alloc_area_alias = &area_src_alias; } else { alloc_area_alias = &area_dst_alias; @@ -270,12 +283,7 @@ static void hugetlb_alias_mapping(__u64 { if (!map_shared) return; - /* - * We can't zap just the pagetable with hugetlbfs because - * MADV_DONTEED won't work. So exercise -EEXIST on a alias - * mapping where the pagetables are not established initially, - * this way we'll exercise the -EEXEC at the fs level. - */ + *start = (unsigned long) area_dst_alias + offset; } @@ -428,7 +436,6 @@ static void uffd_test_ctx_clear(void) uffd = -1; } - huge_fd_off0 = NULL; munmap_area((void **)&area_src); munmap_area((void **)&area_src_alias); munmap_area((void **)&area_dst); @@ -926,10 +933,7 @@ static int faulting_process(int signal_t struct sigaction act; unsigned long signalled = 0; - if (test_type != TEST_HUGETLB) - split_nr_pages = (nr_pages + 1) / 2; - else - split_nr_pages = nr_pages; + split_nr_pages = (nr_pages + 1) / 2; if (signal_test) { sigbuf = &jbuf; @@ -986,9 +990,6 @@ static int faulting_process(int signal_t if (signal_test) return signalled != split_nr_pages; - if (test_type == TEST_HUGETLB) - return 0; - area_dst = mremap(area_dst, nr_pages * page_size, nr_pages * page_size, MREMAP_MAYMOVE | MREMAP_FIXED, area_src); if (area_dst == MAP_FAILED) @@ -1676,7 +1677,7 @@ int main(int argc, char **argv) } nr_pages = nr_pages_per_cpu * nr_cpus; - if (test_type == TEST_HUGETLB) { + if (test_type == TEST_HUGETLB && map_shared) { if (argc < 5) usage(); huge_fd = open(argv[4], O_CREAT | O_RDWR, 0755); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 098/114] mm/huge_memory: make is_transparent_hugepage() static 2022-03-25 1:07 incoming Andrew Morton ` (96 preceding siblings ...) 2022-03-25 1:13 ` [patch 097/114] userfaultfd/selftests: enable hugetlb remap and remove event testing Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 099/114] mm: optimize do_wp_page() for exclusive pages in the swapcache Andrew Morton ` (14 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: willy, william.kucharski, songmuchun, shy828301, peterx, hughd, linmiaohe, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/huge_memory: make is_transparent_hugepage() static It's only used inside the huge_memory.c now. Don't export it and make it static. We can thus reduce the size of huge_memory.o a bit. Without this patch: text data bss dec hex filename 32319 2965 4 35288 89d8 mm/huge_memory.o With this patch: text data bss dec hex filename 32042 2957 4 35003 88bb mm/huge_memory.o Link: https://lkml.kernel.org/r/20220302082145.12028-1-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Muchun Song <songmuchun@bytedance.com> Reviewed-by: Yang Shi <shy828301@gmail.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: William Kucharski <william.kucharski@oracle.com> Cc: Hugh Dickins <hughd@google.com> Cc: Peter Xu <peterx@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/huge_mm.h | 6 ------ mm/huge_memory.c | 3 +-- 2 files changed, 1 insertion(+), 8 deletions(-) --- a/include/linux/huge_mm.h~mm-huge_memory-make-is_transparent_hugepage-static +++ a/include/linux/huge_mm.h @@ -183,7 +183,6 @@ unsigned long thp_get_unmapped_area(stru void prep_transhuge_page(struct page *page); void free_transhuge_page(struct page *page); -bool is_transparent_hugepage(struct page *page); bool can_split_folio(struct folio *folio, int *pextra_pins); int split_huge_page_to_list(struct page *page, struct list_head *list); @@ -341,11 +340,6 @@ static inline bool transhuge_vma_enabled static inline void prep_transhuge_page(struct page *page) {} -static inline bool is_transparent_hugepage(struct page *page) -{ - return false; -} - #define transparent_hugepage_flags 0UL #define thp_get_unmapped_area NULL --- a/mm/huge_memory.c~mm-huge_memory-make-is_transparent_hugepage-static +++ a/mm/huge_memory.c @@ -533,7 +533,7 @@ void prep_transhuge_page(struct page *pa set_compound_page_dtor(page, TRANSHUGE_PAGE_DTOR); } -bool is_transparent_hugepage(struct page *page) +static inline bool is_transparent_hugepage(struct page *page) { if (!PageCompound(page)) return false; @@ -542,7 +542,6 @@ bool is_transparent_hugepage(struct page return is_huge_zero_page(page) || page[1].compound_dtor == TRANSHUGE_PAGE_DTOR; } -EXPORT_SYMBOL_GPL(is_transparent_hugepage); static unsigned long __thp_get_unmapped_area(struct file *filp, unsigned long addr, unsigned long len, _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 099/114] mm: optimize do_wp_page() for exclusive pages in the swapcache 2022-03-25 1:07 incoming Andrew Morton ` (97 preceding siblings ...) 2022-03-25 1:13 ` [patch 098/114] mm/huge_memory: make is_transparent_hugepage() static Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 100/114] mm: optimize do_wp_page() for fresh pages in local LRU pagevecs Andrew Morton ` (13 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: zhangliang5, willy, vbabka, shy828301, shakeelb, rppt, roman.gushchin, rientjes, riel, peterx, oleg, nadav.amit, mike.kravetz, mhocko, kirill.shutemov, jhubbard, jgg, jannh, jack, hughd, hch, ddutile, aarcange, david, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: David Hildenbrand <david@redhat.com> Subject: mm: optimize do_wp_page() for exclusive pages in the swapcache Patch series "mm: COW fixes part 1: fix the COW security issue for THP and swap", v3. This series attempts to optimize and streamline the COW logic for ordinary anon pages and THP anon pages, fixing two remaining instances of CVE-2020-29374 in do_swap_page() and do_huge_pmd_wp_page(): information can leak from a parent process to a child process via anonymous pages shared during fork(). This issue, including other related COW issues, has been summarized in [2]: " 1. Observing Memory Modifications of Private Pages From A Child Process Long story short: process-private memory might not be as private as you think once you fork(): successive modifications of private memory regions in the parent process can still be observed by the child process, for example, by smart use of vmsplice()+munmap(). The core problem is that pinning pages readable in a child process, such as done via the vmsplice system call, can result in a child process observing memory modifications done in the parent process the child is not supposed to observe. [1] contains an excellent summary and [2] contains further details. This issue was assigned CVE-2020-29374 [9]. For this to trigger, it's required to use a fork() without subsequent exec(), for example, as used under Android zygote. Without further details about an application that forks less-privileged child processes, one cannot really say what's actually affected and what's not -- see the details section the end of this mail for a short sshd/openssh analysis. While commit 17839856fd58 ("gup: document and work around "COW can break either way" issue") fixed this issue and resulted in other problems (e.g., ptrace on pmem), commit 09854ba94c6a ("mm: do_wp_page() simplification") re-introduced part of the problem unfortunately. The original reproducer can be modified quite easily to use THP [3] and make the issue appear again on upstream kernels. I modified it to use hugetlb [4] and it triggers as well. The problem is certainly less severe with hugetlb than with THP; it merely highlights that we still have plenty of open holes we should be closing/fixing. Regarding vmsplice(), the only known workaround is to disallow the vmsplice() system call ... or disable THP and hugetlb. But who knows what else is affected (RDMA? O_DIRECT?) to achieve the same goal -- in the end, it's a more generic issue. " This security issue was first reported by Jann Horn on 27 May 2020 and it currently affects anonymous pages during swapin, anonymous THP and hugetlb. This series tackles anonymous pages during swapin and anonymous THP: * do_swap_page() for handling COW on PTEs during swapin directly * do_huge_pmd_wp_page() for handling COW on PMD-mapped THP during write faults With this series, we'll apply the same COW logic we have in do_wp_page() to all swappable anon pages: don't reuse (map writable) the page in case there are additional references (page_count() != 1). All users of reuse_swap_page() are remove, and consequently reuse_swap_page() is removed. In general, we're struggling with the following COW-related issues: (1) "missed COW": we miss to copy on write and reuse the page (map it writable) although we must copy because there are pending references from another process to this page. The result is a security issue. (2) "wrong COW": we copy on write although we wouldn't have to and shouldn't: if there are valid GUP references, they will become out of sync with the pages mapped into the page table. We fail to detect that such a page can be reused safely, especially if never more than a single process mapped the page. The result is an intra process memory corruption. (3) "unnecessary COW": we copy on write although we wouldn't have to: performance degradation and temporary increases swap+memory consumption can be the result. While this series fixes (1) for swappable anon pages, it tries to reduce reported cases of (3) first as good and easy as possible to limit the impact when streamlining. The individual patches try to describe in which cases we will run into (3). This series certainly makes (2) worse for THP, because a THP will now get PTE-mapped on write faults if there are additional references, even if there was only ever a single process involved: once PTE-mapped, we'll copy each and every subpage and won't reuse any subpage as long as the underlying compound page wasn't split. I'm working on an approach to fix (2) and improve (3): PageAnonExclusive to mark anon pages that are exclusive to a single process, allow GUP pins only on such exclusive pages, and allow turning exclusive pages shared (clearing PageAnonExclusive) only if there are no GUP pins. Anon pages with PageAnonExclusive set never have to be copied during write faults, but eventually during fork() if they cannot be turned shared. The improved reuse logic in this series will essentially also be the logic to reset PageAnonExclusive. This work will certainly take a while, but I'm planning on sharing details before having code fully ready. #1-#5 can be applied independently of the rest. #6-#9 are mostly only cleanups related to reuse_swap_page(). Notes: * For now, I'll leave hugetlb code untouched: "unnecessary COW" might easily break existing setups because hugetlb pages are a scarce resource and we could just end up having to crash the application when we run out of hugetlb pages. We have to be very careful and the security aspect with hugetlb is most certainly less relevant than for unprivileged anon pages. * Instead of lru_add_drain() we might actually just drain the lru_add list or even just remove the single page of interest from the lru_add list. This would require a new helper function, and could be added if the conditional lru_add_drain() turn out to be a problem. * I extended the test case already included in [1] to also test for the newly found do_swap_page() case. I'll send that out separately once/if this part was merged. [1] https://lkml.kernel.org/r/20211217113049.23850-1-david@redhat.com [2] https://lore.kernel.org/r/3ae33b08-d9ef-f846-56fb-645e3b9b4c66@redhat.com This patch (of 9): Liang Zhang reported [1] that the current COW logic in do_wp_page() is sub-optimal when it comes to swap+read fault+write fault of anonymous pages that have a single user, visible via a performance degradation in the redis benchmark. Something similar was previously reported [2] by Nadav with a simple reproducer. After we put an anon page into the swapcache and unmapped it from a single process, that process might read that page again and refault it read-only. If that process then writes to that page, the process is actually the exclusive user of the page, however, the COW logic in do_co_page() won't be able to reuse it due to the additional reference from the swapcache. Let's optimize for pages that have been added to the swapcache but only have an exclusive user. Try removing the swapcache reference if there is hope that we're the exclusive user. We will fail removing the swapcache reference in two scenarios: (1) There are additional swap entries referencing the page: copying instead of reusing is the right thing to do. (2) The page is under writeback: theoretically we might be able to reuse in some cases, however, we cannot remove the additional reference and will have to copy. Note that we'll only try removing the page from the swapcache when it's highly likely that we'll be the exclusive owner after removing the page from the swapache. As we're about to map that page writable and redirty it, that should not affect reclaim but is rather the right thing to do. Further, we might have additional references from the LRU pagevecs, which will force us to copy instead of being able to reuse. We'll try handling such references for some scenarios next. Concurrent writeback cannot be handled easily and we'll always have to copy. While at it, remove the superfluous page_mapcount() check: it's implicitly covered by the page_count() for ordinary anon pages. [1] https://lkml.kernel.org/r/20220113140318.11117-1-zhangliang5@huawei.com [2] https://lkml.kernel.org/r/0480D692-D9B2-429A-9A88-9BBA1331AC3A@gmail.com Link: https://lkml.kernel.org/r/20220131162940.210846-2-david@redhat.com Signed-off-by: David Hildenbrand <david@redhat.com> Reported-by: Liang Zhang <zhangliang5@huawei.com> Reported-by: Nadav Amit <nadav.amit@gmail.com> Reviewed-by: Matthew Wilcox (Oracle) <willy@infradead.org> Acked-by: Vlastimil Babka <vbabka@suse.cz> Cc: Hugh Dickins <hughd@google.com> Cc: David Rientjes <rientjes@google.com> Cc: Shakeel Butt <shakeelb@google.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Yang Shi <shy828301@gmail.com> Cc: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: Jann Horn <jannh@google.com> Cc: Michal Hocko <mhocko@kernel.org> Cc: Rik van Riel <riel@surriel.com> Cc: Roman Gushchin <roman.gushchin@linux.dev> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Peter Xu <peterx@redhat.com> Cc: Don Dutile <ddutile@redhat.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Oleg Nesterov <oleg@redhat.com> Cc: Jan Kara <jack@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memory.c | 20 ++++++++++++++------ 1 file changed, 14 insertions(+), 6 deletions(-) --- a/mm/memory.c~mm-optimize-do_wp_page-for-exclusive-pages-in-the-swapcache +++ a/mm/memory.c @@ -3287,19 +3287,27 @@ static vm_fault_t do_wp_page(struct vm_f if (PageAnon(vmf->page)) { struct page *page = vmf->page; - /* PageKsm() doesn't necessarily raise the page refcount */ - if (PageKsm(page) || page_count(page) != 1) + /* + * We have to verify under page lock: these early checks are + * just an optimization to avoid locking the page and freeing + * the swapcache if there is little hope that we can reuse. + * + * PageKsm() doesn't necessarily raise the page refcount. + */ + if (PageKsm(page) || page_count(page) > 1 + PageSwapCache(page)) goto copy; if (!trylock_page(page)) goto copy; - if (PageKsm(page) || page_mapcount(page) != 1 || page_count(page) != 1) { + if (PageSwapCache(page)) + try_to_free_swap(page); + if (PageKsm(page) || page_count(page) != 1) { unlock_page(page); goto copy; } /* - * Ok, we've got the only map reference, and the only - * page count reference, and the page is locked, - * it's dark out, and we're wearing sunglasses. Hit it. + * Ok, we've got the only page reference from our mapping + * and the page is locked, it's dark out, and we're wearing + * sunglasses. Hit it. */ unlock_page(page); wp_page_reuse(vmf); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 100/114] mm: optimize do_wp_page() for fresh pages in local LRU pagevecs 2022-03-25 1:07 incoming Andrew Morton ` (98 preceding siblings ...) 2022-03-25 1:13 ` [patch 099/114] mm: optimize do_wp_page() for exclusive pages in the swapcache Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 101/114] mm: slightly clarify KSM logic in do_swap_page() Andrew Morton ` (12 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: zhangliang5, willy, vbabka, shy828301, shakeelb, rppt, roman.gushchin, rientjes, riel, peterx, oleg, nadav.amit, mike.kravetz, mhocko, kirill.shutemov, jhubbard, jgg, jannh, jack, hughd, hch, ddutile, aarcange, david, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: David Hildenbrand <david@redhat.com> Subject: mm: optimize do_wp_page() for fresh pages in local LRU pagevecs For example, if a page just got swapped in via a read fault, the LRU pagevecs might still hold a reference to the page. If we trigger a write fault on such a page, the additional reference from the LRU pagevecs will prohibit reusing the page. Let's conditionally drain the local LRU pagevecs when we stumble over a !PageLRU() page. We cannot easily drain remote LRU pagevecs and it might not be desirable performance-wise. Consequently, this will only avoid copying in some cases. Add a simple "page_count(page) > 3" check first but keep the "page_count(page) > 1 + PageSwapCache(page)" check in place, as we want to minimize cases where we remove a page from the swapcache but won't be able to reuse it, for example, because another process has it mapped R/O, to not affect reclaim. We cannot easily handle the following cases and we will always have to copy: (1) The page is referenced in the LRU pagevecs of other CPUs. We really would have to drain the LRU pagevecs of all CPUs -- most probably copying is much cheaper. (2) The page is already PageLRU() but is getting moved between LRU lists, for example, for activation (e.g., mark_page_accessed()), deactivation (MADV_COLD), or lazyfree (MADV_FREE). We'd have to drain mostly unconditionally, which might be bad performance-wise. Most probably this won't happen too often in practice. Note that there are other reasons why an anon page might temporarily not be PageLRU(): for example, compaction and migration have to isolate LRU pages from the LRU lists first (isolate_lru_page()), moving them to temporary local lists and clearing PageLRU() and holding an additional reference on the page. In that case, we'll always copy. This change seems to be fairly effective with the reproducer [1] shared by Nadav, as long as writeback is done synchronously, for example, using zram. However, with asynchronous writeback, we'll usually fail to free the swapcache because the page is still under writeback: something we cannot easily optimize for, and maybe it's not really relevant in practice. [1] https://lkml.kernel.org/r/0480D692-D9B2-429A-9A88-9BBA1331AC3A@gmail.com Link: https://lkml.kernel.org/r/20220131162940.210846-3-david@redhat.com Signed-off-by: David Hildenbrand <david@redhat.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Christoph Hellwig <hch@lst.de> Cc: David Rientjes <rientjes@google.com> Cc: Don Dutile <ddutile@redhat.com> Cc: Hugh Dickins <hughd@google.com> Cc: Jan Kara <jack@suse.cz> Cc: Jann Horn <jannh@google.com> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: Liang Zhang <zhangliang5@huawei.com> Cc: Matthew Wilcox (Oracle) <willy@infradead.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Nadav Amit <nadav.amit@gmail.com> Cc: Oleg Nesterov <oleg@redhat.com> Cc: Peter Xu <peterx@redhat.com> Cc: Rik van Riel <riel@surriel.com> Cc: Roman Gushchin <roman.gushchin@linux.dev> Cc: Shakeel Butt <shakeelb@google.com> Cc: Yang Shi <shy828301@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memory.c | 10 +++++++++- 1 file changed, 9 insertions(+), 1 deletion(-) --- a/mm/memory.c~mm-optimize-do_wp_page-for-fresh-pages-in-local-lru-pagevecs +++ a/mm/memory.c @@ -3294,7 +3294,15 @@ static vm_fault_t do_wp_page(struct vm_f * * PageKsm() doesn't necessarily raise the page refcount. */ - if (PageKsm(page) || page_count(page) > 1 + PageSwapCache(page)) + if (PageKsm(page) || page_count(page) > 3) + goto copy; + if (!PageLRU(page)) + /* + * Note: We cannot easily detect+handle references from + * remote LRU pagevecs or references to PageLRU() pages. + */ + lru_add_drain(); + if (page_count(page) > 1 + PageSwapCache(page)) goto copy; if (!trylock_page(page)) goto copy; _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 101/114] mm: slightly clarify KSM logic in do_swap_page() 2022-03-25 1:07 incoming Andrew Morton ` (99 preceding siblings ...) 2022-03-25 1:13 ` [patch 100/114] mm: optimize do_wp_page() for fresh pages in local LRU pagevecs Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 102/114] mm: streamline COW " Andrew Morton ` (11 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: zhangliang5, willy, vbabka, shy828301, shakeelb, rppt, roman.gushchin, rientjes, riel, peterx, oleg, nadav.amit, mike.kravetz, mhocko, kirill.shutemov, jhubbard, jgg, jannh, jack, hughd, hch, ddutile, aarcange, david, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: David Hildenbrand <david@redhat.com> Subject: mm: slightly clarify KSM logic in do_swap_page() Let's make it clearer that KSM might only have to copy a page in case we have a page in the swapcache, not if we allocated a fresh page and bypassed the swapcache. While at it, add a comment why this is usually necessary and merge the two swapcache conditions. [akpm@linux-foundation.org: fix comment, per David] Link: https://lkml.kernel.org/r/20220131162940.210846-4-david@redhat.com Signed-off-by: David Hildenbrand <david@redhat.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Christoph Hellwig <hch@lst.de> Cc: David Rientjes <rientjes@google.com> Cc: Don Dutile <ddutile@redhat.com> Cc: Hugh Dickins <hughd@google.com> Cc: Jan Kara <jack@suse.cz> Cc: Jann Horn <jannh@google.com> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: Liang Zhang <zhangliang5@huawei.com> Cc: Matthew Wilcox (Oracle) <willy@infradead.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Nadav Amit <nadav.amit@gmail.com> Cc: Oleg Nesterov <oleg@redhat.com> Cc: Peter Xu <peterx@redhat.com> Cc: Rik van Riel <riel@surriel.com> Cc: Roman Gushchin <roman.gushchin@linux.dev> Cc: Shakeel Butt <shakeelb@google.com> Cc: Yang Shi <shy828301@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memory.c | 36 ++++++++++++++++++++++-------------- 1 file changed, 22 insertions(+), 14 deletions(-) --- a/mm/memory.c~mm-slightly-clarify-ksm-logic-in-do_swap_page +++ a/mm/memory.c @@ -3607,21 +3607,29 @@ vm_fault_t do_swap_page(struct vm_fault goto out_release; } - /* - * Make sure try_to_free_swap or reuse_swap_page or swapoff did not - * release the swapcache from under us. The page pin, and pte_same - * test below, are not enough to exclude that. Even if it is still - * swapcache, we need to check that the page's swap has not changed. - */ - if (unlikely((!PageSwapCache(page) || - page_private(page) != entry.val)) && swapcache) - goto out_page; + if (swapcache) { + /* + * Make sure try_to_free_swap or swapoff did not release the + * swapcache from under us. The page pin, and pte_same test + * below, are not enough to exclude that. Even if it is still + * swapcache, we need to check that the page's swap has not + * changed. + */ + if (unlikely(!PageSwapCache(page) || + page_private(page) != entry.val)) + goto out_page; - page = ksm_might_need_to_copy(page, vma, vmf->address); - if (unlikely(!page)) { - ret = VM_FAULT_OOM; - page = swapcache; - goto out_page; + /* + * KSM sometimes has to copy on read faults, for example, if + * page->index of !PageKSM() pages would be nonlinear inside the + * anon VMA -- PageKSM() is lost on actual swapout. + */ + page = ksm_might_need_to_copy(page, vma, vmf->address); + if (unlikely(!page)) { + ret = VM_FAULT_OOM; + page = swapcache; + goto out_page; + } } cgroup_throttle_swaprate(page, GFP_KERNEL); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 102/114] mm: streamline COW logic in do_swap_page() 2022-03-25 1:07 incoming Andrew Morton ` (100 preceding siblings ...) 2022-03-25 1:13 ` [patch 101/114] mm: slightly clarify KSM logic in do_swap_page() Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 103/114] mm/huge_memory: streamline COW logic in do_huge_pmd_wp_page() Andrew Morton ` (10 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: zhangliang5, willy, vbabka, shy828301, shakeelb, rppt, roman.gushchin, rientjes, riel, peterx, oleg, nadav.amit, mike.kravetz, mhocko, kirill.shutemov, jhubbard, jgg, jannh, jack, hughd, hch, ddutile, aarcange, david, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: David Hildenbrand <david@redhat.com> Subject: mm: streamline COW logic in do_swap_page() Currently we have a different COW logic when: * triggering a read-fault to swapin first and then trigger a write-fault -> do_swap_page() + do_wp_page() * triggering a write-fault to swapin -> do_swap_page() + do_wp_page() only if we fail reuse in do_swap_page() The COW logic in do_swap_page() is different than our reuse logic in do_wp_page(). The COW logic in do_wp_page() -- page_count() == 1 -- makes currently sure that we certainly don't have a remaining reference, e.g., via GUP, on the target page we want to reuse: if there is any unexpected reference, we have to copy to avoid information leaks. As do_swap_page() behaves differently, in environments with swap enabled we can currently have an unintended information leak from the parent to the child, similar as known from CVE-2020-29374: 1. Parent writes to anonymous page -> Page is mapped writable and modified 2. Page is swapped out -> Page is unmapped and replaced by swap entry 3. fork() -> Swap entries are copied to child 4. Child pins page R/O -> Page is mapped R/O into child 5. Child unmaps page -> Child still holds GUP reference 6. Parent writes to page -> Page is reused in do_swap_page() -> Child can observe changes Exchanging 2. and 3. should have the same effect. Let's apply the same COW logic as in do_wp_page(), conditionally trying to remove the page from the swapcache after freeing the swap entry, however, before actually mapping our page. We can change the order now that we use try_to_free_swap(), which doesn't care about the mapcount, instead of reuse_swap_page(). To handle references from the LRU pagevecs, conditionally drain the local LRU pagevecs when required, however, don't consider the page_count() when deciding whether to drain to keep it simple for now. Link: https://lkml.kernel.org/r/20220131162940.210846-5-david@redhat.com Signed-off-by: David Hildenbrand <david@redhat.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Christoph Hellwig <hch@lst.de> Cc: David Rientjes <rientjes@google.com> Cc: Don Dutile <ddutile@redhat.com> Cc: Hugh Dickins <hughd@google.com> Cc: Jan Kara <jack@suse.cz> Cc: Jann Horn <jannh@google.com> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: Liang Zhang <zhangliang5@huawei.com> Cc: Matthew Wilcox (Oracle) <willy@infradead.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Nadav Amit <nadav.amit@gmail.com> Cc: Oleg Nesterov <oleg@redhat.com> Cc: Peter Xu <peterx@redhat.com> Cc: Rik van Riel <riel@surriel.com> Cc: Roman Gushchin <roman.gushchin@linux.dev> Cc: Shakeel Butt <shakeelb@google.com> Cc: Yang Shi <shy828301@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memory.c | 55 +++++++++++++++++++++++++++++++++++++++----------- 1 file changed, 43 insertions(+), 12 deletions(-) --- a/mm/memory.c~mm-streamline-cow-logic-in-do_swap_page +++ a/mm/memory.c @@ -3489,6 +3489,25 @@ static vm_fault_t remove_device_exclusiv return 0; } +static inline bool should_try_to_free_swap(struct page *page, + struct vm_area_struct *vma, + unsigned int fault_flags) +{ + if (!PageSwapCache(page)) + return false; + if (mem_cgroup_swap_full(page) || (vma->vm_flags & VM_LOCKED) || + PageMlocked(page)) + return true; + /* + * If we want to map a page that's in the swapcache writable, we + * have to detect via the refcount if we're really the exclusive + * user. Try freeing the swapcache to get rid of the swapcache + * reference only in case it's likely that we'll be the exlusive user. + */ + return (fault_flags & FAULT_FLAG_WRITE) && !PageKsm(page) && + page_count(page) == 2; +} + /* * We enter with non-exclusive mmap_lock (to exclude vma changes, * but allow concurrent faults), and pte mapped but not yet locked. @@ -3630,6 +3649,16 @@ vm_fault_t do_swap_page(struct vm_fault page = swapcache; goto out_page; } + + /* + * If we want to map a page that's in the swapcache writable, we + * have to detect via the refcount if we're really the exclusive + * owner. Try removing the extra reference from the local LRU + * pagevecs if required. + */ + if ((vmf->flags & FAULT_FLAG_WRITE) && page == swapcache && + !PageKsm(page) && !PageLRU(page)) + lru_add_drain(); } cgroup_throttle_swaprate(page, GFP_KERNEL); @@ -3648,19 +3677,25 @@ vm_fault_t do_swap_page(struct vm_fault } /* - * The page isn't present yet, go ahead with the fault. - * - * Be careful about the sequence of operations here. - * To get its accounting right, reuse_swap_page() must be called - * while the page is counted on swap but not yet in mapcount i.e. - * before page_add_anon_rmap() and swap_free(); try_to_free_swap() - * must be called after the swap_free(), or it will never succeed. + * Remove the swap entry and conditionally try to free up the swapcache. + * We're already holding a reference on the page but haven't mapped it + * yet. */ + swap_free(entry); + if (should_try_to_free_swap(page, vma, vmf->flags)) + try_to_free_swap(page); inc_mm_counter_fast(vma->vm_mm, MM_ANONPAGES); dec_mm_counter_fast(vma->vm_mm, MM_SWAPENTS); pte = mk_pte(page, vma->vm_page_prot); - if ((vmf->flags & FAULT_FLAG_WRITE) && reuse_swap_page(page)) { + + /* + * Same logic as in do_wp_page(); however, optimize for fresh pages + * that are certainly not shared because we just allocated them without + * exposing them to the swapcache. + */ + if ((vmf->flags & FAULT_FLAG_WRITE) && !PageKsm(page) && + (page != swapcache || page_count(page) == 1)) { pte = maybe_mkwrite(pte_mkdirty(pte), vma); vmf->flags &= ~FAULT_FLAG_WRITE; ret |= VM_FAULT_WRITE; @@ -3686,10 +3721,6 @@ vm_fault_t do_swap_page(struct vm_fault set_pte_at(vma->vm_mm, vmf->address, vmf->pte, pte); arch_do_swap_page(vma->vm_mm, vma, vmf->address, pte, vmf->orig_pte); - swap_free(entry); - if (mem_cgroup_swap_full(page) || - (vma->vm_flags & VM_LOCKED) || PageMlocked(page)) - try_to_free_swap(page); unlock_page(page); if (page != swapcache && swapcache) { /* _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 103/114] mm/huge_memory: streamline COW logic in do_huge_pmd_wp_page() 2022-03-25 1:07 incoming Andrew Morton ` (101 preceding siblings ...) 2022-03-25 1:13 ` [patch 102/114] mm: streamline COW " Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 104/114] mm/khugepaged: remove reuse_swap_page() usage Andrew Morton ` (9 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: zhangliang5, willy, vbabka, shy828301, shakeelb, rppt, roman.gushchin, rientjes, riel, peterx, oleg, nadav.amit, mike.kravetz, mhocko, kirill.shutemov, jhubbard, jgg, jannh, jack, hughd, hch, ddutile, aarcange, david, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: David Hildenbrand <david@redhat.com> Subject: mm/huge_memory: streamline COW logic in do_huge_pmd_wp_page() We currently have a different COW logic for anon THP than we have for ordinary anon pages in do_wp_page(): the effect is that the issue reported in CVE-2020-29374 is currently still possible for anon THP: an unintended information leak from the parent to the child. Let's apply the same logic (page_count() == 1), with similar optimizations to remove additional references first as we really want to avoid PTE-mapping the THP and copying individual pages best we can. If we end up with a page that has page_count() != 1, we'll have to PTE-map the THP and fallback to do_wp_page(), which will always copy the page. Note that KSM does not apply to THP. I. Interaction with the swapcache and writeback While a THP is in the swapcache, the swapcache holds one reference on each subpage of the THP. So with PageSwapCache() set, we expect as many additional references as we have subpages. If we manage to remove the THP from the swapcache, all these references will be gone. Usually, a THP is not split when entered into the swapcache and stays a compound page. However, try_to_unmap() will PTE-map the THP and use PTE swap entries. There are no PMD swap entries for that purpose, consequently, we always only swapin subpages into PTEs. Removing a page from the swapcache can fail either when there are remaining swap entries (in which case COW is the right thing to do) or if the page is currently under writeback. Having a locked, R/O PMD-mapped THP that is in the swapcache seems to be possible only in corner cases, for example, if try_to_unmap() failed after adding the page to the swapcache. However, it's comparatively easy to handle. As we have to fully unmap a THP before starting writeback, and swapin is always done on the PTE level, we shouldn't find a R/O PMD-mapped THP in the swapcache that is under writeback. This should at least leave writeback out of the picture. II. Interaction with GUP references Having a R/O PMD-mapped THP with GUP references (i.e., R/O references) will result in PTE-mapping the THP on a write fault. Similar to ordinary anon pages, do_wp_page() will have to copy sub-pages and result in a disconnect between the GUP references and the pages actually mapped into the page tables. To improve the situation in the future, we'll need additional handling to mark anonymous pages as definitely exclusive to a single process, only allow GUP pins on exclusive anon pages, and disallow sharing of exclusive anon pages with GUP pins e.g., during fork(). III. Interaction with references from LRU pagevecs There is no need to try draining the (local) LRU pagevecs in case we would stumble over a !PageLRU() page: folio_add_lru() and friends will always flush the affected pagevec after adding a compound page to it immediately -- pagevec_add_and_need_flush() always returns "true" for them. Note that the LRU pagevecs will hold a reference on the compound page for a very short time, between adding the page to the pagevec and draining it immediately afterwards. IV. Interaction with speculative/temporary references Similar to ordinary anon pages, other speculative/temporary references on the THP, for example, from the pagecache or page migration code, will disallow exclusive reuse of the page. We'll have to PTE-map the THP. Link: https://lkml.kernel.org/r/20220131162940.210846-6-david@redhat.com Signed-off-by: David Hildenbrand <david@redhat.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Christoph Hellwig <hch@lst.de> Cc: David Rientjes <rientjes@google.com> Cc: Don Dutile <ddutile@redhat.com> Cc: Hugh Dickins <hughd@google.com> Cc: Jan Kara <jack@suse.cz> Cc: Jann Horn <jannh@google.com> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: Liang Zhang <zhangliang5@huawei.com> Cc: Matthew Wilcox (Oracle) <willy@infradead.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Nadav Amit <nadav.amit@gmail.com> Cc: Oleg Nesterov <oleg@redhat.com> Cc: Peter Xu <peterx@redhat.com> Cc: Rik van Riel <riel@surriel.com> Cc: Roman Gushchin <roman.gushchin@linux.dev> Cc: Shakeel Butt <shakeelb@google.com> Cc: Yang Shi <shy828301@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/huge_memory.c | 13 +++++++++---- 1 file changed, 9 insertions(+), 4 deletions(-) --- a/mm/huge_memory.c~mm-huge_memory-streamline-cow-logic-in-do_huge_pmd_wp_page +++ a/mm/huge_memory.c @@ -1303,7 +1303,6 @@ vm_fault_t do_huge_pmd_wp_page(struct vm page = pmd_page(orig_pmd); VM_BUG_ON_PAGE(!PageHead(page), page); - /* Lock page for reuse_swap_page() */ if (!trylock_page(page)) { get_page(page); spin_unlock(vmf->ptl); @@ -1319,10 +1318,15 @@ vm_fault_t do_huge_pmd_wp_page(struct vm } /* - * We can only reuse the page if nobody else maps the huge page or it's - * part. + * See do_wp_page(): we can only map the page writable if there are + * no additional references. Note that we always drain the LRU + * pagevecs immediately after adding a THP. */ - if (reuse_swap_page(page)) { + if (page_count(page) > 1 + PageSwapCache(page) * thp_nr_pages(page)) + goto unlock_fallback; + if (PageSwapCache(page)) + try_to_free_swap(page); + if (page_count(page) == 1) { pmd_t entry; entry = pmd_mkyoung(orig_pmd); entry = maybe_pmd_mkwrite(pmd_mkdirty(entry), vma); @@ -1333,6 +1337,7 @@ vm_fault_t do_huge_pmd_wp_page(struct vm return VM_FAULT_WRITE; } +unlock_fallback: unlock_page(page); spin_unlock(vmf->ptl); fallback: _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 104/114] mm/khugepaged: remove reuse_swap_page() usage 2022-03-25 1:07 incoming Andrew Morton ` (102 preceding siblings ...) 2022-03-25 1:13 ` [patch 103/114] mm/huge_memory: streamline COW logic in do_huge_pmd_wp_page() Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 105/114] mm/swapfile: remove stale reuse_swap_page() Andrew Morton ` (8 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: zhangliang5, willy, vbabka, shy828301, shakeelb, rppt, roman.gushchin, rientjes, riel, peterx, oleg, nadav.amit, mike.kravetz, mhocko, kirill.shutemov, jhubbard, jgg, jannh, jack, hughd, hch, ddutile, aarcange, david, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: David Hildenbrand <david@redhat.com> Subject: mm/khugepaged: remove reuse_swap_page() usage reuse_swap_page() currently indicates if we can write to an anon page without COW. A COW is required if the page is shared by multiple processes (either already mapped or via swap entries) or if there is concurrent writeback that cannot tolerate concurrent page modifications. However, in the context of khugepaged we're not actually going to write to a read-only mapped page, we'll copy the page content to our newly allocated THP and map that THP writable. All we have to make sure is that the read-only mapped page we're about to copy won't get reused by another process sharing the page, otherwise, page content would get modified. But that is already guaranteed via multiple mechanisms (e.g., holding a reference, holding the page lock, removing the rmap after copying the page). The swapcache handling was introduced in commit 10359213d05a ("mm: incorporate read-only pages into transparent huge pages") and it sounds like it merely wanted to mimic what do_swap_page() would do when trying to map a page obtained via the swapcache writable. As that logic is unnecessary, let's just remove it, removing the last user of reuse_swap_page(). Link: https://lkml.kernel.org/r/20220131162940.210846-7-david@redhat.com Signed-off-by: David Hildenbrand <david@redhat.com> Reviewed-by: Yang Shi <shy828301@gmail.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Christoph Hellwig <hch@lst.de> Cc: David Rientjes <rientjes@google.com> Cc: Don Dutile <ddutile@redhat.com> Cc: Hugh Dickins <hughd@google.com> Cc: Jan Kara <jack@suse.cz> Cc: Jann Horn <jannh@google.com> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: Liang Zhang <zhangliang5@huawei.com> Cc: Matthew Wilcox (Oracle) <willy@infradead.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Nadav Amit <nadav.amit@gmail.com> Cc: Oleg Nesterov <oleg@redhat.com> Cc: Peter Xu <peterx@redhat.com> Cc: Rik van Riel <riel@surriel.com> Cc: Roman Gushchin <roman.gushchin@linux.dev> Cc: Shakeel Butt <shakeelb@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/trace/events/huge_memory.h | 1 - mm/khugepaged.c | 11 ----------- 2 files changed, 12 deletions(-) --- a/include/trace/events/huge_memory.h~mm-khugepaged-remove-reuse_swap_page-usage +++ a/include/trace/events/huge_memory.h @@ -29,7 +29,6 @@ EM( SCAN_VMA_NULL, "vma_null") \ EM( SCAN_VMA_CHECK, "vma_check_failed") \ EM( SCAN_ADDRESS_RANGE, "not_suitable_address_range") \ - EM( SCAN_SWAP_CACHE_PAGE, "page_swap_cache") \ EM( SCAN_DEL_PAGE_LRU, "could_not_delete_page_from_lru")\ EM( SCAN_ALLOC_HUGE_PAGE_FAIL, "alloc_huge_page_failed") \ EM( SCAN_CGROUP_CHARGE_FAIL, "ccgroup_charge_failed") \ --- a/mm/khugepaged.c~mm-khugepaged-remove-reuse_swap_page-usage +++ a/mm/khugepaged.c @@ -46,7 +46,6 @@ enum scan_result { SCAN_VMA_NULL, SCAN_VMA_CHECK, SCAN_ADDRESS_RANGE, - SCAN_SWAP_CACHE_PAGE, SCAN_DEL_PAGE_LRU, SCAN_ALLOC_HUGE_PAGE_FAIL, SCAN_CGROUP_CHARGE_FAIL, @@ -683,16 +682,6 @@ static int __collapse_huge_page_isolate( result = SCAN_PAGE_COUNT; goto out; } - if (!pte_write(pteval) && PageSwapCache(page) && - !reuse_swap_page(page)) { - /* - * Page is in the swap cache and cannot be re-used. - * It cannot be collapsed into a THP. - */ - unlock_page(page); - result = SCAN_SWAP_CACHE_PAGE; - goto out; - } /* * Isolate the page to avoid collapsing an hugepage _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 105/114] mm/swapfile: remove stale reuse_swap_page() 2022-03-25 1:07 incoming Andrew Morton ` (103 preceding siblings ...) 2022-03-25 1:13 ` [patch 104/114] mm/khugepaged: remove reuse_swap_page() usage Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 106/114] mm/huge_memory: remove stale page_trans_huge_mapcount() Andrew Morton ` (7 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: zhangliang5, willy, vbabka, shy828301, shakeelb, rppt, roman.gushchin, rientjes, riel, peterx, oleg, nadav.amit, mike.kravetz, mhocko, kirill.shutemov, jhubbard, jgg, jannh, jack, hughd, hch, ddutile, aarcange, david, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: David Hildenbrand <david@redhat.com> Subject: mm/swapfile: remove stale reuse_swap_page() All users are gone, let's remove it. We'll let SWP_STABLE_WRITES stick around for now, as it might come in handy in the near future. Link: https://lkml.kernel.org/r/20220131162940.210846-8-david@redhat.com Signed-off-by: David Hildenbrand <david@redhat.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Christoph Hellwig <hch@lst.de> Cc: David Rientjes <rientjes@google.com> Cc: Don Dutile <ddutile@redhat.com> Cc: Hugh Dickins <hughd@google.com> Cc: Jan Kara <jack@suse.cz> Cc: Jann Horn <jannh@google.com> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: Liang Zhang <zhangliang5@huawei.com> Cc: Matthew Wilcox (Oracle) <willy@infradead.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Nadav Amit <nadav.amit@gmail.com> Cc: Oleg Nesterov <oleg@redhat.com> Cc: Peter Xu <peterx@redhat.com> Cc: Rik van Riel <riel@surriel.com> Cc: Roman Gushchin <roman.gushchin@linux.dev> Cc: Shakeel Butt <shakeelb@google.com> Cc: Yang Shi <shy828301@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/swap.h | 4 - mm/swapfile.c | 104 ----------------------------------------- 2 files changed, 108 deletions(-) --- a/include/linux/swap.h~mm-swapfile-remove-stale-reuse_swap_page +++ a/include/linux/swap.h @@ -515,7 +515,6 @@ extern int __swp_swapcount(swp_entry_t e extern int swp_swapcount(swp_entry_t entry); extern struct swap_info_struct *page_swap_info(struct page *); extern struct swap_info_struct *swp_swap_info(swp_entry_t entry); -extern bool reuse_swap_page(struct page *); extern int try_to_free_swap(struct page *); struct backing_dev_info; extern int init_swap_address_space(unsigned int type, unsigned long nr_pages); @@ -681,9 +680,6 @@ static inline int swp_swapcount(swp_entr return 0; } -#define reuse_swap_page(page) \ - (page_trans_huge_mapcount(page) == 1) - static inline int try_to_free_swap(struct page *page) { return 0; --- a/mm/swapfile.c~mm-swapfile-remove-stale-reuse_swap_page +++ a/mm/swapfile.c @@ -1167,16 +1167,6 @@ out: return NULL; } -static struct swap_info_struct *swap_info_get(swp_entry_t entry) -{ - struct swap_info_struct *p; - - p = _swap_info_get(entry); - if (p) - spin_lock(&p->lock); - return p; -} - static struct swap_info_struct *swap_info_get_cont(swp_entry_t entry, struct swap_info_struct *q) { @@ -1601,100 +1591,6 @@ static bool page_swapped(struct page *pa return false; } -static int page_trans_huge_map_swapcount(struct page *page, - int *total_swapcount) -{ - int i, map_swapcount, _total_swapcount; - unsigned long offset = 0; - struct swap_info_struct *si; - struct swap_cluster_info *ci = NULL; - unsigned char *map = NULL; - int swapcount = 0; - - /* hugetlbfs shouldn't call it */ - VM_BUG_ON_PAGE(PageHuge(page), page); - - if (!IS_ENABLED(CONFIG_THP_SWAP) || likely(!PageTransCompound(page))) { - if (PageSwapCache(page)) - swapcount = page_swapcount(page); - if (total_swapcount) - *total_swapcount = swapcount; - return swapcount + page_trans_huge_mapcount(page); - } - - page = compound_head(page); - - _total_swapcount = map_swapcount = 0; - if (PageSwapCache(page)) { - swp_entry_t entry; - - entry.val = page_private(page); - si = _swap_info_get(entry); - if (si) { - map = si->swap_map; - offset = swp_offset(entry); - } - } - if (map) - ci = lock_cluster(si, offset); - for (i = 0; i < HPAGE_PMD_NR; i++) { - int mapcount = atomic_read(&page[i]._mapcount) + 1; - if (map) { - swapcount = swap_count(map[offset + i]); - _total_swapcount += swapcount; - } - map_swapcount = max(map_swapcount, mapcount + swapcount); - } - unlock_cluster(ci); - - if (PageDoubleMap(page)) - map_swapcount -= 1; - - if (total_swapcount) - *total_swapcount = _total_swapcount; - - return map_swapcount + compound_mapcount(page); -} - -/* - * We can write to an anon page without COW if there are no other references - * to it. And as a side-effect, free up its swap: because the old content - * on disk will never be read, and seeking back there to write new content - * later would only waste time away from clustering. - */ -bool reuse_swap_page(struct page *page) -{ - int count, total_swapcount; - - VM_BUG_ON_PAGE(!PageLocked(page), page); - if (unlikely(PageKsm(page))) - return false; - count = page_trans_huge_map_swapcount(page, &total_swapcount); - if (count == 1 && PageSwapCache(page) && - (likely(!PageTransCompound(page)) || - /* The remaining swap count will be freed soon */ - total_swapcount == page_swapcount(page))) { - if (!PageWriteback(page)) { - page = compound_head(page); - delete_from_swap_cache(page); - SetPageDirty(page); - } else { - swp_entry_t entry; - struct swap_info_struct *p; - - entry.val = page_private(page); - p = swap_info_get(entry); - if (p->flags & SWP_STABLE_WRITES) { - spin_unlock(&p->lock); - return false; - } - spin_unlock(&p->lock); - } - } - - return count <= 1; -} - /* * If swap is getting full, or if there are no more mappings of this page, * then try_to_free_swap is called to free its swap space. _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 106/114] mm/huge_memory: remove stale page_trans_huge_mapcount() 2022-03-25 1:07 incoming Andrew Morton ` (104 preceding siblings ...) 2022-03-25 1:13 ` [patch 105/114] mm/swapfile: remove stale reuse_swap_page() Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 107/114] mm/huge_memory: remove stale locking logic from __split_huge_pmd() Andrew Morton ` (6 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: zhangliang5, willy, vbabka, shy828301, shakeelb, rppt, roman.gushchin, rientjes, riel, peterx, oleg, nadav.amit, mike.kravetz, mhocko, kirill.shutemov, jhubbard, jgg, jannh, jack, hughd, hch, ddutile, aarcange, david, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: David Hildenbrand <david@redhat.com> Subject: mm/huge_memory: remove stale page_trans_huge_mapcount() All users are gone, let's remove it. Link: https://lkml.kernel.org/r/20220131162940.210846-9-david@redhat.com Signed-off-by: David Hildenbrand <david@redhat.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Christoph Hellwig <hch@lst.de> Cc: David Rientjes <rientjes@google.com> Cc: Don Dutile <ddutile@redhat.com> Cc: Hugh Dickins <hughd@google.com> Cc: Jan Kara <jack@suse.cz> Cc: Jann Horn <jannh@google.com> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: Liang Zhang <zhangliang5@huawei.com> Cc: Matthew Wilcox (Oracle) <willy@infradead.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Nadav Amit <nadav.amit@gmail.com> Cc: Oleg Nesterov <oleg@redhat.com> Cc: Peter Xu <peterx@redhat.com> Cc: Rik van Riel <riel@surriel.com> Cc: Roman Gushchin <roman.gushchin@linux.dev> Cc: Shakeel Butt <shakeelb@google.com> Cc: Yang Shi <shy828301@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/mm.h | 5 ---- mm/huge_memory.c | 48 ------------------------------------------- 2 files changed, 53 deletions(-) --- a/include/linux/mm.h~mm-huge_memory-remove-stale-page_trans_huge_mapcount +++ a/include/linux/mm.h @@ -834,16 +834,11 @@ static inline int total_mapcount(struct return folio_mapcount(page_folio(page)); } -int page_trans_huge_mapcount(struct page *page); #else static inline int total_mapcount(struct page *page) { return page_mapcount(page); } -static inline int page_trans_huge_mapcount(struct page *page) -{ - return page_mapcount(page); -} #endif static inline struct page *virt_to_head_page(const void *x) --- a/mm/huge_memory.c~mm-huge_memory-remove-stale-page_trans_huge_mapcount +++ a/mm/huge_memory.c @@ -2483,54 +2483,6 @@ static void __split_huge_page(struct pag } } -/* - * This calculates accurately how many mappings a transparent hugepage - * has (unlike page_mapcount() which isn't fully accurate). This full - * accuracy is primarily needed to know if copy-on-write faults can - * reuse the page and change the mapping to read-write instead of - * copying them. At the same time this returns the total_mapcount too. - * - * The function returns the highest mapcount any one of the subpages - * has. If the return value is one, even if different processes are - * mapping different subpages of the transparent hugepage, they can - * all reuse it, because each process is reusing a different subpage. - * - * The total_mapcount is instead counting all virtual mappings of the - * subpages. If the total_mapcount is equal to "one", it tells the - * caller all mappings belong to the same "mm" and in turn the - * anon_vma of the transparent hugepage can become the vma->anon_vma - * local one as no other process may be mapping any of the subpages. - * - * It would be more accurate to replace page_mapcount() with - * page_trans_huge_mapcount(), however we only use - * page_trans_huge_mapcount() in the copy-on-write faults where we - * need full accuracy to avoid breaking page pinning, because - * page_trans_huge_mapcount() is slower than page_mapcount(). - */ -int page_trans_huge_mapcount(struct page *page) -{ - int i, ret; - - /* hugetlbfs shouldn't call it */ - VM_BUG_ON_PAGE(PageHuge(page), page); - - if (likely(!PageTransCompound(page))) - return atomic_read(&page->_mapcount) + 1; - - page = compound_head(page); - - ret = 0; - for (i = 0; i < thp_nr_pages(page); i++) { - int mapcount = atomic_read(&page[i]._mapcount) + 1; - ret = max(ret, mapcount); - } - - if (PageDoubleMap(page)) - ret -= 1; - - return ret + compound_mapcount(page); -} - /* Racy check whether the huge page can be split */ bool can_split_folio(struct folio *folio, int *pextra_pins) { _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 107/114] mm/huge_memory: remove stale locking logic from __split_huge_pmd() 2022-03-25 1:07 incoming Andrew Morton ` (105 preceding siblings ...) 2022-03-25 1:13 ` [patch 106/114] mm/huge_memory: remove stale page_trans_huge_mapcount() Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:13 ` [patch 108/114] mm: warn on deleting redirtied only if accounted Andrew Morton ` (5 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: zhangliang5, willy, vbabka, shy828301, shakeelb, rppt, roman.gushchin, rientjes, riel, peterx, oleg, nadav.amit, mike.kravetz, mhocko, kirill.shutemov, jhubbard, jgg, jannh, jack, hughd, hch, ddutile, aarcange, david, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: David Hildenbrand <david@redhat.com> Subject: mm/huge_memory: remove stale locking logic from __split_huge_pmd() Let's remove the stale logic that was required for reuse_swap_page(). [akpm@linux-foundation.org: simplification, per Yang Shi] Link: https://lkml.kernel.org/r/20220131162940.210846-10-david@redhat.com Signed-off-by: David Hildenbrand <david@redhat.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Cc: Andrea Arcangeli <aarcange@redhat.com> Cc: Christoph Hellwig <hch@lst.de> Cc: David Rientjes <rientjes@google.com> Cc: Don Dutile <ddutile@redhat.com> Cc: Hugh Dickins <hughd@google.com> Cc: Jan Kara <jack@suse.cz> Cc: Jann Horn <jannh@google.com> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: Liang Zhang <zhangliang5@huawei.com> Cc: Matthew Wilcox (Oracle) <willy@infradead.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Nadav Amit <nadav.amit@gmail.com> Cc: Oleg Nesterov <oleg@redhat.com> Cc: Peter Xu <peterx@redhat.com> Cc: Rik van Riel <riel@surriel.com> Cc: Roman Gushchin <roman.gushchin@linux.dev> Cc: Shakeel Butt <shakeelb@google.com> Cc: Yang Shi <shy828301@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/huge_memory.c | 40 ++++------------------------------------ 1 file changed, 4 insertions(+), 36 deletions(-) --- a/mm/huge_memory.c~mm-huge_memory-remove-stale-locking-logic-from-__split_huge_pmd +++ a/mm/huge_memory.c @@ -2133,8 +2133,6 @@ void __split_huge_pmd(struct vm_area_str { spinlock_t *ptl; struct mmu_notifier_range range; - bool do_unlock_folio = false; - pmd_t _pmd; mmu_notifier_range_init(&range, MMU_NOTIFY_CLEAR, 0, vma, vma->vm_mm, address & HPAGE_PMD_MASK, @@ -2153,42 +2151,12 @@ void __split_huge_pmd(struct vm_area_str goto out; } -repeat: - if (pmd_trans_huge(*pmd)) { - if (!folio) { - folio = page_folio(pmd_page(*pmd)); - /* - * An anonymous page must be locked, to ensure that a - * concurrent reuse_swap_page() sees stable mapcount; - * but reuse_swap_page() is not used on shmem or file, - * and page lock must not be taken when zap_pmd_range() - * calls __split_huge_pmd() while i_mmap_lock is held. - */ - if (folio_test_anon(folio)) { - if (unlikely(!folio_trylock(folio))) { - folio_get(folio); - _pmd = *pmd; - spin_unlock(ptl); - folio_lock(folio); - spin_lock(ptl); - if (unlikely(!pmd_same(*pmd, _pmd))) { - folio_unlock(folio); - folio_put(folio); - folio = NULL; - goto repeat; - } - folio_put(folio); - } - do_unlock_folio = true; - } - } - } else if (!(pmd_devmap(*pmd) || is_pmd_migration_entry(*pmd))) - goto out; - __split_huge_pmd_locked(vma, pmd, range.start, freeze); + if (pmd_trans_huge(*pmd) || pmd_devmap(*pmd) || + is_pmd_migration_entry(*pmd)) + __split_huge_pmd_locked(vma, pmd, range.start, freeze); + out: spin_unlock(ptl); - if (do_unlock_folio) - folio_unlock(folio); /* * No need to double call mmu_notifier->invalidate_range() callback. * They are 3 cases to consider inside __split_huge_pmd_locked(): _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 108/114] mm: warn on deleting redirtied only if accounted 2022-03-25 1:07 incoming Andrew Morton ` (106 preceding siblings ...) 2022-03-25 1:13 ` [patch 107/114] mm/huge_memory: remove stale locking logic from __split_huge_pmd() Andrew Morton @ 2022-03-25 1:13 ` Andrew Morton 2022-03-25 1:14 ` [patch 109/114] mm: unmap_mapping_range_tree() with i_mmap_rwsem shared Andrew Morton ` (4 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:13 UTC (permalink / raw) To: willy, jack, hch, hughd, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Hugh Dickins <hughd@google.com> Subject: mm: warn on deleting redirtied only if accounted filemap_unaccount_folio() has a WARN_ON_ONCE(folio_test_dirty(folio)). It is good to warn of late dirtying on a persistent filesystem, but late dirtying on tmpfs can only lose data which is expected to be thrown away; and it's a pity if that warning comes ONCE on tmpfs, then hides others which really matter. Make it conditional on mapping_cap_writeback(). Cleanup: then folio_account_cleaned() no longer needs to check that for itself, and so no longer needs to know the mapping. Link: https://lkml.kernel.org/r/b5a1106c-7226-a5c6-ad41-ad4832cae1f@google.com Signed-off-by: Hugh Dickins <hughd@google.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Jan Kara <jack@suse.de> Cc: Christoph Hellwig <hch@lst.de> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/pagemap.h | 3 +-- mm/filemap.c | 14 +++++++++----- mm/page-writeback.c | 18 ++++++++---------- 3 files changed, 18 insertions(+), 17 deletions(-) --- a/include/linux/pagemap.h~mm-warn-on-deleting-redirtied-only-if-accounted +++ a/include/linux/pagemap.h @@ -1009,8 +1009,7 @@ static inline void __set_page_dirty(stru { __folio_mark_dirty(page_folio(page), mapping, warn); } -void folio_account_cleaned(struct folio *folio, struct address_space *mapping, - struct bdi_writeback *wb); +void folio_account_cleaned(struct folio *folio, struct bdi_writeback *wb); void __folio_cancel_dirty(struct folio *folio); static inline void folio_cancel_dirty(struct folio *folio) { --- a/mm/filemap.c~mm-warn-on-deleting-redirtied-only-if-accounted +++ a/mm/filemap.c @@ -193,16 +193,20 @@ static void filemap_unaccount_folio(stru /* * At this point folio must be either written or cleaned by * truncate. Dirty folio here signals a bug and loss of - * unwritten data. + * unwritten data - on ordinary filesystems. * - * This fixes dirty accounting after removing the folio entirely + * But it's harmless on in-memory filesystems like tmpfs; and can + * occur when a driver which did get_user_pages() sets page dirty + * before putting it, while the inode is being finally evicted. + * + * Below fixes dirty accounting after removing the folio entirely * but leaves the dirty flag set: it has no effect for truncated * folio and anyway will be cleared before returning folio to * buddy allocator. */ - if (WARN_ON_ONCE(folio_test_dirty(folio))) - folio_account_cleaned(folio, mapping, - inode_to_wb(mapping->host)); + if (WARN_ON_ONCE(folio_test_dirty(folio) && + mapping_can_writeback(mapping))) + folio_account_cleaned(folio, inode_to_wb(mapping->host)); } /* --- a/mm/page-writeback.c~mm-warn-on-deleting-redirtied-only-if-accounted +++ a/mm/page-writeback.c @@ -2465,16 +2465,14 @@ static void folio_account_dirtied(struct * * Caller must hold lock_page_memcg(). */ -void folio_account_cleaned(struct folio *folio, struct address_space *mapping, - struct bdi_writeback *wb) +void folio_account_cleaned(struct folio *folio, struct bdi_writeback *wb) { - if (mapping_can_writeback(mapping)) { - long nr = folio_nr_pages(folio); - lruvec_stat_mod_folio(folio, NR_FILE_DIRTY, -nr); - zone_stat_mod_folio(folio, NR_ZONE_WRITE_PENDING, -nr); - wb_stat_mod(wb, WB_RECLAIMABLE, -nr); - task_io_account_cancelled_write(nr * PAGE_SIZE); - } + long nr = folio_nr_pages(folio); + + lruvec_stat_mod_folio(folio, NR_FILE_DIRTY, -nr); + zone_stat_mod_folio(folio, NR_ZONE_WRITE_PENDING, -nr); + wb_stat_mod(wb, WB_RECLAIMABLE, -nr); + task_io_account_cancelled_write(nr * PAGE_SIZE); } /* @@ -2683,7 +2681,7 @@ void __folio_cancel_dirty(struct folio * wb = unlocked_inode_to_wb_begin(inode, &cookie); if (folio_test_clear_dirty(folio)) - folio_account_cleaned(folio, mapping, wb); + folio_account_cleaned(folio, wb); unlocked_inode_to_wb_end(inode, &cookie); folio_memcg_unlock(folio); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 109/114] mm: unmap_mapping_range_tree() with i_mmap_rwsem shared 2022-03-25 1:07 incoming Andrew Morton ` (107 preceding siblings ...) 2022-03-25 1:13 ` [patch 108/114] mm: warn on deleting redirtied only if accounted Andrew Morton @ 2022-03-25 1:14 ` Andrew Morton 2022-03-25 1:14 ` [patch 111/114] mm: fix race between MADV_FREE reclaim and blkdev direct IO read Andrew Morton ` (3 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:14 UTC (permalink / raw) To: sashal, mike.kravetz, mgorman, kirill.shutemov, dave, hughd, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Hugh Dickins <hughd@google.com> Subject: mm: unmap_mapping_range_tree() with i_mmap_rwsem shared Revert 48ec833b7851 ("Revert "mm/memory.c: share the i_mmap_rwsem"") to reinstate c8475d144abb ("mm/memory.c: share the i_mmap_rwsem"): the unmap_mapping_range family of functions do the unmapping of user pages (ultimately via zap_page_range_single) without modifying the interval tree itself, and unmapping races are necessarily guarded by page table lock, thus the i_mmap_rwsem should be shared in unmap_mapping_pages() and unmap_mapping_folio(). Commit 48ec833b7851 was intended as a short-term measure, allowing the other shared lock changes into 3.19 final, before investigating three trinity crashes, one of which had been bisected to commit c8475d144ab: [1] https://lkml.org/lkml/2014/11/14/342 https://lore.kernel.org/lkml/5466142C.60100@oracle.com/ [2] https://lkml.org/lkml/2014/12/22/213 https://lore.kernel.org/lkml/549832E2.8060609@oracle.com/ [3] https://lkml.org/lkml/2014/12/9/741 https://lore.kernel.org/lkml/5487ACC5.1010002@oracle.com/ Two of those were Bad page states: free_pages_prepare() found PG_mlocked still set - almost certain to have been fixed by 4.4 commit b87537d9e2fe ("mm: rmap use pte lock not mmap_sem to set PageMlocked"). The NULL deref on rwsem in [2]: unclear, only happened once, not bisected to c8475d144ab. No change to the i_mmap_lock_write() around __unmap_hugepage_range_final() in unmap_single_vma(): IIRC that's a special usage, helping to serialize hugetlbfs page table sharing, not to be dabbled with lightly. No change to other uses of i_mmap_lock_write() by hugetlbfs. I am not aware of any significant gains from the concurrency allowed by this commit: it is submitted more to resolve an ancient misunderstanding. Link: https://lkml.kernel.org/r/e4a5e356-6c87-47b2-3ce8-c2a95ae84e20@google.com Signed-off-by: Hugh Dickins <hughd@google.com> Cc: "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com> Cc: Davidlohr Bueso <dave@stgolabs.net> Cc: Sasha Levin <sashal@kernel.org> Cc: Mel Gorman <mgorman@techsingularity.net> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memory.c | 8 ++++---- 1 file changed, 4 insertions(+), 4 deletions(-) --- a/mm/memory.c~mm-unmap_mapping_range_tree-with-i_mmap_rwsem-shared +++ a/mm/memory.c @@ -3388,11 +3388,11 @@ void unmap_mapping_folio(struct folio *f details.even_cows = false; details.single_folio = folio; - i_mmap_lock_write(mapping); + i_mmap_lock_read(mapping); if (unlikely(!RB_EMPTY_ROOT(&mapping->i_mmap.rb_root))) unmap_mapping_range_tree(&mapping->i_mmap, first_index, last_index, &details); - i_mmap_unlock_write(mapping); + i_mmap_unlock_read(mapping); } /** @@ -3418,11 +3418,11 @@ void unmap_mapping_pages(struct address_ if (last_index < first_index) last_index = ULONG_MAX; - i_mmap_lock_write(mapping); + i_mmap_lock_read(mapping); if (unlikely(!RB_EMPTY_ROOT(&mapping->i_mmap.rb_root))) unmap_mapping_range_tree(&mapping->i_mmap, first_index, last_index, &details); - i_mmap_unlock_write(mapping); + i_mmap_unlock_read(mapping); } EXPORT_SYMBOL_GPL(unmap_mapping_pages); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 111/114] mm: fix race between MADV_FREE reclaim and blkdev direct IO read 2022-03-25 1:07 incoming Andrew Morton ` (108 preceding siblings ...) 2022-03-25 1:14 ` [patch 109/114] mm: unmap_mapping_range_tree() with i_mmap_rwsem shared Andrew Morton @ 2022-03-25 1:14 ` Andrew Morton 2022-03-25 1:14 ` [patch 112/114] mm: madvise: MADV_DONTNEED_LOCKED Andrew Morton ` (2 subsequent siblings) 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:14 UTC (permalink / raw) To: yuzhao, ying.huang, stable, shy828301, ponnuvel.palaniyappan, minchan, matthew.ruffell, linmiaohe, jay.vosburgh, ioanna-maria.alifieraki, hch, halves, gerald.yang, gavin.guo, dongdong.tao, dan.streetman, daniel.hill, mfo, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Mauricio Faria de Oliveira <mfo@canonical.com> Subject: mm: fix race between MADV_FREE reclaim and blkdev direct IO read Problem: ======= Userspace might read the zero-page instead of actual data from a direct IO read on a block device if the buffers have been called madvise(MADV_FREE) on earlier (this is discussed below) due to a race between page reclaim on MADV_FREE and blkdev direct IO read. - Race condition: ============== During page reclaim, the MADV_FREE page check in try_to_unmap_one() checks if the page is not dirty, then discards its rmap PTE(s) (vs. remap back if the page is dirty). However, after try_to_unmap_one() returns to shrink_page_list(), it might keep the page _anyway_ if page_ref_freeze() fails (it expects exactly _one_ page reference, from the isolation for page reclaim). Well, blkdev_direct_IO() gets references for all pages, and on READ operations it only sets them dirty _later_. So, if MADV_FREE'd pages (i.e., not dirty) are used as buffers for direct IO read from block devices, and page reclaim happens during __blkdev_direct_IO[_simple]() exactly AFTER bio_iov_iter_get_pages() returns, but BEFORE the pages are set dirty, the situation happens. The direct IO read eventually completes. Now, when userspace reads the buffers, the PTE is no longer there and the page fault handler do_anonymous_page() services that with the zero-page, NOT the data! A synthetic reproducer is provided. - Page faults: =========== If page reclaim happens BEFORE bio_iov_iter_get_pages() the issue doesn't happen, because that faults-in all pages as writeable, so do_anonymous_page() sets up a new page/rmap/PTE, and that is used by direct IO. The userspace reads don't fault as the PTE is there (thus zero-page is not used/setup). But if page reclaim happens AFTER it / BEFORE setting pages dirty, the PTE is no longer there; the subsequent page faults can't help: The data-read from the block device probably won't generate faults due to DMA (no MMU) but even in the case it wouldn't use DMA, that happens on different virtual addresses (not user-mapped addresses) because `struct bio_vec` stores `struct page` to figure addresses out (which are different from user-mapped addresses) for the read. Thus userspace reads (to user-mapped addresses) still fault, then do_anonymous_page() gets another `struct page` that would address/ map to other memory than the `struct page` used by `struct bio_vec` for the read. (The original `struct page` is not available, since it wasn't freed, as page_ref_freeze() failed due to more page refs. And even if it were available, its data cannot be trusted anymore.) Solution: ======== One solution is to check for the expected page reference count in try_to_unmap_one(). There should be one reference from the isolation (that is also checked in shrink_page_list() with page_ref_freeze()) plus one or more references from page mapping(s) (put in discard: label). Further references mean that rmap/PTE cannot be unmapped/nuked. (Note: there might be more than one reference from mapping due to fork()/clone() without CLONE_VM, which use the same `struct page` for references, until the copy-on-write page gets copied.) So, additional page references (e.g., from direct IO read) now prevent the rmap/PTE from being unmapped/dropped; similarly to the page is not freed per shrink_page_list()/page_ref_freeze()). - Races and Barriers: ================== The new check in try_to_unmap_one() should be safe in races with bio_iov_iter_get_pages() in get_user_pages() fast and slow paths, as it's done under the PTE lock. The fast path doesn't take the lock, but it checks if the PTE has changed and if so, it drops the reference and leaves the page for the slow path (which does take that lock). The fast path requires synchronization w/ full memory barrier: it writes the page reference count first then it reads the PTE later, while try_to_unmap() writes PTE first then it reads page refcount. And a second barrier is needed, as the page dirty flag should not be read before the page reference count (as in __remove_mapping()). (This can be a load memory barrier only; no writes are involved.) Call stack/comments: - try_to_unmap_one() - page_vma_mapped_walk() - map_pte() # see pte_offset_map_lock(): pte_offset_map() spin_lock() - ptep_get_and_clear() # write PTE - smp_mb() # (new barrier) GUP fast path - page_ref_count() # (new check) read refcount - page_vma_mapped_walk_done() # see pte_unmap_unlock(): pte_unmap() spin_unlock() - bio_iov_iter_get_pages() - __bio_iov_iter_get_pages() - iov_iter_get_pages() - get_user_pages_fast() - internal_get_user_pages_fast() # fast path - lockless_pages_from_mm() - gup_{pgd,p4d,pud,pmd,pte}_range() ptep = pte_offset_map() # not _lock() pte = ptep_get_lockless(ptep) page = pte_page(pte) try_grab_compound_head(page) # inc refcount # (RMW/barrier # on success) if (pte_val(pte) != pte_val(*ptep)) # read PTE put_compound_head(page) # dec refcount # go slow path # slow path - __gup_longterm_unlocked() - get_user_pages_unlocked() - __get_user_pages_locked() - __get_user_pages() - follow_{page,p4d,pud,pmd}_mask() - follow_page_pte() ptep = pte_offset_map_lock() pte = *ptep page = vm_normal_page(pte) try_grab_page(page) # inc refcount pte_unmap_unlock() - Huge Pages: ========== Regarding transparent hugepages, that logic shouldn't change, as MADV_FREE (aka lazyfree) pages are PageAnon() && !PageSwapBacked() (madvise_free_pte_range() -> mark_page_lazyfree() -> lru_lazyfree_fn()) thus should reach shrink_page_list() -> split_huge_page_to_list() before try_to_unmap[_one](), so it deals with normal pages only. (And in case unlikely/TTU_SPLIT_HUGE_PMD/split_huge_pmd_address() happens, which should not or be rare, the page refcount should be greater than mapcount: the head page is referenced by tail pages. That also prevents checking the head `page` then incorrectly call page_remove_rmap(subpage) for a tail page, that isn't even in the shrink_page_list()'s page_list (an effect of split huge pmd/pmvw), as it might happen today in this unlikely scenario.) MADV_FREE'd buffers: =================== So, back to the "if MADV_FREE pages are used as buffers" note. The case is arguable, and subject to multiple interpretations. The madvise(2) manual page on the MADV_FREE advice value says: 1) 'After a successful MADV_FREE ... data will be lost when the kernel frees the pages.' 2) 'the free operation will be canceled if the caller writes into the page' / 'subsequent writes ... will succeed and then [the] kernel cannot free those dirtied pages' 3) 'If there is no subsequent write, the kernel can free the pages at any time.' Thoughts, questions, considerations... respectively: 1) Since the kernel didn't actually free the page (page_ref_freeze() failed), should the data not have been lost? (on userspace read.) 2) Should writes performed by the direct IO read be able to cancel the free operation? - Should the direct IO read be considered as 'the caller' too, as it's been requested by 'the caller'? - Should the bio technique to dirty pages on return to userspace (bio_check_pages_dirty() is called/used by __blkdev_direct_IO()) be considered in another/special way here? 3) Should an upcoming write from a previously requested direct IO read be considered as a subsequent write, so the kernel should not free the pages? (as it's known at the time of page reclaim.) And lastly: Technically, the last point would seem a reasonable consideration and balance, as the madvise(2) manual page apparently (and fairly) seem to assume that 'writes' are memory access from the userspace process (not explicitly considering writes from the kernel or its corner cases; again, fairly).. plus the kernel fix implementation for the corner case of the largely 'non-atomic write' encompassed by a direct IO read operation, is relatively simple; and it helps. Reproducer: ========== @ test.c (simplified, but works) #define _GNU_SOURCE #include <fcntl.h> #include <stdio.h> #include <unistd.h> #include <sys/mman.h> int main() { int fd, i; char *buf; fd = open(DEV, O_RDONLY | O_DIRECT); buf = mmap(NULL, BUF_SIZE, PROT_READ | PROT_WRITE, MAP_PRIVATE | MAP_ANONYMOUS, -1, 0); for (i = 0; i < BUF_SIZE; i += PAGE_SIZE) buf[i] = 1; // init to non-zero madvise(buf, BUF_SIZE, MADV_FREE); read(fd, buf, BUF_SIZE); for (i = 0; i < BUF_SIZE; i += PAGE_SIZE) printf("%p: 0x%x\n", &buf[i], buf[i]); return 0; } @ block/fops.c (formerly fs/block_dev.c) +#include <linux/swap.h> ... ... __blkdev_direct_IO[_simple](...) { ... + if (!strcmp(current->comm, "good")) + shrink_all_memory(ULONG_MAX); + ret = bio_iov_iter_get_pages(...); + + if (!strcmp(current->comm, "bad")) + shrink_all_memory(ULONG_MAX); ... } @ shell # NUM_PAGES=4 # PAGE_SIZE=$(getconf PAGE_SIZE) # yes | dd of=test.img bs=${PAGE_SIZE} count=${NUM_PAGES} # DEV=$(losetup -f --show test.img) # gcc -DDEV=\"$DEV\" \ -DBUF_SIZE=$((PAGE_SIZE * NUM_PAGES)) \ -DPAGE_SIZE=${PAGE_SIZE} \ test.c -o test # od -tx1 $DEV 0000000 79 0a 79 0a 79 0a 79 0a 79 0a 79 0a 79 0a 79 0a * 0040000 # mv test good # ./good 0x7f7c10418000: 0x79 0x7f7c10419000: 0x79 0x7f7c1041a000: 0x79 0x7f7c1041b000: 0x79 # mv good bad # ./bad 0x7fa1b8050000: 0x0 0x7fa1b8051000: 0x0 0x7fa1b8052000: 0x0 0x7fa1b8053000: 0x0 Note: the issue is consistent on v5.17-rc3, but it's intermittent with the support of MADV_FREE on v4.5 (60%-70% error; needs swap). [wrap do_direct_IO() in do_blockdev_direct_IO() @ fs/direct-io.c]. - v5.17-rc3: # for i in {1..1000}; do ./good; done \ | cut -d: -f2 | sort | uniq -c 4000 0x79 # mv good bad # for i in {1..1000}; do ./bad; done \ | cut -d: -f2 | sort | uniq -c 4000 0x0 # free | grep Swap Swap: 0 0 0 - v4.5: # for i in {1..1000}; do ./good; done \ | cut -d: -f2 | sort | uniq -c 4000 0x79 # mv good bad # for i in {1..1000}; do ./bad; done \ | cut -d: -f2 | sort | uniq -c 2702 0x0 1298 0x79 # swapoff -av swapoff /swap # for i in {1..1000}; do ./bad; done \ | cut -d: -f2 | sort | uniq -c 4000 0x79 Ceph/TCMalloc: ============= For documentation purposes, the use case driving the analysis/fix is Ceph on Ubuntu 18.04, as the TCMalloc library there still uses MADV_FREE to release unused memory to the system from the mmap'ed page heap (might be committed back/used again; it's not munmap'ed.) - PageHeap::DecommitSpan() -> TCMalloc_SystemRelease() -> madvise() - PageHeap::CommitSpan() -> TCMalloc_SystemCommit() -> do nothing. Note: TCMalloc switched back to MADV_DONTNEED a few commits after the release in Ubuntu 18.04 (google-perftools/gperftools 2.5), so the issue just 'disappeared' on Ceph on later Ubuntu releases but is still present in the kernel, and can be hit by other use cases. The observed issue seems to be the old Ceph bug #22464 [1], where checksum mismatches are observed (and instrumentation with buffer dumps shows zero-pages read from mmap'ed/MADV_FREE'd page ranges). The issue in Ceph was reasonably deemed a kernel bug (comment #50) and mostly worked around with a retry mechanism, but other parts of Ceph could still hit that (rocksdb). Anyway, it's less likely to be hit again as TCMalloc switched out of MADV_FREE by default. (Some kernel versions/reports from the Ceph bug, and relation with the MADV_FREE introduction/changes; TCMalloc versions not checked.) - 4.4 good - 4.5 (madv_free: introduction) - 4.9 bad - 4.10 good? maybe a swapless system - 4.12 (madv_free: no longer free instantly on swapless systems) - 4.13 bad [1] https://tracker.ceph.com/issues/22464 Thanks: ====== Several people contributed to analysis/discussions/tests/reproducers in the first stages when drilling down on ceph/tcmalloc/linux kernel: - Dan Hill - Dan Streetman - Dongdong Tao - Gavin Guo - Gerald Yang - Heitor Alves de Siqueira - Ioanna Alifieraki - Jay Vosburgh - Matthew Ruffell - Ponnuvel Palaniyappan Reviews, suggestions, corrections, comments: - Minchan Kim - Yu Zhao - Huang, Ying - John Hubbard - Christoph Hellwig [mfo@canonical.com: v4] Link: https://lkml.kernel.org/r/20220209202659.183418-1-mfo@canonical.comLink: https://lkml.kernel.org/r/20220131230255.789059-1-mfo@canonical.com Fixes: 802a3a92ad7a ("mm: reclaim MADV_FREE pages") Signed-off-by: Mauricio Faria de Oliveira <mfo@canonical.com> Reviewed-by: "Huang, Ying" <ying.huang@intel.com> Cc: Minchan Kim <minchan@kernel.org> Cc: Yu Zhao <yuzhao@google.com> Cc: Yang Shi <shy828301@gmail.com> Cc: Miaohe Lin <linmiaohe@huawei.com> Cc: Dan Hill <daniel.hill@canonical.com> Cc: Dan Streetman <dan.streetman@canonical.com> Cc: Dongdong Tao <dongdong.tao@canonical.com> Cc: Gavin Guo <gavin.guo@canonical.com> Cc: Gerald Yang <gerald.yang@canonical.com> Cc: Heitor Alves de Siqueira <halves@canonical.com> Cc: Ioanna Alifieraki <ioanna-maria.alifieraki@canonical.com> Cc: Jay Vosburgh <jay.vosburgh@canonical.com> Cc: Matthew Ruffell <matthew.ruffell@canonical.com> Cc: Ponnuvel Palaniyappan <ponnuvel.palaniyappan@canonical.com> Cc: <stable@vger.kernel.org> Cc: Christoph Hellwig <hch@infradead.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/rmap.c | 25 ++++++++++++++++++++++++- 1 file changed, 24 insertions(+), 1 deletion(-) --- a/mm/rmap.c~mm-fix-race-between-madv_free-reclaim-and-blkdev-direct-io-read +++ a/mm/rmap.c @@ -1588,7 +1588,30 @@ static bool try_to_unmap_one(struct foli /* MADV_FREE page check */ if (!folio_test_swapbacked(folio)) { - if (!folio_test_dirty(folio)) { + int ref_count, map_count; + + /* + * Synchronize with gup_pte_range(): + * - clear PTE; barrier; read refcount + * - inc refcount; barrier; read PTE + */ + smp_mb(); + + ref_count = folio_ref_count(folio); + map_count = folio_mapcount(folio); + + /* + * Order reads for page refcount and dirty flag + * (see comments in __remove_mapping()). + */ + smp_rmb(); + + /* + * The only page refs must be one from isolation + * plus the rmap(s) (dropped by discard:). + */ + if (ref_count == 1 + map_count && + !folio_test_dirty(folio)) { /* Invalidate as we cleared the pte */ mmu_notifier_invalidate_range(mm, address, address + PAGE_SIZE); _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 112/114] mm: madvise: MADV_DONTNEED_LOCKED 2022-03-25 1:07 incoming Andrew Morton ` (109 preceding siblings ...) 2022-03-25 1:14 ` [patch 111/114] mm: fix race between MADV_FREE reclaim and blkdev direct IO read Andrew Morton @ 2022-03-25 1:14 ` Andrew Morton 2022-03-25 1:14 ` [patch 113/114] selftests: vm: remove dependecy from internal kernel macros Andrew Morton 2022-03-25 1:14 ` [patch 114/114] selftests: kselftest framework: provide "finished" helper Andrew Morton 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:14 UTC (permalink / raw) To: vbabka, shakeelb, nadav.amit, mike.kravetz, mhocko, dgilbert, david, hannes, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Johannes Weiner <hannes@cmpxchg.org> Subject: mm: madvise: MADV_DONTNEED_LOCKED MADV_DONTNEED historically rejects mlocked ranges, but with MLOCK_ONFAULT and MCL_ONFAULT allowing to mlock without populating, there are valid use cases for depopulating locked ranges as well. Users mlock memory to protect secrets. There are allocators for secure buffers that want in-use memory generally mlocked, but cleared and invalidated memory to give up the physical pages. This could be done with explicit munlock -> mlock calls on free -> alloc of course, but that adds two unnecessary syscalls, heavy mmap_sem write locks, vma splits and re-merges - only to get rid of the backing pages. Users also mlockall(MCL_ONFAULT) to suppress sustained paging, but are okay with on-demand initial population. It seems valid to selectively free some memory during the lifetime of such a process, without having to mess with its overall policy. Why add a separate flag? Isn't this a pretty niche usecase? - MADV_DONTNEED has been bailing on locked vmas forever. It's at least conceivable that someone, somewhere is relying on mlock to protect data from perhaps broader invalidation calls. Changing this behavior now could lead to quiet data corruption. - It also clarifies expectations around MADV_FREE and maybe MADV_REMOVE. It avoids the situation where one quietly behaves different than the others. MADV_FREE_LOCKED can be added later. - The combination of mlock() and madvise() in the first place is probably niche. But where it happens, I'd say that dropping pages from a locked region once they don't contain secrets or won't page anymore is much saner than relying on mlock to protect memory from speculative or errant invalidation calls. It's just that we can't change the default behavior because of the two previous points. Given that, an explicit new flag seems to make the most sense. [hannes@cmpxchg.org: fix mips build] Link: https://lkml.kernel.org/r/20220304171912.305060-1-hannes@cmpxchg.org Signed-off-by: Johannes Weiner <hannes@cmpxchg.org> Acked-by: Michal Hocko <mhocko@suse.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Cc: Nadav Amit <nadav.amit@gmail.com> Cc: David Hildenbrand <david@redhat.com> Cc: Dr. David Alan Gilbert <dgilbert@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/alpha/include/uapi/asm/mman.h | 2 + arch/mips/include/uapi/asm/mman.h | 2 + arch/parisc/include/uapi/asm/mman.h | 2 + arch/xtensa/include/uapi/asm/mman.h | 2 + include/uapi/asm-generic/mman-common.h | 2 + mm/madvise.c | 24 +++++++++++++---------- 6 files changed, 24 insertions(+), 10 deletions(-) --- a/arch/alpha/include/uapi/asm/mman.h~mm-madvise-madv_dontneed_locked +++ a/arch/alpha/include/uapi/asm/mman.h @@ -74,6 +74,8 @@ #define MADV_POPULATE_READ 22 /* populate (prefault) page tables readable */ #define MADV_POPULATE_WRITE 23 /* populate (prefault) page tables writable */ +#define MADV_DONTNEED_LOCKED 24 /* like DONTNEED, but drop locked pages too */ + /* compatibility flags */ #define MAP_FILE 0 --- a/arch/mips/include/uapi/asm/mman.h~mm-madvise-madv_dontneed_locked +++ a/arch/mips/include/uapi/asm/mman.h @@ -101,6 +101,8 @@ #define MADV_POPULATE_READ 22 /* populate (prefault) page tables readable */ #define MADV_POPULATE_WRITE 23 /* populate (prefault) page tables writable */ +#define MADV_DONTNEED_LOCKED 24 /* like DONTNEED, but drop locked pages too */ + /* compatibility flags */ #define MAP_FILE 0 --- a/arch/parisc/include/uapi/asm/mman.h~mm-madvise-madv_dontneed_locked +++ a/arch/parisc/include/uapi/asm/mman.h @@ -55,6 +55,8 @@ #define MADV_POPULATE_READ 22 /* populate (prefault) page tables readable */ #define MADV_POPULATE_WRITE 23 /* populate (prefault) page tables writable */ +#define MADV_DONTNEED_LOCKED 24 /* like DONTNEED, but drop locked pages too */ + #define MADV_MERGEABLE 65 /* KSM may merge identical pages */ #define MADV_UNMERGEABLE 66 /* KSM may not merge identical pages */ --- a/arch/xtensa/include/uapi/asm/mman.h~mm-madvise-madv_dontneed_locked +++ a/arch/xtensa/include/uapi/asm/mman.h @@ -109,6 +109,8 @@ #define MADV_POPULATE_READ 22 /* populate (prefault) page tables readable */ #define MADV_POPULATE_WRITE 23 /* populate (prefault) page tables writable */ +#define MADV_DONTNEED_LOCKED 24 /* like DONTNEED, but drop locked pages too */ + /* compatibility flags */ #define MAP_FILE 0 --- a/include/uapi/asm-generic/mman-common.h~mm-madvise-madv_dontneed_locked +++ a/include/uapi/asm-generic/mman-common.h @@ -75,6 +75,8 @@ #define MADV_POPULATE_READ 22 /* populate (prefault) page tables readable */ #define MADV_POPULATE_WRITE 23 /* populate (prefault) page tables writable */ +#define MADV_DONTNEED_LOCKED 24 /* like DONTNEED, but drop locked pages too */ + /* compatibility flags */ #define MAP_FILE 0 --- a/mm/madvise.c~mm-madvise-madv_dontneed_locked +++ a/mm/madvise.c @@ -52,6 +52,7 @@ static int madvise_need_mmap_write(int b case MADV_REMOVE: case MADV_WILLNEED: case MADV_DONTNEED: + case MADV_DONTNEED_LOCKED: case MADV_COLD: case MADV_PAGEOUT: case MADV_FREE: @@ -502,14 +503,9 @@ static void madvise_cold_page_range(stru tlb_end_vma(tlb, vma); } -static inline bool can_madv_lru_non_huge_vma(struct vm_area_struct *vma) -{ - return !(vma->vm_flags & (VM_LOCKED|VM_PFNMAP)); -} - static inline bool can_madv_lru_vma(struct vm_area_struct *vma) { - return can_madv_lru_non_huge_vma(vma) && !is_vm_hugetlb_page(vma); + return !(vma->vm_flags & (VM_LOCKED|VM_PFNMAP|VM_HUGETLB)); } static long madvise_cold(struct vm_area_struct *vma, @@ -787,10 +783,16 @@ static bool madvise_dontneed_free_valid_ unsigned long *end, int behavior) { - if (!is_vm_hugetlb_page(vma)) - return can_madv_lru_non_huge_vma(vma); + if (!is_vm_hugetlb_page(vma)) { + unsigned int forbidden = VM_PFNMAP; + + if (behavior != MADV_DONTNEED_LOCKED) + forbidden |= VM_LOCKED; + + return !(vma->vm_flags & forbidden); + } - if (behavior != MADV_DONTNEED) + if (behavior != MADV_DONTNEED && behavior != MADV_DONTNEED_LOCKED) return false; if (start & ~huge_page_mask(hstate_vma(vma))) return false; @@ -854,7 +856,7 @@ static long madvise_dontneed_free(struct VM_WARN_ON(start >= end); } - if (behavior == MADV_DONTNEED) + if (behavior == MADV_DONTNEED || behavior == MADV_DONTNEED_LOCKED) return madvise_dontneed_single_vma(vma, start, end); else if (behavior == MADV_FREE) return madvise_free_single_vma(vma, start, end); @@ -993,6 +995,7 @@ static int madvise_vma_behavior(struct v return madvise_pageout(vma, prev, start, end); case MADV_FREE: case MADV_DONTNEED: + case MADV_DONTNEED_LOCKED: return madvise_dontneed_free(vma, prev, start, end, behavior); case MADV_POPULATE_READ: case MADV_POPULATE_WRITE: @@ -1123,6 +1126,7 @@ madvise_behavior_valid(int behavior) case MADV_REMOVE: case MADV_WILLNEED: case MADV_DONTNEED: + case MADV_DONTNEED_LOCKED: case MADV_FREE: case MADV_COLD: case MADV_PAGEOUT: _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 113/114] selftests: vm: remove dependecy from internal kernel macros 2022-03-25 1:07 incoming Andrew Morton ` (110 preceding siblings ...) 2022-03-25 1:14 ` [patch 112/114] mm: madvise: MADV_DONTNEED_LOCKED Andrew Morton @ 2022-03-25 1:14 ` Andrew Morton 2022-03-25 1:56 ` Linus Torvalds 2022-03-25 1:14 ` [patch 114/114] selftests: kselftest framework: provide "finished" helper Andrew Morton 112 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:14 UTC (permalink / raw) To: tglx, shuah, peterz, pbonzini, mingo, mic, matthieu.baerts, mathew.j.martineau, kuba, dvhart, dave, davem, chi.minghao, apopple, andrealmeid, usama.anjum, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Muhammad Usama Anjum <usama.anjum@collabora.com> Subject: selftests: vm: remove dependecy from internal kernel macros The defination of swap() is used from kernel's internal header when this test is built in source tree. The build fails when this test is built out of source tree as defination of swap() isn't found. Selftests shouldn't depend on kernel's internal header files. They can only depend on uapi header files. Add the defination of swap() to fix the build error: gcc -Wall -I/linux_mainline2/build/usr/include -no-pie userfaultfd.c -lrt -lpthread -o /linux_mainline2/build/kselftest/vm/userfaultfd userfaultfd.c: In function `userfaultfd_stress': userfaultfd.c:1530:3: warning: implicit declaration of function `swap'; did you mean `swab'? [-Wimplicit-function-declaration] 1530 | swap(area_src, area_dst); | ^~~~ | swab /usr/bin/ld: /tmp/cclUUH7V.o: in function `userfaultfd_stress': userfaultfd.c:(.text+0x4d64): undefined reference to `swap' /usr/bin/ld: userfaultfd.c:(.text+0x4d82): undefined reference to `swap' collect2: error: ld returned 1 exit status Link: https://lkml.kernel.org/r/20220119101531.2850400-11-usama.anjum@collabora.com Fixes: 2c769ed7137a ("tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner") Signed-off-by: Muhammad Usama Anjum <usama.anjum@collabora.com> Reviewed-by: Alistair Popple <apopple@nvidia.com> Cc: Andr Almeida <andrealmeid@collabora.com> Cc: Darren Hart <dvhart@infradead.org> Cc: Davidlohr Bueso <dave@stgolabs.net> Cc: "David S. Miller" <davem@davemloft.net> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jakub Kicinski <kuba@kernel.org> Cc: Mat Martineau <mathew.j.martineau@linux.intel.com> Cc: Matthieu Baerts <matthieu.baerts@tessares.net> Cc: Mickal Salan <mic@digikod.net> Cc: Minghao Chi <chi.minghao@zte.com.cn> Cc: Paolo Bonzini <pbonzini@redhat.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Shuah Khan <shuah@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/testing/selftests/vm/userfaultfd.c | 3 +++ 1 file changed, 3 insertions(+) --- a/tools/testing/selftests/vm/userfaultfd.c~selftests-vm-remove-dependecy-from-internal-kernel-macros +++ a/tools/testing/selftests/vm/userfaultfd.c @@ -122,6 +122,9 @@ struct uffd_stats { #define swap(a, b) \ do { typeof(a) __tmp = (a); (a) = (b); (b) = __tmp; } while (0) +#define swap(a, b) \ + do { typeof(a) __tmp = (a); (a) = (b); (b) = __tmp; } while (0) + const char *examples = "# Run anonymous memory test on 100MiB region with 99999 bounces:\n" "./userfaultfd anon 100 99999\n\n" _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: [patch 113/114] selftests: vm: remove dependecy from internal kernel macros 2022-03-25 1:14 ` [patch 113/114] selftests: vm: remove dependecy from internal kernel macros Andrew Morton @ 2022-03-25 1:56 ` Linus Torvalds 0 siblings, 0 replies; 322+ messages in thread From: Linus Torvalds @ 2022-03-25 1:56 UTC (permalink / raw) To: Andrew Morton Cc: Thomas Gleixner, Shuah Khan, Peter Zijlstra, Paolo Bonzini, Ingo Molnar, Mickaël Salaün, Matthieu Baerts, mathew.j.martineau, Jakub Kicinski, Darren Hart, Davidlohr Bueso, David Miller, chi.minghao, Alistair Popple, andrealmeid, usama.anjum, patches, Linux-MM, mm-commits On Thu, Mar 24, 2022 at 6:14 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > From: Muhammad Usama Anjum <usama.anjum@collabora.com> > Subject: selftests: vm: remove dependecy from internal kernel macros What what what? > --- a/tools/testing/selftests/vm/userfaultfd.c~selftests-vm-remove-dependecy-from-internal-kernel-macros > +++ a/tools/testing/selftests/vm/userfaultfd.c > @@ -122,6 +122,9 @@ struct uffd_stats { > #define swap(a, b) \ > do { typeof(a) __tmp = (a); (a) = (b); (b) = __tmp; } while (0) > > +#define swap(a, b) \ > + do { typeof(a) __tmp = (a); (a) = (b); (b) = __tmp; } while (0) > + > const char *examples = > "# Run anonymous memory test on 100MiB region with 99999 bounces:\n" > "./userfaultfd anon 100 99999\n\n" Read that patch one more time. This was already merged in commit 681696862bc1 ("selftests: vm: remove dependecy from internal kernel macros"), just how many of those 'swap()' macros do you think we need? Your patch managment logic seems to have failed the "was this already applied" thing. This smells like another "it applied with some context noise that I just ignored" thing. Please please PLEASE use "-F0" to apply patches, and if you have context that causes it to not apply cleanly, double-check what is up. (And if you are not git tool based, the *default* for git is to not ignore context. But if you have scripts that do "-C1" or something to ignore context lines, please make them warn very very loudly) Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* [patch 114/114] selftests: kselftest framework: provide "finished" helper 2022-03-25 1:07 incoming Andrew Morton ` (111 preceding siblings ...) 2022-03-25 1:14 ` [patch 113/114] selftests: vm: remove dependecy from internal kernel macros Andrew Morton @ 2022-03-25 1:14 ` Andrew Morton 112 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-25 1:14 UTC (permalink / raw) To: shuah, keescook, akpm, patches, linux-mm, mm-commits, torvalds, akpm From: Kees Cook <keescook@chromium.org> Subject: selftests: kselftest framework: provide "finished" helper Instead of having each time that wants to use ksft_exit() have to figure out the internals of kselftest.h, add the helper ksft_finished() that makes sure the passes, xfails, and skips are equal to the test plan count. Link: https://lkml.kernel.org/r/20220201013717.2464392-1-keescook@chromium.org Signed-off-by: Kees Cook <keescook@chromium.org> Cc: Shuah Khan <shuah@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/testing/selftests/kselftest.h | 10 ++++++++++ tools/testing/selftests/vm/memfd_secret.c | 2 +- 2 files changed, 11 insertions(+), 1 deletion(-) --- a/tools/testing/selftests/kselftest.h~selftests-kselftest-framework-provide-finished-helper +++ a/tools/testing/selftests/kselftest.h @@ -28,6 +28,7 @@ * * When all tests are finished, clean up and exit the program with one of: * + * ksft_finished(); * ksft_exit(condition); * ksft_exit_pass(); * ksft_exit_fail(); @@ -235,6 +236,15 @@ static inline int ksft_exit_fail(void) ksft_exit_fail(); \ } while (0) +/** + * ksft_finished() - Exit selftest with success if all tests passed + */ +#define ksft_finished() \ + ksft_exit(ksft_plan == \ + ksft_cnt.ksft_pass + \ + ksft_cnt.ksft_xfail + \ + ksft_cnt.ksft_xskip) + static inline int ksft_exit_fail_msg(const char *msg, ...) { int saved_errno = errno; --- a/tools/testing/selftests/vm/memfd_secret.c~selftests-kselftest-framework-provide-finished-helper +++ a/tools/testing/selftests/vm/memfd_secret.c @@ -282,7 +282,7 @@ int main(int argc, char *argv[]) close(fd); - ksft_exit(!ksft_get_fail_cnt()); + ksft_finished(); } #else /* __NR_memfd_secret */ _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-04-27 19:41 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-04-27 19:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 2 patches, based on d615b5416f8a1afeb82d13b238f8152c572d59c0. Subsystems affected by this patch series: mm/kasan mm/debug Subsystem: mm/kasan Zqiang <qiang1.zhang@intel.com>: kasan: prevent cpu_quarantine corruption when CPU offline and cache shrink occur at same time Subsystem: mm/debug Akira Yokosawa <akiyks@gmail.com>: docs: vm/page_owner: use literal blocks for param description Documentation/vm/page_owner.rst | 5 +++-- mm/kasan/quarantine.c | 7 +++++++ 2 files changed, 10 insertions(+), 2 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-04-21 23:35 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-04-21 23:35 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches 13 patches, based on b253435746d9a4a701b5f09211b9c14d3370d0da. Subsystems affected by this patch series: mm/memory-failure mm/memcg mm/userfaultfd mm/hugetlbfs mm/mremap mm/oom-kill mm/kasan kcov mm/hmm Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/hwpoison: fix race between hugetlb free/demotion and memory_failure_hugetlb() Xu Yu <xuyu@linux.alibaba.com>: mm/memory-failure.c: skip huge_zero_page in memory_failure() Subsystem: mm/memcg Shakeel Butt <shakeelb@google.com>: memcg: sync flush only if periodic flush is delayed Subsystem: mm/userfaultfd Nadav Amit <namit@vmware.com>: userfaultfd: mark uffd_wp regardless of VM_WRITE flag Subsystem: mm/hugetlbfs Christophe Leroy <christophe.leroy@csgroup.eu>: mm, hugetlb: allow for "high" userspace addresses Subsystem: mm/mremap Sidhartha Kumar <sidhartha.kumar@oracle.com>: selftest/vm: verify mmap addr in mremap_test selftest/vm: verify remap destination address in mremap_test selftest/vm: support xfail in mremap_test selftest/vm: add skip support to mremap_test Subsystem: mm/oom-kill Nico Pache <npache@redhat.com>: oom_kill.c: futex: delay the OOM reaper to allow time for proper futex cleanup Subsystem: mm/kasan Vincenzo Frascino <vincenzo.frascino@arm.com>: MAINTAINERS: add Vincenzo Frascino to KASAN reviewers Subsystem: kcov Aleksandr Nogikh <nogikh@google.com>: kcov: don't generate a warning on vm_insert_page()'s failure Subsystem: mm/hmm Alistair Popple <apopple@nvidia.com>: mm/mmu_notifier.c: fix race in mmu_interval_notifier_remove() MAINTAINERS | 1 fs/hugetlbfs/inode.c | 9 - include/linux/hugetlb.h | 6 + include/linux/memcontrol.h | 5 include/linux/mm.h | 8 + include/linux/sched.h | 1 include/linux/sched/mm.h | 8 + kernel/kcov.c | 7 - mm/hugetlb.c | 10 + mm/memcontrol.c | 12 ++ mm/memory-failure.c | 158 ++++++++++++++++++++++-------- mm/mmap.c | 8 - mm/mmu_notifier.c | 14 ++ mm/oom_kill.c | 54 +++++++--- mm/userfaultfd.c | 15 +- mm/workingset.c | 2 tools/testing/selftests/vm/mremap_test.c | 85 +++++++++++++++- tools/testing/selftests/vm/run_vmtests.sh | 11 +- 18 files changed, 327 insertions(+), 87 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-04-15 2:12 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-04-15 2:12 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 14 patches, based on 115acbb56978941bb7537a97dfc303da286106c1. Subsystems affected by this patch series: MAINTAINERS mm/tmpfs m/secretmem mm/kasan mm/kfence mm/pagealloc mm/zram mm/compaction mm/hugetlb binfmt mm/vmalloc mm/kmemleak Subsystem: MAINTAINERS Joe Perches <joe@perches.com>: MAINTAINERS: Broadcom internal lists aren't maintainers Subsystem: mm/tmpfs Hugh Dickins <hughd@google.com>: tmpfs: fix regressions from wider use of ZERO_PAGE Subsystem: m/secretmem Axel Rasmussen <axelrasmussen@google.com>: mm/secretmem: fix panic when growing a memfd_secret Subsystem: mm/kasan Zqiang <qiang1.zhang@intel.com>: irq_work: use kasan_record_aux_stack_noalloc() record callstack Vincenzo Frascino <vincenzo.frascino@arm.com>: kasan: fix hw tags enablement when KUNIT tests are disabled Subsystem: mm/kfence Marco Elver <elver@google.com>: mm, kfence: support kmem_dump_obj() for KFENCE objects Subsystem: mm/pagealloc Juergen Gross <jgross@suse.com>: mm, page_alloc: fix build_zonerefs_node() Subsystem: mm/zram Minchan Kim <minchan@kernel.org>: mm: fix unexpected zeroed page mapping with zram swap Subsystem: mm/compaction Charan Teja Kalla <quic_charante@quicinc.com>: mm: compaction: fix compiler warning when CONFIG_COMPACTION=n Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: do not demote poisoned hugetlb pages Subsystem: binfmt Andrew Morton <akpm@linux-foundation.org>: revert "fs/binfmt_elf: fix PT_LOAD p_align values for loaders" revert "fs/binfmt_elf: use PT_LOAD p_align values for static PIE" Subsystem: mm/vmalloc Omar Sandoval <osandov@fb.com>: mm/vmalloc: fix spinning drain_vmap_work after reading from /proc/vmcore Subsystem: mm/kmemleak Patrick Wang <patrick.wang.shcn@gmail.com>: mm: kmemleak: take a full lowmem check in kmemleak_*_phys() MAINTAINERS | 64 ++++++++++++++++++++-------------------- arch/x86/include/asm/io.h | 2 - arch/x86/kernel/crash_dump_64.c | 1 fs/binfmt_elf.c | 6 +-- include/linux/kfence.h | 24 +++++++++++++++ kernel/irq_work.c | 2 - mm/compaction.c | 10 +++--- mm/filemap.c | 6 --- mm/hugetlb.c | 17 ++++++---- mm/kasan/hw_tags.c | 5 +-- mm/kasan/kasan.h | 10 +++--- mm/kfence/core.c | 21 ------------- mm/kfence/kfence.h | 21 +++++++++++++ mm/kfence/report.c | 47 +++++++++++++++++++++++++++++ mm/kmemleak.c | 8 ++--- mm/page_alloc.c | 2 - mm/page_io.c | 54 --------------------------------- mm/secretmem.c | 17 ++++++++++ mm/shmem.c | 31 ++++++++++++------- mm/slab.c | 2 - mm/slab.h | 2 - mm/slab_common.c | 9 +++++ mm/slob.c | 2 - mm/slub.c | 2 - mm/vmalloc.c | 11 ------ 25 files changed, 207 insertions(+), 169 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-04-08 20:08 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-04-08 20:08 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 9 patches, based on d00c50b35101b862c3db270ffeba53a63a1063d9. Subsystems affected by this patch series: mm/migration mm/highmem lz4 mm/sparsemem mm/mremap mm/mempolicy mailmap mm/memcg MAINTAINERS Subsystem: mm/migration Zi Yan <ziy@nvidia.com>: mm: migrate: use thp_order instead of HPAGE_PMD_ORDER for new page allocation. Subsystem: mm/highmem Max Filippov <jcmvbkbc@gmail.com>: highmem: fix checks in __kmap_local_sched_{in,out} Subsystem: lz4 Guo Xuenan <guoxuenan@huawei.com>: lz4: fix LZ4_decompress_safe_partial read out of bound Subsystem: mm/sparsemem Waiman Long <longman@redhat.com>: mm/sparsemem: fix 'mem_section' will never be NULL gcc 12 warning Subsystem: mm/mremap Paolo Bonzini <pbonzini@redhat.com>: mmmremap.c: avoid pointless invalidate_range_start/end on mremap(old_size=0) Subsystem: mm/mempolicy Miaohe Lin <linmiaohe@huawei.com>: mm/mempolicy: fix mpol_new leak in shared_policy_replace Subsystem: mailmap Vasily Averin <vasily.averin@linux.dev>: mailmap: update Vasily Averin's email address Subsystem: mm/memcg Andrew Morton <akpm@linux-foundation.org>: mm/list_lru.c: revert "mm/list_lru: optimize memcg_reparent_list_lru_node()" Subsystem: MAINTAINERS Tom Rix <trix@redhat.com>: MAINTAINERS: add Tom as clang reviewer .mailmap | 4 ++++ MAINTAINERS | 1 + include/linux/mmzone.h | 11 +++++++---- lib/lz4/lz4_decompress.c | 8 ++++++-- mm/highmem.c | 4 ++-- mm/list_lru.c | 6 ------ mm/mempolicy.c | 3 ++- mm/migrate.c | 2 +- mm/mremap.c | 3 +++ 9 files changed, 26 insertions(+), 16 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-04-01 18:27 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-04-01 18:27 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696. Subsystems affected by this patch series: mm/madvise ofs2 nilfs2 mm/mlock mm/mfence mailmap mm/memory-failure mm/kasan mm/debug mm/kmemleak mm/damon Subsystem: mm/madvise Charan Teja Kalla <quic_charante@quicinc.com>: Revert "mm: madvise: skip unmapped vma holes passed to process_madvise" Subsystem: ofs2 Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: fix crash when mount with quota enabled Subsystem: nilfs2 Ryusuke Konishi <konishi.ryusuke@gmail.com>: Patch series "nilfs2 lockdep warning fixes": nilfs2: fix lockdep warnings in page operations for btree nodes nilfs2: fix lockdep warnings during disk space reclamation nilfs2: get rid of nilfs_mapping_init() Subsystem: mm/mlock Hugh Dickins <hughd@google.com>: mm/munlock: add lru_add_drain() to fix memcg_stat_test mm/munlock: update Documentation/vm/unevictable-lru.rst Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/munlock: protect the per-CPU pagevec by a local_lock_t Subsystem: mm/kfence Muchun Song <songmuchun@bytedance.com>: mm: kfence: fix objcgs vector allocation Subsystem: mailmap Kirill Tkhai <kirill.tkhai@openvz.org>: mailmap: update Kirill's email Subsystem: mm/memory-failure Rik van Riel <riel@surriel.com>: mm,hwpoison: unmap poisoned page before invalidation Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP Subsystem: mm/debug Yinan Zhang <zhangyinan2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: remove -c option doc/vm/page_owner.rst: remove content related to -c option Subsystem: mm/kmemleak Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: mm/kmemleak: reset tag when compare object pointer Subsystem: mm/damon Jonghyeon Kim <tome01@ajou.ac.kr>: mm/damon: prevent activated scheme from sleeping by deactivated schemes .mailmap | 1 Documentation/vm/page_owner.rst | 1 Documentation/vm/unevictable-lru.rst | 473 +++++++++++++++-------------------- fs/nilfs2/btnode.c | 23 + fs/nilfs2/btnode.h | 1 fs/nilfs2/btree.c | 27 + fs/nilfs2/dat.c | 4 fs/nilfs2/gcinode.c | 7 fs/nilfs2/inode.c | 167 +++++++++++- fs/nilfs2/mdt.c | 45 ++- fs/nilfs2/mdt.h | 6 fs/nilfs2/nilfs.h | 16 - fs/nilfs2/page.c | 16 - fs/nilfs2/page.h | 1 fs/nilfs2/segment.c | 9 fs/nilfs2/super.c | 5 fs/ocfs2/quota_global.c | 23 - fs/ocfs2/quota_local.c | 2 include/linux/gfp.h | 4 mm/damon/core.c | 5 mm/gup.c | 10 mm/internal.h | 6 mm/kfence/core.c | 11 mm/kfence/kfence.h | 3 mm/kmemleak.c | 9 mm/madvise.c | 9 mm/memory.c | 12 mm/migrate.c | 2 mm/mlock.c | 46 ++- mm/page_alloc.c | 1 mm/rmap.c | 4 mm/swap.c | 4 tools/vm/page_owner_sort.c | 6 33 files changed, 560 insertions(+), 399 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-04-01 18:20 Andrew Morton 2022-04-01 18:27 ` incoming Andrew Morton 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2022-04-01 18:20 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696. Subsystems affected by this patch series: mm/madvise ofs2 nilfs2 mm/mlock mm/mfence mailmap mm/memory-failure mm/kasan mm/debug mm/kmemleak mm/damon Subsystem: mm/madvise Charan Teja Kalla <quic_charante@quicinc.com>: Revert "mm: madvise: skip unmapped vma holes passed to process_madvise" Subsystem: ofs2 Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: fix crash when mount with quota enabled Subsystem: nilfs2 Ryusuke Konishi <konishi.ryusuke@gmail.com>: Patch series "nilfs2 lockdep warning fixes": nilfs2: fix lockdep warnings in page operations for btree nodes nilfs2: fix lockdep warnings during disk space reclamation nilfs2: get rid of nilfs_mapping_init() Subsystem: mm/mlock Hugh Dickins <hughd@google.com>: mm/munlock: add lru_add_drain() to fix memcg_stat_test mm/munlock: update Documentation/vm/unevictable-lru.rst Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/munlock: protect the per-CPU pagevec by a local_lock_t Subsystem: mm/kfence Muchun Song <songmuchun@bytedance.com>: mm: kfence: fix objcgs vector allocation Subsystem: mailmap Kirill Tkhai <kirill.tkhai@openvz.org>: mailmap: update Kirill's email Subsystem: mm/memory-failure Rik van Riel <riel@surriel.com>: mm,hwpoison: unmap poisoned page before invalidation Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP Subsystem: mm/debug Yinan Zhang <zhangyinan2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: remove -c option doc/vm/page_owner.rst: remove content related to -c option Subsystem: mm/kmemleak Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: mm/kmemleak: reset tag when compare object pointer Subsystem: mm/damon Jonghyeon Kim <tome01@ajou.ac.kr>: mm/damon: prevent activated scheme from sleeping by deactivated schemes .mailmap | 1 Documentation/vm/page_owner.rst | 1 Documentation/vm/unevictable-lru.rst | 473 +++++++++++++++-------------------- fs/nilfs2/btnode.c | 23 + fs/nilfs2/btnode.h | 1 fs/nilfs2/btree.c | 27 + fs/nilfs2/dat.c | 4 fs/nilfs2/gcinode.c | 7 fs/nilfs2/inode.c | 167 +++++++++++- fs/nilfs2/mdt.c | 45 ++- fs/nilfs2/mdt.h | 6 fs/nilfs2/nilfs.h | 16 - fs/nilfs2/page.c | 16 - fs/nilfs2/page.h | 1 fs/nilfs2/segment.c | 9 fs/nilfs2/super.c | 5 fs/ocfs2/quota_global.c | 23 - fs/ocfs2/quota_local.c | 2 include/linux/gfp.h | 4 mm/damon/core.c | 5 mm/gup.c | 10 mm/internal.h | 6 mm/kfence/core.c | 11 mm/kfence/kfence.h | 3 mm/kmemleak.c | 9 mm/madvise.c | 9 mm/memory.c | 12 mm/migrate.c | 2 mm/mlock.c | 46 ++- mm/page_alloc.c | 1 mm/rmap.c | 4 mm/swap.c | 4 tools/vm/page_owner_sort.c | 6 33 files changed, 560 insertions(+), 399 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2022-04-01 18:20 incoming Andrew Morton @ 2022-04-01 18:27 ` Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-04-01 18:27 UTC (permalink / raw) To: Linus Torvalds, linux-mm, mm-commits, patches Argh, messed up in-reply-to. Let me redo... ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-03-23 23:04 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-23 23:04 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches Various misc subsystems, before getting into the post-linux-next material. This is all based on v5.17. I tested applying and compiling against today's 1bc191051dca28fa6. One patch required an extra whack, all looks good. 41 patches, based on f443e374ae131c168a065ea1748feac6b2e76613. Subsystems affected by this patch series: procfs misc core-kernel lib checkpatch init pipe minix fat cgroups kexec kdump taskstats panic kcov resource ubsan Subsystem: procfs Hao Lee <haolee.swjtu@gmail.com>: proc: alloc PATH_MAX bytes for /proc/${pid}/fd/ symlinks David Hildenbrand <david@redhat.com>: proc/vmcore: fix possible deadlock on concurrent mmap and read Yang Li <yang.lee@linux.alibaba.com>: proc/vmcore: fix vmcore_alloc_buf() kernel-doc comment Subsystem: misc Bjorn Helgaas <bhelgaas@google.com>: linux/types.h: remove unnecessary __bitwise__ Documentation/sparse: add hints about __CHECKER__ Subsystem: core-kernel Miaohe Lin <linmiaohe@huawei.com>: kernel/ksysfs.c: use helper macro __ATTR_RW Subsystem: lib Kees Cook <keescook@chromium.org>: Kconfig.debug: make DEBUG_INFO selectable from a choice Rasmus Villemoes <linux@rasmusvillemoes.dk>: include: drop pointless __compiler_offsetof indirection Christophe Leroy <christophe.leroy@csgroup.eu>: ilog2: force inlining of __ilog2_u32() and __ilog2_u64() Andy Shevchenko <andriy.shevchenko@linux.intel.com>: bitfield: add explicit inclusions to the example Feng Tang <feng.tang@intel.com>: lib/Kconfig.debug: add ARCH dependency for FUNCTION_ALIGN option Randy Dunlap <rdunlap@infradead.org>: lib: bitmap: fix many kernel-doc warnings Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: prefer MODULE_LICENSE("GPL") over MODULE_LICENSE("GPL v2") checkpatch: add --fix option for some TRAILING_STATEMENTS checkpatch: add early_param exception to blank line after struct/function test Sagar Patel <sagarmp@cs.unc.edu>: checkpatch: use python3 to find codespell dictionary Subsystem: init Mark-PK Tsai <mark-pk.tsai@mediatek.com>: init: use ktime_us_delta() to make initcall_debug log more precise Randy Dunlap <rdunlap@infradead.org>: init.h: improve __setup and early_param documentation init/main.c: return 1 from handled __setup() functions Subsystem: pipe Andrei Vagin <avagin@gmail.com>: fs/pipe: use kvcalloc to allocate a pipe_buffer array fs/pipe.c: local vars have to match types of proper pipe_inode_info fields Subsystem: minix Qinghua Jin <qhjin.dev@gmail.com>: minix: fix bug when opening a file with O_DIRECT Subsystem: fat Helge Deller <deller@gmx.de>: fat: use pointer to simple type in put_user() Subsystem: cgroups Sebastian Andrzej Siewior <bigeasy@linutronix.de>: cgroup: use irqsave in cgroup_rstat_flush_locked(). cgroup: add a comment to cgroup_rstat_flush_locked(). Subsystem: kexec Jisheng Zhang <jszhang@kernel.org>: Patch series "kexec: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef", v2: kexec: make crashk_res, crashk_low_res and crash_notes symbols always visible riscv: mm: init: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef x86/setup: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef arm64: mm: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef Subsystem: kdump Tiezhu Yang <yangtiezhu@loongson.cn>: Patch series "Update doc and fix some issues about kdump", v2: docs: kdump: update description about sysfs file system support docs: kdump: add scp example to write out the dump file panic: unset panic_on_warn inside panic() ubsan: no need to unset panic_on_warn in ubsan_epilogue() kasan: no need to unset panic_on_warn in end_report() Subsystem: taskstats Lukas Bulwahn <lukas.bulwahn@gmail.com>: taskstats: remove unneeded dead assignment Subsystem: panic "Guilherme G. Piccoli" <gpiccoli@igalia.com>: Patch series "Some improvements on panic_print": docs: sysctl/kernel: add missing bit to panic_print panic: add option to dump all CPUs backtraces in panic_print panic: move panic_print before kmsg dumpers Subsystem: kcov Aleksandr Nogikh <nogikh@google.com>: Patch series "kcov: improve mmap processing", v3: kcov: split ioctl handling into locked and unlocked parts kcov: properly handle subsequent mmap calls Subsystem: resource Miaohe Lin <linmiaohe@huawei.com>: kernel/resource: fix kfree() of bootmem memory again Subsystem: ubsan Marco Elver <elver@google.com>: Revert "ubsan, kcsan: Don't combine sanitizer with kcov on clang" Documentation/admin-guide/kdump/kdump.rst | 10 + Documentation/admin-guide/kernel-parameters.txt | 5 Documentation/admin-guide/sysctl/kernel.rst | 2 Documentation/dev-tools/sparse.rst | 2 arch/arm64/mm/init.c | 9 - arch/riscv/mm/init.c | 6 - arch/x86/kernel/setup.c | 10 - fs/fat/dir.c | 2 fs/minix/inode.c | 3 fs/pipe.c | 13 +- fs/proc/base.c | 8 - fs/proc/vmcore.c | 43 +++---- include/linux/bitfield.h | 3 include/linux/compiler_types.h | 3 include/linux/init.h | 11 + include/linux/kexec.h | 12 +- include/linux/log2.h | 4 include/linux/stddef.h | 6 - include/uapi/linux/types.h | 6 - init/main.c | 14 +- kernel/cgroup/rstat.c | 13 +- kernel/kcov.c | 102 ++++++++--------- kernel/ksysfs.c | 3 kernel/panic.c | 37 ++++-- kernel/resource.c | 41 +----- kernel/taskstats.c | 5 lib/Kconfig.debug | 142 ++++++++++++------------ lib/Kconfig.kcsan | 11 - lib/Kconfig.ubsan | 12 -- lib/bitmap.c | 24 ++-- lib/ubsan.c | 10 - mm/kasan/report.c | 10 - scripts/checkpatch.pl | 31 ++++- tools/include/linux/types.h | 5 34 files changed, 313 insertions(+), 305 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-03-22 21:38 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-22 21:38 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches - A few misc subsystems - There is a lot of MM material in Willy's tree. Folio work and non-folio patches which depended on that work. Here I send almost all the MM patches which precede the patches in Willy's tree. The remaining ~100 MM patches are staged on Willy's tree and I'll send those along once Willy is merged up. I tried this batch against your current tree (as of 51912904076680281) and a couple need some extra persuasion to apply, but all looks OK otherwise. 227 patches, based on f443e374ae131c168a065ea1748feac6b2e76613 Subsystems affected by this patch series: kthread scripts ntfs ocfs2 block vfs mm/kasan mm/pagecache mm/gup mm/swap mm/shmem mm/memcg mm/selftests mm/pagemap mm/mremap mm/sparsemem mm/vmalloc mm/pagealloc mm/memory-failure mm/mlock mm/hugetlb mm/userfaultfd mm/vmscan mm/compaction mm/mempolicy mm/oom-kill mm/migration mm/thp mm/cma mm/autonuma mm/psi mm/ksm mm/page-poison mm/madvise mm/memory-hotplug mm/rmap mm/zswap mm/uaccess mm/ioremap mm/highmem mm/cleanups mm/kfence mm/hmm mm/damon Subsystem: kthread Rasmus Villemoes <linux@rasmusvillemoes.dk>: linux/kthread.h: remove unused macros Subsystem: scripts Colin Ian King <colin.i.king@gmail.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ntfs Dongliang Mu <mudongliangabcd@gmail.com>: ntfs: add sanity check on allocation size Subsystem: ocfs2 Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: cleanup some return variables hongnanli <hongnan.li@linux.alibaba.com>: fs/ocfs2: fix comments mentioning i_mutex Subsystem: block NeilBrown <neilb@suse.de>: Patch series "Remove remaining parts of congestion tracking code", v2: doc: convert 'subsection' to 'section' in gfp.h mm: document and polish read-ahead code mm: improve cleanup when ->readpages doesn't process all pages fuse: remove reliance on bdi congestion nfs: remove reliance on bdi congestion ceph: remove reliance on bdi congestion remove inode_congested() remove bdi_congested() and wb_congested() and related functions f2fs: replace congestion_wait() calls with io_schedule_timeout() block/bfq-iosched.c: use "false" rather than "BLK_RW_ASYNC" remove congestion tracking framework Subsystem: vfs Anthony Iliopoulos <ailiop@suse.com>: mount: warn only once about timestamp range expiration Subsystem: mm/kasan Miaohe Lin <linmiaohe@huawei.com>: mm/memremap: avoid calling kasan_remove_zero_shadow() for device private memory Subsystem: mm/pagecache Miaohe Lin <linmiaohe@huawei.com>: filemap: remove find_get_pages() mm/writeback: minor clean up for highmem_dirtyable_memory Minchan Kim <minchan@kernel.org>: mm: fs: fix lru_cache_disabled race in bh_lru Subsystem: mm/gup Peter Xu <peterx@redhat.com>: Patch series "mm/gup: some cleanups", v5: mm: fix invalid page pointer returned with FOLL_PIN gups John Hubbard <jhubbard@nvidia.com>: mm/gup: follow_pfn_pte(): -EEXIST cleanup mm/gup: remove unused pin_user_pages_locked() mm: change lookup_node() to use get_user_pages_fast() mm/gup: remove unused get_user_pages_locked() Subsystem: mm/swap Bang Li <libang.linuxer@gmail.com>: mm/swap: fix confusing comment in folio_mark_accessed Subsystem: mm/shmem Xavier Roche <xavier.roche@algolia.com>: tmpfs: support for file creation time Hugh Dickins <hughd@google.com>: shmem: mapping_set_exiting() to help mapped resilience tmpfs: do not allocate pages on read Miaohe Lin <linmiaohe@huawei.com>: mm: shmem: use helper macro __ATTR_RW Subsystem: mm/memcg Shakeel Butt <shakeelb@google.com>: memcg: replace in_interrupt() with !in_task() Yosry Ahmed <yosryahmed@google.com>: memcg: add per-memcg total kernel memory stat Wei Yang <richard.weiyang@gmail.com>: mm/memcg: mem_cgroup_per_node is already set to 0 on allocation mm/memcg: retrieve parent memcg from css.parent Shakeel Butt <shakeelb@google.com>: Patch series "memcg: robust enforcement of memory.high", v2: memcg: refactor mem_cgroup_oom memcg: unify force charging conditions selftests: memcg: test high limit for single entry allocation memcg: synchronously enforce memory.high for large overcharges Randy Dunlap <rdunlap@infradead.org>: mm/memcontrol: return 1 from cgroup.memory __setup() handler Michal Hocko <mhocko@suse.com>: Patch series "mm/memcg: Address PREEMPT_RT problems instead of disabling it", v5: mm/memcg: revert ("mm/memcg: optimize user context object stock access") Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/memcg: disable threshold event handlers on PREEMPT_RT mm/memcg: protect per-CPU counter by disabling preemption on PREEMPT_RT where needed. Johannes Weiner <hannes@cmpxchg.org>: mm/memcg: opencode the inner part of obj_cgroup_uncharge_pages() in drain_obj_stock() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/memcg: protect memcg_stock with a local_lock_t mm/memcg: disable migration instead of preemption in drain_all_stock(). Muchun Song <songmuchun@bytedance.com>: Patch series "Optimize list lru memory consumption", v6: mm: list_lru: transpose the array of per-node per-memcg lru lists mm: introduce kmem_cache_alloc_lru fs: introduce alloc_inode_sb() to allocate filesystems specific inode fs: allocate inode by using alloc_inode_sb() f2fs: allocate inode by using alloc_inode_sb() mm: dcache: use kmem_cache_alloc_lru() to allocate dentry xarray: use kmem_cache_alloc_lru to allocate xa_node mm: memcontrol: move memcg_online_kmem() to mem_cgroup_css_online() mm: list_lru: allocate list_lru_one only when needed mm: list_lru: rename memcg_drain_all_list_lrus to memcg_reparent_list_lrus mm: list_lru: replace linear array with xarray mm: memcontrol: reuse memory cgroup ID for kmem ID mm: memcontrol: fix cannot alloc the maximum memcg ID mm: list_lru: rename list_lru_per_memcg to list_lru_memcg mm: memcontrol: rename memcg_cache_id to memcg_kmem_id Vasily Averin <vvs@virtuozzo.com>: memcg: enable accounting for tty-related objects Subsystem: mm/selftests Guillaume Tucker <guillaume.tucker@collabora.com>: selftests, x86: fix how check_cc.sh is being invoked Subsystem: mm/pagemap Anshuman Khandual <anshuman.khandual@arm.com>: mm: merge pte_mkhuge() call into arch_make_huge_pte() Stafford Horne <shorne@gmail.com>: mm: remove mmu_gathers storage from remaining architectures Muchun Song <songmuchun@bytedance.com>: Patch series "Fix some cache flush bugs", v5: mm: thp: fix wrong cache flush in remove_migration_pmd() mm: fix missing cache flush for all tail pages of compound page mm: hugetlb: fix missing cache flush in copy_huge_page_from_user() mm: hugetlb: fix missing cache flush in hugetlb_mcopy_atomic_pte() mm: shmem: fix missing cache flush in shmem_mfill_atomic_pte() mm: userfaultfd: fix missing cache flush in mcopy_atomic_pte() and __mcopy_atomic() mm: replace multiple dcache flush with flush_dcache_folio() Peter Xu <peterx@redhat.com>: Patch series "mm: Rework zap ptes on swap entries", v5: mm: don't skip swap entry even if zap_details specified mm: rename zap_skip_check_mapping() to should_zap_page() mm: change zap_details.zap_mapping into even_cows mm: rework swap handling of zap_pte_range Randy Dunlap <rdunlap@infradead.org>: mm/mmap: return 1 from stack_guard_gap __setup() handler Miaohe Lin <linmiaohe@huawei.com>: mm/memory.c: use helper function range_in_vma() mm/memory.c: use helper macro min and max in unmap_mapping_range_tree() Hugh Dickins <hughd@google.com>: mm: _install_special_mapping() apply VM_LOCKED_CLEAR_MASK Miaohe Lin <linmiaohe@huawei.com>: mm/mmap: remove obsolete comment in ksys_mmap_pgoff Subsystem: mm/mremap Miaohe Lin <linmiaohe@huawei.com>: mm/mremap:: use vma_lookup() instead of find_vma() Subsystem: mm/sparsemem Miaohe Lin <linmiaohe@huawei.com>: mm/sparse: make mminit_validate_memmodel_limits() static Subsystem: mm/vmalloc Miaohe Lin <linmiaohe@huawei.com>: mm/vmalloc: remove unneeded function forward declaration "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: Move draining areas out of caller context Uladzislau Rezki <uladzislau.rezki@sony.com>: mm/vmalloc: add adjust_search_size parameter "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: eliminate an extra orig_gfp_mask Jiapeng Chong <jiapeng.chong@linux.alibaba.com>: mm/vmalloc.c: fix "unused function" warning Bang Li <libang.linuxer@gmail.com>: mm/vmalloc: fix comments about vmap_area struct Subsystem: mm/pagealloc Zi Yan <ziy@nvidia.com>: mm: page_alloc: avoid merging non-fallbackable pageblocks with others Peter Collingbourne <pcc@google.com>: mm/mmzone.c: use try_cmpxchg() in page_cpupid_xchg_last() Miaohe Lin <linmiaohe@huawei.com>: mm/mmzone.h: remove unused macros Nicolas Saenz Julienne <nsaenzju@redhat.com>: mm/page_alloc: don't pass pfn to free_unref_page_commit() David Hildenbrand <david@redhat.com>: Patch series "mm: enforce pageblock_order < MAX_ORDER": cma: factor out minimum alignment requirement mm: enforce pageblock_order < MAX_ORDER Nathan Chancellor <nathan@kernel.org>: mm/page_alloc: mark pagesets as __maybe_unused Alistair Popple <apopple@nvidia.com>: mm/pages_alloc.c: don't create ZONE_MOVABLE beyond the end of a node Mel Gorman <mgorman@techsingularity.net>: Patch series "Follow-up on high-order PCP caching", v2: mm/page_alloc: fetch the correct pcp buddy during bulk free mm/page_alloc: track range of active PCP lists during bulk free mm/page_alloc: simplify how many pages are selected per pcp list during bulk free mm/page_alloc: drain the requested list first during bulk free mm/page_alloc: free pages in a single pass during bulk free mm/page_alloc: limit number of high-order pages on PCP during bulk free mm/page_alloc: do not prefetch buddies during bulk free Oscar Salvador <osalvador@suse.de>: arch/x86/mm/numa: Do not initialize nodes twice Suren Baghdasaryan <surenb@google.com>: mm: count time in drain_all_pages during direct reclaim as memory pressure Eric Dumazet <edumazet@google.com>: mm/page_alloc: call check_new_pages() while zone spinlock is not held Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: check high-order pages for corruption during PCP operations Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/memory-failure.c: remove obsolete comment mm/hwpoison: fix error page recovered but reported "not recovered" Rik van Riel <riel@surriel.com>: mm: invalidate hwpoison page cache page in fault path Miaohe Lin <linmiaohe@huawei.com>: Patch series "A few cleanup and fixup patches for memory failure", v3: mm/memory-failure.c: minor clean up for memory_failure_dev_pagemap mm/memory-failure.c: catch unexpected -EFAULT from vma_address() mm/memory-failure.c: rework the signaling logic in kill_proc mm/memory-failure.c: fix race with changing page more robustly mm/memory-failure.c: remove PageSlab check in hwpoison_filter_dev mm/memory-failure.c: rework the try_to_unmap logic in hwpoison_user_mappings() mm/memory-failure.c: remove obsolete comment in __soft_offline_page mm/memory-failure.c: remove unnecessary PageTransTail check mm/hwpoison-inject: support injecting hwpoison to free page luofei <luofei@unicloud.com>: mm/hwpoison: avoid the impact of hwpoison_filter() return value on mce handler mm/hwpoison: add in-use hugepage hwpoison filter judgement Miaohe Lin <linmiaohe@huawei.com>: Patch series "A few fixup patches for memory failure", v2: mm/memory-failure.c: fix race with changing page compound again mm/memory-failure.c: avoid calling invalidate_inode_page() with unexpected pages mm/memory-failure.c: make non-LRU movable pages unhandlable Vlastimil Babka <vbabka@suse.cz>: mm, fault-injection: declare should_fail_alloc_page() Subsystem: mm/mlock Miaohe Lin <linmiaohe@huawei.com>: mm/mlock: fix potential imbalanced rlimit ucounts adjustment Subsystem: mm/hugetlb Muchun Song <songmuchun@bytedance.com>: Patch series "Free the 2nd vmemmap page associated with each HugeTLB page", v7: mm: hugetlb: free the 2nd vmemmap page associated with each HugeTLB page mm: hugetlb: replace hugetlb_free_vmemmap_enabled with a static_key mm: sparsemem: use page table lock to protect kernel pmd operations selftests: vm: add a hugetlb test case mm: sparsemem: move vmemmap related to HugeTLB to CONFIG_HUGETLB_PAGE_FREE_VMEMMAP Anshuman Khandual <anshuman.khandual@arm.com>: mm/hugetlb: generalize ARCH_WANT_GENERAL_HUGETLB Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: clean up potential spectre issue warnings Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: use helper macro __ATTR_RW David Howells <dhowells@redhat.com>: mm/hugetlb.c: export PageHeadHuge() Miaohe Lin <linmiaohe@huawei.com>: mm: remove unneeded local variable follflags Subsystem: mm/userfaultfd Nadav Amit <namit@vmware.com>: userfaultfd: provide unmasked address on page-fault Guo Zhengkui <guozhengkui@vivo.com>: userfaultfd/selftests: fix uninitialized_var.cocci warning Subsystem: mm/vmscan Hugh Dickins <hughd@google.com>: mm/fs: delete PF_SWAPWRITE mm: __isolate_lru_page_prepare() in isolate_migratepages_block() Waiman Long <longman@redhat.com>: mm/list_lru: optimize memcg_reparent_list_lru_node() Marcelo Tosatti <mtosatti@redhat.com>: mm: lru_cache_disable: replace work queue synchronization with synchronize_rcu Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm: workingset: replace IRQ-off check with a lockdep assert. Charan Teja Kalla <quic_charante@quicinc.com>: mm: vmscan: fix documentation for page_check_references() Subsystem: mm/compaction Baolin Wang <baolin.wang@linux.alibaba.com>: mm: compaction: cleanup the compaction trace events Subsystem: mm/mempolicy Hugh Dickins <hughd@google.com>: mempolicy: mbind_range() set_policy() after vma_merge() Subsystem: mm/oom-kill Miaohe Lin <linmiaohe@huawei.com>: mm/oom_kill: remove unneeded is_memcg_oom check Subsystem: mm/migration Huang Ying <ying.huang@intel.com>: mm,migrate: fix establishing demotion target "andrew.yang" <andrew.yang@mediatek.com>: mm/migrate: fix race between lock page and clear PG_Isolated Subsystem: mm/thp Hugh Dickins <hughd@google.com>: mm/thp: refix __split_huge_pmd_locked() for migration PMD Subsystem: mm/cma Hari Bathini <hbathini@linux.ibm.com>: Patch series "powerpc/fadump: handle CMA activation failure appropriately", v3: mm/cma: provide option to opt out from exposing pages on activation failure powerpc/fadump: opt out from freeing pages on cma activation failure Subsystem: mm/autonuma Huang Ying <ying.huang@intel.com>: Patch series "NUMA balancing: optimize memory placement for memory tiering system", v13: NUMA Balancing: add page promotion counter NUMA balancing: optimize page placement for memory tiering system memory tiering: skip to scan fast memory Subsystem: mm/psi Johannes Weiner <hannes@cmpxchg.org>: mm: page_io: fix psi memory pressure error on cold swapins Subsystem: mm/ksm Yang Yang <yang.yang29@zte.com.cn>: mm/vmstat: add event for ksm swapping in copy Miaohe Lin <linmiaohe@huawei.com>: mm/ksm: use helper macro __ATTR_RW Subsystem: mm/page-poison "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/hwpoison: check the subpage, not the head page Subsystem: mm/madvise Miaohe Lin <linmiaohe@huawei.com>: mm/madvise: use vma_lookup() instead of find_vma() Charan Teja Kalla <quic_charante@quicinc.com>: Patch series "mm: madvise: return correct bytes processed with: mm: madvise: return correct bytes advised with process_madvise mm: madvise: skip unmapped vma holes passed to process_madvise Subsystem: mm/memory-hotplug Michal Hocko <mhocko@suse.com>: Patch series "mm, memory_hotplug: handle unitialized numa node gracefully": mm, memory_hotplug: make arch_alloc_nodedata independent on CONFIG_MEMORY_HOTPLUG mm: handle uninitialized numa nodes gracefully mm, memory_hotplug: drop arch_free_nodedata mm, memory_hotplug: reorganize new pgdat initialization mm: make free_area_init_node aware of memory less nodes Wei Yang <richard.weiyang@gmail.com>: memcg: do not tweak node in alloc_mem_cgroup_per_node_info David Hildenbrand <david@redhat.com>: drivers/base/memory: add memory block to memory group after registration succeeded drivers/base/node: consolidate node device subsystem initialization in node_dev_init() Miaohe Lin <linmiaohe@huawei.com>: Patch series "A few cleanup patches around memory_hotplug": mm/memory_hotplug: remove obsolete comment of __add_pages mm/memory_hotplug: avoid calling zone_intersects() for ZONE_NORMAL mm/memory_hotplug: clean up try_offline_node mm/memory_hotplug: fix misplaced comment in offline_pages David Hildenbrand <david@redhat.com>: Patch series "drivers/base/memory: determine and store zone for single-zone memory blocks", v2: drivers/base/node: rename link_mem_sections() to register_memory_block_under_node() drivers/base/memory: determine and store zone for single-zone memory blocks drivers/base/memory: clarify adding and removing of memory blocks Oscar Salvador <osalvador@suse.de>: mm: only re-generate demotion targets when a numa node changes its N_CPU state Subsystem: mm/rmap Hugh Dickins <hughd@google.com>: mm/thp: ClearPageDoubleMap in first page_add_file_rmap() Subsystem: mm/zswap "Maciej S. Szmigiero" <maciej.szmigiero@oracle.com>: mm/zswap.c: allow handling just same-value filled pages Subsystem: mm/uaccess Christophe Leroy <christophe.leroy@csgroup.eu>: mm: remove usercopy_warn() mm: uninline copy_overflow() Randy Dunlap <rdunlap@infradead.org>: mm/usercopy: return 1 from hardened_usercopy __setup() handler Subsystem: mm/ioremap Vlastimil Babka <vbabka@suse.cz>: mm/early_ioremap: declare early_memremap_pgprot_adjust() Subsystem: mm/highmem Ira Weiny <ira.weiny@intel.com>: highmem: document kunmap_local() Miaohe Lin <linmiaohe@huawei.com>: mm/highmem: remove unnecessary done label Subsystem: mm/cleanups "Dr. David Alan Gilbert" <linux@treblig.org>: mm/page_table_check.c: use strtobool for param parsing Subsystem: mm/kfence tangmeng <tangmeng@uniontech.com>: mm/kfence: remove unnecessary CONFIG_KFENCE option Tianchen Ding <dtcccc@linux.alibaba.com>: Patch series "provide the flexibility to enable KFENCE", v3: kfence: allow re-enabling KFENCE after system startup kfence: alloc kfence_pool after system startup Peng Liu <liupeng256@huawei.com>: Patch series "kunit: fix a UAF bug and do some optimization", v2: kunit: fix UAF when run kfence test case test_gfpzero kunit: make kunit_test_timeout compatible with comment kfence: test: try to avoid test_gfpzero trigger rcu_stall Marco Elver <elver@google.com>: kfence: allow use of a deferrable timer Subsystem: mm/hmm Miaohe Lin <linmiaohe@huawei.com>: mm/hmm.c: remove unneeded local variable ret Subsystem: mm/damon SeongJae Park <sj@kernel.org>: Patch series "Remove the type-unclear target id concept": mm/damon/dbgfs/init_regions: use target index instead of target id Docs/admin-guide/mm/damon/usage: update for changed initail_regions file input mm/damon/core: move damon_set_targets() into dbgfs mm/damon: remove the target id concept Baolin Wang <baolin.wang@linux.alibaba.com>: mm/damon: remove redundant page validation SeongJae Park <sj@kernel.org>: Patch series "Allow DAMON user code independent of monitoring primitives": mm/damon: rename damon_primitives to damon_operations mm/damon: let monitoring operations can be registered and selected mm/damon/paddr,vaddr: register themselves to DAMON in subsys_initcall mm/damon/reclaim: use damon_select_ops() instead of damon_{v,p}a_set_operations() mm/damon/dbgfs: use damon_select_ops() instead of damon_{v,p}a_set_operations() mm/damon/dbgfs: use operations id for knowing if the target has pid mm/damon/dbgfs-test: fix is_target_id() change mm/damon/paddr,vaddr: remove damon_{p,v}a_{target_valid,set_operations}() tangmeng <tangmeng@uniontech.com>: mm/damon: remove unnecessary CONFIG_DAMON option SeongJae Park <sj@kernel.org>: Patch series "Docs/damon: Update documents for better consistency": Docs/vm/damon: call low level monitoring primitives the operations Docs/vm/damon/design: update DAMON-Idle Page Tracking interference handling Docs/damon: update outdated term 'regions update interval' Patch series "Introduce DAMON sysfs interface", v3: mm/damon/core: allow non-exclusive DAMON start/stop mm/damon/core: add number of each enum type values mm/damon: implement a minimal stub for sysfs-based DAMON interface mm/damon/sysfs: link DAMON for virtual address spaces monitoring mm/damon/sysfs: support the physical address space monitoring mm/damon/sysfs: support DAMON-based Operation Schemes mm/damon/sysfs: support DAMOS quotas mm/damon/sysfs: support schemes prioritization mm/damon/sysfs: support DAMOS watermarks mm/damon/sysfs: support DAMOS stats selftests/damon: add a test for DAMON sysfs interface Docs/admin-guide/mm/damon/usage: document DAMON sysfs interface Docs/ABI/testing: add DAMON sysfs interface ABI document Xin Hao <xhao@linux.alibaba.com>: mm/damon/sysfs: remove repeat container_of() in damon_sysfs_kdamond_release() Documentation/ABI/testing/sysfs-kernel-mm-damon | 274 ++ Documentation/admin-guide/cgroup-v1/memory.rst | 2 Documentation/admin-guide/cgroup-v2.rst | 5 Documentation/admin-guide/kernel-parameters.txt | 2 Documentation/admin-guide/mm/damon/usage.rst | 380 +++ Documentation/admin-guide/mm/zswap.rst | 22 Documentation/admin-guide/sysctl/kernel.rst | 31 Documentation/core-api/mm-api.rst | 19 Documentation/dev-tools/kfence.rst | 12 Documentation/filesystems/porting.rst | 6 Documentation/filesystems/vfs.rst | 16 Documentation/vm/damon/design.rst | 43 Documentation/vm/damon/faq.rst | 2 MAINTAINERS | 1 arch/arm/Kconfig | 4 arch/arm64/kernel/setup.c | 3 arch/arm64/mm/hugetlbpage.c | 1 arch/hexagon/mm/init.c | 2 arch/ia64/kernel/topology.c | 10 arch/ia64/mm/discontig.c | 11 arch/mips/kernel/topology.c | 5 arch/nds32/mm/init.c | 1 arch/openrisc/mm/init.c | 2 arch/powerpc/include/asm/fadump-internal.h | 5 arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h | 4 arch/powerpc/kernel/fadump.c | 8 arch/powerpc/kernel/sysfs.c | 17 arch/riscv/Kconfig | 4 arch/riscv/kernel/setup.c | 3 arch/s390/kernel/numa.c | 7 arch/sh/kernel/topology.c | 5 arch/sparc/kernel/sysfs.c | 12 arch/sparc/mm/hugetlbpage.c | 1 arch/x86/Kconfig | 4 arch/x86/kernel/cpu/mce/core.c | 8 arch/x86/kernel/topology.c | 5 arch/x86/mm/numa.c | 33 block/bdev.c | 2 block/bfq-iosched.c | 2 drivers/base/init.c | 1 drivers/base/memory.c | 149 + drivers/base/node.c | 48 drivers/block/drbd/drbd_int.h | 3 drivers/block/drbd/drbd_req.c | 3 drivers/dax/super.c | 2 drivers/of/of_reserved_mem.c | 9 drivers/tty/tty_io.c | 2 drivers/virtio/virtio_mem.c | 9 fs/9p/vfs_inode.c | 2 fs/adfs/super.c | 2 fs/affs/super.c | 2 fs/afs/super.c | 2 fs/befs/linuxvfs.c | 2 fs/bfs/inode.c | 2 fs/btrfs/inode.c | 2 fs/buffer.c | 8 fs/ceph/addr.c | 22 fs/ceph/inode.c | 2 fs/ceph/super.c | 1 fs/ceph/super.h | 1 fs/cifs/cifsfs.c | 2 fs/coda/inode.c | 2 fs/dcache.c | 3 fs/ecryptfs/super.c | 2 fs/efs/super.c | 2 fs/erofs/super.c | 2 fs/exfat/super.c | 2 fs/ext2/ialloc.c | 5 fs/ext2/super.c | 2 fs/ext4/super.c | 2 fs/f2fs/compress.c | 4 fs/f2fs/data.c | 3 fs/f2fs/f2fs.h | 6 fs/f2fs/segment.c | 8 fs/f2fs/super.c | 14 fs/fat/inode.c | 2 fs/freevxfs/vxfs_super.c | 2 fs/fs-writeback.c | 40 fs/fuse/control.c | 17 fs/fuse/dev.c | 8 fs/fuse/file.c | 17 fs/fuse/inode.c | 2 fs/gfs2/super.c | 2 fs/hfs/super.c | 2 fs/hfsplus/super.c | 2 fs/hostfs/hostfs_kern.c | 2 fs/hpfs/super.c | 2 fs/hugetlbfs/inode.c | 2 fs/inode.c | 2 fs/isofs/inode.c | 2 fs/jffs2/super.c | 2 fs/jfs/super.c | 2 fs/minix/inode.c | 2 fs/namespace.c | 2 fs/nfs/inode.c | 2 fs/nfs/write.c | 14 fs/nilfs2/segbuf.c | 16 fs/nilfs2/super.c | 2 fs/ntfs/inode.c | 6 fs/ntfs3/super.c | 2 fs/ocfs2/alloc.c | 2 fs/ocfs2/aops.c | 2 fs/ocfs2/cluster/nodemanager.c | 2 fs/ocfs2/dir.c | 4 fs/ocfs2/dlmfs/dlmfs.c | 2 fs/ocfs2/file.c | 13 fs/ocfs2/inode.c | 2 fs/ocfs2/localalloc.c | 6 fs/ocfs2/namei.c | 2 fs/ocfs2/ocfs2.h | 4 fs/ocfs2/quota_global.c | 2 fs/ocfs2/stack_user.c | 18 fs/ocfs2/super.c | 2 fs/ocfs2/xattr.c | 2 fs/openpromfs/inode.c | 2 fs/orangefs/super.c | 2 fs/overlayfs/super.c | 2 fs/proc/inode.c | 2 fs/qnx4/inode.c | 2 fs/qnx6/inode.c | 2 fs/reiserfs/super.c | 2 fs/romfs/super.c | 2 fs/squashfs/super.c | 2 fs/sysv/inode.c | 2 fs/ubifs/super.c | 2 fs/udf/super.c | 2 fs/ufs/super.c | 2 fs/userfaultfd.c | 5 fs/vboxsf/super.c | 2 fs/xfs/libxfs/xfs_btree.c | 2 fs/xfs/xfs_buf.c | 3 fs/xfs/xfs_icache.c | 2 fs/zonefs/super.c | 2 include/linux/backing-dev-defs.h | 8 include/linux/backing-dev.h | 50 include/linux/cma.h | 14 include/linux/damon.h | 95 include/linux/fault-inject.h | 2 include/linux/fs.h | 21 include/linux/gfp.h | 10 include/linux/highmem-internal.h | 10 include/linux/hugetlb.h | 8 include/linux/kthread.h | 22 include/linux/list_lru.h | 45 include/linux/memcontrol.h | 46 include/linux/memory.h | 12 include/linux/memory_hotplug.h | 132 - include/linux/migrate.h | 8 include/linux/mm.h | 11 include/linux/mmzone.h | 22 include/linux/nfs_fs_sb.h | 1 include/linux/node.h | 25 include/linux/page-flags.h | 96 include/linux/pageblock-flags.h | 7 include/linux/pagemap.h | 7 include/linux/sched.h | 1 include/linux/sched/sysctl.h | 10 include/linux/shmem_fs.h | 1 include/linux/slab.h | 3 include/linux/swap.h | 6 include/linux/thread_info.h | 5 include/linux/uaccess.h | 2 include/linux/vm_event_item.h | 3 include/linux/vmalloc.h | 4 include/linux/xarray.h | 9 include/ras/ras_event.h | 1 include/trace/events/compaction.h | 26 include/trace/events/writeback.h | 28 include/uapi/linux/userfaultfd.h | 8 ipc/mqueue.c | 2 kernel/dma/contiguous.c | 4 kernel/sched/core.c | 21 kernel/sysctl.c | 2 lib/Kconfig.kfence | 12 lib/kunit/try-catch.c | 3 lib/xarray.c | 10 mm/Kconfig | 6 mm/backing-dev.c | 57 mm/cma.c | 31 mm/cma.h | 1 mm/compaction.c | 60 mm/damon/Kconfig | 19 mm/damon/Makefile | 7 mm/damon/core-test.h | 23 mm/damon/core.c | 190 + mm/damon/dbgfs-test.h | 103 mm/damon/dbgfs.c | 264 +- mm/damon/ops-common.c | 133 + mm/damon/ops-common.h | 16 mm/damon/paddr.c | 62 mm/damon/prmtv-common.c | 133 - mm/damon/prmtv-common.h | 16 mm/damon/reclaim.c | 11 mm/damon/sysfs.c | 2632 ++++++++++++++++++++++- mm/damon/vaddr-test.h | 8 mm/damon/vaddr.c | 67 mm/early_ioremap.c | 1 mm/fadvise.c | 5 mm/filemap.c | 17 mm/gup.c | 103 mm/highmem.c | 9 mm/hmm.c | 3 mm/huge_memory.c | 41 mm/hugetlb.c | 23 mm/hugetlb_vmemmap.c | 74 mm/hwpoison-inject.c | 7 mm/internal.h | 19 mm/kfence/Makefile | 2 mm/kfence/core.c | 147 + mm/kfence/kfence_test.c | 3 mm/ksm.c | 6 mm/list_lru.c | 690 ++---- mm/maccess.c | 6 mm/madvise.c | 18 mm/memcontrol.c | 549 ++-- mm/memory-failure.c | 148 - mm/memory.c | 116 - mm/memory_hotplug.c | 136 - mm/mempolicy.c | 29 mm/memremap.c | 3 mm/migrate.c | 128 - mm/mlock.c | 1 mm/mmap.c | 5 mm/mmzone.c | 7 mm/mprotect.c | 13 mm/mremap.c | 4 mm/oom_kill.c | 3 mm/page-writeback.c | 12 mm/page_alloc.c | 429 +-- mm/page_io.c | 7 mm/page_table_check.c | 10 mm/ptdump.c | 16 mm/readahead.c | 124 + mm/rmap.c | 15 mm/shmem.c | 46 mm/slab.c | 39 mm/slab.h | 25 mm/slob.c | 6 mm/slub.c | 42 mm/sparse-vmemmap.c | 70 mm/sparse.c | 2 mm/swap.c | 25 mm/swapfile.c | 1 mm/usercopy.c | 16 mm/userfaultfd.c | 3 mm/vmalloc.c | 102 mm/vmscan.c | 138 - mm/vmstat.c | 19 mm/workingset.c | 7 mm/zswap.c | 15 net/socket.c | 2 net/sunrpc/rpc_pipe.c | 2 scripts/spelling.txt | 16 tools/testing/selftests/cgroup/cgroup_util.c | 15 tools/testing/selftests/cgroup/cgroup_util.h | 1 tools/testing/selftests/cgroup/test_memcontrol.c | 78 tools/testing/selftests/damon/Makefile | 1 tools/testing/selftests/damon/sysfs.sh | 306 ++ tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 7 tools/testing/selftests/vm/hugepage-vmemmap.c | 144 + tools/testing/selftests/vm/run_vmtests.sh | 11 tools/testing/selftests/vm/userfaultfd.c | 2 tools/testing/selftests/x86/Makefile | 6 264 files changed, 7205 insertions(+), 3090 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-03-16 23:14 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-16 23:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches 4 patches, based on 56e337f2cf1326323844927a04e9dbce9a244835. Subsystems affected by this patch series: mm/swap kconfig ocfs2 selftests Subsystem: mm/swap Guo Ziliang <guo.ziliang@zte.com.cn>: mm: swap: get rid of deadloop in swapin readahead Subsystem: kconfig Qian Cai <quic_qiancai@quicinc.com>: configs/debug: restore DEBUG_INFO=y for overriding Subsystem: ocfs2 Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: fix crash when initialize filecheck kobj fails Subsystem: selftests Yosry Ahmed <yosryahmed@google.com>: selftests: vm: fix clang build error multiple output files fs/ocfs2/super.c | 22 +++++++++++----------- kernel/configs/debug.config | 1 + mm/swap_state.c | 2 +- tools/testing/selftests/vm/Makefile | 6 ++---- 4 files changed, 15 insertions(+), 16 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-03-05 4:28 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-03-05 4:28 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches 8 patches, based on 07ebd38a0da24d2534da57b4841346379db9f354. Subsystems affected by this patch series: mm/hugetlb mm/pagemap memfd selftests mm/userfaultfd kconfig Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: selftests/vm: cleanup hugetlb file after mremap test Subsystem: mm/pagemap Suren Baghdasaryan <surenb@google.com>: mm: refactor vm_area_struct::anon_vma_name usage code mm: prevent vm_area_struct::anon_name refcount saturation mm: fix use-after-free when anon vma name is used after vma is freed Subsystem: memfd Hugh Dickins <hughd@google.com>: memfd: fix F_SEAL_WRITE after shmem huge page allocated Subsystem: selftests Chengming Zhou <zhouchengming@bytedance.com>: kselftest/vm: fix tests build with old libc Subsystem: mm/userfaultfd Yun Zhou <yun.zhou@windriver.com>: proc: fix documentation and description of pagemap Subsystem: kconfig Qian Cai <quic_qiancai@quicinc.com>: configs/debug: set CONFIG_DEBUG_INFO=y properly Documentation/admin-guide/mm/pagemap.rst | 2 fs/proc/task_mmu.c | 9 +- fs/userfaultfd.c | 6 - include/linux/mm.h | 7 + include/linux/mm_inline.h | 105 ++++++++++++++++++--------- include/linux/mm_types.h | 5 + kernel/configs/debug.config | 2 kernel/fork.c | 4 - kernel/sys.c | 19 +++- mm/madvise.c | 98 +++++++++---------------- mm/memfd.c | 40 +++++++--- mm/mempolicy.c | 2 mm/mlock.c | 2 mm/mmap.c | 12 +-- mm/mprotect.c | 2 tools/testing/selftests/vm/hugepage-mremap.c | 26 ++++-- tools/testing/selftests/vm/run_vmtests.sh | 3 tools/testing/selftests/vm/userfaultfd.c | 1 18 files changed, 201 insertions(+), 144 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-02-26 3:10 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-02-26 3:10 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches 12 patches, based on c47658311d60be064b839f329c0e4d34f5f0735b. Subsystems affected by this patch series: MAINTAINERS mm/hugetlb mm/kasan mm/hugetlbfs mm/pagemap mm/selftests mm/memcg m/slab mailmap memfd Subsystem: MAINTAINERS Luis Chamberlain <mcgrof@kernel.org>: MAINTAINERS: add sysctl-next git tree Subsystem: mm/hugetlb "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/hugetlb: fix kernel crash with hugetlb mremap Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: test: prevent cache merging in kmem_cache_double_destroy Subsystem: mm/hugetlbfs Liu Yuntao <liuyuntao10@huawei.com>: hugetlbfs: fix a truncation issue in hugepages parameter Subsystem: mm/pagemap Suren Baghdasaryan <surenb@google.com>: mm: fix use-after-free bug when mm->mmap is reused after being freed Subsystem: mm/selftests "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: selftest/vm: fix map_fixed_noreplace test failure Subsystem: mm/memcg Roman Gushchin <roman.gushchin@linux.dev>: MAINTAINERS: add Roman as a memcg co-maintainer Vladimir Davydov <vdavydov.dev@gmail.com>: MAINTAINERS: remove Vladimir from memcg maintainers Shakeel Butt <shakeelb@google.com>: MAINTAINERS: add Shakeel as a memcg co-maintainer Subsystem: m/slab Vlastimil Babka <vbabka@suse.cz>: MAINTAINERS, SLAB: add Roman as reviewer, git tree Subsystem: mailmap Roman Gushchin <roman.gushchin@linux.dev>: mailmap: update Roman Gushchin's email Subsystem: memfd Mike Kravetz <mike.kravetz@oracle.com>: selftests/memfd: clean up mapping in mfd_fail_write .mailmap | 3 + MAINTAINERS | 6 ++ lib/test_kasan.c | 5 +- mm/hugetlb.c | 11 ++--- mm/mmap.c | 1 tools/testing/selftests/memfd/memfd_test.c | 1 tools/testing/selftests/vm/map_fixed_noreplace.c | 49 +++++++++++++++++------ 7 files changed, 56 insertions(+), 20 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-02-12 0:27 Andrew Morton 2022-02-12 2:02 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2022-02-12 0:27 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43. Subsystems affected by this patch series: binfmt procfs mm/vmscan mm/memcg mm/kfence Subsystem: binfmt Mike Rapoport <rppt@linux.ibm.com>: fs/binfmt_elf: fix PT_LOAD p_align values for loaders Subsystem: procfs Yang Shi <shy828301@gmail.com>: fs/proc: task_mmu.c: don't read mapcount for migration entry Subsystem: mm/vmscan Mel Gorman <mgorman@suse.de>: mm: vmscan: remove deadlock due to throttling failing to make progress Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: memcg: synchronize objcg lists with a dedicated spinlock Subsystem: mm/kfence Peng Liu <liupeng256@huawei.com>: kfence: make test case compatible with run time set sample interval fs/binfmt_elf.c | 2 +- fs/proc/task_mmu.c | 40 +++++++++++++++++++++++++++++++--------- include/linux/kfence.h | 2 ++ include/linux/memcontrol.h | 5 +++-- mm/kfence/core.c | 3 ++- mm/kfence/kfence_test.c | 8 ++++---- mm/memcontrol.c | 10 +++++----- mm/vmscan.c | 4 +++- 8 files changed, 51 insertions(+), 23 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2022-02-12 0:27 incoming Andrew Morton @ 2022-02-12 2:02 ` Linus Torvalds 2022-02-12 5:24 ` incoming Andrew Morton 0 siblings, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2022-02-12 2:02 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits, patches On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43. So this *completely* flummoxed 'b4', because you first sent the wrong series, and then sent the right one in the same thread. I fetched the emails manually, but honestly, this was confusing even then, with two "[PATCH x/5]" series where the only way to tell the right one was basically by date of email. They did arrive in the same order in my mailbox, but even that wouldn't have been guaranteed if there had been some mailer delays somewhere.. So next time when you mess up, resend it all as a completely new series and completely new threading - so with a new header email too. Please? And since I'm here, let me just verify that yes, the series you actually want me to apply is this one (as described by the head email): Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values .. Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f.. Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl.. Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a .. Subject: [patch 5/5] kfence: make test case compatible with run.. and not the other one with GUP patches? Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2022-02-12 2:02 ` incoming Linus Torvalds @ 2022-02-12 5:24 ` Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-02-12 5:24 UTC (permalink / raw) To: Linus Torvalds; +Cc: Linux-MM, mm-commits, patches On Fri, 11 Feb 2022 18:02:53 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43. > > So this *completely* flummoxed 'b4', because you first sent the wrong > series, and then sent the right one in the same thread. > > I fetched the emails manually, but honestly, this was confusing even > then, with two "[PATCH x/5]" series where the only way to tell the > right one was basically by date of email. They did arrive in the same > order in my mailbox, but even that wouldn't have been guaranteed if > there had been some mailer delays somewhere.. Yes, I wondered. Sorry bout that. > So next time when you mess up, resend it all as a completely new > series and completely new threading - so with a new header email too. > Please? Wilco. > And since I'm here, let me just verify that yes, the series you > actually want me to apply is this one (as described by the head > email): > > Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values .. > Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f.. > Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl.. > Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a .. > Subject: [patch 5/5] kfence: make test case compatible with run.. > > and not the other one with GUP patches? Those are the ones. Five fixes, three with cc:stable. ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-02-04 4:48 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-02-04 4:48 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 10 patches, based on 1f2cfdd349b7647f438c1e552dc1b983da86d830. Subsystems affected by this patch series: mm/vmscan mm/debug mm/pagemap ipc mm/kmemleak MAINTAINERS mm/selftests Subsystem: mm/vmscan Chen Wandun <chenwandun@huawei.com>: Revert "mm/page_isolation: unset migratetype directly for non Buddy page" Subsystem: mm/debug Pasha Tatashin <pasha.tatashin@soleen.com>: Patch series "page table check fixes and cleanups", v5: mm/debug_vm_pgtable: remove pte entry from the page table mm/page_table_check: use unsigned long for page counters and cleanup mm/khugepaged: unify collapse pmd clear, flush and free mm/page_table_check: check entries at pmd levels Subsystem: mm/pagemap Mike Rapoport <rppt@linux.ibm.com>: mm/pgtable: define pte_index so that preprocessor could recognize it Subsystem: ipc Minghao Chi <chi.minghao@zte.com.cn>: ipc/sem: do not sleep with a spin lock held Subsystem: mm/kmemleak Lang Yu <lang.yu@amd.com>: mm/kmemleak: avoid scanning potential huge holes Subsystem: MAINTAINERS Mike Rapoport <rppt@linux.ibm.com>: MAINTAINERS: update rppt's email Subsystem: mm/selftests Shuah Khan <skhan@linuxfoundation.org>: kselftest/vm: revert "tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner" MAINTAINERS | 2 - include/linux/page_table_check.h | 19 ++++++++++ include/linux/pgtable.h | 1 ipc/sem.c | 4 +- mm/debug_vm_pgtable.c | 2 + mm/khugepaged.c | 37 +++++++++++--------- mm/kmemleak.c | 13 +++---- mm/page_isolation.c | 2 - mm/page_table_check.c | 55 +++++++++++++++---------------- tools/testing/selftests/vm/userfaultfd.c | 11 ++++-- 10 files changed, 89 insertions(+), 57 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-01-29 21:40 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-01-29 21:40 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 12 patches, based on f8c7e4ede46fe63ff10000669652648aab09d112. Subsystems affected by this patch series: sysctl binfmt ia64 mm/memory-failure mm/folios selftests mm/kasan mm/psi ocfs2 Subsystem: sysctl Andrew Morton <akpm@linux-foundation.org>: include/linux/sysctl.h: fix register_sysctl_mount_point() return type Subsystem: binfmt Tong Zhang <ztong0001@gmail.com>: binfmt_misc: fix crash when load/unload module Subsystem: ia64 Randy Dunlap <rdunlap@infradead.org>: ia64: make IA64_MCA_RECOVERY bool instead of tristate Subsystem: mm/memory-failure Joao Martins <joao.m.martins@oracle.com>: memory-failure: fetch compound_head after pgmap_pfn_valid() Subsystem: mm/folios Wei Yang <richard.weiyang@gmail.com>: mm: page->mapping folio->mapping should have the same offset Subsystem: selftests Maor Gottlieb <maorg@nvidia.com>: tools/testing/scatterlist: add missing defines Subsystem: mm/kasan Marco Elver <elver@google.com>: kasan: test: fix compatibility with FORTIFY_SOURCE Peter Collingbourne <pcc@google.com>: mm, kasan: use compare-exchange operation to set KASAN page tag Subsystem: mm/psi Suren Baghdasaryan <surenb@google.com>: psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n Subsystem: ocfs2 Joseph Qi <joseph.qi@linux.alibaba.com>: Patch series "ocfs2: fix a deadlock case": jbd2: export jbd2_journal_[grab|put]_journal_head ocfs2: fix a deadlock when commit trans arch/ia64/Kconfig | 2 fs/binfmt_misc.c | 8 +-- fs/jbd2/journal.c | 2 fs/ocfs2/suballoc.c | 25 ++++------- include/linux/mm.h | 17 +++++-- include/linux/mm_types.h | 1 include/linux/psi.h | 11 ++-- include/linux/sysctl.h | 2 kernel/sched/psi.c | 79 ++++++++++++++++++----------------- lib/test_kasan.c | 5 ++ mm/memory-failure.c | 6 ++ tools/testing/scatterlist/linux/mm.h | 3 - 12 files changed, 91 insertions(+), 70 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-01-29 2:13 Andrew Morton 2022-01-29 4:25 ` incoming Matthew Wilcox 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2022-01-29 2:13 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f. Subsystems affected by this patch series: sysctl binfmt ia64 mm/memory-failure mm/folios selftests mm/kasan mm/psi ocfs2 Subsystem: sysctl Andrew Morton <akpm@linux-foundation.org>: include/linux/sysctl.h: fix register_sysctl_mount_point() return type Subsystem: binfmt Tong Zhang <ztong0001@gmail.com>: binfmt_misc: fix crash when load/unload module Subsystem: ia64 Randy Dunlap <rdunlap@infradead.org>: ia64: make IA64_MCA_RECOVERY bool instead of tristate Subsystem: mm/memory-failure Joao Martins <joao.m.martins@oracle.com>: memory-failure: fetch compound_head after pgmap_pfn_valid() Subsystem: mm/folios Wei Yang <richard.weiyang@gmail.com>: mm: page->mapping folio->mapping should have the same offset Subsystem: selftests Maor Gottlieb <maorg@nvidia.com>: tools/testing/scatterlist: add missing defines Subsystem: mm/kasan Marco Elver <elver@google.com>: kasan: test: fix compatibility with FORTIFY_SOURCE Peter Collingbourne <pcc@google.com>: mm, kasan: use compare-exchange operation to set KASAN page tag Subsystem: mm/psi Suren Baghdasaryan <surenb@google.com>: psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n Subsystem: ocfs2 Joseph Qi <joseph.qi@linux.alibaba.com>: Patch series "ocfs2: fix a deadlock case": jbd2: export jbd2_journal_[grab|put]_journal_head ocfs2: fix a deadlock when commit trans arch/ia64/Kconfig | 2 fs/binfmt_misc.c | 8 +-- fs/jbd2/journal.c | 2 fs/ocfs2/suballoc.c | 25 ++++------- include/linux/mm.h | 17 +++++-- include/linux/mm_types.h | 1 include/linux/psi.h | 11 ++-- include/linux/sysctl.h | 2 kernel/sched/psi.c | 79 ++++++++++++++++++----------------- lib/test_kasan.c | 5 ++ mm/memory-failure.c | 6 ++ tools/testing/scatterlist/linux/mm.h | 3 - 12 files changed, 91 insertions(+), 70 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2022-01-29 2:13 incoming Andrew Morton @ 2022-01-29 4:25 ` Matthew Wilcox 2022-01-29 6:23 ` incoming Andrew Morton 0 siblings, 1 reply; 322+ messages in thread From: Matthew Wilcox @ 2022-01-29 4:25 UTC (permalink / raw) To: Andrew Morton; +Cc: Linus Torvalds, mm-commits, linux-mm On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote: > 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f. ^^ I see 7? ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2022-01-29 4:25 ` incoming Matthew Wilcox @ 2022-01-29 6:23 ` Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-01-29 6:23 UTC (permalink / raw) To: Matthew Wilcox; +Cc: Linus Torvalds, mm-commits, linux-mm On Sat, 29 Jan 2022 04:25:33 +0000 Matthew Wilcox <willy@infradead.org> wrote: > On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote: > > 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f. > ^^ > > I see 7? Crap, sorry, ignore all this, shall redo tomorrow. (It wasn't a good day over here. The thing with disk drives is that the bigger they are, the harder they fall). ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-01-22 6:10 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-01-22 6:10 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits This is the post-linux-next queue. Material which was based on or dependent upon material which was in -next. 69 patches, based on 9b57f458985742bd1c585f4c7f36d04634ce1143. Subsystems affected by this patch series: mm/migration sysctl mm/zsmalloc proc lib Subsystem: mm/migration Alistair Popple <apopple@nvidia.com>: mm/migrate.c: rework migration_entry_wait() to not take a pageref Subsystem: sysctl Xiaoming Ni <nixiaoming@huawei.com>: Patch series "sysctl: first set of kernel/sysctl cleanups", v2: sysctl: add a new register_sysctl_init() interface sysctl: move some boundary constants from sysctl.c to sysctl_vals hung_task: move hung_task sysctl interface to hung_task.c watchdog: move watchdog sysctl interface to watchdog.c Stephen Kitt <steve@sk2.org>: sysctl: make ngroups_max const Xiaoming Ni <nixiaoming@huawei.com>: sysctl: use const for typically used max/min proc sysctls sysctl: use SYSCTL_ZERO to replace some static int zero uses aio: move aio sysctl to aio.c dnotify: move dnotify sysctl to dnotify.c Luis Chamberlain <mcgrof@kernel.org>: Patch series "sysctl: second set of kernel/sysctl cleanups", v2: hpet: simplify subdirectory registration with register_sysctl() i915: simplify subdirectory registration with register_sysctl() macintosh/mac_hid.c: simplify subdirectory registration with register_sysctl() ocfs2: simplify subdirectory registration with register_sysctl() test_sysctl: simplify subdirectory registration with register_sysctl() Xiaoming Ni <nixiaoming@huawei.com>: inotify: simplify subdirectory registration with register_sysctl() Luis Chamberlain <mcgrof@kernel.org>: cdrom: simplify subdirectory registration with register_sysctl() Xiaoming Ni <nixiaoming@huawei.com>: eventpoll: simplify sysctl declaration with register_sysctl() Patch series "sysctl: 3rd set of kernel/sysctl cleanups", v2: firmware_loader: move firmware sysctl to its own files random: move the random sysctl declarations to its own file Luis Chamberlain <mcgrof@kernel.org>: sysctl: add helper to register a sysctl mount point fs: move binfmt_misc sysctl to its own file Xiaoming Ni <nixiaoming@huawei.com>: printk: move printk sysctl to printk/sysctl.c scsi/sg: move sg-big-buff sysctl to scsi/sg.c stackleak: move stack_erasing sysctl to stackleak.c Luis Chamberlain <mcgrof@kernel.org>: sysctl: share unsigned long const values Patch series "sysctl: 4th set of kernel/sysctl cleanups": fs: move inode sysctls to its own file fs: move fs stat sysctls to file_table.c fs: move dcache sysctls to its own file sysctl: move maxolduid as a sysctl specific const fs: move shared sysctls to fs/sysctls.c fs: move locking sysctls where they are used fs: move namei sysctls to its own file fs: move fs/exec.c sysctls into its own file fs: move pipe sysctls to is own file Patch series "sysctl: add and use base directory declarer and registration helper": sysctl: add and use base directory declarer and registration helper fs: move namespace sysctls and declare fs base directory kernel/sysctl.c: rename sysctl_init() to sysctl_init_bases() Xiaoming Ni <nixiaoming@huawei.com>: printk: fix build warning when CONFIG_PRINTK=n fs/coredump: move coredump sysctls into its own file kprobe: move sysctl_kprobes_optimization to kprobes.c Colin Ian King <colin.i.king@gmail.com>: kernel/sysctl.c: remove unused variable ten_thousand Baokun Li <libaokun1@huawei.com>: sysctl: returns -EINVAL when a negative value is passed to proc_doulongvec_minmax Subsystem: mm/zsmalloc Minchan Kim <minchan@kernel.org>: Patch series "zsmalloc: remove bit_spin_lock", v2: zsmalloc: introduce some helper functions zsmalloc: rename zs_stat_type to class_stat_type zsmalloc: decouple class actions from zspage works zsmalloc: introduce obj_allocated zsmalloc: move huge compressed obj from page to zspage zsmalloc: remove zspage isolation for migration locking/rwlocks: introduce write_lock_nested zsmalloc: replace per zpage lock with pool->migrate_lock Mike Galbraith <umgwanakikbuti@gmail.com>: zsmalloc: replace get_cpu_var with local_lock Subsystem: proc Muchun Song <songmuchun@bytedance.com>: fs: proc: store PDE()->data into inode->i_private proc: remove PDE_DATA() completely Subsystem: lib Vlastimil Babka <vbabka@suse.cz>: lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() lib/stackdepot: fix spelling mistake and grammar in pr_err message lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup3 lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup4 Marco Elver <elver@google.com>: lib/stackdepot: always do filter_irq_stacks() in stack_depot_save() Christoph Hellwig <hch@lst.de>: Patch series "remove Xen tmem leftovers": mm: remove cleancache frontswap: remove frontswap_writethrough frontswap: remove frontswap_tmem_exclusive_gets frontswap: remove frontswap_shrink frontswap: remove frontswap_curr_pages frontswap: simplify frontswap_init frontswap: remove the frontswap exports mm: simplify try_to_unuse frontswap: remove frontswap_test frontswap: simplify frontswap_register_ops mm: mark swap_lock and swap_active_head static frontswap: remove support for multiple ops mm: hide the FRONTSWAP Kconfig symbol Documentation/vm/cleancache.rst | 296 ------ Documentation/vm/frontswap.rst | 31 Documentation/vm/index.rst | 1 MAINTAINERS | 7 arch/alpha/kernel/srm_env.c | 4 arch/arm/configs/bcm2835_defconfig | 1 arch/arm/configs/qcom_defconfig | 1 arch/arm/kernel/atags_proc.c | 2 arch/arm/mm/alignment.c | 2 arch/ia64/kernel/salinfo.c | 10 arch/m68k/configs/amiga_defconfig | 1 arch/m68k/configs/apollo_defconfig | 1 arch/m68k/configs/atari_defconfig | 1 arch/m68k/configs/bvme6000_defconfig | 1 arch/m68k/configs/hp300_defconfig | 1 arch/m68k/configs/mac_defconfig | 1 arch/m68k/configs/multi_defconfig | 1 arch/m68k/configs/mvme147_defconfig | 1 arch/m68k/configs/mvme16x_defconfig | 1 arch/m68k/configs/q40_defconfig | 1 arch/m68k/configs/sun3_defconfig | 1 arch/m68k/configs/sun3x_defconfig | 1 arch/powerpc/kernel/proc_powerpc.c | 4 arch/s390/configs/debug_defconfig | 1 arch/s390/configs/defconfig | 1 arch/sh/mm/alignment.c | 4 arch/xtensa/platforms/iss/simdisk.c | 4 block/bdev.c | 5 drivers/acpi/proc.c | 2 drivers/base/firmware_loader/fallback.c | 7 drivers/base/firmware_loader/fallback.h | 11 drivers/base/firmware_loader/fallback_table.c | 25 drivers/cdrom/cdrom.c | 23 drivers/char/hpet.c | 22 drivers/char/random.c | 14 drivers/gpu/drm/drm_dp_mst_topology.c | 1 drivers/gpu/drm/drm_mm.c | 4 drivers/gpu/drm/drm_modeset_lock.c | 9 drivers/gpu/drm/i915/i915_perf.c | 22 drivers/gpu/drm/i915/intel_runtime_pm.c | 3 drivers/hwmon/dell-smm-hwmon.c | 4 drivers/macintosh/mac_hid.c | 24 drivers/net/bonding/bond_procfs.c | 8 drivers/net/wireless/cisco/airo.c | 22 drivers/net/wireless/intersil/hostap/hostap_ap.c | 16 drivers/net/wireless/intersil/hostap/hostap_download.c | 2 drivers/net/wireless/intersil/hostap/hostap_proc.c | 24 drivers/net/wireless/ray_cs.c | 2 drivers/nubus/proc.c | 36 drivers/parisc/led.c | 4 drivers/pci/proc.c | 10 drivers/platform/x86/thinkpad_acpi.c | 4 drivers/platform/x86/toshiba_acpi.c | 16 drivers/pnp/isapnp/proc.c | 2 drivers/pnp/pnpbios/proc.c | 4 drivers/scsi/scsi_proc.c | 4 drivers/scsi/sg.c | 35 drivers/usb/gadget/function/rndis.c | 4 drivers/zorro/proc.c | 2 fs/Makefile | 4 fs/afs/proc.c | 6 fs/aio.c | 31 fs/binfmt_misc.c | 6 fs/btrfs/extent_io.c | 10 fs/btrfs/super.c | 2 fs/coredump.c | 66 + fs/dcache.c | 37 fs/eventpoll.c | 10 fs/exec.c | 145 +-- fs/ext4/mballoc.c | 14 fs/ext4/readpage.c | 6 fs/ext4/super.c | 3 fs/f2fs/data.c | 13 fs/file_table.c | 47 - fs/inode.c | 39 fs/jbd2/journal.c | 2 fs/locks.c | 34 fs/mpage.c | 7 fs/namei.c | 58 + fs/namespace.c | 24 fs/notify/dnotify/dnotify.c | 21 fs/notify/fanotify/fanotify_user.c | 10 fs/notify/inotify/inotify_user.c | 11 fs/ntfs3/ntfs_fs.h | 1 fs/ocfs2/stackglue.c | 25 fs/ocfs2/super.c | 2 fs/pipe.c | 64 + fs/proc/generic.c | 6 fs/proc/inode.c | 1 fs/proc/internal.h | 5 fs/proc/proc_net.c | 8 fs/proc/proc_sysctl.c | 67 + fs/super.c | 3 fs/sysctls.c | 47 - include/linux/aio.h | 4 include/linux/cleancache.h | 124 -- include/linux/coredump.h | 10 include/linux/dcache.h | 10 include/linux/dnotify.h | 1 include/linux/fanotify.h | 2 include/linux/frontswap.h | 35 include/linux/fs.h | 18 include/linux/inotify.h | 3 include/linux/kprobes.h | 6 include/linux/migrate.h | 2 include/linux/mount.h | 3 include/linux/pipe_fs_i.h | 4 include/linux/poll.h | 2 include/linux/printk.h | 4 include/linux/proc_fs.h | 17 include/linux/ref_tracker.h | 2 include/linux/rwlock.h | 6 include/linux/rwlock_api_smp.h | 8 include/linux/rwlock_rt.h | 10 include/linux/sched/sysctl.h | 14 include/linux/seq_file.h | 2 include/linux/shmem_fs.h | 3 include/linux/spinlock_api_up.h | 1 include/linux/stackdepot.h | 25 include/linux/stackleak.h | 5 include/linux/swapfile.h | 3 include/linux/sysctl.h | 67 + include/scsi/sg.h | 4 init/main.c | 9 ipc/util.c | 2 kernel/hung_task.c | 81 + kernel/irq/proc.c | 8 kernel/kprobes.c | 30 kernel/locking/spinlock.c | 10 kernel/locking/spinlock_rt.c | 12 kernel/printk/Makefile | 5 kernel/printk/internal.h | 8 kernel/printk/printk.c | 4 kernel/printk/sysctl.c | 85 + kernel/resource.c | 4 kernel/stackleak.c | 26 kernel/sysctl.c | 790 +---------------- kernel/watchdog.c | 101 ++ lib/Kconfig | 4 lib/Kconfig.kasan | 2 lib/stackdepot.c | 46 lib/test_sysctl.c | 22 mm/Kconfig | 40 mm/Makefile | 1 mm/cleancache.c | 315 ------ mm/filemap.c | 102 +- mm/frontswap.c | 259 ----- mm/kasan/common.c | 1 mm/migrate.c | 38 mm/page_owner.c | 2 mm/shmem.c | 33 mm/swapfile.c | 90 - mm/truncate.c | 15 mm/zsmalloc.c | 557 ++++------- mm/zswap.c | 8 net/atm/proc.c | 4 net/bluetooth/af_bluetooth.c | 8 net/can/bcm.c | 2 net/can/proc.c | 2 net/core/neighbour.c | 6 net/core/pktgen.c | 6 net/ipv4/netfilter/ipt_CLUSTERIP.c | 6 net/ipv4/raw.c | 8 net/ipv4/tcp_ipv4.c | 2 net/ipv4/udp.c | 6 net/netfilter/x_tables.c | 10 net/netfilter/xt_hashlimit.c | 18 net/netfilter/xt_recent.c | 4 net/sunrpc/auth_gss/svcauth_gss.c | 4 net/sunrpc/cache.c | 24 net/sunrpc/stats.c | 2 sound/core/info.c | 4 172 files changed, 1877 insertions(+), 2931 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-01-20 2:07 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-01-20 2:07 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 55 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16") Subsystems affected by this patch series: percpu procfs sysctl misc core-kernel get_maintainer lib checkpatch binfmt nilfs2 hfs fat adfs panic delayacct kconfig kcov ubsan Subsystem: percpu Kefeng Wang <wangkefeng.wang@huawei.com>: Patch series "mm: percpu: Cleanup percpu first chunk function": mm: percpu: generalize percpu related config mm: percpu: add pcpu_fc_cpu_to_node_fn_t typedef mm: percpu: add generic pcpu_fc_alloc/free funciton mm: percpu: add generic pcpu_populate_pte() function Subsystem: procfs David Hildenbrand <david@redhat.com>: proc/vmcore: don't fake reading zeroes on surprise vmcore_cb unregistration Hans de Goede <hdegoede@redhat.com>: proc: make the proc_create[_data]() stubs static inlines Qi Zheng <zhengqi.arch@bytedance.com>: proc: convert the return type of proc_fd_access_allowed() to be boolean Subsystem: sysctl Geert Uytterhoeven <geert+renesas@glider.be>: sysctl: fix duplicate path separator in printed entries luo penghao <luo.penghao@zte.com.cn>: sysctl: remove redundant ret assignment Subsystem: misc Andy Shevchenko <andriy.shevchenko@linux.intel.com>: include/linux/unaligned: replace kernel.h with the necessary inclusions kernel.h: include a note to discourage people from including it in headers Subsystem: core-kernel Yafang Shao <laoar.shao@gmail.com>: Patch series "task comm cleanups", v2: fs/exec: replace strlcpy with strscpy_pad in __set_task_comm fs/exec: replace strncpy with strscpy_pad in __get_task_comm drivers/infiniband: replace open-coded string copy with get_task_comm fs/binfmt_elf: replace open-coded string copy with get_task_comm samples/bpf/test_overhead_kprobe_kern: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm tools/bpf/bpftool/skeleton: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm tools/testing/selftests/bpf: replace open-coded 16 with TASK_COMM_LEN kthread: dynamically allocate memory to store kthread's full name Davidlohr Bueso <dave@stgolabs.net>: kernel/sys.c: only take tasklist_lock for get/setpriority(PRIO_PGRP) Subsystem: get_maintainer Randy Dunlap <rdunlap@infradead.org>: get_maintainer: don't remind about no git repo when --nogit is used Subsystem: lib Alexey Dobriyan <adobriyan@gmail.com>: kstrtox: uninline everything Andy Shevchenko <andriy.shevchenko@linux.intel.com>: list: introduce list_is_head() helper and re-use it in list.h Zhen Lei <thunder.leizhen@huawei.com>: lib/list_debug.c: print more list debugging context in __list_del_entry_valid() Isabella Basso <isabbasso@riseup.net>: Patch series "test_hash.c: refactor into KUnit", v3: hash.h: remove unused define directive test_hash.c: split test_int_hash into arch-specific functions test_hash.c: split test_hash_init lib/Kconfig.debug: properly split hash test kernel entries test_hash.c: refactor into kunit Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kunit: replace kernel.h with the necessary inclusions uuid: discourage people from using UAPI header in new code uuid: remove licence boilerplate text from the header Andrey Konovalov <andreyknvl@google.com>: lib/test_meminit: destroy cache in kmem_cache_alloc_bulk() test Subsystem: checkpatch Jerome Forissier <jerome@forissier.org>: checkpatch: relax regexp for COMMIT_LOG_LONG_LINE Joe Perches <joe@perches.com>: checkpatch: improve Kconfig help test Rikard Falkeborn <rikard.falkeborn@gmail.com>: const_structs.checkpatch: add frequently used ops structs Subsystem: binfmt "H.J. Lu" <hjl.tools@gmail.com>: fs/binfmt_elf: use PT_LOAD p_align values for static PIE Subsystem: nilfs2 Colin Ian King <colin.i.king@gmail.com>: nilfs2: remove redundant pointer sbufs Subsystem: hfs Kees Cook <keescook@chromium.org>: hfsplus: use struct_group_attr() for memcpy() region Subsystem: fat "NeilBrown" <neilb@suse.de>: FAT: use io_schedule_timeout() instead of congestion_wait() Subsystem: adfs Minghao Chi <chi.minghao@zte.com.cn>: fs/adfs: remove unneeded variable make code cleaner Subsystem: panic Marco Elver <elver@google.com>: panic: use error_report_end tracepoint on warnings Sebastian Andrzej Siewior <bigeasy@linutronix.de>: panic: remove oops_id Subsystem: delayacct Yang Yang <yang.yang29@zte.com.cn>: delayacct: support swapin delay accounting for swapping without blkio delayacct: fix incomplete disable operation when switch enable to disable delayacct: cleanup flags in struct task_delay_info and functions use it wangyong <wang.yong12@zte.com.cn>: Documentation/accounting/delay-accounting.rst: add thrashing page cache and direct compact delayacct: track delays from memory compact Subsystem: kconfig Qian Cai <quic_qiancai@quicinc.com>: configs: introduce debug.config for CI-like setup Nathan Chancellor <nathan@kernel.org>: Patch series "Fix CONFIG_TEST_KMOD with 256kB page size": arch/Kconfig: split PAGE_SIZE_LESS_THAN_256KB from PAGE_SIZE_LESS_THAN_64KB btrfs: use generic Kconfig option for 256kB page size limit lib/Kconfig.debug: make TEST_KMOD depend on PAGE_SIZE_LESS_THAN_256KB Subsystem: kcov Marco Elver <elver@google.com>: kcov: fix generic Kconfig dependencies if ARCH_WANTS_NO_INSTR Subsystem: ubsan Kees Cook <keescook@chromium.org>: ubsan: remove CONFIG_UBSAN_OBJECT_SIZE Colin Ian King <colin.i.king@gmail.com>: lib: remove redundant assignment to variable ret Documentation/accounting/delay-accounting.rst | 63 +- arch/Kconfig | 4 arch/arm64/Kconfig | 20 arch/ia64/Kconfig | 9 arch/mips/Kconfig | 10 arch/mips/mm/init.c | 28 - arch/powerpc/Kconfig | 17 arch/powerpc/kernel/setup_64.c | 113 ---- arch/riscv/Kconfig | 10 arch/sparc/Kconfig | 12 arch/sparc/kernel/led.c | 8 arch/sparc/kernel/smp_64.c | 119 ----- arch/x86/Kconfig | 19 arch/x86/kernel/setup_percpu.c | 82 --- drivers/base/arch_numa.c | 78 --- drivers/infiniband/hw/qib/qib.h | 2 drivers/infiniband/hw/qib/qib_file_ops.c | 2 drivers/infiniband/sw/rxe/rxe_qp.c | 3 drivers/net/wireless/broadcom/brcm80211/brcmfmac/xtlv.c | 2 fs/adfs/inode.c | 4 fs/binfmt_elf.c | 6 fs/btrfs/Kconfig | 3 fs/exec.c | 5 fs/fat/file.c | 5 fs/hfsplus/hfsplus_raw.h | 12 fs/hfsplus/xattr.c | 4 fs/nilfs2/page.c | 4 fs/proc/array.c | 3 fs/proc/base.c | 4 fs/proc/proc_sysctl.c | 9 fs/proc/vmcore.c | 10 include/kunit/assert.h | 2 include/linux/delayacct.h | 107 ++-- include/linux/elfcore-compat.h | 5 include/linux/elfcore.h | 5 include/linux/hash.h | 5 include/linux/kernel.h | 9 include/linux/kthread.h | 1 include/linux/list.h | 36 - include/linux/percpu.h | 21 include/linux/proc_fs.h | 12 include/linux/sched.h | 9 include/linux/unaligned/packed_struct.h | 2 include/trace/events/error_report.h | 8 include/uapi/linux/taskstats.h | 6 include/uapi/linux/uuid.h | 10 kernel/configs/debug.config | 105 ++++ kernel/delayacct.c | 49 +- kernel/kthread.c | 32 + kernel/panic.c | 21 kernel/sys.c | 16 lib/Kconfig.debug | 45 + lib/Kconfig.ubsan | 13 lib/Makefile | 5 lib/asn1_encoder.c | 2 lib/kstrtox.c | 12 lib/list_debug.c | 8 lib/lz4/lz4defs.h | 2 lib/test_hash.c | 375 +++++++--------- lib/test_meminit.c | 1 lib/test_ubsan.c | 22 mm/Kconfig | 12 mm/memory.c | 4 mm/page_alloc.c | 3 mm/page_io.c | 3 mm/percpu.c | 168 +++++-- samples/bpf/offwaketime_kern.c | 4 samples/bpf/test_overhead_kprobe_kern.c | 11 samples/bpf/test_overhead_tp_kern.c | 5 scripts/Makefile.ubsan | 1 scripts/checkpatch.pl | 54 +- scripts/const_structs.checkpatch | 23 scripts/get_maintainer.pl | 2 tools/accounting/getdelays.c | 8 tools/bpf/bpftool/skeleton/pid_iter.bpf.c | 4 tools/include/linux/hash.h | 5 tools/testing/selftests/bpf/progs/test_stacktrace_map.c | 6 tools/testing/selftests/bpf/progs/test_tracepoint.c | 6 78 files changed, 943 insertions(+), 992 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2022-01-14 22:02 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2022-01-14 22:02 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 146 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16") Subsystems affected by this patch series: kthread ia64 scripts ntfs squashfs ocfs2 vfs mm/slab-generic mm/slab mm/kmemleak mm/dax mm/kasan mm/debug mm/pagecache mm/gup mm/shmem mm/frontswap mm/memremap mm/memcg mm/selftests mm/pagemap mm/dma mm/vmalloc mm/memory-failure mm/hugetlb mm/userfaultfd mm/vmscan mm/mempolicy mm/oom-kill mm/hugetlbfs mm/migration mm/thp mm/ksm mm/page-poison mm/percpu mm/rmap mm/zswap mm/zram mm/cleanups mm/hmm mm/damon Subsystem: kthread Cai Huoqing <caihuoqing@baidu.com>: kthread: add the helper function kthread_run_on_cpu() RDMA/siw: make use of the helper function kthread_run_on_cpu() ring-buffer: make use of the helper function kthread_run_on_cpu() rcutorture: make use of the helper function kthread_run_on_cpu() trace/osnoise: make use of the helper function kthread_run_on_cpu() trace/hwlat: make use of the helper function kthread_run_on_cpu() Subsystem: ia64 Yang Guang <yang.guang5@zte.com.cn>: ia64: module: use swap() to make code cleaner arch/ia64/kernel/setup.c: use swap() to make code cleaner Jason Wang <wangborong@cdjrlc.com>: ia64: fix typo in a comment Greg Kroah-Hartman <gregkh@linuxfoundation.org>: ia64: topology: use default_groups in kobj_type Subsystem: scripts Drew Fustini <dfustini@baylibre.com>: scripts/spelling.txt: add "oveflow" Subsystem: ntfs Yang Li <yang.lee@linux.alibaba.com>: fs/ntfs/attrib.c: fix one kernel-doc comment Subsystem: squashfs Zheng Liang <zhengliang6@huawei.com>: squashfs: provide backing_dev_info in order to disable read-ahead Subsystem: ocfs2 Zhang Mingyu <zhang.mingyu@zte.com.cn>: ocfs2: use BUG_ON instead of if condition followed by BUG. Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: clearly handle ocfs2_grab_pages_for_write() return value Greg Kroah-Hartman <gregkh@linuxfoundation.org>: ocfs2: use default_groups in kobj_type Colin Ian King <colin.i.king@gmail.com>: ocfs2: remove redundant assignment to pointer root_bh Greg Kroah-Hartman <gregkh@linuxfoundation.org>: ocfs2: cluster: use default_groups in kobj_type Colin Ian King <colin.i.king@gmail.com>: ocfs2: remove redundant assignment to variable free_space Subsystem: vfs Amit Daniel Kachhap <amit.kachhap@arm.com>: fs/ioctl: remove unnecessary __user annotation Subsystem: mm/slab-generic Marco Elver <elver@google.com>: mm/slab_common: use WARN() if cache still has objects on destroy Subsystem: mm/slab Muchun Song <songmuchun@bytedance.com>: mm: slab: make slab iterator functions static Subsystem: mm/kmemleak Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: kmemleak: fix kmemleak false positive report with HW tag-based kasan enable Calvin Zhang <calvinzhang.cool@gmail.com>: mm: kmemleak: alloc gray object for reserved region with direct map Kefeng Wang <wangkefeng.wang@huawei.com>: mm: defer kmemleak object creation of module_alloc() Subsystem: mm/dax Joao Martins <joao.m.martins@oracle.com>: Patch series "mm, device-dax: Introduce compound pages in devmap", v7: mm/page_alloc: split prep_compound_page into head and tail subparts mm/page_alloc: refactor memmap_init_zone_device() page init mm/memremap: add ZONE_DEVICE support for compound pages device-dax: use ALIGN() for determining pgoff device-dax: use struct_size() device-dax: ensure dev_dax->pgmap is valid for dynamic devices device-dax: factor out page mapping initialization device-dax: set mapping prior to vmf_insert_pfn{,_pmd,pud}() device-dax: remove pfn from __dev_dax_{pte,pmd,pud}_fault() device-dax: compound devmap support Subsystem: mm/kasan Marco Elver <elver@google.com>: kasan: test: add globals left-out-of-bounds test kasan: add ability to detect double-kmem_cache_destroy() kasan: test: add test case for double-kmem_cache_destroy() Andrey Konovalov <andreyknvl@google.com>: kasan: fix quarantine conflicting with init_on_free Subsystem: mm/debug "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm,fs: split dump_mapping() out from dump_page() Anshuman Khandual <anshuman.khandual@arm.com>: mm/debug_vm_pgtable: update comments regarding migration swap entries Subsystem: mm/pagecache chiminghao <chi.minghao@zte.com.cn>: mm/truncate.c: remove unneeded variable Subsystem: mm/gup Christophe Leroy <christophe.leroy@csgroup.eu>: gup: avoid multiple user access locking/unlocking in fault_in_{read/write}able Li Xinhai <lixinhai.lxh@gmail.com>: mm/gup.c: stricter check on THP migration entry during follow_pmd_mask Subsystem: mm/shmem Yang Shi <shy828301@gmail.com>: mm: shmem: don't truncate page if memory failure happens Gang Li <ligang.bdlg@bytedance.com>: shmem: fix a race between shmem_unused_huge_shrink and shmem_evict_inode Subsystem: mm/frontswap Christophe JAILLET <christophe.jaillet@wanadoo.fr>: mm/frontswap.c: use non-atomic '__set_bit()' when possible Subsystem: mm/memremap Subsystem: mm/memcg Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: make cgroup_memory_nokmem static Donghai Qiao <dqiao@redhat.com>: mm/page_counter: remove an incorrect call to propagate_protected_usage() Dan Schatzberg <schatzberg.dan@gmail.com>: mm/memcg: add oom_group_kill memory event Shakeel Butt <shakeelb@google.com>: memcg: better bounds on the memcg stats updates Wang Weiyang <wangweiyang2@huawei.com>: mm/memcg: use struct_size() helper in kzalloc() Shakeel Butt <shakeelb@google.com>: memcg: add per-memcg vmalloc stat Subsystem: mm/selftests chiminghao <chi.minghao@zte.com.cn>: tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner Subsystem: mm/pagemap Qi Zheng <zhengqi.arch@bytedance.com>: mm: remove redundant check about FAULT_FLAG_ALLOW_RETRY bit Colin Cross <ccross@google.com>: Patch series "mm: rearrange madvise code to allow for reuse", v11: mm: rearrange madvise code to allow for reuse mm: add a field to store names for private anonymous memory Suren Baghdasaryan <surenb@google.com>: mm: add anonymous vma name refcounting Arnd Bergmann <arnd@arndb.de>: mm: move anon_vma declarations to linux/mm_inline.h mm: move tlb_flush_pending inline helpers to mm_inline.h Suren Baghdasaryan <surenb@google.com>: mm: protect free_pgtables with mmap_lock write lock in exit_mmap mm: document locking restrictions for vm_operations_struct::close mm/oom_kill: allow process_mrelease to run under mmap_lock protection Shuah Khan <skhan@linuxfoundation.org>: docs/vm: add vmalloced-kernel-stacks document Pasha Tatashin <pasha.tatashin@soleen.com>: Patch series "page table check", v3: mm: change page type prior to adding page table entry mm: ptep_clear() page table helper mm: page table check x86: mm: add x86_64 support for page table check "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: remove last argument of reuse_swap_page() mm: remove the total_mapcount argument from page_trans_huge_map_swapcount() mm: remove the total_mapcount argument from page_trans_huge_mapcount() Subsystem: mm/dma Christian König <christian.koenig@amd.com>: mm/dmapool.c: revert "make dma pool to use kmalloc_node" Subsystem: mm/vmalloc Michal Hocko <mhocko@suse.com>: Patch series "extend vmalloc support for constrained allocations", v2: mm/vmalloc: alloc GFP_NO{FS,IO} for vmalloc mm/vmalloc: add support for __GFP_NOFAIL mm/vmalloc: be more explicit about supported gfp flags. mm: allow !GFP_KERNEL allocations for kvmalloc mm: make slab and vmalloc allocators __GFP_NOLOCKDEP aware "NeilBrown" <neilb@suse.de>: mm: introduce memalloc_retry_wait() Suren Baghdasaryan <surenb@google.com>: mm/pagealloc: sysctl: change watermark_scale_factor max limit to 30% Changcheng Deng <deng.changcheng@zte.com.cn>: mm: fix boolreturn.cocci warning Xiongwei Song <sxwjean@gmail.com>: mm: page_alloc: fix building error on -Werror=array-compare Michal Hocko <mhocko@suse.com>: mm: drop node from alloc_pages_vma Miles Chen <miles.chen@mediatek.com>: include/linux/gfp.h: further document GFP_DMA32 Anshuman Khandual <anshuman.khandual@arm.com>: mm/page_alloc.c: modify the comment section for alloc_contig_pages() Baoquan He <bhe@redhat.com>: Patch series "Handle warning of allocation failure on DMA zone w/o managed pages", v4: mm_zone: add function to check if managed dma zone exists dma/pool: create dma atomic pool only if dma zone has managed pages mm/page_alloc.c: do not warn allocation failure on zone DMA if no managed pages Subsystem: mm/memory-failure Subsystem: mm/hugetlb Mina Almasry <almasrymina@google.com>: hugetlb: add hugetlb.*.numa_stat file Yosry Ahmed <yosryahmed@google.com>: mm, hugepages: make memory size variable in hugepage-mremap selftest Yang Yang <yang.yang29@zte.com.cn>: mm/vmstat: add events for THP max_ptes_* exceeds Waiman Long <longman@redhat.com>: selftests/vm: make charge_reserved_hugetlb.sh work with existing cgroup setting Subsystem: mm/userfaultfd Peter Xu <peterx@redhat.com>: selftests/uffd: allow EINTR/EAGAIN Mike Kravetz <mike.kravetz@oracle.com>: userfaultfd/selftests: clean up hugetlb allocation code Subsystem: mm/vmscan Gang Li <ligang.bdlg@bytedance.com>: vmscan: make drop_slab_node static Chen Wandun <chenwandun@huawei.com>: mm/page_isolation: unset migratetype directly for non Buddy page Subsystem: mm/mempolicy "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "mm: add new syscall set_mempolicy_home_node", v6: mm/mempolicy: use policy_node helper with MPOL_PREFERRED_MANY mm/mempolicy: add set_mempolicy_home_node syscall mm/mempolicy: wire up syscall set_mempolicy_home_node Randy Dunlap <rdunlap@infradead.org>: mm/mempolicy: fix all kernel-doc warnings Subsystem: mm/oom-kill Jann Horn <jannh@google.com>: mm, oom: OOM sysrq should always kill a process Subsystem: mm/hugetlbfs Sean Christopherson <seanjc@google.com>: hugetlbfs: fix off-by-one error in hugetlb_vmdelete_list() Subsystem: mm/migration Baolin Wang <baolin.wang@linux.alibaba.com>: Patch series "Improve the migration stats": mm: migrate: fix the return value of migrate_pages() mm: migrate: correct the hugetlb migration stats mm: compaction: fix the migration stats in trace_mm_compaction_migratepages() mm: migrate: support multiple target nodes demotion mm: migrate: add more comments for selecting target node randomly Huang Ying <ying.huang@intel.com>: mm/migrate: move node demotion code to near its user Colin Ian King <colin.i.king@gmail.com>: mm/migrate: remove redundant variables used in a for-loop Subsystem: mm/thp Anshuman Khandual <anshuman.khandual@arm.com>: mm/thp: drop unused trace events hugepage_[invalidate|splitting] Subsystem: mm/ksm Nanyong Sun <sunnanyong@huawei.com>: mm: ksm: fix use-after-free kasan report in ksm_might_need_to_copy Subsystem: mm/page-poison Naoya Horiguchi <naoya.horiguchi@nec.com>: Patch series "mm/hwpoison: fix unpoison_memory()", v4: mm/hwpoison: mf_mutex for soft offline and unpoison mm/hwpoison: remove MF_MSG_BUDDY_2ND and MF_MSG_POISONED_HUGE mm/hwpoison: fix unpoison_memory() Subsystem: mm/percpu Qi Zheng <zhengqi.arch@bytedance.com>: mm: memcg/percpu: account extra objcg space to memory cgroups Subsystem: mm/rmap Huang Ying <ying.huang@intel.com>: mm/rmap: fix potential batched TLB flush race Subsystem: mm/zswap Zhaoyu Liu <zackary.liu.pro@gmail.com>: zpool: remove the list of pools_head Subsystem: mm/zram Luis Chamberlain <mcgrof@kernel.org>: zram: use ATTRIBUTE_GROUPS Subsystem: mm/cleanups Quanfa Fu <fuqf0919@gmail.com>: mm: fix some comment errors Ting Liu <liuting.0x7c00@bytedance.com>: mm: make some vars and functions static or __init Subsystem: mm/hmm Alistair Popple <apopple@nvidia.com>: mm/hmm.c: allow VM_MIXEDMAP to work with hmm_range_fault Subsystem: mm/damon Xin Hao <xhao@linux.alibaba.com>: Patch series "mm/damon: Do some small changes", v4: mm/damon: unified access_check function naming rules mm/damon: add 'age' of region tracepoint support mm/damon/core: use abs() instead of diff_of() mm/damon: remove some unneeded function definitions in damon.h Yihao Han <hanyihao@vivo.com>: mm/damon/vaddr: remove swap_ranges() and replace it with swap() Xin Hao <xhao@linux.alibaba.com>: mm/damon/schemes: add the validity judgment of thresholds mm/damon: move damon_rand() definition into damon.h mm/damon: modify damon_rand() macro to static inline function SeongJae Park <sj@kernel.org>: Patch series "mm/damon: Misc cleanups": mm/damon: convert macro functions to static inline functions Docs/admin-guide/mm/damon/usage: update for scheme quotas and watermarks Docs/admin-guide/mm/damon/usage: remove redundant information Docs/admin-guide/mm/damon/usage: mention tracepoint at the beginning Docs/admin-guide/mm/damon/usage: update for kdamond_pid and (mk|rm)_contexts mm/damon: remove a mistakenly added comment for a future feature Patch series "mm/damon/schemes: Extend stats for better online analysis and tuning": mm/damon/schemes: account scheme actions that successfully applied mm/damon/schemes: account how many times quota limit has exceeded mm/damon/reclaim: provide reclamation statistics Docs/admin-guide/mm/damon/reclaim: document statistics parameters mm/damon/dbgfs: support all DAMOS stats Docs/admin-guide/mm/damon/usage: update for schemes statistics Baolin Wang <baolin.wang@linux.alibaba.com>: mm/damon: add access checking for hugetlb pages Guoqing Jiang <guoqing.jiang@linux.dev>: mm/damon: move the implementation of damon_insert_region to damon.h SeongJae Park <sj@kernel.org>: Patch series "mm/damon: Hide unnecessary information disclosures": mm/damon/dbgfs: remove an unnecessary variable mm/damon/vaddr: use pr_debug() for damon_va_three_regions() failure logging mm/damon/vaddr: hide kernel pointer from damon_va_three_regions() failure log mm/damon: hide kernel pointer from tracepoint event Documentation/admin-guide/cgroup-v1/hugetlb.rst | 4 Documentation/admin-guide/cgroup-v2.rst | 11 Documentation/admin-guide/mm/damon/reclaim.rst | 25 Documentation/admin-guide/mm/damon/usage.rst | 235 +++++-- Documentation/admin-guide/mm/numa_memory_policy.rst | 16 Documentation/admin-guide/sysctl/vm.rst | 2 Documentation/filesystems/proc.rst | 6 Documentation/vm/arch_pgtable_helpers.rst | 20 Documentation/vm/index.rst | 2 Documentation/vm/page_migration.rst | 12 Documentation/vm/page_table_check.rst | 56 + Documentation/vm/vmalloced-kernel-stacks.rst | 153 ++++ MAINTAINERS | 9 arch/Kconfig | 3 arch/alpha/kernel/syscalls/syscall.tbl | 1 arch/alpha/mm/fault.c | 16 arch/arc/mm/fault.c | 3 arch/arm/mm/fault.c | 2 arch/arm/tools/syscall.tbl | 1 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 2 arch/arm64/kernel/module.c | 4 arch/arm64/mm/fault.c | 6 arch/hexagon/mm/vm_fault.c | 8 arch/ia64/kernel/module.c | 6 arch/ia64/kernel/setup.c | 5 arch/ia64/kernel/syscalls/syscall.tbl | 1 arch/ia64/kernel/topology.c | 3 arch/ia64/kernel/uncached.c | 2 arch/ia64/mm/fault.c | 16 arch/m68k/kernel/syscalls/syscall.tbl | 1 arch/m68k/mm/fault.c | 18 arch/microblaze/kernel/syscalls/syscall.tbl | 1 arch/microblaze/mm/fault.c | 18 arch/mips/kernel/syscalls/syscall_n32.tbl | 1 arch/mips/kernel/syscalls/syscall_n64.tbl | 1 arch/mips/kernel/syscalls/syscall_o32.tbl | 1 arch/mips/mm/fault.c | 19 arch/nds32/mm/fault.c | 16 arch/nios2/mm/fault.c | 18 arch/openrisc/mm/fault.c | 18 arch/parisc/kernel/syscalls/syscall.tbl | 1 arch/parisc/mm/fault.c | 18 arch/powerpc/kernel/syscalls/syscall.tbl | 1 arch/powerpc/mm/fault.c | 6 arch/riscv/mm/fault.c | 2 arch/s390/kernel/module.c | 5 arch/s390/kernel/syscalls/syscall.tbl | 1 arch/s390/mm/fault.c | 28 arch/sh/kernel/syscalls/syscall.tbl | 1 arch/sh/mm/fault.c | 18 arch/sparc/kernel/syscalls/syscall.tbl | 1 arch/sparc/mm/fault_32.c | 16 arch/sparc/mm/fault_64.c | 16 arch/um/kernel/trap.c | 8 arch/x86/Kconfig | 1 arch/x86/entry/syscalls/syscall_32.tbl | 1 arch/x86/entry/syscalls/syscall_64.tbl | 1 arch/x86/include/asm/pgtable.h | 31 - arch/x86/kernel/module.c | 7 arch/x86/mm/fault.c | 3 arch/xtensa/kernel/syscalls/syscall.tbl | 1 arch/xtensa/mm/fault.c | 17 drivers/block/zram/zram_drv.c | 11 drivers/dax/bus.c | 32 + drivers/dax/bus.h | 1 drivers/dax/device.c | 140 ++-- drivers/infiniband/sw/siw/siw_main.c | 7 drivers/of/fdt.c | 6 fs/ext4/extents.c | 8 fs/ext4/inline.c | 5 fs/ext4/page-io.c | 9 fs/f2fs/data.c | 4 fs/f2fs/gc.c | 5 fs/f2fs/inode.c | 4 fs/f2fs/node.c | 4 fs/f2fs/recovery.c | 6 fs/f2fs/segment.c | 9 fs/f2fs/super.c | 5 fs/hugetlbfs/inode.c | 7 fs/inode.c | 49 + fs/ioctl.c | 2 fs/ntfs/attrib.c | 2 fs/ocfs2/alloc.c | 2 fs/ocfs2/aops.c | 26 fs/ocfs2/cluster/masklog.c | 11 fs/ocfs2/dir.c | 2 fs/ocfs2/filecheck.c | 3 fs/ocfs2/journal.c | 6 fs/proc/task_mmu.c | 13 fs/squashfs/super.c | 33 + fs/userfaultfd.c | 8 fs/xfs/kmem.c | 3 fs/xfs/xfs_buf.c | 2 include/linux/ceph/libceph.h | 1 include/linux/damon.h | 93 +-- include/linux/fs.h | 1 include/linux/gfp.h | 12 include/linux/hugetlb.h | 4 include/linux/hugetlb_cgroup.h | 7 include/linux/kasan.h | 4 include/linux/kthread.h | 25 include/linux/memcontrol.h | 22 include/linux/mempolicy.h | 1 include/linux/memremap.h | 11 include/linux/mm.h | 76 -- include/linux/mm_inline.h | 136 ++++ include/linux/mm_types.h | 252 +++----- include/linux/mmzone.h | 9 include/linux/page-flags.h | 6 include/linux/page_idle.h | 1 include/linux/page_table_check.h | 147 ++++ include/linux/pgtable.h | 8 include/linux/sched/mm.h | 26 include/linux/swap.h | 8 include/linux/syscalls.h | 3 include/linux/vm_event_item.h | 3 include/linux/vmalloc.h | 7 include/ras/ras_event.h | 2 include/trace/events/compaction.h | 24 include/trace/events/damon.h | 15 include/trace/events/thp.h | 35 - include/uapi/asm-generic/unistd.h | 5 include/uapi/linux/prctl.h | 3 kernel/dma/pool.c | 4 kernel/fork.c | 3 kernel/kthread.c | 1 kernel/rcu/rcutorture.c | 7 kernel/sys.c | 63 ++ kernel/sys_ni.c | 1 kernel/sysctl.c | 3 kernel/trace/ring_buffer.c | 7 kernel/trace/trace_hwlat.c | 6 kernel/trace/trace_osnoise.c | 3 lib/test_hmm.c | 24 lib/test_kasan.c | 30 mm/Kconfig | 14 mm/Kconfig.debug | 24 mm/Makefile | 1 mm/compaction.c | 7 mm/damon/core.c | 45 - mm/damon/dbgfs.c | 20 mm/damon/paddr.c | 24 mm/damon/prmtv-common.h | 4 mm/damon/reclaim.c | 46 + mm/damon/vaddr.c | 186 ++++-- mm/debug.c | 52 - mm/debug_vm_pgtable.c | 6 mm/dmapool.c | 2 mm/frontswap.c | 4 mm/gup.c | 31 - mm/hmm.c | 5 mm/huge_memory.c | 32 - mm/hugetlb.c | 6 mm/hugetlb_cgroup.c | 133 +++- mm/internal.h | 7 mm/kasan/quarantine.c | 11 mm/kasan/shadow.c | 9 mm/khugepaged.c | 23 mm/kmemleak.c | 21 mm/ksm.c | 5 mm/madvise.c | 510 ++++++++++------ mm/mapping_dirty_helpers.c | 1 mm/memcontrol.c | 44 - mm/memory-failure.c | 189 +++--- mm/memory.c | 12 mm/mempolicy.c | 95 ++- mm/memremap.c | 18 mm/migrate.c | 527 ++++++++++------- mm/mlock.c | 2 mm/mmap.c | 55 + mm/mmu_gather.c | 1 mm/mprotect.c | 2 mm/oom_kill.c | 30 mm/page_alloc.c | 198 ++++-- mm/page_counter.c | 1 mm/page_ext.c | 8 mm/page_isolation.c | 2 mm/page_owner.c | 4 mm/page_table_check.c | 270 ++++++++ mm/percpu-internal.h | 18 mm/percpu.c | 10 mm/pgtable-generic.c | 1 mm/rmap.c | 43 + mm/shmem.c | 91 ++ mm/slab.h | 5 mm/slab_common.c | 34 - mm/swap.c | 2 mm/swapfile.c | 46 - mm/truncate.c | 5 mm/userfaultfd.c | 5 mm/util.c | 15 mm/vmalloc.c | 75 +- mm/vmscan.c | 2 mm/vmstat.c | 3 mm/zpool.c | 12 net/ceph/buffer.c | 4 net/ceph/ceph_common.c | 27 net/ceph/crypto.c | 2 net/ceph/messenger.c | 2 net/ceph/messenger_v2.c | 2 net/ceph/osdmap.c | 12 net/sunrpc/svc_xprt.c | 3 scripts/spelling.txt | 1 tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 34 - tools/testing/selftests/vm/hmm-tests.c | 42 + tools/testing/selftests/vm/hugepage-mremap.c | 46 - tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 21 tools/testing/selftests/vm/run_vmtests.sh | 2 tools/testing/selftests/vm/userfaultfd.c | 33 - tools/testing/selftests/vm/write_hugetlb_memory.sh | 2 211 files changed, 3980 insertions(+), 1759 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-12-31 4:12 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-12-31 4:12 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 2 patches, based on 4f3d93c6eaff6b84e43b63e0d7a119c5920e1020. Subsystems affected by this patch series: mm/userfaultfd mm/damon Subsystem: mm/userfaultfd Mike Kravetz <mike.kravetz@oracle.com>: userfaultfd/selftests: fix hugetlb area allocations Subsystem: mm/damon SeongJae Park <sj@kernel.org>: mm/damon/dbgfs: fix 'struct pid' leaks in 'dbgfs_target_ids_write()' mm/damon/dbgfs.c | 9 +++++++-- tools/testing/selftests/vm/userfaultfd.c | 16 ++++++++++------ 2 files changed, 17 insertions(+), 8 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-12-25 5:11 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-12-25 5:11 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 9 patches, based on bc491fb12513e79702c6f936c838f792b5389129. Subsystems affected by this patch series: mm/kfence mm/mempolicy core-kernel MAINTAINERS mm/memory-failure mm/pagemap mm/pagealloc mm/damon mm/memory-failure Subsystem: mm/kfence Baokun Li <libaokun1@huawei.com>: kfence: fix memory leak when cat kfence objects Subsystem: mm/mempolicy Andrey Ryabinin <arbn@yandex-team.com>: mm: mempolicy: fix THP allocations escaping mempolicy restrictions Subsystem: core-kernel Philipp Rudo <prudo@redhat.com>: kernel/crash_core: suppress unknown crashkernel parameter warning Subsystem: MAINTAINERS Randy Dunlap <rdunlap@infradead.org>: MAINTAINERS: mark more list instances as moderated Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm, hwpoison: fix condition in free hugetlb page path Subsystem: mm/pagemap Hugh Dickins <hughd@google.com>: mm: delete unsafe BUG from page_cache_add_speculative() Subsystem: mm/pagealloc Thibaut Sautereau <thibaut.sautereau@ssi.gouv.fr>: mm/page_alloc: fix __alloc_size attribute for alloc_pages_exact_nid Subsystem: mm/damon SeongJae Park <sj@kernel.org>: mm/damon/dbgfs: protect targets destructions with kdamond_lock Subsystem: mm/memory-failure Liu Shixin <liushixin2@huawei.com>: mm/hwpoison: clear MF_COUNT_INCREASED before retrying get_any_page() MAINTAINERS | 4 ++-- include/linux/gfp.h | 2 +- include/linux/pagemap.h | 1 - kernel/crash_core.c | 11 +++++++++++ mm/damon/dbgfs.c | 2 ++ mm/kfence/core.c | 1 + mm/memory-failure.c | 14 +++++--------- mm/mempolicy.c | 3 +-- 8 files changed, 23 insertions(+), 15 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-12-10 22:45 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-12-10 22:45 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 21 patches, based on c741e49150dbb0c0aebe234389f4aa8b47958fa8. Subsystems affected by this patch series: mm/mlock MAINTAINERS mailmap mm/pagecache mm/damon mm/slub mm/memcg mm/hugetlb mm/pagecache Subsystem: mm/mlock Drew DeVault <sir@cmpwn.com>: Increase default MLOCK_LIMIT to 8 MiB Subsystem: MAINTAINERS Dave Young <dyoung@redhat.com>: MAINTAINERS: update kdump maintainers Subsystem: mailmap Guo Ren <guoren@linux.alibaba.com>: mailmap: update email address for Guo Ren Subsystem: mm/pagecache "Matthew Wilcox (Oracle)" <willy@infradead.org>: filemap: remove PageHWPoison check from next_uptodate_page() Subsystem: mm/damon SeongJae Park <sj@kernel.org>: Patch series "mm/damon: Fix fake /proc/loadavg reports", v3: timers: implement usleep_idle_range() mm/damon/core: fix fake load reports due to uninterruptible sleeps Patch series "mm/damon: Trivial fixups and improvements": mm/damon/core: use better timer mechanisms selection threshold mm/damon/dbgfs: remove an unnecessary error message mm/damon/core: remove unnecessary error messages mm/damon/vaddr: remove an unnecessary warning message mm/damon/vaddr-test: split a test function having >1024 bytes frame size mm/damon/vaddr-test: remove unnecessary variables selftests/damon: skip test if DAMON is running selftests/damon: test DAMON enabling with empty target_ids case selftests/damon: test wrong DAMOS condition ranges input selftests/damon: test debugfs file reads/writes with huge count selftests/damon: split test cases Subsystem: mm/slub Gerald Schaefer <gerald.schaefer@linux.ibm.com>: mm/slub: fix endianness bug for alloc/free_traces attributes Subsystem: mm/memcg Waiman Long <longman@redhat.com>: mm/memcg: relocate mod_objcg_mlstate(), get_obj_stock() and put_obj_stock() Subsystem: mm/hugetlb Zhenguo Yao <yaozhenguo1@gmail.com>: hugetlbfs: fix issue of preallocation of gigantic pages can't work Subsystem: mm/pagecache Manjong Lee <mj0123.lee@samsung.com>: mm: bdi: initialize bdi_min_ratio when bdi is unregistered .mailmap | 2 MAINTAINERS | 2 include/linux/delay.h | 14 include/uapi/linux/resource.h | 13 kernel/time/timer.c | 16 - mm/backing-dev.c | 7 mm/damon/core.c | 20 - mm/damon/dbgfs.c | 4 mm/damon/vaddr-test.h | 85 ++--- mm/damon/vaddr.c | 1 mm/filemap.c | 2 mm/hugetlb.c | 2 mm/memcontrol.c | 106 +++---- mm/slub.c | 15 - tools/testing/selftests/damon/.gitignore | 2 tools/testing/selftests/damon/Makefile | 7 tools/testing/selftests/damon/_debugfs_common.sh | 52 +++ tools/testing/selftests/damon/debugfs_attrs.sh | 149 ++-------- tools/testing/selftests/damon/debugfs_empty_targets.sh | 13 tools/testing/selftests/damon/debugfs_huge_count_read_write.sh | 22 + tools/testing/selftests/damon/debugfs_schemes.sh | 19 + tools/testing/selftests/damon/debugfs_target_ids.sh | 19 + tools/testing/selftests/damon/huge_count_read_write.c | 39 ++ 23 files changed, 363 insertions(+), 248 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-11-20 0:42 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-11-20 0:42 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 15 patches, based on a90af8f15bdc9449ee2d24e1d73fa3f7e8633f81. Subsystems affected by this patch series: mm/swap ipc mm/slab-generic hexagon mm/kmemleak mm/hugetlb mm/kasan mm/damon mm/highmem proc Subsystem: mm/swap Matthew Wilcox <willy@infradead.org>: mm/swap.c:put_pages_list(): reinitialise the page list Subsystem: ipc Alexander Mikhalitsyn <alexander.mikhalitsyn@virtuozzo.com>: Patch series "shm: shm_rmid_forced feature fixes": ipc: WARN if trying to remove ipc object which is absent shm: extend forced shm destroy to support objects from several IPC nses Subsystem: mm/slab-generic Yunfeng Ye <yeyunfeng@huawei.com>: mm: emit the "free" trace report before freeing memory in kmem_cache_free() Subsystem: hexagon Nathan Chancellor <nathan@kernel.org>: Patch series "Fixes for ARCH=hexagon allmodconfig", v2: hexagon: export raw I/O routines for modules hexagon: clean up timer-regs.h hexagon: ignore vmlinux.lds Subsystem: mm/kmemleak Rustam Kovhaev <rkovhaev@gmail.com>: mm: kmemleak: slob: respect SLAB_NOLEAKTRACE flag Subsystem: mm/hugetlb Bui Quang Minh <minhquangbui99@gmail.com>: hugetlb: fix hugetlb cgroup refcounting during mremap Mina Almasry <almasrymina@google.com>: hugetlb, userfaultfd: fix reservation restore on userfaultfd error Subsystem: mm/kasan Kees Cook <keescook@chromium.org>: kasan: test: silence intentional read overflow warnings Subsystem: mm/damon SeongJae Park <sj@kernel.org>: Patch series "DAMON fixes": mm/damon/dbgfs: use '__GFP_NOWARN' for user-specified size buffer allocation mm/damon/dbgfs: fix missed use of damon_dbgfs_lock Subsystem: mm/highmem Ard Biesheuvel <ardb@kernel.org>: kmap_local: don't assume kmap PTEs are linear arrays in memory Subsystem: proc David Hildenbrand <david@redhat.com>: proc/vmcore: fix clearing user buffer by properly using clear_user() arch/arm/Kconfig | 1 arch/hexagon/include/asm/timer-regs.h | 26 ---- arch/hexagon/include/asm/timex.h | 3 arch/hexagon/kernel/.gitignore | 1 arch/hexagon/kernel/time.c | 12 +- arch/hexagon/lib/io.c | 4 fs/proc/vmcore.c | 20 ++- include/linux/hugetlb_cgroup.h | 12 ++ include/linux/ipc_namespace.h | 15 ++ include/linux/sched/task.h | 2 ipc/shm.c | 189 +++++++++++++++++++++++++--------- ipc/util.c | 6 - lib/test_kasan.c | 2 mm/Kconfig | 3 mm/damon/dbgfs.c | 20 ++- mm/highmem.c | 32 +++-- mm/hugetlb.c | 11 + mm/slab.c | 3 mm/slab.h | 2 mm/slob.c | 3 mm/slub.c | 2 mm/swap.c | 1 22 files changed, 254 insertions(+), 116 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-11-11 4:32 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-11-11 4:32 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits The post-linux-next material. 7 patches, based on debe436e77c72fcee804fb867f275e6d31aa999c. Subsystems affected by this patch series: mm/debug mm/slab-generic mm/migration mm/memcg mm/kasan Subsystem: mm/debug Yixuan Cao <caoyixuan2019@email.szu.edu.cn>: mm/page_owner.c: modify the type of argument "order" in some functions Subsystem: mm/slab-generic Ingo Molnar <mingo@kernel.org>: mm: allow only SLUB on PREEMPT_RT Subsystem: mm/migration Baolin Wang <baolin.wang@linux.alibaba.com>: mm: migrate: simplify the file-backed pages validation when migrating its mapping Alistair Popple <apopple@nvidia.com>: mm/migrate.c: remove MIGRATE_PFN_LOCKED Subsystem: mm/memcg Christoph Hellwig <hch@lst.de>: Patch series "unexport memcg locking helpers": mm: unexport folio_memcg_{,un}lock mm: unexport {,un}lock_page_memcg Subsystem: mm/kasan Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: kasan: add kasan mode messages when kasan init Documentation/vm/hmm.rst | 2 arch/arm64/mm/kasan_init.c | 2 arch/powerpc/kvm/book3s_hv_uvmem.c | 4 drivers/gpu/drm/amd/amdkfd/kfd_migrate.c | 2 drivers/gpu/drm/nouveau/nouveau_dmem.c | 4 include/linux/migrate.h | 1 include/linux/page_owner.h | 12 +- init/Kconfig | 2 lib/test_hmm.c | 5 - mm/kasan/hw_tags.c | 14 ++ mm/kasan/sw_tags.c | 2 mm/memcontrol.c | 4 mm/migrate.c | 151 +++++-------------------------- mm/page_owner.c | 6 - 14 files changed, 61 insertions(+), 150 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-11-09 2:30 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-11-09 2:30 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 87 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813, plus previously sent material. Subsystems affected by this patch series: mm/pagecache mm/hugetlb procfs misc MAINTAINERS lib checkpatch binfmt kallsyms ramfs init codafs nilfs2 hfs crash_dump signals seq_file fork sysvfs kcov gdb resource selftests ipc Subsystem: mm/pagecache Johannes Weiner <hannes@cmpxchg.org>: vfs: keep inodes with page cache off the inode shrinker LRU Subsystem: mm/hugetlb zhangyiru <zhangyiru3@huawei.com>: mm,hugetlb: remove mlock ulimit for SHM_HUGETLB Subsystem: procfs Florian Weimer <fweimer@redhat.com>: procfs: do not list TID 0 in /proc/<pid>/task David Hildenbrand <david@redhat.com>: x86/xen: update xen_oldmem_pfn_is_ram() documentation x86/xen: simplify xen_oldmem_pfn_is_ram() x86/xen: print a warning when HVMOP_get_mem_type fails proc/vmcore: let pfn_is_ram() return a bool proc/vmcore: convert oldmem_pfn_is_ram callback to more generic vmcore callbacks virtio-mem: factor out hotplug specifics from virtio_mem_init() into virtio_mem_init_hotplug() virtio-mem: factor out hotplug specifics from virtio_mem_probe() into virtio_mem_init_hotplug() virtio-mem: factor out hotplug specifics from virtio_mem_remove() into virtio_mem_deinit_hotplug() virtio-mem: kdump mode to sanitize /proc/vmcore access Stephen Brennan <stephen.s.brennan@oracle.com>: proc: allow pid_revalidate() during LOOKUP_RCU Subsystem: misc Andy Shevchenko <andriy.shevchenko@linux.intel.com>: Patch series "kernel.h further split", v5: kernel.h: drop unneeded <linux/kernel.h> inclusion from other headers kernel.h: split out container_of() and typeof_member() macros include/kunit/test.h: replace kernel.h with the necessary inclusions include/linux/list.h: replace kernel.h with the necessary inclusions include/linux/llist.h: replace kernel.h with the necessary inclusions include/linux/plist.h: replace kernel.h with the necessary inclusions include/media/media-entity.h: replace kernel.h with the necessary inclusions include/linux/delay.h: replace kernel.h with the necessary inclusions include/linux/sbitmap.h: replace kernel.h with the necessary inclusions include/linux/radix-tree.h: replace kernel.h with the necessary inclusions include/linux/generic-radix-tree.h: replace kernel.h with the necessary inclusions Stephen Rothwell <sfr@canb.auug.org.au>: kernel.h: split out instruction pointer accessors Rasmus Villemoes <linux@rasmusvillemoes.dk>: linux/container_of.h: switch to static_assert Colin Ian King <colin.i.king@googlemail.com>: mailmap: update email address for Colin King Subsystem: MAINTAINERS Kees Cook <keescook@chromium.org>: MAINTAINERS: add "exec & binfmt" section with myself and Eric Lukas Bulwahn <lukas.bulwahn@gmail.com>: Patch series "Rectify file references for dt-bindings in MAINTAINERS", v5: MAINTAINERS: rectify entry for ARM/TOSHIBA VISCONTI ARCHITECTURE MAINTAINERS: rectify entry for HIKEY960 ONBOARD USB GPIO HUB DRIVER MAINTAINERS: rectify entry for INTEL KEEM BAY DRM DRIVER MAINTAINERS: rectify entry for ALLWINNER HARDWARE SPINLOCK SUPPORT Subsystem: lib Imran Khan <imran.f.khan@oracle.com>: Patch series "lib, stackdepot: check stackdepot handle before accessing slabs", v2: lib, stackdepot: check stackdepot handle before accessing slabs lib, stackdepot: add helper to print stack entries lib, stackdepot: add helper to print stack entries into buffer Lucas De Marchi <lucas.demarchi@intel.com>: include/linux/string_helpers.h: add linux/string.h for strlen() Alexey Dobriyan <adobriyan@gmail.com>: lib: uninline simple_strntoull() as well Thomas Gleixner <tglx@linutronix.de>: mm/scatterlist: replace the !preemptible warning in sg_miter_stop() Subsystem: checkpatch Rikard Falkeborn <rikard.falkeborn@gmail.com>: const_structs.checkpatch: add a few sound ops structs Joe Perches <joe@perches.com>: checkpatch: improve EXPORT_SYMBOL test for EXPORT_SYMBOL_NS uses Peter Ujfalusi <peter.ujfalusi@linux.intel.com>: checkpatch: get default codespell dictionary path from package location Subsystem: binfmt Kees Cook <keescook@chromium.org>: binfmt_elf: reintroduce using MAP_FIXED_NOREPLACE Alexey Dobriyan <adobriyan@gmail.com>: ELF: simplify STACK_ALLOC macro Subsystem: kallsyms Kefeng Wang <wangkefeng.wang@huawei.com>: Patch series "sections: Unify kernel sections range check and use", v4: kallsyms: remove arch specific text and data check kallsyms: fix address-checks for kernel related range sections: move and rename core_kernel_data() to is_kernel_core_data() sections: move is_kernel_inittext() into sections.h x86: mm: rename __is_kernel_text() to is_x86_32_kernel_text() sections: provide internal __is_kernel() and __is_kernel_text() helper mm: kasan: use is_kernel() helper extable: use is_kernel_text() helper powerpc/mm: use core_kernel_text() helper microblaze: use is_kernel_text() helper alpha: use is_kernel_text() helper Subsystem: ramfs yangerkun <yangerkun@huawei.com>: ramfs: fix mount source show for ramfs Subsystem: init Andrew Halaney <ahalaney@redhat.com>: init: make unknown command line param message clearer Subsystem: codafs Jan Harkes <jaharkes@cs.cmu.edu>: Patch series "Coda updates for -next": coda: avoid NULL pointer dereference from a bad inode coda: check for async upcall request using local state Alex Shi <alex.shi@linux.alibaba.com>: coda: remove err which no one care Jan Harkes <jaharkes@cs.cmu.edu>: coda: avoid flagging NULL inodes coda: avoid hidden code duplication in rename coda: avoid doing bad things on inode type changes during revalidation Xiyu Yang <xiyuyang19@fudan.edu.cn>: coda: convert from atomic_t to refcount_t on coda_vm_ops->refcnt Jing Yangyang <jing.yangyang@zte.com.cn>: coda: use vmemdup_user to replace the open code Jan Harkes <jaharkes@cs.cmu.edu>: coda: bump module version to 7.2 Subsystem: nilfs2 Qing Wang <wangqing@vivo.com>: Patch series "nilfs2 updates": nilfs2: replace snprintf in show functions with sysfs_emit Ryusuke Konishi <konishi.ryusuke@gmail.com>: nilfs2: remove filenames from file comments Subsystem: hfs Arnd Bergmann <arnd@arndb.de>: hfs/hfsplus: use WARN_ON for sanity check Subsystem: crash_dump Changcheng Deng <deng.changcheng@zte.com.cn>: crash_dump: fix boolreturn.cocci warning Ye Guojin <ye.guojin@zte.com.cn>: crash_dump: remove duplicate include in crash_dump.h Subsystem: signals Ye Guojin <ye.guojin@zte.com.cn>: signal: remove duplicate include in signal.h Subsystem: seq_file Andy Shevchenko <andriy.shevchenko@linux.intel.com>: seq_file: move seq_escape() to a header Muchun Song <songmuchun@bytedance.com>: seq_file: fix passing wrong private data Subsystem: fork Ran Xiaokai <ran.xiaokai@zte.com.cn>: kernel/fork.c: unshare(): use swap() to make code cleaner Subsystem: sysvfs Pavel Skripkin <paskripkin@gmail.com>: sysv: use BUILD_BUG_ON instead of runtime check Subsystem: kcov Sebastian Andrzej Siewior <bigeasy@linutronix.de>: Patch series "kcov: PREEMPT_RT fixup + misc", v2: Documentation/kcov: include types.h in the example Documentation/kcov: define `ip' in the example kcov: allocate per-CPU memory on the relevant node kcov: avoid enable+disable interrupts if !in_task() kcov: replace local_irq_save() with a local_lock_t Subsystem: gdb Douglas Anderson <dianders@chromium.org>: scripts/gdb: handle split debug for vmlinux Subsystem: resource David Hildenbrand <david@redhat.com>: Patch series "virtio-mem: disallow mapping virtio-mem memory via /dev/mem", v5: kernel/resource: clean up and optimize iomem_is_exclusive() kernel/resource: disallow access to exclusive system RAM regions virtio-mem: disallow mapping virtio-mem memory via /dev/mem Subsystem: selftests SeongJae Park <sjpark@amazon.de>: selftests/kselftest/runner/run_one(): allow running non-executable files Subsystem: ipc Michal Clapinski <mclapinski@google.com>: ipc: check checkpoint_restore_ns_capable() to modify C/R proc files Manfred Spraul <manfred@colorfullife.com>: ipc/ipc_sysctl.c: remove fallback for !CONFIG_PROC_SYSCTL .mailmap | 2 Documentation/dev-tools/kcov.rst | 5 MAINTAINERS | 21 + arch/alpha/kernel/traps.c | 4 arch/microblaze/mm/pgtable.c | 3 arch/powerpc/mm/pgtable_32.c | 7 arch/riscv/lib/delay.c | 4 arch/s390/include/asm/facility.h | 4 arch/x86/kernel/aperture_64.c | 13 arch/x86/kernel/unwind_orc.c | 2 arch/x86/mm/init_32.c | 14 arch/x86/xen/mmu_hvm.c | 39 -- drivers/gpu/drm/drm_dp_mst_topology.c | 5 drivers/gpu/drm/drm_mm.c | 5 drivers/gpu/drm/i915/i915_vma.c | 5 drivers/gpu/drm/i915/intel_runtime_pm.c | 20 - drivers/media/dvb-frontends/cxd2880/cxd2880_common.h | 1 drivers/virtio/Kconfig | 1 drivers/virtio/virtio_mem.c | 321 +++++++++++++------ fs/binfmt_elf.c | 33 + fs/coda/cnode.c | 13 fs/coda/coda_linux.c | 39 +- fs/coda/coda_linux.h | 6 fs/coda/dir.c | 20 - fs/coda/file.c | 12 fs/coda/psdev.c | 14 fs/coda/upcall.c | 3 fs/hfs/inode.c | 6 fs/hfsplus/inode.c | 12 fs/hugetlbfs/inode.c | 23 - fs/inode.c | 46 +- fs/internal.h | 1 fs/nilfs2/alloc.c | 2 fs/nilfs2/alloc.h | 2 fs/nilfs2/bmap.c | 2 fs/nilfs2/bmap.h | 2 fs/nilfs2/btnode.c | 2 fs/nilfs2/btnode.h | 2 fs/nilfs2/btree.c | 2 fs/nilfs2/btree.h | 2 fs/nilfs2/cpfile.c | 2 fs/nilfs2/cpfile.h | 2 fs/nilfs2/dat.c | 2 fs/nilfs2/dat.h | 2 fs/nilfs2/dir.c | 2 fs/nilfs2/direct.c | 2 fs/nilfs2/direct.h | 2 fs/nilfs2/file.c | 2 fs/nilfs2/gcinode.c | 2 fs/nilfs2/ifile.c | 2 fs/nilfs2/ifile.h | 2 fs/nilfs2/inode.c | 2 fs/nilfs2/ioctl.c | 2 fs/nilfs2/mdt.c | 2 fs/nilfs2/mdt.h | 2 fs/nilfs2/namei.c | 2 fs/nilfs2/nilfs.h | 2 fs/nilfs2/page.c | 2 fs/nilfs2/page.h | 2 fs/nilfs2/recovery.c | 2 fs/nilfs2/segbuf.c | 2 fs/nilfs2/segbuf.h | 2 fs/nilfs2/segment.c | 2 fs/nilfs2/segment.h | 2 fs/nilfs2/sufile.c | 2 fs/nilfs2/sufile.h | 2 fs/nilfs2/super.c | 2 fs/nilfs2/sysfs.c | 78 ++-- fs/nilfs2/sysfs.h | 2 fs/nilfs2/the_nilfs.c | 2 fs/nilfs2/the_nilfs.h | 2 fs/proc/base.c | 21 - fs/proc/vmcore.c | 109 ++++-- fs/ramfs/inode.c | 11 fs/seq_file.c | 16 fs/sysv/super.c | 6 include/asm-generic/sections.h | 75 +++- include/kunit/test.h | 13 include/linux/bottom_half.h | 3 include/linux/container_of.h | 52 ++- include/linux/crash_dump.h | 30 + include/linux/delay.h | 2 include/linux/fs.h | 1 include/linux/fwnode.h | 1 include/linux/generic-radix-tree.h | 3 include/linux/hugetlb.h | 6 include/linux/instruction_pointer.h | 8 include/linux/kallsyms.h | 21 - include/linux/kernel.h | 39 -- include/linux/list.h | 4 include/linux/llist.h | 4 include/linux/pagemap.h | 50 ++ include/linux/plist.h | 5 include/linux/radix-tree.h | 4 include/linux/rwsem.h | 1 include/linux/sbitmap.h | 11 include/linux/seq_file.h | 19 + include/linux/signal.h | 1 include/linux/smp.h | 1 include/linux/spinlock.h | 1 include/linux/stackdepot.h | 5 include/linux/string_helpers.h | 1 include/media/media-entity.h | 3 init/main.c | 4 ipc/ipc_sysctl.c | 42 +- ipc/shm.c | 8 kernel/extable.c | 33 - kernel/fork.c | 9 kernel/kcov.c | 40 +- kernel/locking/lockdep.c | 3 kernel/resource.c | 54 ++- kernel/trace/ftrace.c | 2 lib/scatterlist.c | 11 lib/stackdepot.c | 46 ++ lib/vsprintf.c | 3 mm/Kconfig | 7 mm/filemap.c | 8 mm/kasan/report.c | 17 - mm/memfd.c | 4 mm/mmap.c | 3 mm/page_owner.c | 18 - mm/truncate.c | 19 + mm/vmscan.c | 7 mm/workingset.c | 10 net/sysctl_net.c | 2 scripts/checkpatch.pl | 33 + scripts/const_structs.checkpatch | 4 scripts/gdb/linux/symbols.py | 3 tools/testing/selftests/kselftest/runner.sh | 28 + tools/testing/selftests/proc/.gitignore | 1 tools/testing/selftests/proc/Makefile | 2 tools/testing/selftests/proc/proc-tid0.c | 81 ++++ 132 files changed, 1206 insertions(+), 681 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-11-05 20:34 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-11-05 20:34 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 262 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813 Subsystems affected by this patch series: scripts ocfs2 vfs mm/slab-generic mm/slab mm/slub mm/kconfig mm/dax mm/kasan mm/debug mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/mprotect mm/mremap mm/iomap mm/tracing mm/vmalloc mm/pagealloc mm/memory-failure mm/hugetlb mm/userfaultfd mm/vmscan mm/tools mm/memblock mm/oom-kill mm/hugetlbfs mm/migration mm/thp mm/readahead mm/nommu mm/ksm mm/vmstat mm/madvise mm/memory-hotplug mm/rmap mm/zsmalloc mm/highmem mm/zram mm/cleanups mm/kfence mm/damon Subsystem: scripts Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Sven Eckelmann <sven@narfation.org>: scripts/spelling.txt: fix "mistake" version of "synchronization" weidonghui <weidonghui@allwinnertech.com>: scripts/decodecode: fix faulting instruction no print when opps.file is DOS format Subsystem: ocfs2 Chenyuan Mi <cymi20@fudan.edu.cn>: ocfs2: fix handle refcount leak in two exception handling paths Valentin Vidic <vvidic@valentin-vidic.from.hr>: ocfs2: cleanup journal init and shutdown Colin Ian King <colin.king@canonical.com>: ocfs2/dlm: remove redundant assignment of variable ret Jan Kara <jack@suse.cz>: Patch series "ocfs2: Truncate data corruption fix": ocfs2: fix data corruption on truncate ocfs2: do not zero pages beyond i_size Subsystem: vfs Arnd Bergmann <arnd@arndb.de>: fs/posix_acl.c: avoid -Wempty-body warning Jia He <justin.he@arm.com>: d_path: fix Kernel doc validator complaining Subsystem: mm/slab-generic "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: move kvmalloc-related functions to slab.h Subsystem: mm/slab Shi Lei <shi_lei@massclouds.com>: mm/slab.c: remove useless lines in enable_cpucache() Subsystem: mm/slub Kefeng Wang <wangkefeng.wang@huawei.com>: slub: add back check for free nonslab objects Vlastimil Babka <vbabka@suse.cz>: mm, slub: change percpu partial accounting from objects to pages mm/slub: increase default cpu partial list sizes Hyeonggon Yoo <42.hyeyoo@gmail.com>: mm, slub: use prefetchw instead of prefetch Subsystem: mm/kconfig Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm: disable NUMA_BALANCING_DEFAULT_ENABLED and TRANSPARENT_HUGEPAGE on PREEMPT_RT Subsystem: mm/dax Christoph Hellwig <hch@lst.de>: mm: don't include <linux/dax.h> in <linux/mempolicy.h> Subsystem: mm/kasan Marco Elver <elver@google.com>: Patch series "stackdepot, kasan, workqueue: Avoid expanding stackdepot slabs when holding raw_spin_lock", v2: lib/stackdepot: include gfp.h lib/stackdepot: remove unused function argument lib/stackdepot: introduce __stack_depot_save() kasan: common: provide can_alloc in kasan_save_stack() kasan: generic: introduce kasan_record_aux_stack_noalloc() workqueue, kasan: avoid alloc_pages() when recording stack "Matthew Wilcox (Oracle)" <willy@infradead.org>: kasan: fix tag for large allocations when using CONFIG_SLAB Peter Collingbourne <pcc@google.com>: kasan: test: add memcpy test that avoids out-of-bounds write Subsystem: mm/debug Peter Xu <peterx@redhat.com>: Patch series "mm/smaps: Fixes and optimizations on shmem swap handling": mm/smaps: fix shmem pte hole swap calculation mm/smaps: use vma->vm_pgoff directly when counting partial swap mm/smaps: simplify shmem handling of pte holes Guo Ren <guoren@linux.alibaba.com>: mm: debug_vm_pgtable: don't use __P000 directly Kees Cook <keescook@chromium.org>: kasan: test: bypass __alloc_size checks Patch series "Add __alloc_size()", v3: rapidio: avoid bogus __alloc_size warning Compiler Attributes: add __alloc_size() for better bounds checking slab: clean up function prototypes slab: add __alloc_size attributes for better bounds checking mm/kvmalloc: add __alloc_size attributes for better bounds checking mm/vmalloc: add __alloc_size attributes for better bounds checking mm/page_alloc: add __alloc_size attributes for better bounds checking percpu: add __alloc_size attributes for better bounds checking Yinan Zhang <zhangyinan2019@email.szu.edu.cn>: mm/page_ext.c: fix a comment Subsystem: mm/pagecache David Howells <dhowells@redhat.com>: mm: stop filemap_read() from grabbing a superfluous page Christoph Hellwig <hch@lst.de>: Patch series "simplify bdi unregistation": mm: export bdi_unregister mtd: call bdi_unregister explicitly fs: explicitly unregister per-superblock BDIs mm: don't automatically unregister bdis mm: simplify bdi refcounting Jens Axboe <axboe@kernel.dk>: mm: don't read i_size of inode unless we need it "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap.c: remove bogus VM_BUG_ON Jens Axboe <axboe@kernel.dk>: mm: move more expensive part of XA setup out of mapping check Subsystem: mm/gup John Hubbard <jhubbard@nvidia.com>: mm/gup: further simplify __gup_device_huge() Subsystem: mm/swap Xu Wang <vulab@iscas.ac.cn>: mm/swapfile: remove needless request_queue NULL pointer check Rafael Aquini <aquini@redhat.com>: mm/swapfile: fix an integer overflow in swap_show() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: optimise put_pages_list() Subsystem: mm/memcg Peter Xu <peterx@redhat.com>: mm/memcg: drop swp_entry_t* in mc_handle_file_pte() Shakeel Butt <shakeelb@google.com>: memcg: flush stats only if updated memcg: unify memcg stat flushing Waiman Long <longman@redhat.com>: mm/memcg: remove obsolete memcg_free_kmem() Len Baker <len.baker@gmx.com>: mm/list_lru.c: prefer struct_size over open coded arithmetic Shakeel Butt <shakeelb@google.com>: memcg, kmem: further deprecate kmem.limit_in_bytes Muchun Song <songmuchun@bytedance.com>: mm: list_lru: remove holding lru lock mm: list_lru: fix the return value of list_lru_count_one() mm: memcontrol: remove kmemcg_id reparenting mm: memcontrol: remove the kmem states mm: list_lru: only add memcg-aware lrus to the global lru list Vasily Averin <vvs@virtuozzo.com>: Patch series "memcg: prohibit unconditional exceeding the limit of dying tasks", v3: mm, oom: pagefault_out_of_memory: don't force global OOM for dying tasks Michal Hocko <mhocko@suse.com>: mm, oom: do not trigger out_of_memory from the #PF Vasily Averin <vvs@virtuozzo.com>: memcg: prohibit unconditional exceeding the limit of dying tasks Subsystem: mm/pagemap Peng Liu <liupeng256@huawei.com>: mm/mmap.c: fix a data race of mm->total_vm Rolf Eike Beer <eb@emlix.com>: mm: use __pfn_to_section() instead of open coding it Amit Daniel Kachhap <amit.kachhap@arm.com>: mm/memory.c: avoid unnecessary kernel/user pointer conversion Nadav Amit <namit@vmware.com>: mm/memory.c: use correct VMA flags when freeing page-tables Peter Xu <peterx@redhat.com>: Patch series "mm: A few cleanup patches around zap, shmem and uffd", v4: mm/shmem: unconditionally set pte dirty in mfill_atomic_install_pte mm: clear vmf->pte after pte_unmap_same() returns mm: drop first_index/last_index in zap_details mm: add zap_skip_check_mapping() helper Qi Zheng <zhengqi.arch@bytedance.com>: Patch series "Do some code cleanups related to mm", v3: mm: introduce pmd_install() helper mm: remove redundant smp_wmb() Tiberiu A Georgescu <tiberiu.georgescu@nutanix.com>: Documentation: update pagemap with shmem exceptions Nicholas Piggin <npiggin@gmail.com>: Patch series "shoot lazy tlbs", v4: lazy tlb: introduce lazy mm refcount helper functions lazy tlb: allow lazy tlb mm refcounting to be configurable lazy tlb: shoot lazies, a non-refcounting lazy tlb option powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN Lukas Bulwahn <lukas.bulwahn@gmail.com>: memory: remove unused CONFIG_MEM_BLOCK_SIZE Subsystem: mm/mprotect Liu Song <liu.song11@zte.com.cn>: mm/mprotect.c: avoid repeated assignment in do_mprotect_pkey() Subsystem: mm/mremap Dmitry Safonov <dima@arista.com>: mm/mremap: don't account pages in vma_to_resize() Subsystem: mm/iomap Lucas De Marchi <lucas.demarchi@intel.com>: include/linux/io-mapping.h: remove fallback for writecombine Subsystem: mm/tracing Gang Li <ligang.bdlg@bytedance.com>: mm: mmap_lock: remove redundant newline in TP_printk mm: mmap_lock: use DECLARE_EVENT_CLASS and DEFINE_EVENT_FN Subsystem: mm/vmalloc Vasily Averin <vvs@virtuozzo.com>: mm/vmalloc: repair warn_alloc()s in __vmalloc_area_node() Peter Zijlstra <peterz@infradead.org>: mm/vmalloc: don't allow VM_NO_GUARD on vmap() Eric Dumazet <edumazet@google.com>: mm/vmalloc: make show_numa_info() aware of hugepage mappings mm/vmalloc: make sure to dump unpurged areas in /proc/vmallocinfo "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: do not adjust the search size for alignment overhead mm/vmalloc: check various alignments when debugging Vasily Averin <vvs@virtuozzo.com>: vmalloc: back off when the current task is OOM-killed Kefeng Wang <wangkefeng.wang@huawei.com>: vmalloc: choose a better start address in vm_area_register_early() arm64: support page mapping percpu first chunk allocator kasan: arm64: fix pcpu_page_first_chunk crash with KASAN_VMALLOC Michal Hocko <mhocko@suse.com>: mm/vmalloc: be more explicit about supported gfp flags Chen Wandun <chenwandun@huawei.com>: mm/vmalloc: introduce alloc_pages_bulk_array_mempolicy to accelerate memory allocation Changcheng Deng <deng.changcheng@zte.com.cn>: lib/test_vmalloc.c: use swap() to make code cleaner Subsystem: mm/pagealloc Eric Dumazet <edumazet@google.com>: mm/large system hash: avoid possible NULL deref in alloc_large_system_hash Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups and fixup for page_alloc", v2: mm/page_alloc.c: remove meaningless VM_BUG_ON() in pindex_to_order() mm/page_alloc.c: simplify the code by using macro K() mm/page_alloc.c: fix obsolete comment in free_pcppages_bulk() mm/page_alloc.c: use helper function zone_spans_pfn() mm/page_alloc.c: avoid allocating highmem pages via alloc_pages_exact[_nid] Bharata B Rao <bharata@amd.com>: Patch series "Fix NUMA nodes fallback list ordering": mm/page_alloc: print node fallback order Krupa Ramakrishnan <krupa.ramakrishnan@amd.com>: mm/page_alloc: use accumulated load when building node fallback list Geert Uytterhoeven <geert+renesas@glider.be>: Patch series "Fix NUMA without SMP": mm: move node_reclaim_distance to fix NUMA without SMP mm: move fold_vm_numa_events() to fix NUMA without SMP Eric Dumazet <edumazet@google.com>: mm/page_alloc.c: do not acquire zone lock in is_free_buddy_page() Feng Tang <feng.tang@intel.com>: mm/page_alloc: detect allocation forbidden by cpuset and bail out early Liangcai Fan <liangcaifan19@gmail.com>: mm/page_alloc.c: show watermark_boost of zone in zoneinfo Christophe Leroy <christophe.leroy@csgroup.eu>: mm: create a new system state and fix core_kernel_text() mm: make generic arch_is_kernel_initmem_freed() do what it says powerpc: use generic version of arch_is_kernel_initmem_freed() s390: use generic version of arch_is_kernel_initmem_freed() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm: page_alloc: use migrate_disable() in drain_local_pages_wq() Wang ShaoBo <bobo.shaobowang@huawei.com>: mm/page_alloc: use clamp() to simplify code Subsystem: mm/memory-failure Marco Elver <elver@google.com>: mm: fix data race in PagePoisoned() Rikard Falkeborn <rikard.falkeborn@gmail.com>: mm/memory_failure: constify static mm_walk_ops Yang Shi <shy828301@gmail.com>: Patch series "Solve silent data loss caused by poisoned page cache (shmem/tmpfs)", v5: mm: filemap: coding style cleanup for filemap_map_pmd() mm: hwpoison: refactor refcount check handling mm: shmem: don't truncate page if memory failure happens mm: hwpoison: handle non-anonymous THP correctly Subsystem: mm/hugetlb Peter Xu <peterx@redhat.com>: mm/hugetlb: drop __unmap_hugepage_range definition from hugetlb.h Mike Kravetz <mike.kravetz@oracle.com>: Patch series "hugetlb: add demote/split page functionality", v4: hugetlb: add demote hugetlb page sysfs interfaces mm/cma: add cma_pages_valid to determine if pages are in CMA hugetlb: be sure to free demoted CMA pages to CMA hugetlb: add demote bool to gigantic page routines hugetlb: add hugetlb demote page support Liangcai Fan <liangcaifan19@gmail.com>: mm: khugepaged: recalculate min_free_kbytes after stopping khugepaged Mina Almasry <almasrymina@google.com>: mm, hugepages: add mremap() support for hugepage backed vma mm, hugepages: add hugetlb vma mremap() test Baolin Wang <baolin.wang@linux.alibaba.com>: hugetlb: support node specified when using cma for gigantic hugepages Ran Jianping <ran.jianping@zte.com.cn>: mm: remove duplicate include in hugepage-mremap.c Baolin Wang <baolin.wang@linux.alibaba.com>: Patch series "Some cleanups and improvements for hugetlb": hugetlb_cgroup: remove unused hugetlb_cgroup_from_counter macro hugetlb: replace the obsolete hugetlb_instantiation_mutex in the comments hugetlb: remove redundant validation in has_same_uncharge_info() hugetlb: remove redundant VM_BUG_ON() in add_reservation_in_range() Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: remove unnecessary set_page_count in prep_compound_gigantic_page Subsystem: mm/userfaultfd Axel Rasmussen <axelrasmussen@google.com>: Patch series "Small userfaultfd selftest fixups", v2: userfaultfd/selftests: don't rely on GNU extensions for random numbers userfaultfd/selftests: fix feature support detection userfaultfd/selftests: fix calculation of expected ioctls Subsystem: mm/vmscan Miaohe Lin <linmiaohe@huawei.com>: mm/page_isolation: fix potential missing call to unset_migratetype_isolate() mm/page_isolation: guard against possible putback unisolated page Kai Song <songkai01@inspur.com>: mm/vmscan.c: fix -Wunused-but-set-variable warning Mel Gorman <mgorman@techsingularity.net>: Patch series "Remove dependency on congestion_wait in mm/", v5. Patch series: mm/vmscan: throttle reclaim until some writeback completes if congested mm/vmscan: throttle reclaim and compaction when too may pages are isolated mm/vmscan: throttle reclaim when no progress is being made mm/writeback: throttle based on page writeback instead of congestion mm/page_alloc: remove the throttling logic from the page allocator mm/vmscan: centralise timeout values for reclaim_throttle mm/vmscan: increase the timeout if page reclaim is not making progress mm/vmscan: delay waking of tasks throttled on NOPROGRESS Yuanzheng Song <songyuanzheng@huawei.com>: mm/vmpressure: fix data-race with memcg->socket_pressure Subsystem: mm/tools Zhenliang Wei <weizhenliang@huawei.com>: tools/vm/page_owner_sort.c: count and sort by mem Naoya Horiguchi <naoya.horiguchi@nec.com>: Patch series "tools/vm/page-types.c: a few improvements": tools/vm/page-types.c: make walk_file() aware of address range option tools/vm/page-types.c: move show_file() to summary output tools/vm/page-types.c: print file offset in hexadecimal Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: Patch series "memblock: cleanup memblock_free interface", v2: arch_numa: simplify numa_distance allocation xen/x86: free_p2m_page: use memblock_free_ptr() to free a virtual pointer memblock: drop memblock_free_early_nid() and memblock_free_early() memblock: stop aliasing __memblock_free_late with memblock_free_late memblock: rename memblock_free to memblock_phys_free memblock: use memblock_free for freeing virtual pointers Subsystem: mm/oom-kill Sultan Alsawaf <sultan@kerneltoast.com>: mm: mark the OOM reaper thread as freezable Subsystem: mm/hugetlbfs Zhenguo Yao <yaozhenguo1@gmail.com>: hugetlbfs: extend the definition of hugepages parameter to support node allocation Subsystem: mm/migration John Hubbard <jhubbard@nvidia.com>: mm/migrate: de-duplicate migrate_reason strings Yang Shi <shy828301@gmail.com>: mm: migrate: make demotion knob depend on migration Subsystem: mm/thp "George G. Davis" <davis.george@siemens.com>: selftests/vm/transhuge-stress: fix ram size thinko Rongwei Wang <rongwei.wang@linux.alibaba.com>: Patch series "fix two bugs for file THP": mm, thp: lock filemap when truncating page cache mm, thp: fix incorrect unmap behavior for private pages Subsystem: mm/readahead Lin Feng <linf@wangsu.com>: mm/readahead.c: fix incorrect comments for get_init_ra_size Subsystem: mm/nommu Kefeng Wang <wangkefeng.wang@huawei.com>: mm: nommu: kill arch_get_unmapped_area() Subsystem: mm/ksm "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: selftest/vm: fix ksm selftest to run with different NUMA topologies Pedro Demarchi Gomes <pedrodemargomes@gmail.com>: selftests: vm: add KSM huge pages merging time test Subsystem: mm/vmstat Liu Shixin <liushixin2@huawei.com>: mm/vmstat: annotate data race for zone->free_area[order].nr_free Lin Feng <linf@wangsu.com>: mm: vmstat.c: make extfrag_index show more pretty Subsystem: mm/madvise David Hildenbrand <david@redhat.com>: selftests/vm: make MADV_POPULATE_(READ|WRITE) use in-tree headers Subsystem: mm/memory-hotplug Tang Yizhou <tangyizhou@huawei.com>: mm/memory_hotplug: add static qualifier for online_policy_to_str() David Hildenbrand <david@redhat.com>: Patch series "memory-hotplug.rst: document the "auto-movable" online policy": memory-hotplug.rst: fix two instances of "movablecore" that should be "movable_node" memory-hotplug.rst: fix wrong /sys/module/memory_hotplug/parameters/ path memory-hotplug.rst: document the "auto-movable" online policy Patch series "mm/memory_hotplug: Kconfig and 32 bit cleanups": mm/memory_hotplug: remove CONFIG_X86_64_ACPI_NUMA dependency from CONFIG_MEMORY_HOTPLUG mm/memory_hotplug: remove CONFIG_MEMORY_HOTPLUG_SPARSE mm/memory_hotplug: restrict CONFIG_MEMORY_HOTPLUG to 64 bit mm/memory_hotplug: remove HIGHMEM leftovers mm/memory_hotplug: remove stale function declarations x86: remove memory hotplug support on X86_32 Patch series "mm/memory_hotplug: full support for add_memory_driver_managed() with CONFIG_ARCH_KEEP_MEMBLOCK", v2: mm/memory_hotplug: handle memblock_add_node() failures in add_memory_resource() memblock: improve MEMBLOCK_HOTPLUG documentation memblock: allow to specify flags with memblock_add_node() memblock: add MEMBLOCK_DRIVER_MANAGED to mimic IORESOURCE_SYSRAM_DRIVER_MANAGED mm/memory_hotplug: indicate MEMBLOCK_DRIVER_MANAGED with IORESOURCE_SYSRAM_DRIVER_MANAGED Subsystem: mm/rmap Alistair Popple <apopple@nvidia.com>: mm/rmap.c: avoid double faults migrating device private pages Subsystem: mm/zsmalloc Miaohe Lin <linmiaohe@huawei.com>: mm/zsmalloc.c: close race window between zs_pool_dec_isolated() and zs_unregister_migration() Subsystem: mm/highmem Ira Weiny <ira.weiny@intel.com>: mm/highmem: remove deprecated kmap_atomic Subsystem: mm/zram Jaewon Kim <jaewon31.kim@samsung.com>: zram_drv: allow reclaim on bio_alloc Dan Carpenter <dan.carpenter@oracle.com>: zram: off by one in read_block_state() Brian Geffon <bgeffon@google.com>: zram: introduce an aged idle interface Subsystem: mm/cleanups Stephen Kitt <steve@sk2.org>: mm: remove HARDENED_USERCOPY_FALLBACK Mianhan Liu <liumh1@shanghaitech.edu.cn>: include/linux/mm.h: move nr_free_buffer_pages from swap.h to mm.h Subsystem: mm/kfence Marco Elver <elver@google.com>: stacktrace: move filter_irq_stacks() to kernel/stacktrace.c kfence: count unexpectedly skipped allocations kfence: move saving stack trace of allocations into __kfence_alloc() kfence: limit currently covered allocations when pool nearly full kfence: add note to documentation about skipping covered allocations kfence: test: use kunit_skip() to skip tests kfence: shorten critical sections of alloc/free kfence: always use static branches to guard kfence_alloc() kfence: default to dynamic branch instead of static keys mode Subsystem: mm/damon Geert Uytterhoeven <geert@linux-m68k.org>: mm/damon: grammar s/works/work/ SeongJae Park <sjpark@amazon.de>: Documentation/vm: move user guides to admin-guide/mm/ SeongJae Park <sj@kernel.org>: MAINTAINERS: update SeongJae's email address SeongJae Park <sjpark@amazon.de>: docs/vm/damon: remove broken reference include/linux/damon.h: fix kernel-doc comments for 'damon_callback' SeongJae Park <sj@kernel.org>: mm/damon/core: print kdamond start log in debug mode only Changbin Du <changbin.du@gmail.com>: mm/damon: remove unnecessary do_exit() from kdamond mm/damon: needn't hold kdamond_lock to print pid of kdamond Colin Ian King <colin.king@canonical.com>: mm/damon/core: nullify pointer ctx->kdamond with a NULL SeongJae Park <sj@kernel.org>: Patch series "Implement Data Access Monitoring-based Memory Operation Schemes": mm/damon/core: account age of target regions mm/damon/core: implement DAMON-based Operation Schemes (DAMOS) mm/damon/vaddr: support DAMON-based Operation Schemes mm/damon/dbgfs: support DAMON-based Operation Schemes mm/damon/schemes: implement statistics feature selftests/damon: add 'schemes' debugfs tests Docs/admin-guide/mm/damon: document DAMON-based Operation Schemes Patch series "DAMON: Support Physical Memory Address Space Monitoring:: mm/damon/dbgfs: allow users to set initial monitoring target regions mm/damon/dbgfs-test: add a unit test case for 'init_regions' Docs/admin-guide/mm/damon: document 'init_regions' feature mm/damon/vaddr: separate commonly usable functions mm/damon: implement primitives for physical address space monitoring mm/damon/dbgfs: support physical memory monitoring Docs/DAMON: document physical memory monitoring support Rikard Falkeborn <rikard.falkeborn@gmail.com>: mm/damon/vaddr: constify static mm_walk_ops Rongwei Wang <rongwei.wang@linux.alibaba.com>: mm/damon/dbgfs: remove unnecessary variables SeongJae Park <sj@kernel.org>: mm/damon/paddr: support the pageout scheme mm/damon/schemes: implement size quota for schemes application speed control mm/damon/schemes: skip already charged targets and regions mm/damon/schemes: implement time quota mm/damon/dbgfs: support quotas of schemes mm/damon/selftests: support schemes quotas mm/damon/schemes: prioritize regions within the quotas mm/damon/vaddr,paddr: support pageout prioritization mm/damon/dbgfs: support prioritization weights tools/selftests/damon: update for regions prioritization of schemes mm/damon/schemes: activate schemes based on a watermarks mechanism mm/damon/dbgfs: support watermarks selftests/damon: support watermarks mm/damon: introduce DAMON-based Reclamation (DAMON_RECLAIM) Documentation/admin-guide/mm/damon: add a document for DAMON_RECLAIM Xin Hao <xhao@linux.alibaba.com>: Patch series "mm/damon: Fix some small bugs", v4: mm/damon: remove unnecessary variable initialization mm/damon/dbgfs: add adaptive_targets list check before enable monitor_on SeongJae Park <sj@kernel.org>: Patch series "Fix trivial nits in Documentation/admin-guide/mm": Docs/admin-guide/mm/damon/start: fix wrong example commands Docs/admin-guide/mm/damon/start: fix a wrong link Docs/admin-guide/mm/damon/start: simplify the content Docs/admin-guide/mm/pagemap: wordsmith page flags descriptions Changbin Du <changbin.du@gmail.com>: mm/damon: simplify stop mechanism Colin Ian King <colin.i.king@googlemail.com>: mm/damon: fix a few spelling mistakes in comments and a pr_debug message Changbin Du <changbin.du@gmail.com>: mm/damon: remove return value from before_terminate callback a/Documentation/admin-guide/blockdev/zram.rst | 8 a/Documentation/admin-guide/cgroup-v1/memory.rst | 11 a/Documentation/admin-guide/kernel-parameters.txt | 14 a/Documentation/admin-guide/mm/damon/index.rst | 1 a/Documentation/admin-guide/mm/damon/reclaim.rst | 235 +++ a/Documentation/admin-guide/mm/damon/start.rst | 140 + a/Documentation/admin-guide/mm/damon/usage.rst | 117 + a/Documentation/admin-guide/mm/hugetlbpage.rst | 42 a/Documentation/admin-guide/mm/memory-hotplug.rst | 147 +- a/Documentation/admin-guide/mm/pagemap.rst | 75 - a/Documentation/core-api/memory-hotplug.rst | 3 a/Documentation/dev-tools/kfence.rst | 23 a/Documentation/translations/zh_CN/core-api/memory-hotplug.rst | 4 a/Documentation/vm/damon/design.rst | 29 a/Documentation/vm/damon/faq.rst | 5 a/Documentation/vm/damon/index.rst | 1 a/Documentation/vm/page_owner.rst | 23 a/MAINTAINERS | 2 a/Makefile | 15 a/arch/Kconfig | 28 a/arch/alpha/kernel/core_irongate.c | 6 a/arch/arc/mm/init.c | 6 a/arch/arm/mach-hisi/platmcpm.c | 2 a/arch/arm/mach-rpc/ecard.c | 2 a/arch/arm/mm/init.c | 2 a/arch/arm64/Kconfig | 4 a/arch/arm64/mm/kasan_init.c | 16 a/arch/arm64/mm/mmu.c | 4 a/arch/ia64/mm/contig.c | 2 a/arch/ia64/mm/init.c | 2 a/arch/m68k/mm/mcfmmu.c | 3 a/arch/m68k/mm/motorola.c | 6 a/arch/mips/loongson64/init.c | 4 a/arch/mips/mm/init.c | 6 a/arch/mips/sgi-ip27/ip27-memory.c | 3 a/arch/mips/sgi-ip30/ip30-setup.c | 6 a/arch/powerpc/Kconfig | 1 a/arch/powerpc/configs/skiroot_defconfig | 1 a/arch/powerpc/include/asm/machdep.h | 2 a/arch/powerpc/include/asm/sections.h | 13 a/arch/powerpc/kernel/dt_cpu_ftrs.c | 8 a/arch/powerpc/kernel/paca.c | 8 a/arch/powerpc/kernel/setup-common.c | 4 a/arch/powerpc/kernel/setup_64.c | 6 a/arch/powerpc/kernel/smp.c | 2 a/arch/powerpc/mm/book3s64/radix_tlb.c | 4 a/arch/powerpc/mm/hugetlbpage.c | 9 a/arch/powerpc/platforms/powernv/pci-ioda.c | 4 a/arch/powerpc/platforms/powernv/setup.c | 4 a/arch/powerpc/platforms/pseries/setup.c | 2 a/arch/powerpc/platforms/pseries/svm.c | 9 a/arch/riscv/kernel/setup.c | 10 a/arch/s390/include/asm/sections.h | 12 a/arch/s390/kernel/setup.c | 11 a/arch/s390/kernel/smp.c | 6 a/arch/s390/kernel/uv.c | 2 a/arch/s390/mm/init.c | 3 a/arch/s390/mm/kasan_init.c | 2 a/arch/sh/boards/mach-ap325rxa/setup.c | 2 a/arch/sh/boards/mach-ecovec24/setup.c | 4 a/arch/sh/boards/mach-kfr2r09/setup.c | 2 a/arch/sh/boards/mach-migor/setup.c | 2 a/arch/sh/boards/mach-se/7724/setup.c | 4 a/arch/sparc/kernel/smp_64.c | 4 a/arch/um/kernel/mem.c | 4 a/arch/x86/Kconfig | 6 a/arch/x86/kernel/setup.c | 4 a/arch/x86/kernel/setup_percpu.c | 2 a/arch/x86/mm/init.c | 2 a/arch/x86/mm/init_32.c | 31 a/arch/x86/mm/kasan_init_64.c | 4 a/arch/x86/mm/numa.c | 2 a/arch/x86/mm/numa_emulation.c | 2 a/arch/x86/xen/mmu_pv.c | 8 a/arch/x86/xen/p2m.c | 4 a/arch/x86/xen/setup.c | 6 a/drivers/base/Makefile | 2 a/drivers/base/arch_numa.c | 96 + a/drivers/base/node.c | 9 a/drivers/block/zram/zram_drv.c | 66 a/drivers/firmware/efi/memmap.c | 2 a/drivers/hwmon/occ/p9_sbe.c | 1 a/drivers/macintosh/smu.c | 2 a/drivers/mmc/core/mmc_test.c | 1 a/drivers/mtd/mtdcore.c | 1 a/drivers/of/kexec.c | 4 a/drivers/of/of_reserved_mem.c | 5 a/drivers/rapidio/devices/rio_mport_cdev.c | 9 a/drivers/s390/char/sclp_early.c | 4 a/drivers/usb/early/xhci-dbc.c | 10 a/drivers/virtio/Kconfig | 2 a/drivers/xen/swiotlb-xen.c | 4 a/fs/d_path.c | 8 a/fs/exec.c | 4 a/fs/ocfs2/alloc.c | 21 a/fs/ocfs2/dlm/dlmrecovery.c | 1 a/fs/ocfs2/file.c | 8 a/fs/ocfs2/inode.c | 4 a/fs/ocfs2/journal.c | 28 a/fs/ocfs2/journal.h | 3 a/fs/ocfs2/super.c | 40 a/fs/open.c | 16 a/fs/posix_acl.c | 3 a/fs/proc/task_mmu.c | 28 a/fs/super.c | 3 a/include/asm-generic/sections.h | 14 a/include/linux/backing-dev-defs.h | 3 a/include/linux/backing-dev.h | 1 a/include/linux/cma.h | 1 a/include/linux/compiler-gcc.h | 8 a/include/linux/compiler_attributes.h | 10 a/include/linux/compiler_types.h | 12 a/include/linux/cpuset.h | 17 a/include/linux/damon.h | 258 +++ a/include/linux/fs.h | 1 a/include/linux/gfp.h | 8 a/include/linux/highmem.h | 28 a/include/linux/hugetlb.h | 36 a/include/linux/io-mapping.h | 6 a/include/linux/kasan.h | 8 a/include/linux/kernel.h | 1 a/include/linux/kfence.h | 21 a/include/linux/memblock.h | 48 a/include/linux/memcontrol.h | 9 a/include/linux/memory.h | 26 a/include/linux/memory_hotplug.h | 3 a/include/linux/mempolicy.h | 5 a/include/linux/migrate.h | 23 a/include/linux/migrate_mode.h | 13 a/include/linux/mm.h | 57 a/include/linux/mm_types.h | 2 a/include/linux/mmzone.h | 41 a/include/linux/node.h | 4 a/include/linux/page-flags.h | 2 a/include/linux/percpu.h | 6 a/include/linux/sched/mm.h | 25 a/include/linux/slab.h | 181 +- a/include/linux/slub_def.h | 13 a/include/linux/stackdepot.h | 8 a/include/linux/stacktrace.h | 1 a/include/linux/swap.h | 1 a/include/linux/vmalloc.h | 24 a/include/trace/events/mmap_lock.h | 50 a/include/trace/events/vmscan.h | 42 a/include/trace/events/writeback.h | 7 a/init/Kconfig | 2 a/init/initramfs.c | 4 a/init/main.c | 6 a/kernel/cgroup/cpuset.c | 23 a/kernel/cpu.c | 2 a/kernel/dma/swiotlb.c | 6 a/kernel/exit.c | 2 a/kernel/extable.c | 2 a/kernel/fork.c | 51 a/kernel/kexec_file.c | 5 a/kernel/kthread.c | 21 a/kernel/locking/lockdep.c | 15 a/kernel/printk/printk.c | 4 a/kernel/sched/core.c | 37 a/kernel/sched/sched.h | 4 a/kernel/sched/topology.c | 1 a/kernel/stacktrace.c | 30 a/kernel/tsacct.c | 2 a/kernel/workqueue.c | 2 a/lib/Kconfig.debug | 2 a/lib/Kconfig.kfence | 26 a/lib/bootconfig.c | 2 a/lib/cpumask.c | 6 a/lib/stackdepot.c | 76 - a/lib/test_kasan.c | 26 a/lib/test_kasan_module.c | 2 a/lib/test_vmalloc.c | 6 a/mm/Kconfig | 10 a/mm/backing-dev.c | 65 a/mm/cma.c | 26 a/mm/compaction.c | 12 a/mm/damon/Kconfig | 24 a/mm/damon/Makefile | 4 a/mm/damon/core.c | 500 ++++++- a/mm/damon/dbgfs-test.h | 56 a/mm/damon/dbgfs.c | 486 +++++- a/mm/damon/paddr.c | 275 +++ a/mm/damon/prmtv-common.c | 133 + a/mm/damon/prmtv-common.h | 20 a/mm/damon/reclaim.c | 356 ++++ a/mm/damon/vaddr-test.h | 2 a/mm/damon/vaddr.c | 167 +- a/mm/debug.c | 20 a/mm/debug_vm_pgtable.c | 7 a/mm/filemap.c | 78 - a/mm/gup.c | 5 a/mm/highmem.c | 6 a/mm/hugetlb.c | 713 +++++++++- a/mm/hugetlb_cgroup.c | 3 a/mm/internal.h | 26 a/mm/kasan/common.c | 8 a/mm/kasan/generic.c | 16 a/mm/kasan/kasan.h | 2 a/mm/kasan/shadow.c | 5 a/mm/kfence/core.c | 214 ++- a/mm/kfence/kfence.h | 2 a/mm/kfence/kfence_test.c | 14 a/mm/khugepaged.c | 10 a/mm/list_lru.c | 58 a/mm/memblock.c | 35 a/mm/memcontrol.c | 217 +-- a/mm/memory-failure.c | 117 + a/mm/memory.c | 166 +- a/mm/memory_hotplug.c | 57 a/mm/mempolicy.c | 143 +- a/mm/migrate.c | 61 a/mm/mmap.c | 2 a/mm/mprotect.c | 5 a/mm/mremap.c | 86 - a/mm/nommu.c | 6 a/mm/oom_kill.c | 27 a/mm/page-writeback.c | 13 a/mm/page_alloc.c | 119 - a/mm/page_ext.c | 2 a/mm/page_isolation.c | 29 a/mm/percpu.c | 24 a/mm/readahead.c | 2 a/mm/rmap.c | 8 a/mm/shmem.c | 44 a/mm/slab.c | 16 a/mm/slab_common.c | 8 a/mm/slub.c | 117 - a/mm/sparse-vmemmap.c | 2 a/mm/sparse.c | 6 a/mm/swap.c | 23 a/mm/swapfile.c | 6 a/mm/userfaultfd.c | 8 a/mm/vmalloc.c | 107 + a/mm/vmpressure.c | 2 a/mm/vmscan.c | 194 ++ a/mm/vmstat.c | 76 - a/mm/zsmalloc.c | 7 a/net/ipv4/tcp.c | 1 a/net/ipv4/udp.c | 1 a/net/netfilter/ipvs/ip_vs_ctl.c | 1 a/net/openvswitch/meter.c | 1 a/net/sctp/protocol.c | 1 a/scripts/checkpatch.pl | 3 a/scripts/decodecode | 2 a/scripts/spelling.txt | 18 a/security/Kconfig | 14 a/tools/testing/selftests/damon/debugfs_attrs.sh | 25 a/tools/testing/selftests/memory-hotplug/config | 1 a/tools/testing/selftests/vm/.gitignore | 1 a/tools/testing/selftests/vm/Makefile | 1 a/tools/testing/selftests/vm/hugepage-mremap.c | 161 ++ a/tools/testing/selftests/vm/ksm_tests.c | 154 ++ a/tools/testing/selftests/vm/madv_populate.c | 15 a/tools/testing/selftests/vm/run_vmtests.sh | 11 a/tools/testing/selftests/vm/transhuge-stress.c | 2 a/tools/testing/selftests/vm/userfaultfd.c | 157 +- a/tools/vm/page-types.c | 38 a/tools/vm/page_owner_sort.c | 94 + b/Documentation/admin-guide/mm/index.rst | 2 b/Documentation/vm/index.rst | 26 260 files changed, 6448 insertions(+), 2327 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-10-28 21:35 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-10-28 21:35 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 11 patches, based on 411a44c24a561e449b592ff631b7ae321f1eb559. Subsystems affected by this patch series: mm/memcg mm/memory-failure mm/oom-kill ocfs2 mm/secretmem mm/vmalloc mm/hugetlb mm/damon mm/tools Subsystem: mm/memcg Shakeel Butt <shakeelb@google.com>: memcg: page_alloc: skip bulk allocator for __GFP_ACCOUNT Subsystem: mm/memory-failure Yang Shi <shy828301@gmail.com>: mm: hwpoison: remove the unnecessary THP check mm: filemap: check if THP has hwpoisoned subpage for PMD page fault Subsystem: mm/oom-kill Suren Baghdasaryan <surenb@google.com>: mm/oom_kill.c: prevent a race between process_mrelease and exit_mmap Subsystem: ocfs2 Gautham Ananthakrishna <gautham.ananthakrishna@oracle.com>: ocfs2: fix race between searching chunks and release journal_head from buffer_head Subsystem: mm/secretmem Kees Cook <keescook@chromium.org>: mm/secretmem: avoid letting secretmem_users drop to zero Subsystem: mm/vmalloc Chen Wandun <chenwandun@huawei.com>: mm/vmalloc: fix numa spreading for large hash tables Subsystem: mm/hugetlb Rongwei Wang <rongwei.wang@linux.alibaba.com>: mm, thp: bail out early in collapse_file for writeback page Yang Shi <shy828301@gmail.com>: mm: khugepaged: skip huge page collapse for special files Subsystem: mm/damon SeongJae Park <sj@kernel.org>: mm/damon/core-test: fix wrong expectations for 'damon_split_regions_of()' Subsystem: mm/tools David Yang <davidcomponentone@gmail.com>: tools/testing/selftests/vm/split_huge_page_test.c: fix application of sizeof to pointer fs/ocfs2/suballoc.c | 22 ++++++++++------- include/linux/page-flags.h | 23 ++++++++++++++++++ mm/damon/core-test.h | 4 +-- mm/huge_memory.c | 2 + mm/khugepaged.c | 26 +++++++++++++------- mm/memory-failure.c | 28 +++++++++++----------- mm/memory.c | 9 +++++++ mm/oom_kill.c | 23 +++++++++--------- mm/page_alloc.c | 8 +++++- mm/secretmem.c | 2 - mm/vmalloc.c | 15 +++++++---- tools/testing/selftests/vm/split_huge_page_test.c | 2 - 12 files changed, 110 insertions(+), 54 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-10-18 22:14 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-10-18 22:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 19 patches, based on 519d81956ee277b4419c723adfb154603c2565ba. Subsystems affected by this patch series: mm/userfaultfd mm/migration ocfs2 mm/memblock mm/mempolicy mm/slub binfmt vfs mm/secretmem mm/thp misc Subsystem: mm/userfaultfd Peter Xu <peterx@redhat.com>: mm/userfaultfd: selftests: fix memory corruption with thp enabled Nadav Amit <namit@vmware.com>: userfaultfd: fix a race between writeprotect and exit_mmap() Subsystem: mm/migration Dave Hansen <dave.hansen@linux.intel.com>: Patch series "mm/migrate: 5.15 fixes for automatic demotion", v2: mm/migrate: optimize hotplug-time demotion order updates mm/migrate: add CPU hotplug to demotion #ifdef Huang Ying <ying.huang@intel.com>: mm/migrate: fix CPUHP state to update node demotion order Subsystem: ocfs2 Jan Kara <jack@suse.cz>: ocfs2: fix data corruption after conversion from inline format Valentin Vidic <vvidic@valentin-vidic.from.hr>: ocfs2: mount fails with buffer overflow in strlen Subsystem: mm/memblock Peng Fan <peng.fan@nxp.com>: memblock: check memory total_size Subsystem: mm/mempolicy Eric Dumazet <edumazet@google.com>: mm/mempolicy: do not allow illegal MPOL_F_NUMA_BALANCING | MPOL_LOCAL in mbind() Subsystem: mm/slub Miaohe Lin <linmiaohe@huawei.com>: Patch series "Fixups for slub": mm, slub: fix two bugs in slab_debug_trace_open() mm, slub: fix mismatch between reconstructed freelist depth and cnt mm, slub: fix potential memoryleak in kmem_cache_open() mm, slub: fix potential use-after-free in slab_debugfs_fops mm, slub: fix incorrect memcg slab count for bulk free Subsystem: binfmt Lukas Bulwahn <lukas.bulwahn@gmail.com>: elfcore: correct reference to CONFIG_UML Subsystem: vfs "Matthew Wilcox (Oracle)" <willy@infradead.org>: vfs: check fd has read access in kernel_read_file_from_fd() Subsystem: mm/secretmem Sean Christopherson <seanjc@google.com>: mm/secretmem: fix NULL page->mapping dereference in page_is_secretmem() Subsystem: mm/thp Marek Szyprowski <m.szyprowski@samsung.com>: mm/thp: decrease nr_thps in file's mapping on THP split Subsystem: misc Andrej Shadura <andrew.shadura@collabora.co.uk>: mailmap: add Andrej Shadura .mailmap | 2 + fs/kernel_read_file.c | 2 - fs/ocfs2/alloc.c | 46 ++++++----------------- fs/ocfs2/super.c | 14 +++++-- fs/userfaultfd.c | 12 ++++-- include/linux/cpuhotplug.h | 4 ++ include/linux/elfcore.h | 2 - include/linux/memory.h | 5 ++ include/linux/secretmem.h | 2 - mm/huge_memory.c | 6 ++- mm/memblock.c | 2 - mm/mempolicy.c | 16 ++------ mm/migrate.c | 62 ++++++++++++++++++------------- mm/page_ext.c | 4 -- mm/slab.c | 4 +- mm/slub.c | 31 ++++++++++++--- tools/testing/selftests/vm/userfaultfd.c | 23 ++++++++++- 17 files changed, 138 insertions(+), 99 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-09-24 22:42 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-09-24 22:42 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 16 patches, based on 7d42e98182586f57f376406d033f05fe135edb75. Subsystems affected by this patch series: mm/memory-failure mm/kasan mm/damon xtensa mm/shmem ocfs2 scripts mm/tools lib mm/pagecache mm/debug sh mm/kasan mm/memory-failure mm/pagemap Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm, hwpoison: add is_free_buddy_page() in HWPoisonHandlable() Subsystem: mm/kasan Marco Elver <elver@google.com>: kasan: fix Kconfig check of CC_HAS_WORKING_NOSANITIZE_ADDRESS Subsystem: mm/damon Adam Borowski <kilobyte@angband.pl>: mm/damon: don't use strnlen() with known-bogus source length Subsystem: xtensa Guenter Roeck <linux@roeck-us.net>: xtensa: increase size of gcc stack frame check Subsystem: mm/shmem Liu Yuntao <liuyuntao10@huawei.com>: mm/shmem.c: fix judgment error in shmem_is_huge() Subsystem: ocfs2 Wengang Wang <wen.gang.wang@oracle.com>: ocfs2: drop acl cache for directories too Subsystem: scripts Miles Chen <miles.chen@mediatek.com>: scripts/sorttable: riscv: fix undeclared identifier 'EM_RISCV' error Subsystem: mm/tools Changbin Du <changbin.du@gmail.com>: tools/vm/page-types: remove dependency on opt_file for idle page tracking Subsystem: lib Paul Menzel <pmenzel@molgen.mpg.de>: lib/zlib_inflate/inffast: check config in C to avoid unused function warning Subsystem: mm/pagecache Minchan Kim <minchan@kernel.org>: mm: fs: invalidate bh_lrus for only cold path Subsystem: mm/debug Weizhao Ouyang <o451686892@gmail.com>: mm/debug: sync up MR_CONTIG_RANGE and MR_LONGTERM_PIN mm/debug: sync up latest migrate_reason to migrate_reason_names Subsystem: sh Geert Uytterhoeven <geert+renesas@glider.be>: sh: pgtable-3level: fix cast to pointer from integer of different size Subsystem: mm/kasan Nathan Chancellor <nathan@kernel.org>: kasan: always respect CONFIG_KASAN_STACK Subsystem: mm/memory-failure Qi Zheng <zhengqi.arch@bytedance.com>: mm/memory_failure: fix the missing pte_unmap() call Subsystem: mm/pagemap Chen Jun <chenjun102@huawei.com>: mm: fix uninitialized use in overcommit_policy_handler arch/sh/include/asm/pgtable-3level.h | 2 +- fs/buffer.c | 8 ++++++-- fs/ocfs2/dlmglue.c | 3 ++- include/linux/buffer_head.h | 4 ++-- include/linux/migrate.h | 6 +++++- lib/Kconfig.debug | 2 +- lib/Kconfig.kasan | 2 ++ lib/zlib_inflate/inffast.c | 13 ++++++------- mm/damon/dbgfs-test.h | 16 ++++++++-------- mm/debug.c | 4 +++- mm/memory-failure.c | 12 ++++++------ mm/shmem.c | 4 ++-- mm/swap.c | 19 ++++++++++++++++--- mm/util.c | 4 ++-- scripts/Makefile.kasan | 3 ++- scripts/sorttable.c | 4 ++++ tools/vm/page-types.c | 2 +- 17 files changed, 69 insertions(+), 39 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-09-10 3:09 Andrew Morton 2021-09-10 17:11 ` incoming Kees Cook 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2021-09-10 3:09 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits More post linux-next material. 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6. Subsystems affected by this patch series: mm/slab-generic rapidio mm/debug Subsystem: mm/slab-generic "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: move kvmalloc-related functions to slab.h Subsystem: rapidio Kees Cook <keescook@chromium.org>: rapidio: avoid bogus __alloc_size warning Subsystem: mm/debug Kees Cook <keescook@chromium.org>: Patch series "Add __alloc_size() for better bounds checking", v2: Compiler Attributes: add __alloc_size() for better bounds checking checkpatch: add __alloc_size() to known $Attribute slab: clean up function declarations slab: add __alloc_size attributes for better bounds checking mm/page_alloc: add __alloc_size attributes for better bounds checking percpu: add __alloc_size attributes for better bounds checking mm/vmalloc: add __alloc_size attributes for better bounds checking Makefile | 15 +++ drivers/of/kexec.c | 1 drivers/rapidio/devices/rio_mport_cdev.c | 9 +- include/linux/compiler_attributes.h | 6 + include/linux/gfp.h | 2 include/linux/mm.h | 34 -------- include/linux/percpu.h | 3 include/linux/slab.h | 122 ++++++++++++++++++++++--------- include/linux/vmalloc.h | 11 ++ scripts/checkpatch.pl | 3 10 files changed, 132 insertions(+), 74 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-09-10 3:09 incoming Andrew Morton @ 2021-09-10 17:11 ` Kees Cook 2021-09-10 20:13 ` incoming Kees Cook 0 siblings, 1 reply; 322+ messages in thread From: Kees Cook @ 2021-09-10 17:11 UTC (permalink / raw) To: Linus Torvalds, Andrew Morton; +Cc: linux-mm, mm-commits On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote: > > More post linux-next material. > > 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6. > > Subsystems affected by this patch series: > > mm/slab-generic > rapidio > mm/debug > > Subsystem: mm/slab-generic > > "Matthew Wilcox (Oracle)" <willy@infradead.org>: > mm: move kvmalloc-related functions to slab.h > > Subsystem: rapidio > > Kees Cook <keescook@chromium.org>: > rapidio: avoid bogus __alloc_size warning > > Subsystem: mm/debug > > Kees Cook <keescook@chromium.org>: > Patch series "Add __alloc_size() for better bounds checking", v2: > Compiler Attributes: add __alloc_size() for better bounds checking > checkpatch: add __alloc_size() to known $Attribute > slab: clean up function declarations > slab: add __alloc_size attributes for better bounds checking > mm/page_alloc: add __alloc_size attributes for better bounds checking > percpu: add __alloc_size attributes for better bounds checking > mm/vmalloc: add __alloc_size attributes for better bounds checking Hi, FYI, in overnight build testing I found yet another corner case in GCC's handling of the __alloc_size attribute. It's the gift that keeps on giving. The fix is here: https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/ > > Makefile | 15 +++ > drivers/of/kexec.c | 1 > drivers/rapidio/devices/rio_mport_cdev.c | 9 +- > include/linux/compiler_attributes.h | 6 + > include/linux/gfp.h | 2 > include/linux/mm.h | 34 -------- > include/linux/percpu.h | 3 > include/linux/slab.h | 122 ++++++++++++++++++++++--------- > include/linux/vmalloc.h | 11 ++ > scripts/checkpatch.pl | 3 > 10 files changed, 132 insertions(+), 74 deletions(-) > -- Kees Cook ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-09-10 17:11 ` incoming Kees Cook @ 2021-09-10 20:13 ` Kees Cook 0 siblings, 0 replies; 322+ messages in thread From: Kees Cook @ 2021-09-10 20:13 UTC (permalink / raw) To: linux-kernel; +Cc: Linus Torvalds, Andrew Morton, linux-mm, mm-commits On Fri, Sep 10, 2021 at 10:11:53AM -0700, Kees Cook wrote: > On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote: > > > > More post linux-next material. > > > > 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6. > > > > Subsystems affected by this patch series: > > > > mm/slab-generic > > rapidio > > mm/debug > > > > Subsystem: mm/slab-generic > > > > "Matthew Wilcox (Oracle)" <willy@infradead.org>: > > mm: move kvmalloc-related functions to slab.h > > > > Subsystem: rapidio > > > > Kees Cook <keescook@chromium.org>: > > rapidio: avoid bogus __alloc_size warning > > > > Subsystem: mm/debug > > > > Kees Cook <keescook@chromium.org>: > > Patch series "Add __alloc_size() for better bounds checking", v2: > > Compiler Attributes: add __alloc_size() for better bounds checking > > checkpatch: add __alloc_size() to known $Attribute > > slab: clean up function declarations > > slab: add __alloc_size attributes for better bounds checking > > mm/page_alloc: add __alloc_size attributes for better bounds checking > > percpu: add __alloc_size attributes for better bounds checking > > mm/vmalloc: add __alloc_size attributes for better bounds checking > > Hi, > > FYI, in overnight build testing I found yet another corner case in > GCC's handling of the __alloc_size attribute. It's the gift that keeps > on giving. The fix is here: > > https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/ I'm so glad it's Friday. Here's the v2 fix... *sigh* https://lore.kernel.org/lkml/20210910201132.3809437-1-keescook@chromium.org/ -Kees > > > > > Makefile | 15 +++ > > drivers/of/kexec.c | 1 > > drivers/rapidio/devices/rio_mport_cdev.c | 9 +- > > include/linux/compiler_attributes.h | 6 + > > include/linux/gfp.h | 2 > > include/linux/mm.h | 34 -------- > > include/linux/percpu.h | 3 > > include/linux/slab.h | 122 ++++++++++++++++++++++--------- > > include/linux/vmalloc.h | 11 ++ > > scripts/checkpatch.pl | 3 > > 10 files changed, 132 insertions(+), 74 deletions(-) > > > > -- > Kees Cook -- Kees Cook ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-09-09 1:08 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-09-09 1:08 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm A bunch of hotfixes, mostly cc:stable. 8 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c. Subsystems affected by this patch series: mm/hmm mm/hugetlb mm/vmscan mm/pagealloc mm/pagemap mm/kmemleak mm/mempolicy mm/memblock Subsystem: mm/hmm Li Zhijian <lizhijian@cn.fujitsu.com>: mm/hmm: bypass devmap pte when all pfn requested flags are fulfilled Subsystem: mm/hugetlb Liu Zixian <liuzixian4@huawei.com>: mm/hugetlb: initialize hugetlb_usage in mm_init Subsystem: mm/vmscan Rik van Riel <riel@surriel.com>: mm,vmscan: fix divide by zero in get_scan_count Subsystem: mm/pagealloc Miaohe Lin <linmiaohe@huawei.com>: mm/page_alloc.c: avoid accessing uninitialized pcp page migratetype Subsystem: mm/pagemap Liam Howlett <liam.howlett@oracle.com>: mmap_lock: change trace and locking order Subsystem: mm/kmemleak Naohiro Aota <naohiro.aota@wdc.com>: mm/kmemleak: allow __GFP_NOLOCKDEP passed to kmemleak's gfp Subsystem: mm/mempolicy yanghui <yanghui.def@bytedance.com>: mm/mempolicy: fix a race between offset_il_node and mpol_rebind_task Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: nds32/setup: remove unused memblock_region variable in setup_memory() arch/nds32/kernel/setup.c | 1 - include/linux/hugetlb.h | 9 +++++++++ include/linux/mmap_lock.h | 8 ++++---- kernel/fork.c | 1 + mm/hmm.c | 5 ++++- mm/kmemleak.c | 3 ++- mm/mempolicy.c | 17 +++++++++++++---- mm/page_alloc.c | 4 +++- mm/vmscan.c | 2 +- 9 files changed, 37 insertions(+), 13 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-09-08 22:17 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-09-08 22:17 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits This is the post-linux-next material, so it is based upon latest upstream to catch the now-merged dependencies. 10 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c. Subsystems affected by this patch series: mm/vmstat mm/migration compat Subsystem: mm/vmstat Ingo Molnar <mingo@elte.hu>: mm/vmstat: protect per cpu variables with preempt disable on RT Subsystem: mm/migration Baolin Wang <baolin.wang@linux.alibaba.com>: mm: migrate: introduce a local variable to get the number of pages mm: migrate: fix the incorrect function name in comments mm: migrate: change to use bool type for 'page_was_mapped' Subsystem: compat Arnd Bergmann <arnd@arndb.de>: Patch series "compat: remove compat_alloc_user_space", v5: kexec: move locking into do_kexec_load kexec: avoid compat_alloc_user_space mm: simplify compat_sys_move_pages mm: simplify compat numa syscalls compat: remove some compat entry points arch: remove compat_alloc_user_space arch/arm64/include/asm/compat.h | 5 arch/arm64/include/asm/uaccess.h | 11 - arch/arm64/include/asm/unistd32.h | 10 - arch/arm64/lib/Makefile | 2 arch/arm64/lib/copy_in_user.S | 77 ---------- arch/mips/cavium-octeon/octeon-memcpy.S | 2 arch/mips/include/asm/compat.h | 8 - arch/mips/include/asm/uaccess.h | 26 --- arch/mips/kernel/syscalls/syscall_n32.tbl | 10 - arch/mips/kernel/syscalls/syscall_o32.tbl | 10 - arch/mips/lib/memcpy.S | 11 - arch/parisc/include/asm/compat.h | 6 arch/parisc/include/asm/uaccess.h | 2 arch/parisc/kernel/syscalls/syscall.tbl | 8 - arch/parisc/lib/memcpy.c | 9 - arch/powerpc/include/asm/compat.h | 16 -- arch/powerpc/kernel/syscalls/syscall.tbl | 10 - arch/s390/include/asm/compat.h | 10 - arch/s390/include/asm/uaccess.h | 3 arch/s390/kernel/syscalls/syscall.tbl | 10 - arch/s390/lib/uaccess.c | 63 -------- arch/sparc/include/asm/compat.h | 19 -- arch/sparc/kernel/process_64.c | 2 arch/sparc/kernel/signal32.c | 12 - arch/sparc/kernel/signal_64.c | 8 - arch/sparc/kernel/syscalls/syscall.tbl | 10 - arch/x86/entry/syscalls/syscall_32.tbl | 4 arch/x86/entry/syscalls/syscall_64.tbl | 2 arch/x86/include/asm/compat.h | 13 - arch/x86/include/asm/uaccess_64.h | 7 include/linux/compat.h | 39 +---- include/linux/uaccess.h | 10 - include/uapi/asm-generic/unistd.h | 10 - kernel/compat.c | 21 -- kernel/kexec.c | 105 +++++--------- kernel/sys_ni.c | 5 mm/mempolicy.c | 213 +++++++----------------------- mm/migrate.c | 69 +++++---- mm/vmstat.c | 48 ++++++ 39 files changed, 243 insertions(+), 663 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-09-08 2:52 Andrew Morton 2021-09-08 8:57 ` incoming Vlastimil Babka 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2021-09-08 2:52 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 147 patches, based on 7d2a07b769330c34b4deabeed939325c77a7ec2f. Subsystems affected by this patch series: mm/slub mm/memory-hotplug mm/rmap mm/ioremap mm/highmem mm/cleanups mm/secretmem mm/kfence mm/damon alpha percpu procfs misc core-kernel MAINTAINERS lib bitops checkpatch epoll init nilfs2 coredump fork pids criu kconfig selftests ipc mm/vmscan scripts Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6: mm, slub: don't call flush_all() from slab_debug_trace_open() mm, slub: allocate private object map for debugfs listings mm, slub: allocate private object map for validate_slab_cache() mm, slub: don't disable irq for debug_check_no_locks_freed() mm, slub: remove redundant unfreeze_partials() from put_cpu_partial() mm, slub: extract get_partial() from new_slab_objects() mm, slub: dissolve new_slab_objects() into ___slab_alloc() mm, slub: return slab page from get_partial() and set c->page afterwards mm, slub: restructure new page checks in ___slab_alloc() mm, slub: simplify kmem_cache_cpu and tid setup mm, slub: move disabling/enabling irqs to ___slab_alloc() mm, slub: do initial checks in ___slab_alloc() with irqs enabled mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc() mm, slub: restore irqs around calling new_slab() mm, slub: validate slab from partial list or page allocator before making it cpu slab mm, slub: check new pages with restored irqs mm, slub: stop disabling irqs around get_partial() mm, slub: move reset of c->page and freelist out of deactivate_slab() mm, slub: make locking in deactivate_slab() irq-safe mm, slub: call deactivate_slab() without disabling irqs mm, slub: move irq control into unfreeze_partials() mm, slub: discard slabs in unfreeze_partials() without irqs disabled mm, slub: detach whole partial list at once in unfreeze_partials() mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing mm, slub: only disable irq with spin_lock in __unfreeze_partials() mm, slub: don't disable irqs in slub_cpu_dead() mm, slab: split out the cpu offline variant of flush_slab() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context mm: slub: make object_map_lock a raw_spinlock_t Vlastimil Babka <vbabka@suse.cz>: mm, slub: make slab_lock() disable irqs with PREEMPT_RT mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg mm, slub: use migrate_disable() on PREEMPT_RT mm, slub: convert kmem_cpu_slab protection to local_lock Subsystem: mm/memory-hotplug David Hildenbrand <david@redhat.com>: Patch series "memory-hotplug.rst: complete admin-guide overhaul", v3: memory-hotplug.rst: remove locking details from admin-guide memory-hotplug.rst: complete admin-guide overhaul Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE": mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE mm: memory_hotplug: cleanup after removal of pfn_valid_within() David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: preparatory patches for new online policy and memory": mm/memory_hotplug: use "unsigned long" for PFN in zone_for_pfn_range() mm/memory_hotplug: remove nid parameter from arch_remove_memory() mm/memory_hotplug: remove nid parameter from remove_memory() and friends ACPI: memhotplug: memory resources cannot be enabled yet Patch series "mm/memory_hotplug: "auto-movable" online policy and memory groups", v3: mm: track present early pages per zone mm/memory_hotplug: introduce "auto-movable" online policy drivers/base/memory: introduce "memory groups" to logically group memory blocks mm/memory_hotplug: track present pages in memory groups ACPI: memhotplug: use a single static memory group for a single memory device dax/kmem: use a single static memory group for a single probed unit virtio-mem: use a single dynamic memory group for a single virtio-mem device mm/memory_hotplug: memory group aware "auto-movable" online policy mm/memory_hotplug: improved dynamic memory group aware "auto-movable" online policy Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixups for memory hotplug": mm/memory_hotplug: use helper zone_is_zone_device() to simplify the code Subsystem: mm/rmap Muchun Song <songmuchun@bytedance.com>: mm: remove redundant compound_head() calling Subsystem: mm/ioremap Christoph Hellwig <hch@lst.de>: riscv: only select GENERIC_IOREMAP if MMU support is enabled Patch series "small ioremap cleanups": mm: move ioremap_page_range to vmalloc.c mm: don't allow executable ioremap mappings Weizhao Ouyang <o451686892@gmail.com>: mm/early_ioremap.c: remove redundant early_ioremap_shutdown() Subsystem: mm/highmem Sebastian Andrzej Siewior <bigeasy@linutronix.de>: highmem: don't disable preemption on RT in kmap_atomic() Subsystem: mm/cleanups Changbin Du <changbin.du@gmail.com>: mm: in_irq() cleanup Muchun Song <songmuchun@bytedance.com>: mm: introduce PAGEFLAGS_MASK to replace ((1UL << NR_PAGEFLAGS) - 1) Subsystem: mm/secretmem Jordy Zomer <jordy@jordyzomer.github.io>: mm/secretmem: use refcount_t instead of atomic_t Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: show cpu and timestamp in alloc/free info kfence: test: fail fast if disabled at boot Subsystem: mm/damon SeongJae Park <sjpark@amazon.de>: Patch series "Introduce Data Access MONitor (DAMON)", v34: mm: introduce Data Access MONitor (DAMON) mm/damon/core: implement region-based sampling mm/damon: adaptively adjust regions mm/idle_page_tracking: make PG_idle reusable mm/damon: implement primitives for the virtual memory address spaces mm/damon: add a tracepoint mm/damon: implement a debugfs-based user space interface mm/damon/dbgfs: export kdamond pid to the user space mm/damon/dbgfs: support multiple contexts Documentation: add documents for DAMON mm/damon: add kunit tests mm/damon: add user space selftests MAINTAINERS: update for DAMON Subsystem: alpha Randy Dunlap <rdunlap@infradead.org>: alpha: agp: make empty macros use do-while-0 style alpha: pci-sysfs: fix all kernel-doc warnings Subsystem: percpu Greg Kroah-Hartman <gregkh@linuxfoundation.org>: percpu: remove export of pcpu_base_addr Subsystem: procfs Feng Zhou <zhoufeng.zf@bytedance.com>: fs/proc/kcore.c: add mmap interface Christoph Hellwig <hch@lst.de>: proc: stop using seq_get_buf in proc_task_name Ohhoon Kwon <ohoono.kwon@samsung.com>: connector: send event on write to /proc/[pid]/comm Subsystem: misc Colin Ian King <colin.king@canonical.com>: arch: Kconfig: fix spelling mistake "seperate" -> "separate" Andy Shevchenko <andriy.shevchenko@linux.intel.com>: include/linux/once.h: fix trivia typo Not -> Note Daniel Lezcano <daniel.lezcano@linaro.org>: Patch series "Add Hz macros", v3: units: change from 'L' to 'UL' units: add the HZ macros thermal/drivers/devfreq_cooling: use HZ macros devfreq: use HZ macros iio/drivers/as73211: use HZ macros hwmon/drivers/mr75203: use HZ macros iio/drivers/hid-sensor: use HZ macros i2c/drivers/ov02q10: use HZ macros mtd/drivers/nand: use HZ macros phy/drivers/stm32: use HZ macros Subsystem: core-kernel Yang Yang <yang.yang29@zte.com.cn>: kernel/acct.c: use dedicated helper to access rlimit values Pavel Skripkin <paskripkin@gmail.com>: profiling: fix shift-out-of-bounds bugs Subsystem: MAINTAINERS Nathan Chancellor <nathan@kernel.org>: MAINTAINERS: update ClangBuiltLinux mailing list Documentation/llvm: update mailing list Documentation/llvm: update IRC location Subsystem: lib Geert Uytterhoeven <geert@linux-m68k.org>: Patch series "math: RATIONAL and RATIONAL_KUNIT_TEST improvements": math: make RATIONAL tristate math: RATIONAL_KUNIT_TEST should depend on RATIONAL instead of selecting it Matteo Croce <mcroce@microsoft.com>: Patch series "lib/string: optimized mem* functions", v2: lib/string: optimized memcpy lib/string: optimized memmove lib/string: optimized memset Daniel Latypov <dlatypov@google.com>: lib/test: convert test_sort.c to use KUnit Randy Dunlap <rdunlap@infradead.org>: lib/dump_stack: correct kernel-doc notation lib/iov_iter.c: fix kernel-doc warnings Subsystem: bitops Yury Norov <yury.norov@gmail.com>: Patch series "Resend bitmap patches": bitops: protect find_first_{,zero}_bit properly bitops: move find_bit_*_le functions from le.h to find.h include: move find.h from asm_generic to linux arch: remove GENERIC_FIND_FIRST_BIT entirely lib: add find_first_and_bit() cpumask: use find_first_and_bit() all: replace find_next{,_zero}_bit with find_first{,_zero}_bit where appropriate tools: sync tools/bitmap with mother linux cpumask: replace cpumask_next_* with cpumask_first_* where appropriate include/linux: move for_each_bit() macros from bitops.h to find.h find: micro-optimize for_each_{set,clear}_bit() bitops: replace for_each_*_bit_from() with for_each_*_bit() where appropriate Andy Shevchenko <andriy.shevchenko@linux.intel.com>: tools: rename bitmap_alloc() to bitmap_zalloc() Yury Norov <yury.norov@gmail.com>: mm/percpu: micro-optimize pcpu_is_populated() bitmap: unify find_bit operations lib: bitmap: add performance test for bitmap_print_to_pagebuf vsprintf: rework bitmap_list_string Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: support wide strings Mimi Zohar <zohar@linux.ibm.com>: checkpatch: make email address check case insensitive Joe Perches <joe@perches.com>: checkpatch: improve GIT_COMMIT_ID test Subsystem: epoll Nicholas Piggin <npiggin@gmail.com>: fs/epoll: use a per-cpu counter for user's watches count Subsystem: init Rasmus Villemoes <linux@rasmusvillemoes.dk>: init: move usermodehelper_enable() to populate_rootfs() Kefeng Wang <wangkefeng.wang@huawei.com>: trap: cleanup trap_init() Subsystem: nilfs2 Nanyong Sun <sunnanyong@huawei.com>: Patch series "nilfs2: fix incorrect usage of kobject": nilfs2: fix memory leak in nilfs_sysfs_create_device_group nilfs2: fix NULL pointer in nilfs_##name##_attr_release nilfs2: fix memory leak in nilfs_sysfs_create_##name##_group nilfs2: fix memory leak in nilfs_sysfs_delete_##name##_group nilfs2: fix memory leak in nilfs_sysfs_create_snapshot_group nilfs2: fix memory leak in nilfs_sysfs_delete_snapshot_group Zhen Lei <thunder.leizhen@huawei.com>: nilfs2: use refcount_dec_and_lock() to fix potential UAF Subsystem: coredump David Oberhollenzer <david.oberhollenzer@sigma-star.at>: fs/coredump.c: log if a core dump is aborted due to changed file permissions QiuXi <qiuxi1@huawei.com>: coredump: fix memleak in dump_vma_snapshot() Subsystem: fork Christoph Hellwig <hch@lst.de>: kernel/fork.c: unexport get_{mm,task}_exe_file Subsystem: pids Takahiro Itazuri <itazur@amazon.com>: pid: cleanup the stale comment mentioning pidmap_init(). Subsystem: criu Cyrill Gorcunov <gorcunov@gmail.com>: prctl: allow to setup brk for et_dyn executables Subsystem: kconfig Zenghui Yu <yuzenghui@huawei.com>: configs: remove the obsolete CONFIG_INPUT_POLLDEV Lukas Bulwahn <lukas.bulwahn@gmail.com>: Kconfig.debug: drop selecting non-existing HARDLOCKUP_DETECTOR_ARCH Subsystem: selftests Greg Thelen <gthelen@google.com>: selftests/memfd: remove unused variable Subsystem: ipc Rafael Aquini <aquini@redhat.com>: ipc: replace costly bailout check in sysvipc_find_ipc() Subsystem: mm/vmscan Randy Dunlap <rdunlap@infradead.org>: mm/workingset: correct kernel-doc notations Subsystem: scripts Randy Dunlap <rdunlap@infradead.org>: scripts: check_extable: fix typo in user error message a/Documentation/admin-guide/mm/damon/index.rst | 15 a/Documentation/admin-guide/mm/damon/start.rst | 114 + a/Documentation/admin-guide/mm/damon/usage.rst | 112 + a/Documentation/admin-guide/mm/index.rst | 1 a/Documentation/admin-guide/mm/memory-hotplug.rst | 842 ++++++----- a/Documentation/dev-tools/kfence.rst | 98 - a/Documentation/kbuild/llvm.rst | 5 a/Documentation/vm/damon/api.rst | 20 a/Documentation/vm/damon/design.rst | 166 ++ a/Documentation/vm/damon/faq.rst | 51 a/Documentation/vm/damon/index.rst | 30 a/Documentation/vm/index.rst | 1 a/MAINTAINERS | 17 a/arch/Kconfig | 2 a/arch/alpha/include/asm/agp.h | 4 a/arch/alpha/include/asm/bitops.h | 2 a/arch/alpha/kernel/pci-sysfs.c | 12 a/arch/arc/Kconfig | 1 a/arch/arc/include/asm/bitops.h | 1 a/arch/arc/kernel/traps.c | 5 a/arch/arm/configs/dove_defconfig | 1 a/arch/arm/configs/pxa_defconfig | 1 a/arch/arm/include/asm/bitops.h | 1 a/arch/arm/kernel/traps.c | 5 a/arch/arm64/Kconfig | 1 a/arch/arm64/include/asm/bitops.h | 1 a/arch/arm64/mm/mmu.c | 3 a/arch/csky/include/asm/bitops.h | 1 a/arch/h8300/include/asm/bitops.h | 1 a/arch/h8300/kernel/traps.c | 4 a/arch/hexagon/include/asm/bitops.h | 1 a/arch/hexagon/kernel/traps.c | 4 a/arch/ia64/include/asm/bitops.h | 2 a/arch/ia64/mm/init.c | 3 a/arch/m68k/include/asm/bitops.h | 2 a/arch/mips/Kconfig | 1 a/arch/mips/configs/lemote2f_defconfig | 1 a/arch/mips/configs/pic32mzda_defconfig | 1 a/arch/mips/configs/rt305x_defconfig | 1 a/arch/mips/configs/xway_defconfig | 1 a/arch/mips/include/asm/bitops.h | 1 a/arch/nds32/kernel/traps.c | 5 a/arch/nios2/kernel/traps.c | 5 a/arch/openrisc/include/asm/bitops.h | 1 a/arch/openrisc/kernel/traps.c | 5 a/arch/parisc/configs/generic-32bit_defconfig | 1 a/arch/parisc/include/asm/bitops.h | 2 a/arch/parisc/kernel/traps.c | 4 a/arch/powerpc/include/asm/bitops.h | 2 a/arch/powerpc/include/asm/cputhreads.h | 2 a/arch/powerpc/kernel/traps.c | 5 a/arch/powerpc/mm/mem.c | 3 a/arch/powerpc/platforms/pasemi/dma_lib.c | 4 a/arch/powerpc/platforms/pseries/hotplug-memory.c | 9 a/arch/riscv/Kconfig | 2 a/arch/riscv/include/asm/bitops.h | 1 a/arch/riscv/kernel/traps.c | 5 a/arch/s390/Kconfig | 1 a/arch/s390/include/asm/bitops.h | 1 a/arch/s390/kvm/kvm-s390.c | 2 a/arch/s390/mm/init.c | 3 a/arch/sh/include/asm/bitops.h | 1 a/arch/sh/mm/init.c | 3 a/arch/sparc/include/asm/bitops_32.h | 1 a/arch/sparc/include/asm/bitops_64.h | 2 a/arch/um/kernel/trap.c | 4 a/arch/x86/Kconfig | 1 a/arch/x86/configs/i386_defconfig | 1 a/arch/x86/configs/x86_64_defconfig | 1 a/arch/x86/include/asm/bitops.h | 2 a/arch/x86/kernel/apic/vector.c | 4 a/arch/x86/mm/init_32.c | 3 a/arch/x86/mm/init_64.c | 3 a/arch/x86/um/Kconfig | 1 a/arch/xtensa/include/asm/bitops.h | 1 a/block/blk-mq.c | 2 a/drivers/acpi/acpi_memhotplug.c | 46 a/drivers/base/memory.c | 231 ++- a/drivers/base/node.c | 2 a/drivers/block/rnbd/rnbd-clt.c | 2 a/drivers/dax/kmem.c | 43 a/drivers/devfreq/devfreq.c | 2 a/drivers/dma/ti/edma.c | 2 a/drivers/gpu/drm/etnaviv/etnaviv_gpu.c | 4 a/drivers/hwmon/ltc2992.c | 3 a/drivers/hwmon/mr75203.c | 2 a/drivers/iio/adc/ad7124.c | 2 a/drivers/iio/common/hid-sensors/hid-sensor-attributes.c | 3 a/drivers/iio/light/as73211.c | 3 a/drivers/infiniband/hw/irdma/hw.c | 16 a/drivers/media/cec/core/cec-core.c | 2 a/drivers/media/i2c/ov02a10.c | 2 a/drivers/media/mc/mc-devnode.c | 2 a/drivers/mmc/host/renesas_sdhi_core.c | 2 a/drivers/mtd/nand/raw/intel-nand-controller.c | 2 a/drivers/net/virtio_net.c | 2 a/drivers/pci/controller/dwc/pci-dra7xx.c | 2 a/drivers/phy/st/phy-stm32-usbphyc.c | 2 a/drivers/scsi/lpfc/lpfc_sli.c | 10 a/drivers/soc/fsl/qbman/bman_portal.c | 2 a/drivers/soc/fsl/qbman/qman_portal.c | 2 a/drivers/soc/ti/k3-ringacc.c | 4 a/drivers/thermal/devfreq_cooling.c | 2 a/drivers/tty/n_tty.c | 2 a/drivers/virt/acrn/ioreq.c | 3 a/drivers/virtio/virtio_mem.c | 26 a/fs/coredump.c | 15 a/fs/eventpoll.c | 18 a/fs/f2fs/segment.c | 8 a/fs/nilfs2/sysfs.c | 26 a/fs/nilfs2/the_nilfs.c | 9 a/fs/ocfs2/cluster/heartbeat.c | 2 a/fs/ocfs2/dlm/dlmdomain.c | 4 a/fs/ocfs2/dlm/dlmmaster.c | 18 a/fs/ocfs2/dlm/dlmrecovery.c | 2 a/fs/ocfs2/dlm/dlmthread.c | 2 a/fs/proc/array.c | 18 a/fs/proc/base.c | 5 a/fs/proc/kcore.c | 73 a/include/asm-generic/bitops.h | 1 a/include/asm-generic/bitops/find.h | 198 -- a/include/asm-generic/bitops/le.h | 64 a/include/asm-generic/early_ioremap.h | 6 a/include/linux/bitmap.h | 34 a/include/linux/bitops.h | 34 a/include/linux/cpumask.h | 46 a/include/linux/damon.h | 290 +++ a/include/linux/find.h | 134 + a/include/linux/highmem-internal.h | 27 a/include/linux/memory.h | 55 a/include/linux/memory_hotplug.h | 40 a/include/linux/mmzone.h | 19 a/include/linux/once.h | 2 a/include/linux/page-flags.h | 17 a/include/linux/page_ext.h | 2 a/include/linux/page_idle.h | 6 a/include/linux/pagemap.h | 7 a/include/linux/sched/user.h | 3 a/include/linux/slub_def.h | 6 a/include/linux/threads.h | 2 a/include/linux/units.h | 10 a/include/linux/vmalloc.h | 3 a/include/trace/events/damon.h | 43 a/include/trace/events/mmflags.h | 2 a/include/trace/events/page_ref.h | 4 a/init/initramfs.c | 2 a/init/main.c | 3 a/init/noinitramfs.c | 2 a/ipc/util.c | 16 a/kernel/acct.c | 2 a/kernel/fork.c | 2 a/kernel/profile.c | 21 a/kernel/sys.c | 7 a/kernel/time/clocksource.c | 4 a/kernel/user.c | 25 a/lib/Kconfig | 3 a/lib/Kconfig.debug | 9 a/lib/dump_stack.c | 3 a/lib/find_bit.c | 21 a/lib/find_bit_benchmark.c | 21 a/lib/genalloc.c | 2 a/lib/iov_iter.c | 8 a/lib/math/Kconfig | 2 a/lib/math/rational.c | 3 a/lib/string.c | 130 + a/lib/test_bitmap.c | 37 a/lib/test_printf.c | 2 a/lib/test_sort.c | 40 a/lib/vsprintf.c | 26 a/mm/Kconfig | 15 a/mm/Makefile | 4 a/mm/compaction.c | 20 a/mm/damon/Kconfig | 68 a/mm/damon/Makefile | 5 a/mm/damon/core-test.h | 253 +++ a/mm/damon/core.c | 748 ++++++++++ a/mm/damon/dbgfs-test.h | 126 + a/mm/damon/dbgfs.c | 631 ++++++++ a/mm/damon/vaddr-test.h | 329 ++++ a/mm/damon/vaddr.c | 672 +++++++++ a/mm/early_ioremap.c | 5 a/mm/highmem.c | 2 a/mm/ioremap.c | 25 a/mm/kfence/core.c | 3 a/mm/kfence/kfence.h | 2 a/mm/kfence/kfence_test.c | 3 a/mm/kfence/report.c | 19 a/mm/kmemleak.c | 2 a/mm/memory_hotplug.c | 396 ++++- a/mm/memremap.c | 5 a/mm/page_alloc.c | 27 a/mm/page_ext.c | 12 a/mm/page_idle.c | 10 a/mm/page_isolation.c | 7 a/mm/page_owner.c | 14 a/mm/percpu.c | 36 a/mm/rmap.c | 6 a/mm/secretmem.c | 9 a/mm/slab_common.c | 2 a/mm/slub.c | 1023 +++++++++----- a/mm/vmalloc.c | 24 a/mm/workingset.c | 2 a/net/ncsi/ncsi-manage.c | 4 a/scripts/check_extable.sh | 2 a/scripts/checkpatch.pl | 93 - a/tools/include/linux/bitmap.h | 4 a/tools/perf/bench/find-bit-bench.c | 2 a/tools/perf/builtin-c2c.c | 6 a/tools/perf/builtin-record.c | 2 a/tools/perf/tests/bitmap.c | 2 a/tools/perf/tests/mem2node.c | 2 a/tools/perf/util/affinity.c | 4 a/tools/perf/util/header.c | 4 a/tools/perf/util/metricgroup.c | 2 a/tools/perf/util/mmap.c | 4 a/tools/testing/selftests/damon/Makefile | 7 a/tools/testing/selftests/damon/_chk_dependency.sh | 28 a/tools/testing/selftests/damon/debugfs_attrs.sh | 75 + a/tools/testing/selftests/kvm/dirty_log_perf_test.c | 2 a/tools/testing/selftests/kvm/dirty_log_test.c | 4 a/tools/testing/selftests/kvm/x86_64/vmx_dirty_log_test.c | 2 a/tools/testing/selftests/memfd/memfd_test.c | 2 b/MAINTAINERS | 2 b/tools/include/asm-generic/bitops.h | 1 b/tools/include/linux/bitmap.h | 7 b/tools/include/linux/find.h | 81 + b/tools/lib/find_bit.c | 20 227 files changed, 6695 insertions(+), 1875 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-09-08 2:52 incoming Andrew Morton @ 2021-09-08 8:57 ` Vlastimil Babka 0 siblings, 0 replies; 322+ messages in thread From: Vlastimil Babka @ 2021-09-08 8:57 UTC (permalink / raw) To: Andrew Morton, Linus Torvalds Cc: linux-mm, mm-commits, Mike Galbraith, Mel Gorman On 9/8/21 04:52, Andrew Morton wrote: > Subsystem: mm/slub > > Vlastimil Babka <vbabka@suse.cz>: > Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6: > mm, slub: don't call flush_all() from slab_debug_trace_open() > mm, slub: allocate private object map for debugfs listings > mm, slub: allocate private object map for validate_slab_cache() > mm, slub: don't disable irq for debug_check_no_locks_freed() > mm, slub: remove redundant unfreeze_partials() from put_cpu_partial() > mm, slub: extract get_partial() from new_slab_objects() > mm, slub: dissolve new_slab_objects() into ___slab_alloc() > mm, slub: return slab page from get_partial() and set c->page afterwards > mm, slub: restructure new page checks in ___slab_alloc() > mm, slub: simplify kmem_cache_cpu and tid setup > mm, slub: move disabling/enabling irqs to ___slab_alloc() > mm, slub: do initial checks in ___slab_alloc() with irqs enabled > mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc() > mm, slub: restore irqs around calling new_slab() > mm, slub: validate slab from partial list or page allocator before making it cpu slab > mm, slub: check new pages with restored irqs > mm, slub: stop disabling irqs around get_partial() > mm, slub: move reset of c->page and freelist out of deactivate_slab() > mm, slub: make locking in deactivate_slab() irq-safe > mm, slub: call deactivate_slab() without disabling irqs > mm, slub: move irq control into unfreeze_partials() > mm, slub: discard slabs in unfreeze_partials() without irqs disabled > mm, slub: detach whole partial list at once in unfreeze_partials() > mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing > mm, slub: only disable irq with spin_lock in __unfreeze_partials() > mm, slub: don't disable irqs in slub_cpu_dead() > mm, slab: split out the cpu offline variant of flush_slab() > > Sebastian Andrzej Siewior <bigeasy@linutronix.de>: > mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context > mm: slub: make object_map_lock a raw_spinlock_t > > Vlastimil Babka <vbabka@suse.cz>: > mm, slub: make slab_lock() disable irqs with PREEMPT_RT > mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg > mm, slub: use migrate_disable() on PREEMPT_RT > mm, slub: convert kmem_cpu_slab protection to local_lock For my own piece of mind, I've checked that this part (patches 1 to 33) are identical to the v6 posting [1] and git version [2] that Mel and Mike tested (replies to [1]). [1] https://lore.kernel.org/all/20210904105003.11688-1-vbabka@suse.cz/ [2] git://git.kernel.org/pub/scm/linux/kernel/git/vbabka/linux.git tags/mm-slub-5.15-rc1 ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-09-02 21:48 Andrew Morton 2021-09-02 21:49 ` incoming Andrew Morton 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2021-09-02 21:48 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b. Subsystems affected by this patch series: ia64 ocfs2 block mm/slub mm/debug mm/pagecache mm/gup mm/swap mm/shmem mm/memcg mm/selftests mm/pagemap mm/mremap mm/bootmem mm/sparsemem mm/vmalloc mm/kasan mm/pagealloc mm/memory-failure mm/hugetlb mm/userfaultfd mm/vmscan mm/compaction mm/mempolicy mm/memblock mm/oom-kill mm/migration mm/ksm mm/percpu mm/vmstat mm/madvise Subsystem: ia64 Jason Wang <wangborong@cdjrlc.com>: ia64: fix typo in a comment Geert Uytterhoeven <geert+renesas@glider.be>: Patch series "ia64: Miscellaneous fixes and cleanups": ia64: fix #endif comment for reserve_elfcorehdr() ia64: make reserve_elfcorehdr() static ia64: make num_rsvd_regions static Subsystem: ocfs2 Dan Carpenter <dan.carpenter@oracle.com>: ocfs2: remove an unnecessary condition Tuo Li <islituo@gmail.com>: ocfs2: quota_local: fix possible uninitialized-variable access in ocfs2_local_read_info() Gang He <ghe@suse.com>: ocfs2: ocfs2_downconvert_lock failure results in deadlock Subsystem: block kernel test robot <lkp@intel.com>: arch/csky/kernel/probes/kprobes.c: fix bugon.cocci warnings Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v4: mm, slub: don't call flush_all() from slab_debug_trace_open() mm, slub: allocate private object map for debugfs listings mm, slub: allocate private object map for validate_slab_cache() mm, slub: don't disable irq for debug_check_no_locks_freed() mm, slub: remove redundant unfreeze_partials() from put_cpu_partial() mm, slub: unify cmpxchg_double_slab() and __cmpxchg_double_slab() mm, slub: extract get_partial() from new_slab_objects() mm, slub: dissolve new_slab_objects() into ___slab_alloc() mm, slub: return slab page from get_partial() and set c->page afterwards mm, slub: restructure new page checks in ___slab_alloc() mm, slub: simplify kmem_cache_cpu and tid setup mm, slub: move disabling/enabling irqs to ___slab_alloc() mm, slub: do initial checks in ___slab_alloc() with irqs enabled mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc() mm, slub: restore irqs around calling new_slab() mm, slub: validate slab from partial list or page allocator before making it cpu slab mm, slub: check new pages with restored irqs mm, slub: stop disabling irqs around get_partial() mm, slub: move reset of c->page and freelist out of deactivate_slab() mm, slub: make locking in deactivate_slab() irq-safe mm, slub: call deactivate_slab() without disabling irqs mm, slub: move irq control into unfreeze_partials() mm, slub: discard slabs in unfreeze_partials() without irqs disabled mm, slub: detach whole partial list at once in unfreeze_partials() mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing mm, slub: only disable irq with spin_lock in __unfreeze_partials() mm, slub: don't disable irqs in slub_cpu_dead() mm, slab: make flush_slab() possible to call with irqs enabled Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context mm: slub: make object_map_lock a raw_spinlock_t Vlastimil Babka <vbabka@suse.cz>: mm, slub: optionally save/restore irqs in slab_[un]lock()/ mm, slub: make slab_lock() disable irqs with PREEMPT_RT mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg mm, slub: use migrate_disable() on PREEMPT_RT mm, slub: convert kmem_cpu_slab protection to local_lock Subsystem: mm/debug Gavin Shan <gshan@redhat.com>: Patch series "mm/debug_vm_pgtable: Enhancements", v6: mm/debug_vm_pgtable: introduce struct pgtable_debug_args mm/debug_vm_pgtable: use struct pgtable_debug_args in basic tests mm/debug_vm_pgtable: use struct pgtable_debug_args in leaf and savewrite tests mm/debug_vm_pgtable: use struct pgtable_debug_args in protnone and devmap tests mm/debug_vm_pgtable: use struct pgtable_debug_args in soft_dirty and swap tests mm/debug_vm_pgtable: use struct pgtable_debug_args in migration and thp tests mm/debug_vm_pgtable: use struct pgtable_debug_args in PTE modifying tests mm/debug_vm_pgtable: use struct pgtable_debug_args in PMD modifying tests mm/debug_vm_pgtable: use struct pgtable_debug_args in PUD modifying tests mm/debug_vm_pgtable: use struct pgtable_debug_args in PGD and P4D modifying tests mm/debug_vm_pgtable: remove unused code mm/debug_vm_pgtable: fix corrupted page flag "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: report a more useful address for reclaim acquisition liuhailong <liuhailong@oppo.com>: mm: add kernel_misc_reclaimable in show_free_areas Subsystem: mm/pagecache Jan Kara <jack@suse.cz>: Patch series "writeback: Fix bandwidth estimates", v4: writeback: track number of inodes under writeback writeback: reliably update bandwidth estimation writeback: fix bandwidth estimate for spiky workload writeback: rename domain_update_bandwidth() writeback: use READ_ONCE for unlocked reads of writeback stats Johannes Weiner <hannes@cmpxchg.org>: mm: remove irqsave/restore locking from contexts with irqs enabled fs: drop_caches: fix skipping over shadow cache inodes fs: inode: count invalidated shadow pages in pginodesteal Shakeel Butt <shakeelb@google.com>: writeback: memcg: simplify cgroup_writeback_by_id Jing Yangyang <jing.yangyang@zte.com.cn>: include/linux/buffer_head.h: fix boolreturn.cocci warnings Subsystem: mm/gup Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups and fixup for gup": mm: gup: remove set but unused local variable major mm: gup: remove unneed local variable orig_refs mm: gup: remove useless BUG_ON in __get_user_pages() mm: gup: fix potential pgmap refcnt leak in __gup_device_huge() mm: gup: use helper PAGE_ALIGNED in populate_vma_page_range() John Hubbard <jhubbard@nvidia.com>: Patch series "A few gup refactorings and documentation updates", v3: mm/gup: documentation corrections for gup/pup mm/gup: small refactoring: simplify try_grab_page() mm/gup: remove try_get_page(), call try_get_compound_head() directly Subsystem: mm/swap Hugh Dickins <hughd@google.com>: fs, mm: fix race in unlinking swapfile John Hubbard <jhubbard@nvidia.com>: mm: delete unused get_kernel_page() Subsystem: mm/shmem Sebastian Andrzej Siewior <bigeasy@linutronix.de>: shmem: use raw_spinlock_t for ->stat_lock Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups for shmem": shmem: remove unneeded variable ret shmem: remove unneeded header file shmem: remove unneeded function forward declaration shmem: include header file to declare swap_info Hugh Dickins <hughd@google.com>: Patch series "huge tmpfs: shmem_is_huge() fixes and cleanups": huge tmpfs: fix fallocate(vanilla) advance over huge pages huge tmpfs: fix split_huge_page() after FALLOC_FL_KEEP_SIZE huge tmpfs: remove shrinklist addition from shmem_setattr() huge tmpfs: revert shmem's use of transhuge_vma_enabled() huge tmpfs: move shmem_huge_enabled() upwards huge tmpfs: SGP_NOALLOC to stop collapse_file() on race huge tmpfs: shmem_is_huge(vma, inode, index) huge tmpfs: decide stat.st_blksize by shmem_is_huge() shmem: shmem_writepage() split unlikely i915 THP Subsystem: mm/memcg Suren Baghdasaryan <surenb@google.com>: mm, memcg: add mem_cgroup_disabled checks in vmpressure and swap-related functions mm, memcg: inline mem_cgroup_{charge/uncharge} to improve disabled memcg config mm, memcg: inline swap-related functions to improve disabled memcg config Vasily Averin <vvs@virtuozzo.com>: memcg: enable accounting for pids in nested pid namespaces Shakeel Butt <shakeelb@google.com>: memcg: switch lruvec stats to rstat memcg: infrastructure to flush memcg stats Yutian Yang <nglaive@gmail.com>: memcg: charge fs_context and legacy_fs_context Vasily Averin <vvs@virtuozzo.com>: Patch series "memcg accounting from OpenVZ", v7: memcg: enable accounting for mnt_cache entries memcg: enable accounting for pollfd and select bits arrays memcg: enable accounting for file lock caches memcg: enable accounting for fasync_cache memcg: enable accounting for new namesapces and struct nsproxy memcg: enable accounting of ipc resources memcg: enable accounting for signals memcg: enable accounting for posix_timers_cache slab memcg: enable accounting for ldt_struct objects Shakeel Butt <shakeelb@google.com>: memcg: cleanup racy sum avoidance code Vasily Averin <vvs@virtuozzo.com>: memcg: replace in_interrupt() by !in_task() in active_memcg() Baolin Wang <baolin.wang@linux.alibaba.com>: mm: memcontrol: set the correct memcg swappiness restriction Miaohe Lin <linmiaohe@huawei.com>: mm, memcg: remove unused functions mm, memcg: save some atomic ops when flush is already true Michal Hocko <mhocko@suse.com>: memcg: fix up drain_local_stock comment Shakeel Butt <shakeelb@google.com>: memcg: make memcg->event_list_lock irqsafe Subsystem: mm/selftests Po-Hsu Lin <po-hsu.lin@canonical.com>: selftests/vm: use kselftest skip code for skipped tests Colin Ian King <colin.king@canonical.com>: selftests: Fix spelling mistake "cann't" -> "cannot" Subsystem: mm/pagemap Nicholas Piggin <npiggin@gmail.com>: Patch series "shoot lazy tlbs", v4: lazy tlb: introduce lazy mm refcount helper functions lazy tlb: allow lazy tlb mm refcounting to be configurable lazy tlb: shoot lazies, a non-refcounting lazy tlb option powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN Christoph Hellwig <hch@lst.de>: Patch series "_kernel_dcache_page fixes and removal": mmc: JZ4740: remove the flush_kernel_dcache_page call in jz4740_mmc_read_data mmc: mmc_spi: replace flush_kernel_dcache_page with flush_dcache_page scatterlist: replace flush_kernel_dcache_page with flush_dcache_page mm: remove flush_kernel_dcache_page Huang Ying <ying.huang@intel.com>: mm,do_huge_pmd_numa_page: remove unnecessary TLB flushing code Greg Kroah-Hartman <gregkh@linuxfoundation.org>: mm: change fault_in_pages_* to have an unsigned size parameter Luigi Rizzo <lrizzo@google.com>: mm/pagemap: add mmap_assert_locked() annotations to find_vma*() "Liam R. Howlett" <Liam.Howlett@Oracle.com>: remap_file_pages: Use vma_lookup() instead of find_vma() Subsystem: mm/mremap Chen Wandun <chenwandun@huawei.com>: mm/mremap: fix memory account on do_munmap() failure Subsystem: mm/bootmem Muchun Song <songmuchun@bytedance.com>: mm/bootmem_info.c: mark __init on register_page_bootmem_info_section Subsystem: mm/sparsemem Ohhoon Kwon <ohoono.kwon@samsung.com>: Patch series "mm: sparse: remove __section_nr() function", v4: mm: sparse: pass section_nr to section_mark_present mm: sparse: pass section_nr to find_memory_block mm: sparse: remove __section_nr() function Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/sparse: set SECTION_NID_SHIFT to 6 Matthew Wilcox <willy@infradead.org>: include/linux/mmzone.h: avoid a warning in sparse memory support Miles Chen <miles.chen@mediatek.com>: mm/sparse: clarify pgdat_to_phys Subsystem: mm/vmalloc "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: use batched page requests in bulk-allocator mm/vmalloc: remove gfpflags_allow_blocking() check lib/test_vmalloc.c: add a new 'nr_pages' parameter Chen Wandun <chenwandun@huawei.com>: mm/vmalloc: fix wrong behavior in vread Subsystem: mm/kasan Woody Lin <woodylin@google.com>: mm/kasan: move kasan.fault to mm/kasan/report.c Andrey Konovalov <andreyknvl@gmail.com>: Patch series "kasan: test: avoid crashing the kernel with HW_TAGS", v2: kasan: test: rework kmalloc_oob_right kasan: test: avoid writing invalid memory kasan: test: avoid corrupting memory via memset kasan: test: disable kmalloc_memmove_invalid_size for HW_TAGS kasan: test: only do kmalloc_uaf_memset for generic mode kasan: test: clean up ksize_uaf kasan: test: avoid corrupting memory in copy_user_test kasan: test: avoid corrupting memory in kasan_rcu_uaf Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: ensure consistency of memory map poisoning": mm/page_alloc: always initialize memory map for the holes microblaze: simplify pte_alloc_one_kernel() mm: introduce memmap_alloc() to unify memory map allocation memblock: stop poisoning raw allocations Nico Pache <npache@redhat.com>: mm/page_alloc.c: fix 'zone_id' may be used uninitialized in this function warning Mike Rapoport <rppt@linux.ibm.com>: mm/page_alloc: make alloc_node_mem_map() __init rather than __ref Vasily Averin <vvs@virtuozzo.com>: mm/page_alloc.c: use in_task() "George G. Davis" <davis.george@siemens.com>: mm/page_isolation: tracing: trace all test_pages_isolated failures Subsystem: mm/memory-failure Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups and fixup for hwpoison": mm/hwpoison: remove unneeded variable unmap_success mm/hwpoison: fix potential pte_unmap_unlock pte error mm/hwpoison: change argument struct page **hpagep to *hpage mm/hwpoison: fix some obsolete comments Yang Shi <shy828301@gmail.com>: mm: hwpoison: don't drop slab caches for offlining non-LRU page doc: hwpoison: correct the support for hugepage mm: hwpoison: dump page for unhandlable page Michael Wang <yun.wang@linux.alibaba.com>: mm: fix panic caused by __page_handle_poison() Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: simplify prep_compound_gigantic_page ref count racing code hugetlb: drop ref count earlier after page allocation hugetlb: before freeing hugetlb page set dtor to appropriate value hugetlb: fix hugetlb cgroup refcounting during vma split Subsystem: mm/userfaultfd Nadav Amit <namit@vmware.com>: Patch series "userfaultfd: minor bug fixes": userfaultfd: change mmap_changing to atomic userfaultfd: prevent concurrent API initialization selftests/vm/userfaultfd: wake after copy failure Subsystem: mm/vmscan Dave Hansen <dave.hansen@linux.intel.com>: Patch series "Migrate Pages in lieu of discard", v11: mm/numa: automatically generate node migration order mm/migrate: update node demotion order on hotplug events Yang Shi <yang.shi@linux.alibaba.com>: mm/migrate: enable returning precise migrate_pages() success count Dave Hansen <dave.hansen@linux.intel.com>: mm/migrate: demote pages during reclaim Yang Shi <yang.shi@linux.alibaba.com>: mm/vmscan: add page demotion counter Dave Hansen <dave.hansen@linux.intel.com>: mm/vmscan: add helper for querying ability to age anonymous pages Keith Busch <kbusch@kernel.org>: mm/vmscan: Consider anonymous pages without swap Dave Hansen <dave.hansen@linux.intel.com>: mm/vmscan: never demote for memcg reclaim Huang Ying <ying.huang@intel.com>: mm/migrate: add sysfs interface to enable reclaim migration Hui Su <suhui@zeku.com>: mm/vmpressure: replace vmpressure_to_css() with vmpressure_to_memcg() Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups for vmscan", v2: mm/vmscan: remove the PageDirty check after MADV_FREE pages are page_ref_freezed mm/vmscan: remove misleading setting to sc->priority mm/vmscan: remove unneeded return value of kswapd_run() mm/vmscan: add 'else' to remove check_pending label Vlastimil Babka <vbabka@suse.cz>: mm, vmscan: guarantee drop_slab_node() termination Subsystem: mm/compaction Charan Teja Reddy <charante@codeaurora.org>: mm: compaction: optimize proactive compaction deferrals mm: compaction: support triggering of proactive compaction by user Subsystem: mm/mempolicy Baolin Wang <baolin.wang@linux.alibaba.com>: mm/mempolicy: use readable NUMA_NO_NODE macro instead of magic number Dave Hansen <dave.hansen@linux.intel.com>: Patch series "Introduce multi-preference mempolicy", v7: mm/mempolicy: add MPOL_PREFERRED_MANY for multiple preferred nodes Feng Tang <feng.tang@intel.com>: mm/memplicy: add page allocation function for MPOL_PREFERRED_MANY policy Ben Widawsky <ben.widawsky@intel.com>: mm/hugetlb: add support for mempolicy MPOL_PREFERRED_MANY mm/mempolicy: advertise new MPOL_PREFERRED_MANY Feng Tang <feng.tang@intel.com>: mm/mempolicy: unify the create() func for bind/interleave/prefer-many policies Vasily Averin <vvs@virtuozzo.com>: mm/mempolicy.c: use in_task() in mempolicy_slab_node() Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: memblock: make memblock_find_in_range method private Subsystem: mm/oom-kill Suren Baghdasaryan <surenb@google.com>: mm: introduce process_mrelease system call mm: wire up syscall process_mrelease Subsystem: mm/migration Randy Dunlap <rdunlap@infradead.org>: mm/migrate: correct kernel-doc notation Subsystem: mm/ksm Zhansaya Bagdauletkyzy <zhansayabagdaulet@gmail.com>: Patch series "add KSM selftests": selftests: vm: add KSM merge test selftests: vm: add KSM unmerge test selftests: vm: add KSM zero page merging test selftests: vm: add KSM merging across nodes test mm: KSM: fix data type Patch series "add KSM performance tests", v3: selftests: vm: add KSM merging time test selftests: vm: add COW time test for KSM pages Subsystem: mm/percpu Jing Xiangfeng <jingxiangfeng@huawei.com>: mm/percpu,c: remove obsolete comments of pcpu_chunk_populated() Subsystem: mm/vmstat Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup for vmstat": mm/vmstat: correct some wrong comments mm/vmstat: simplify the array size calculation mm/vmstat: remove unneeded return value Subsystem: mm/madvise zhangkui <zhangkui@oppo.com>: mm/madvise: add MADV_WILLNEED to process_madvise() Documentation/ABI/testing/sysfs-kernel-mm-numa | 24 Documentation/admin-guide/mm/numa_memory_policy.rst | 15 Documentation/admin-guide/sysctl/vm.rst | 3 Documentation/core-api/cachetlb.rst | 86 - Documentation/dev-tools/kasan.rst | 13 Documentation/translations/zh_CN/core-api/cachetlb.rst | 9 Documentation/vm/hwpoison.rst | 1 arch/Kconfig | 28 arch/alpha/kernel/syscalls/syscall.tbl | 2 arch/arm/include/asm/cacheflush.h | 4 arch/arm/kernel/setup.c | 20 arch/arm/mach-rpc/ecard.c | 2 arch/arm/mm/flush.c | 33 arch/arm/mm/nommu.c | 6 arch/arm/tools/syscall.tbl | 2 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 2 arch/arm64/kvm/hyp/reserved_mem.c | 9 arch/arm64/mm/init.c | 38 arch/csky/abiv1/cacheflush.c | 11 arch/csky/abiv1/inc/abi/cacheflush.h | 4 arch/csky/kernel/probes/kprobes.c | 3 arch/ia64/include/asm/meminit.h | 2 arch/ia64/kernel/acpi.c | 2 arch/ia64/kernel/setup.c | 55 arch/ia64/kernel/syscalls/syscall.tbl | 2 arch/m68k/kernel/syscalls/syscall.tbl | 2 arch/microblaze/include/asm/page.h | 3 arch/microblaze/include/asm/pgtable.h | 2 arch/microblaze/kernel/syscalls/syscall.tbl | 2 arch/microblaze/mm/init.c | 12 arch/microblaze/mm/pgtable.c | 17 arch/mips/include/asm/cacheflush.h | 8 arch/mips/kernel/setup.c | 14 arch/mips/kernel/syscalls/syscall_n32.tbl | 2 arch/mips/kernel/syscalls/syscall_n64.tbl | 2 arch/mips/kernel/syscalls/syscall_o32.tbl | 2 arch/nds32/include/asm/cacheflush.h | 3 arch/nds32/mm/cacheflush.c | 9 arch/parisc/include/asm/cacheflush.h | 8 arch/parisc/kernel/cache.c | 3 arch/parisc/kernel/syscalls/syscall.tbl | 2 arch/powerpc/Kconfig | 1 arch/powerpc/kernel/smp.c | 2 arch/powerpc/kernel/syscalls/syscall.tbl | 2 arch/powerpc/mm/book3s64/radix_tlb.c | 4 arch/powerpc/platforms/pseries/hotplug-memory.c | 4 arch/riscv/mm/init.c | 44 arch/s390/kernel/setup.c | 9 arch/s390/kernel/syscalls/syscall.tbl | 2 arch/s390/mm/fault.c | 2 arch/sh/include/asm/cacheflush.h | 8 arch/sh/kernel/syscalls/syscall.tbl | 2 arch/sparc/kernel/syscalls/syscall.tbl | 2 arch/x86/entry/syscalls/syscall_32.tbl | 1 arch/x86/entry/syscalls/syscall_64.tbl | 1 arch/x86/kernel/aperture_64.c | 5 arch/x86/kernel/ldt.c | 6 arch/x86/mm/init.c | 23 arch/x86/mm/numa.c | 5 arch/x86/mm/numa_emulation.c | 5 arch/x86/realmode/init.c | 2 arch/xtensa/kernel/syscalls/syscall.tbl | 2 block/blk-map.c | 2 drivers/acpi/tables.c | 5 drivers/base/arch_numa.c | 5 drivers/base/memory.c | 4 drivers/mmc/host/jz4740_mmc.c | 4 drivers/mmc/host/mmc_spi.c | 2 drivers/of/of_reserved_mem.c | 12 fs/drop_caches.c | 3 fs/exec.c | 12 fs/fcntl.c | 3 fs/fs-writeback.c | 28 fs/fs_context.c | 4 fs/inode.c | 2 fs/locks.c | 6 fs/namei.c | 8 fs/namespace.c | 7 fs/ocfs2/dlmglue.c | 14 fs/ocfs2/quota_global.c | 1 fs/ocfs2/quota_local.c | 2 fs/pipe.c | 2 fs/select.c | 4 fs/userfaultfd.c | 116 - include/linux/backing-dev-defs.h | 2 include/linux/backing-dev.h | 19 include/linux/buffer_head.h | 2 include/linux/compaction.h | 2 include/linux/highmem.h | 5 include/linux/hugetlb_cgroup.h | 12 include/linux/memblock.h | 2 include/linux/memcontrol.h | 118 + include/linux/memory.h | 2 include/linux/mempolicy.h | 16 include/linux/migrate.h | 14 include/linux/mm.h | 17 include/linux/mmzone.h | 4 include/linux/page-flags.h | 9 include/linux/pagemap.h | 4 include/linux/sched/mm.h | 35 include/linux/shmem_fs.h | 25 include/linux/slub_def.h | 6 include/linux/swap.h | 28 include/linux/syscalls.h | 1 include/linux/userfaultfd_k.h | 8 include/linux/vm_event_item.h | 2 include/linux/vmpressure.h | 2 include/linux/writeback.h | 4 include/trace/events/migrate.h | 3 include/uapi/asm-generic/unistd.h | 4 include/uapi/linux/mempolicy.h | 1 ipc/msg.c | 2 ipc/namespace.c | 2 ipc/sem.c | 9 ipc/shm.c | 2 kernel/cgroup/namespace.c | 2 kernel/cpu.c | 2 kernel/exit.c | 2 kernel/fork.c | 51 kernel/kthread.c | 21 kernel/nsproxy.c | 2 kernel/pid_namespace.c | 5 kernel/sched/core.c | 37 kernel/sched/sched.h | 4 kernel/signal.c | 2 kernel/sys_ni.c | 1 kernel/sysctl.c | 2 kernel/time/namespace.c | 4 kernel/time/posix-timers.c | 4 kernel/user_namespace.c | 2 lib/scatterlist.c | 5 lib/test_kasan.c | 80 - lib/test_kasan_module.c | 20 lib/test_vmalloc.c | 5 mm/backing-dev.c | 11 mm/bootmem_info.c | 4 mm/compaction.c | 69 - mm/debug_vm_pgtable.c | 982 +++++++++------ mm/filemap.c | 15 mm/gup.c | 109 - mm/huge_memory.c | 32 mm/hugetlb.c | 173 ++ mm/hwpoison-inject.c | 2 mm/internal.h | 9 mm/kasan/hw_tags.c | 43 mm/kasan/kasan.h | 1 mm/kasan/report.c | 29 mm/khugepaged.c | 2 mm/ksm.c | 8 mm/madvise.c | 1 mm/memblock.c | 22 mm/memcontrol.c | 234 +-- mm/memory-failure.c | 53 mm/memory_hotplug.c | 2 mm/mempolicy.c | 207 ++- mm/migrate.c | 319 ++++ mm/mmap.c | 7 mm/mremap.c | 2 mm/oom_kill.c | 70 + mm/page-writeback.c | 133 +- mm/page_alloc.c | 62 mm/page_isolation.c | 13 mm/percpu.c | 3 mm/shmem.c | 309 ++-- mm/slab_common.c | 2 mm/slub.c | 1085 ++++++++++------- mm/sparse.c | 46 mm/swap.c | 22 mm/swapfile.c | 14 mm/truncate.c | 28 mm/userfaultfd.c | 15 mm/vmalloc.c | 79 - mm/vmpressure.c | 10 mm/vmscan.c | 220 ++- mm/vmstat.c | 25 security/tomoyo/domain.c | 13 tools/testing/scatterlist/linux/mm.h | 1 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 3 tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 5 tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 5 tools/testing/selftests/vm/ksm_tests.c | 696 ++++++++++ tools/testing/selftests/vm/mlock-random-test.c | 2 tools/testing/selftests/vm/run_vmtests.sh | 98 + tools/testing/selftests/vm/userfaultfd.c | 13 186 files changed, 4488 insertions(+), 2281 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-09-02 21:48 incoming Andrew Morton @ 2021-09-02 21:49 ` Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-09-02 21:49 UTC (permalink / raw) To: Linus Torvalds, linux-mm, mm-commits On Thu, 2 Sep 2021 14:48:20 -0700 Andrew Morton <akpm@linux-foundation.org> wrote: > 212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b. Make that "based on 7d2a07b769330c34b4deabeed939325c77a7ec2f". ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-08-25 19:17 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-08-25 19:17 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 2 patches, based on 6e764bcd1cf72a2846c0e53d3975a09b242c04c9. Subsystems affected by this patch series: mm/memory-hotplug MAINTAINERS Subsystem: mm/memory-hotplug Miaohe Lin <linmiaohe@huawei.com>: mm/memory_hotplug: fix potential permanent lru cache disable Subsystem: MAINTAINERS Namjae Jeon <namjae.jeon@samsung.com>: MAINTAINERS: exfat: update my email address MAINTAINERS | 2 +- mm/memory_hotplug.c | 1 + 2 files changed, 2 insertions(+), 1 deletion(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-08-20 2:03 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-08-20 2:03 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 10 patches, based on 614cb2751d3150850d459bee596c397f344a7936. Subsystems affected by this patch series: mm/shmem mm/pagealloc mm/tracing MAINTAINERS mm/memcg mm/memory-failure mm/vmscan mm/kfence mm/hugetlb Subsystem: mm/shmem Yang Shi <shy828301@gmail.com>: Revert "mm/shmem: fix shmem_swapin() race with swapoff" Revert "mm: swap: check if swap backing device is congested or not" Subsystem: mm/pagealloc Doug Berger <opendmb@gmail.com>: mm/page_alloc: don't corrupt pcppage_migratetype Subsystem: mm/tracing Mike Rapoport <rppt@linux.ibm.com>: mmflags.h: add missing __GFP_ZEROTAGS and __GFP_SKIP_KASAN_POISON names Subsystem: MAINTAINERS Nathan Chancellor <nathan@kernel.org>: MAINTAINERS: update ClangBuiltLinux IRC chat Subsystem: mm/memcg Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: fix occasional OOMs due to proportional memory.low reclaim Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/hwpoison: retry with shake_page() for unhandlable pages Subsystem: mm/vmscan Johannes Weiner <hannes@cmpxchg.org>: mm: vmscan: fix missing psi annotation for node_reclaim() Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: fix is_kfence_address() for addresses below KFENCE_POOL_SIZE Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: don't pass page cache pages to restore_reserve_on_error MAINTAINERS | 2 +- include/linux/kfence.h | 7 ++++--- include/linux/memcontrol.h | 29 +++++++++++++++-------------- include/trace/events/mmflags.h | 4 +++- mm/hugetlb.c | 19 ++++++++++++++----- mm/memory-failure.c | 12 +++++++++--- mm/page_alloc.c | 25 ++++++++++++------------- mm/shmem.c | 14 +------------- mm/swap_state.c | 7 ------- mm/vmscan.c | 30 ++++++++++++++++++++++-------- 10 files changed, 81 insertions(+), 68 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-08-13 23:53 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-08-13 23:53 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 7 patches, based on f8e6dfc64f6135d1b6c5215c14cd30b9b60a0008. Subsystems affected by this patch series: mm/kasan mm/slub mm/madvise mm/memcg lib Subsystem: mm/kasan Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: Patch series "kasan, slub: reset tag when printing address", v3: kasan, kmemleak: reset tags when scanning block kasan, slub: reset tag when printing address Subsystem: mm/slub Shakeel Butt <shakeelb@google.com>: slub: fix kmalloc_pagealloc_invalid_free unit test Vlastimil Babka <vbabka@suse.cz>: mm: slub: fix slub_debug disabling for list of slabs Subsystem: mm/madvise David Hildenbrand <david@redhat.com>: mm/madvise: report SIGBUS as -EFAULT for MADV_POPULATE_(READ|WRITE) Subsystem: mm/memcg Waiman Long <longman@redhat.com>: mm/memcg: fix incorrect flushing of lruvec data in obj_stock Subsystem: lib Liang Wang <wangliang101@huawei.com>: lib: use PFN_PHYS() in devmem_is_allowed() lib/devmem_is_allowed.c | 2 +- mm/gup.c | 7 +++++-- mm/kmemleak.c | 6 +++--- mm/madvise.c | 4 +++- mm/memcontrol.c | 6 ++++-- mm/slub.c | 25 ++++++++++++++----------- 6 files changed, 30 insertions(+), 20 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-07-29 21:52 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-07-29 21:52 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 7 patches, based on 7e96bf476270aecea66740a083e51b38c1371cd2. Subsystems affected by this patch series: lib ocfs2 mm/memcg mm/migration mm/slub mm/memcg Subsystem: lib Matteo Croce <mcroce@microsoft.com>: lib/test_string.c: move string selftest in the Runtime Testing menu Subsystem: ocfs2 Junxiao Bi <junxiao.bi@oracle.com>: ocfs2: fix zero out valid data ocfs2: issue zeroout to EOF blocks Subsystem: mm/memcg Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: fix blocking rstat function called from atomic cgroup1 thresholding code Subsystem: mm/migration "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/migrate: fix NR_ISOLATED corruption on 64-bit Subsystem: mm/slub Shakeel Butt <shakeelb@google.com>: slub: fix unreclaimable slab stat for bulk free Subsystem: mm/memcg Wang Hai <wanghai38@huawei.com>: mm/memcg: fix NULL pointer dereference in memcg_slab_free_hook() fs/ocfs2/file.c | 103 ++++++++++++++++++++++++++++++++---------------------- lib/Kconfig | 3 - lib/Kconfig.debug | 3 + mm/memcontrol.c | 3 + mm/migrate.c | 2 - mm/slab.h | 2 - mm/slub.c | 22 ++++++----- 7 files changed, 81 insertions(+), 57 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-07-23 22:49 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-07-23 22:49 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 15 patches, based on 704f4cba43d4ed31ef4beb422313f1263d87bc55. Subsystems affected by this patch series: mm/userfaultfd mm/kfence mm/highmem mm/pagealloc mm/memblock mm/pagecache mm/secretmem mm/pagemap mm/hugetlbfs Subsystem: mm/userfaultfd Peter Collingbourne <pcc@google.com>: Patch series "userfaultfd: do not untag user pointers", v5: userfaultfd: do not untag user pointers selftest: use mmap instead of posix_memalign to allocate memory Subsystem: mm/kfence Weizhao Ouyang <o451686892@gmail.com>: kfence: defer kfence_test_init to ensure that kunit debugfs is created Alexander Potapenko <glider@google.com>: kfence: move the size check to the beginning of __kfence_alloc() kfence: skip all GFP_ZONEMASK allocations Subsystem: mm/highmem Christoph Hellwig <hch@lst.de>: mm: call flush_dcache_page() in memcpy_to_page() and memzero_page() mm: use kmap_local_page in memzero_page Subsystem: mm/pagealloc Sergei Trofimovich <slyfox@gentoo.org>: mm: page_alloc: fix page_poison=1 / INIT_ON_ALLOC_DEFAULT_ON interaction Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: memblock: make for_each_mem_range() traverse MEMBLOCK_HOTPLUG regions Subsystem: mm/pagecache Roman Gushchin <guro@fb.com>: writeback, cgroup: remove wb from offline list before releasing refcnt writeback, cgroup: do not reparent dax inodes Subsystem: mm/secretmem Mike Rapoport <rppt@linux.ibm.com>: mm/secretmem: wire up ->set_page_dirty Subsystem: mm/pagemap Muchun Song <songmuchun@bytedance.com>: mm: mmap_lock: fix disabling preemption directly Qi Zheng <zhengqi.arch@bytedance.com>: mm: fix the deadlock in finish_fault() Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: hugetlbfs: fix mount mode command line processing Documentation/arm64/tagged-address-abi.rst | 26 ++++++++++++++++++-------- fs/fs-writeback.c | 3 +++ fs/hugetlbfs/inode.c | 2 +- fs/userfaultfd.c | 26 ++++++++++++-------------- include/linux/highmem.h | 6 ++++-- include/linux/memblock.h | 4 ++-- mm/backing-dev.c | 2 +- mm/kfence/core.c | 19 ++++++++++++++++--- mm/kfence/kfence_test.c | 2 +- mm/memblock.c | 3 ++- mm/memory.c | 11 ++++++++++- mm/mmap_lock.c | 4 ++-- mm/page_alloc.c | 29 ++++++++++++++++------------- mm/secretmem.c | 1 + tools/testing/selftests/vm/userfaultfd.c | 6 ++++-- 15 files changed, 93 insertions(+), 51 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-07-15 4:26 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-07-15 4:26 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 13 patches, based on 40226a3d96ef8ab8980f032681c8bfd46d63874e. Subsystems affected by this patch series: mm/kasan mm/pagealloc mm/rmap mm/hmm hfs mm/hugetlb Subsystem: mm/kasan Marco Elver <elver@google.com>: mm: move helper to check slub_debug_enabled Yee Lee <yee.lee@mediatek.com>: kasan: add memzero init for unaligned size at DEBUG Marco Elver <elver@google.com>: kasan: fix build by including kernel.h Subsystem: mm/pagealloc Matteo Croce <mcroce@microsoft.com>: Revert "mm/page_alloc: make should_fail_alloc_page() static" Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: avoid page allocator recursion with pagesets.lock held Yanfei Xu <yanfei.xu@windriver.com>: mm/page_alloc: correct return value when failing at preparing Chuck Lever <chuck.lever@oracle.com>: mm/page_alloc: further fix __alloc_pages_bulk() return value Subsystem: mm/rmap Christoph Hellwig <hch@lst.de>: mm: fix the try_to_unmap prototype for !CONFIG_MMU Subsystem: mm/hmm Alistair Popple <apopple@nvidia.com>: lib/test_hmm: remove set but unused page variable Subsystem: hfs Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>: Patch series "hfs: fix various errors", v2: hfs: add missing clean-up in hfs_fill_super hfs: fix high memory mapping in hfs_bnode_read hfs: add lock nesting notation to hfs_find_init Subsystem: mm/hugetlb Joao Martins <joao.m.martins@oracle.com>: mm/hugetlb: fix refs calculation from unaligned @vaddr fs/hfs/bfind.c | 14 +++++++++++++- fs/hfs/bnode.c | 25 ++++++++++++++++++++----- fs/hfs/btree.h | 7 +++++++ fs/hfs/super.c | 10 +++++----- include/linux/kasan.h | 1 + include/linux/rmap.h | 4 +++- lib/test_hmm.c | 2 -- mm/hugetlb.c | 5 +++-- mm/kasan/kasan.h | 12 ++++++++++++ mm/page_alloc.c | 30 ++++++++++++++++++++++-------- mm/slab.h | 15 +++++++++++---- mm/slub.c | 14 -------------- 12 files changed, 97 insertions(+), 42 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-07-08 0:59 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-07-08 0:59 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 54 patches, based on a931dd33d370896a683236bba67c0d6f3d01144d. Subsystems affected by this patch series: lib mm/slub mm/secretmem mm/cleanups mm/init debug mm/pagemap mm/mremap Subsystem: lib Zhen Lei <thunder.leizhen@huawei.com>: lib/test: fix spelling mistakes lib: fix spelling mistakes lib: fix spelling mistakes in header files Subsystem: mm/slub Nathan Chancellor <nathan@kernel.org>: Patch series "hexagon: Fix build error with CONFIG_STACKDEPOT and select CONFIG_ARCH_WANT_LD_ORPHAN_WARN": hexagon: handle {,SOFT}IRQENTRY_TEXT in linker script hexagon: use common DISCARDS macro hexagon: select ARCH_WANT_LD_ORPHAN_WARN Oliver Glitta <glittao@gmail.com>: mm/slub: use stackdepot to save stack trace in objects Subsystem: mm/secretmem Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: introduce memfd_secret system call to create "secret" memory areas", v20: mmap: make mlock_future_check() global riscv/Kconfig: make direct map manipulation options depend on MMU set_memory: allow querying whether set_direct_map_*() is actually enabled mm: introduce memfd_secret system call to create "secret" memory areas PM: hibernate: disable when there are active secretmem users arch, mm: wire up memfd_secret system call where relevant secretmem: test: add basic selftest for memfd_secret(2) Subsystem: mm/cleanups Zhen Lei <thunder.leizhen@huawei.com>: mm: fix spelling mistakes in header files Subsystem: mm/init Kefeng Wang <wangkefeng.wang@huawei.com>: Patch series "init_mm: cleanup ARCH's text/data/brk setup code", v3: mm: add setup_initial_init_mm() helper arc: convert to setup_initial_init_mm() arm: convert to setup_initial_init_mm() arm64: convert to setup_initial_init_mm() csky: convert to setup_initial_init_mm() h8300: convert to setup_initial_init_mm() m68k: convert to setup_initial_init_mm() nds32: convert to setup_initial_init_mm() nios2: convert to setup_initial_init_mm() openrisc: convert to setup_initial_init_mm() powerpc: convert to setup_initial_init_mm() riscv: convert to setup_initial_init_mm() s390: convert to setup_initial_init_mm() sh: convert to setup_initial_init_mm() x86: convert to setup_initial_init_mm() Subsystem: debug Stephen Boyd <swboyd@chromium.org>: Patch series "Add build ID to stacktraces", v6: buildid: only consider GNU notes for build ID parsing buildid: add API to parse build ID out of buffer buildid: stash away kernels build ID on init dump_stack: add vmlinux build ID to stack traces module: add printk formats to add module build ID to stacktraces arm64: stacktrace: use %pSb for backtrace printing x86/dumpstack: use %pSb/%pBb for backtrace printing scripts/decode_stacktrace.sh: support debuginfod scripts/decode_stacktrace.sh: silence stderr messages from addr2line/nm scripts/decode_stacktrace.sh: indicate 'auto' can be used for base path buildid: mark some arguments const buildid: fix kernel-doc notation kdump: use vmlinux_build_id to simplify Subsystem: mm/pagemap "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm: rename pud_page_vaddr to pud_pgtable and make it return pmd_t * mm: rename p4d_page_vaddr to p4d_pgtable and make it return pud_t * Subsystem: mm/mremap "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "mrermap fixes", v2: selftest/mremap_test: update the test to handle pagesize other than 4K selftest/mremap_test: avoid crash with static build mm/mremap: convert huge PUD move to separate helper mm/mremap: don't enable optimized PUD move if page table levels is 2 mm/mremap: use pmd/pud_poplulate to update page table entries mm/mremap: hold the rmap lock in write mode when moving page table entries. Patch series "Speedup mremap on ppc64", v8: mm/mremap: allow arch runtime override powerpc/book3s64/mm: update flush_tlb_range to flush page walk cache powerpc/mm: enable HAVE_MOVE_PMD support Documentation/core-api/printk-formats.rst | 11 arch/alpha/include/asm/pgtable.h | 8 arch/arc/mm/init.c | 5 arch/arm/include/asm/pgtable-3level.h | 2 arch/arm/kernel/setup.c | 5 arch/arm64/include/asm/Kbuild | 1 arch/arm64/include/asm/cacheflush.h | 6 arch/arm64/include/asm/kfence.h | 2 arch/arm64/include/asm/pgtable.h | 8 arch/arm64/include/asm/set_memory.h | 17 + arch/arm64/include/uapi/asm/unistd.h | 1 arch/arm64/kernel/machine_kexec.c | 1 arch/arm64/kernel/setup.c | 5 arch/arm64/kernel/stacktrace.c | 2 arch/arm64/mm/mmu.c | 7 arch/arm64/mm/pageattr.c | 13 arch/csky/kernel/setup.c | 5 arch/h8300/kernel/setup.c | 5 arch/hexagon/Kconfig | 1 arch/hexagon/kernel/vmlinux.lds.S | 9 arch/ia64/include/asm/pgtable.h | 4 arch/m68k/include/asm/motorola_pgtable.h | 2 arch/m68k/kernel/setup_mm.c | 5 arch/m68k/kernel/setup_no.c | 5 arch/mips/include/asm/pgtable-64.h | 8 arch/nds32/kernel/setup.c | 5 arch/nios2/kernel/setup.c | 5 arch/openrisc/kernel/setup.c | 5 arch/parisc/include/asm/pgtable.h | 4 arch/powerpc/include/asm/book3s/64/pgtable.h | 11 arch/powerpc/include/asm/book3s/64/tlbflush-radix.h | 2 arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 6 arch/powerpc/include/asm/nohash/64/pgtable.h | 6 arch/powerpc/include/asm/tlb.h | 6 arch/powerpc/kernel/setup-common.c | 5 arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 8 arch/powerpc/mm/book3s64/radix_pgtable.c | 6 arch/powerpc/mm/book3s64/radix_tlb.c | 44 +- arch/powerpc/mm/pgtable_64.c | 4 arch/powerpc/platforms/Kconfig.cputype | 2 arch/riscv/Kconfig | 4 arch/riscv/include/asm/pgtable-64.h | 4 arch/riscv/include/asm/unistd.h | 1 arch/riscv/kernel/setup.c | 5 arch/s390/kernel/setup.c | 5 arch/sh/include/asm/pgtable-3level.h | 4 arch/sh/kernel/setup.c | 5 arch/sparc/include/asm/pgtable_32.h | 6 arch/sparc/include/asm/pgtable_64.h | 10 arch/um/include/asm/pgtable-3level.h | 2 arch/x86/entry/syscalls/syscall_32.tbl | 1 arch/x86/entry/syscalls/syscall_64.tbl | 1 arch/x86/include/asm/pgtable.h | 8 arch/x86/kernel/dumpstack.c | 2 arch/x86/kernel/setup.c | 5 arch/x86/mm/init_64.c | 4 arch/x86/mm/pat/set_memory.c | 4 arch/x86/mm/pgtable.c | 2 include/asm-generic/pgtable-nop4d.h | 2 include/asm-generic/pgtable-nopmd.h | 2 include/asm-generic/pgtable-nopud.h | 4 include/linux/bootconfig.h | 4 include/linux/buildid.h | 10 include/linux/compaction.h | 4 include/linux/cpumask.h | 2 include/linux/crash_core.h | 12 include/linux/debugobjects.h | 2 include/linux/hmm.h | 2 include/linux/hugetlb.h | 6 include/linux/kallsyms.h | 21 + include/linux/list_lru.h | 4 include/linux/lru_cache.h | 8 include/linux/mm.h | 3 include/linux/mmu_notifier.h | 8 include/linux/module.h | 9 include/linux/nodemask.h | 6 include/linux/percpu-defs.h | 2 include/linux/percpu-refcount.h | 2 include/linux/pgtable.h | 4 include/linux/scatterlist.h | 2 include/linux/secretmem.h | 54 +++ include/linux/set_memory.h | 12 include/linux/shrinker.h | 2 include/linux/syscalls.h | 1 include/linux/vmalloc.h | 4 include/uapi/asm-generic/unistd.h | 7 include/uapi/linux/magic.h | 1 init/Kconfig | 1 init/main.c | 2 kernel/crash_core.c | 50 --- kernel/kallsyms.c | 104 +++++-- kernel/module.c | 42 ++ kernel/power/hibernate.c | 5 kernel/sys_ni.c | 2 lib/Kconfig.debug | 17 - lib/asn1_encoder.c | 2 lib/buildid.c | 80 ++++- lib/devres.c | 2 lib/dump_stack.c | 13 lib/dynamic_debug.c | 2 lib/fonts/font_pearl_8x8.c | 2 lib/kfifo.c | 2 lib/list_sort.c | 2 lib/nlattr.c | 4 lib/oid_registry.c | 2 lib/pldmfw/pldmfw.c | 2 lib/reed_solomon/test_rslib.c | 2 lib/refcount.c | 2 lib/rhashtable.c | 2 lib/sbitmap.c | 2 lib/scatterlist.c | 4 lib/seq_buf.c | 2 lib/sort.c | 2 lib/stackdepot.c | 2 lib/test_bitops.c | 2 lib/test_bpf.c | 2 lib/test_kasan.c | 2 lib/test_kmod.c | 6 lib/test_scanf.c | 2 lib/vsprintf.c | 10 mm/Kconfig | 4 mm/Makefile | 1 mm/gup.c | 12 mm/init-mm.c | 9 mm/internal.h | 3 mm/mlock.c | 3 mm/mmap.c | 5 mm/mremap.c | 108 ++++++- mm/secretmem.c | 254 +++++++++++++++++ mm/slub.c | 79 +++-- scripts/checksyscalls.sh | 4 scripts/decode_stacktrace.sh | 89 +++++- tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 3 tools/testing/selftests/vm/memfd_secret.c | 296 ++++++++++++++++++++ tools/testing/selftests/vm/mremap_test.c | 116 ++++--- tools/testing/selftests/vm/run_vmtests.sh | 17 + 137 files changed, 1470 insertions(+), 442 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-07-01 1:46 Andrew Morton 2021-07-03 0:28 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2021-07-01 1:46 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits This is the rest of the -mm tree, less 66 patches which are dependent on things which are (or were recently) in linux-next. I'll trickle that material over next week. 192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2 plus the June 28 sendings. Subsystems affected by this patch series: mm/hugetlb mm/userfaultfd mm/vmscan mm/kconfig mm/proc mm/z3fold mm/zbud mm/ras mm/mempolicy mm/memblock mm/migration mm/thp mm/nommu mm/kconfig mm/madvise mm/memory-hotplug mm/zswap mm/zsmalloc mm/zram mm/cleanups mm/kfence mm/hmm procfs sysctl misc core-kernel lib lz4 checkpatch init kprobes nilfs2 hfs signals exec kcov selftests compress/decompress ipc Subsystem: mm/hugetlb Muchun Song <songmuchun@bytedance.com>: Patch series "Free some vmemmap pages of HugeTLB page", v23: mm: memory_hotplug: factor out bootmem core functions to bootmem_info.c mm: hugetlb: introduce a new config HUGETLB_PAGE_FREE_VMEMMAP mm: hugetlb: gather discrete indexes of tail page mm: hugetlb: free the vmemmap pages associated with each HugeTLB page mm: hugetlb: defer freeing of HugeTLB pages mm: hugetlb: alloc the vmemmap pages associated with each HugeTLB page mm: hugetlb: add a kernel parameter hugetlb_free_vmemmap mm: memory_hotplug: disable memmap_on_memory when hugetlb_free_vmemmap enabled mm: hugetlb: introduce nr_free_vmemmap_pages in the struct hstate Shixin Liu <liushixin2@huawei.com>: mm/debug_vm_pgtable: move {pmd/pud}_huge_tests out of CONFIG_TRANSPARENT_HUGEPAGE mm/debug_vm_pgtable: remove redundant pfn_{pmd/pte}() and fix one comment mistake Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for huge_memory:, v3: mm/huge_memory.c: remove dedicated macro HPAGE_CACHE_INDEX_MASK mm/huge_memory.c: use page->deferred_list mm/huge_memory.c: add missing read-only THP checking in transparent_hugepage_enabled() mm/huge_memory.c: remove unnecessary tlb_remove_page_size() for huge zero pmd mm/huge_memory.c: don't discard hugepage if other processes are mapping it Christophe Leroy <christophe.leroy@csgroup.eu>: Patch series "Subject: [PATCH v2 0/5] Implement huge VMAP and VMALLOC on powerpc 8xx", v2: mm/hugetlb: change parameters of arch_make_huge_pte() mm/pgtable: add stubs for {pmd/pub}_{set/clear}_huge mm/vmalloc: enable mapping of huge pages at pte level in vmap mm/vmalloc: enable mapping of huge pages at pte level in vmalloc powerpc/8xx: add support for huge pages on VMAP and VMALLOC Nanyong Sun <sunnanyong@huawei.com>: khugepaged: selftests: remove debug_cow Mina Almasry <almasrymina@google.com>: mm, hugetlb: fix racy resv_huge_pages underflow on UFFDIO_COPY Muchun Song <songmuchun@bytedance.com>: Patch series "Split huge PMD mapping of vmemmap pages", v4: mm: sparsemem: split the huge PMD mapping of vmemmap pages mm: sparsemem: use huge PMD mapping for vmemmap pages mm: hugetlb: introduce CONFIG_HUGETLB_PAGE_FREE_VMEMMAP_DEFAULT_ON Mike Kravetz <mike.kravetz@oracle.com>: Patch series "Fix prep_compound_gigantic_page ref count adjustment": hugetlb: remove prep_compound_huge_page cleanup hugetlb: address ref count racing in prep_compound_gigantic_page Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/hwpoison: disable pcp for page_handle_poison() Subsystem: mm/userfaultfd Peter Xu <peterx@redhat.com>: Patch series "userfaultfd/selftests: A few cleanups", v2: userfaultfd/selftests: use user mode only userfaultfd/selftests: remove the time() check on delayed uffd userfaultfd/selftests: dropping VERIFY check in locking_thread userfaultfd/selftests: only dump counts if mode enabled userfaultfd/selftests: unify error handling Patch series "mm/uffd: Misc fix for uffd-wp and one more test": mm/thp: simplify copying of huge zero page pmd when fork mm/userfaultfd: fix uffd-wp special cases for fork() mm/userfaultfd: fail uffd-wp registration if not supported mm/pagemap: export uffd-wp protection information userfaultfd/selftests: add pagemap uffd-wp test Axel Rasmussen <axelrasmussen@google.com>: Patch series "userfaultfd: add minor fault handling for shmem", v6: userfaultfd/shmem: combine shmem_{mcopy_atomic,mfill_zeropage}_pte userfaultfd/shmem: support minor fault registration for shmem userfaultfd/shmem: support UFFDIO_CONTINUE for shmem userfaultfd/shmem: advertise shmem minor fault support userfaultfd/shmem: modify shmem_mfill_atomic_pte to use install_pte() userfaultfd/selftests: use memfd_create for shmem test type userfaultfd/selftests: create alias mappings in the shmem test userfaultfd/selftests: reinitialize test context in each test userfaultfd/selftests: exercise minor fault handling shmem support Subsystem: mm/vmscan Yu Zhao <yuzhao@google.com>: mm/vmscan.c: fix potential deadlock in reclaim_pages() include/trace/events/vmscan.h: remove mm_vmscan_inactive_list_is_low Miaohe Lin <linmiaohe@huawei.com>: mm: workingset: define macro WORKINGSET_SHIFT Subsystem: mm/kconfig Kefeng Wang <wangkefeng.wang@huawei.com>: mm/kconfig: move HOLES_IN_ZONE into mm Subsystem: mm/proc Mike Rapoport <rppt@linux.ibm.com>: docs: proc.rst: meminfo: briefly describe gaps in memory accounting David Hildenbrand <david@redhat.com>: Patch series "fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages", v3: fs/proc/kcore: drop KCORE_REMAP and KCORE_OTHER fs/proc/kcore: pfn_is_ram check only applies to KCORE_RAM fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages mm: introduce page_offline_(begin|end|freeze|thaw) to synchronize setting PageOffline() virtio-mem: use page_offline_(start|end) when setting PageOffline() fs/proc/kcore: use page_offline_(freeze|thaw) Subsystem: mm/z3fold Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for z3fold": mm/z3fold: define macro NCHUNKS as TOTAL_CHUNKS - ZHDR_CHUNKS mm/z3fold: avoid possible underflow in z3fold_alloc() mm/z3fold: remove magic number in z3fold_create_pool() mm/z3fold: remove unused function handle_to_z3fold_header() mm/z3fold: fix potential memory leak in z3fold_destroy_pool() mm/z3fold: use release_z3fold_page_locked() to release locked z3fold page Subsystem: mm/zbud Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups for zbud", v2: mm/zbud: reuse unbuddied[0] as buddied in zbud_pool mm/zbud: don't export any zbud API Subsystem: mm/ras YueHaibing <yuehaibing@huawei.com>: mm/compaction: use DEVICE_ATTR_WO macro Liu Xiang <liu.xiang@zlingsmart.com>: mm: compaction: remove duplicate !list_empty(&sublist) check Wonhyuk Yang <vvghjk1234@gmail.com>: mm/compaction: fix 'limit' in fast_isolate_freepages Subsystem: mm/mempolicy Feng Tang <feng.tang@intel.com>: Patch series "mm/mempolicy: some fix and semantics cleanup", v4: mm/mempolicy: cleanup nodemask intersection check for oom mm/mempolicy: don't handle MPOL_LOCAL like a fake MPOL_PREFERRED policy mm/mempolicy: unify the parameter sanity check for mbind and set_mempolicy Yang Shi <shy828301@gmail.com>: mm: mempolicy: don't have to split pmd for huge zero page Ben Widawsky <ben.widawsky@intel.com>: mm/mempolicy: use unified 'nodes' for bind/interleave/prefer policies Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: Patch series "arm64: drop pfn_valid_within() and simplify pfn_valid()", v4: include/linux/mmzone.h: add documentation for pfn_valid() memblock: update initialization of reserved pages arm64: decouple check whether pfn is in linear map from pfn_valid() arm64: drop pfn_valid_within() and simplify pfn_valid() Anshuman Khandual <anshuman.khandual@arm.com>: arm64/mm: drop HAVE_ARCH_PFN_VALID Subsystem: mm/migration Muchun Song <songmuchun@bytedance.com>: mm: migrate: fix missing update page_private to hugetlb_page_subpool Subsystem: mm/thp Collin Fijalkovich <cfijalkovich@google.com>: mm, thp: relax the VM_DENYWRITE constraint on file-backed THPs Yang Shi <shy828301@gmail.com>: mm: memory: add orig_pmd to struct vm_fault mm: memory: make numa_migrate_prep() non-static mm: thp: refactor NUMA fault handling mm: migrate: account THP NUMA migration counters correctly mm: migrate: don't split THP for misplaced NUMA page mm: migrate: check mapcount for THP instead of refcount mm: thp: skip make PMD PROT_NONE if THP migration is not supported Anshuman Khandual <anshuman.khandual@arm.com>: mm/thp: make ARCH_ENABLE_SPLIT_PMD_PTLOCK dependent on PGTABLE_LEVELS > 2 Yang Shi <shy828301@gmail.com>: mm: rmap: make try_to_unmap() void function Hugh Dickins <hughd@google.com>: mm/thp: remap_page() is only needed on anonymous THP mm: hwpoison_user_mappings() try_to_unmap() with TTU_SYNC "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/thp: fix strncpy warning Subsystem: mm/nommu Chen Li <chenli@uniontech.com>: nommu: remove __GFP_HIGHMEM in vmalloc/vzalloc Liam Howlett <liam.howlett@oracle.com>: mm/nommu: unexport do_munmap() Subsystem: mm/kconfig Kefeng Wang <wangkefeng.wang@huawei.com>: mm: generalize ZONE_[DMA|DMA32] Subsystem: mm/madvise David Hildenbrand <david@redhat.com>: Patch series "mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables", v2: mm: make variable names for populate_vma_page_range() consistent mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables MAINTAINERS: add tools/testing/selftests/vm/ to MEMORY MANAGEMENT selftests/vm: add protection_keys_32 / protection_keys_64 to gitignore selftests/vm: add test for MADV_POPULATE_(READ|WRITE) Subsystem: mm/memory-hotplug Liam Mark <lmark@codeaurora.org>: mm/memory_hotplug: rate limit page migration warnings Oscar Salvador <osalvador@suse.de>: mm,memory_hotplug: drop unneeded locking Subsystem: mm/zswap Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for zswap": mm/zswap.c: remove unused function zswap_debugfs_exit() mm/zswap.c: avoid unnecessary copy-in at map time mm/zswap.c: fix two bugs in zswap_writeback_entry() Subsystem: mm/zsmalloc Zhaoyang Huang <zhaoyang.huang@unisoc.com>: mm: zram: amend SLAB_RECLAIM_ACCOUNT on zspage_cachep Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup for zsmalloc": mm/zsmalloc.c: remove confusing code in obj_free() mm/zsmalloc.c: improve readability for async_free_zspage() Subsystem: mm/zram Yue Hu <huyue2@yulong.com>: zram: move backing_dev under macro CONFIG_ZRAM_WRITEBACK Subsystem: mm/cleanups Hyeonggon Yoo <42.hyeyoo@gmail.com>: mm: fix typos and grammar error in comments Anshuman Khandual <anshuman.khandual@arm.com>: mm: define default value for FIRST_USER_ADDRESS Zhen Lei <thunder.leizhen@huawei.com>: mm: fix spelling mistakes Mel Gorman <mgorman@techsingularity.net>: Patch series "Clean W=1 build warnings for mm/": mm/vmscan: remove kerneldoc-like comment from isolate_lru_pages mm/vmalloc: include header for prototype of set_iounmap_nonlazy mm/page_alloc: make should_fail_alloc_page() static mm/mapping_dirty_helpers: remove double Note in kerneldoc mm/memcontrol.c: fix kerneldoc comment for mem_cgroup_calculate_protection mm/memory_hotplug: fix kerneldoc comment for __try_online_node mm/memory_hotplug: fix kerneldoc comment for __remove_memory mm/zbud: add kerneldoc fields for zbud_pool mm/z3fold: add kerneldoc fields for z3fold_pool mm/swap: make swap_address_space an inline function mm/mmap_lock: remove dead code for !CONFIG_TRACING configurations mm/page_alloc: move prototype for find_suitable_fallback mm/swap: make NODE_DATA an inline function on CONFIG_FLATMEM Anshuman Khandual <anshuman.khandual@arm.com>: mm/thp: define default pmd_pgtable() Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: unconditionally use unbound work queue Subsystem: mm/hmm Alistair Popple <apopple@nvidia.com>: Patch series "Add support for SVM atomics in Nouveau", v11: mm: remove special swap entry functions mm/swapops: rework swap entry manipulation code mm/rmap: split try_to_munlock from try_to_unmap mm/rmap: split migration into its own function mm: rename migrate_pgmap_owner mm/memory.c: allow different return codes for copy_nonpresent_pte() mm: device exclusive memory access mm: selftests for exclusive device memory nouveau/svm: refactor nouveau_range_fault nouveau/svm: implement atomic SVM access Subsystem: procfs Marcelo Henrique Cerri <marcelo.cerri@canonical.com>: proc: Avoid mixing integer types in mem_rw() ZHOUFENG <zhoufeng.zf@bytedance.com>: fs/proc/kcore.c: add mmap interface Kalesh Singh <kaleshsingh@google.com>: procfs: allow reading fdinfo with PTRACE_MODE_READ procfs/dmabuf: add inode number to /proc/*/fdinfo Subsystem: sysctl Jiapeng Chong <jiapeng.chong@linux.alibaba.com>: sysctl: remove redundant assignment to first Subsystem: misc Andy Shevchenko <andriy.shevchenko@linux.intel.com>: drm: include only needed headers in ascii85.h Subsystem: core-kernel Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: split out panic and oops helpers Subsystem: lib Zhen Lei <thunder.leizhen@huawei.com>: lib: decompress_bunzip2: remove an unneeded semicolon Andy Shevchenko <andriy.shevchenko@linux.intel.com>: Patch series "lib/string_helpers: get rid of ugly *_escape_mem_ascii()", v3: lib/string_helpers: switch to use BIT() macro lib/string_helpers: move ESCAPE_NP check inside 'else' branch in a loop lib/string_helpers: drop indentation level in string_escape_mem() lib/string_helpers: introduce ESCAPE_NA for escaping non-ASCII lib/string_helpers: introduce ESCAPE_NAP to escape non-ASCII and non-printable lib/string_helpers: allow to append additional characters to be escaped lib/test-string_helpers: print flags in hexadecimal format lib/test-string_helpers: get rid of trailing comma in terminators lib/test-string_helpers: add test cases for new features MAINTAINERS: add myself as designated reviewer for generic string library seq_file: introduce seq_escape_mem() seq_file: add seq_escape_str() as replica of string_escape_str() seq_file: convert seq_escape() to use seq_escape_str() nfsd: avoid non-flexible API in seq_quote_mem() seq_file: drop unused *_escape_mem_ascii() Trent Piepho <tpiepho@gmail.com>: lib/math/rational.c: fix divide by zero lib/math/rational: add Kunit test cases Zhen Lei <thunder.leizhen@huawei.com>: lib/decompressors: fix spelling mistakes lib/mpi: fix spelling mistakes Alexey Dobriyan <adobriyan@gmail.com>: lib: memscan() fixlet lib: uninline simple_strtoull() Matteo Croce <mcroce@microsoft.com>: lib/test_string.c: allow module removal Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: split out kstrtox() and simple_strtox() to a separate header Subsystem: lz4 Rajat Asthana <thisisrast7@gmail.com>: lz4_decompress: declare LZ4_decompress_safe_withPrefix64k static Dimitri John Ledkov <dimitri.ledkov@canonical.com>: lib/decompress_unlz4.c: correctly handle zero-padding around initrds. Subsystem: checkpatch Guenter Roeck <linux@roeck-us.net>: checkpatch: scripts/spdxcheck.py now requires python3 Joe Perches <joe@perches.com>: checkpatch: improve the indented label test Guenter Roeck <linux@roeck-us.net>: checkpatch: do not complain about positive return values starting with EPOLL Subsystem: init Andrew Halaney <ahalaney@redhat.com>: init: print out unknown kernel parameters Subsystem: kprobes Barry Song <song.bao.hua@hisilicon.com>: kprobes: remove duplicated strong free_insn_page in x86 and s390 Subsystem: nilfs2 Colin Ian King <colin.king@canonical.com>: nilfs2: remove redundant continue statement in a while-loop Subsystem: hfs Zhen Lei <thunder.leizhen@huawei.com>: hfsplus: remove unnecessary oom message Chung-Chiang Cheng <shepjeng@gmail.com>: hfsplus: report create_date to kstat.btime Subsystem: signals Al Viro <viro@zeniv.linux.org.uk>: x86: signal: don't do sas_ss_reset() until we are certain that sigframe won't be abandoned Subsystem: exec Alexey Dobriyan <adobriyan@gmail.com>: exec: remove checks in __register_bimfmt() Subsystem: kcov Marco Elver <elver@google.com>: kcov: add __no_sanitize_coverage to fix noinstr for all architectures Subsystem: selftests Dave Hansen <dave.hansen@linux.intel.com>: Patch series "selftests/vm/pkeys: Bug fixes and a new test": selftests/vm/pkeys: fix alloc_random_pkey() to make it really, really random selftests/vm/pkeys: handle negative sys_pkey_alloc() return code selftests/vm/pkeys: refill shadow register after implicit kernel write selftests/vm/pkeys: exercise x86 XSAVE init state Subsystem: compress/decompress Yu Kuai <yukuai3@huawei.com>: lib/decompressors: remove set but not used variabled 'level' Subsystem: ipc Vasily Averin <vvs@virtuozzo.com>: Patch series "ipc: allocations cleanup", v2: ipc sem: use kvmalloc for sem_undo allocation ipc: use kmalloc for msg_queue and shmid_kernel Manfred Spraul <manfred@colorfullife.com>: ipc/sem.c: use READ_ONCE()/WRITE_ONCE() for use_global_lock ipc/util.c: use binary search for max_idx Documentation/admin-guide/kernel-parameters.txt | 35 Documentation/admin-guide/mm/hugetlbpage.rst | 11 Documentation/admin-guide/mm/memory-hotplug.rst | 13 Documentation/admin-guide/mm/pagemap.rst | 2 Documentation/admin-guide/mm/userfaultfd.rst | 3 Documentation/core-api/kernel-api.rst | 7 Documentation/filesystems/proc.rst | 48 Documentation/vm/hmm.rst | 19 Documentation/vm/unevictable-lru.rst | 33 MAINTAINERS | 10 arch/alpha/Kconfig | 5 arch/alpha/include/asm/pgalloc.h | 1 arch/alpha/include/asm/pgtable.h | 1 arch/alpha/include/uapi/asm/mman.h | 3 arch/alpha/kernel/setup.c | 2 arch/arc/include/asm/pgalloc.h | 2 arch/arc/include/asm/pgtable.h | 8 arch/arm/Kconfig | 3 arch/arm/include/asm/pgalloc.h | 1 arch/arm64/Kconfig | 15 arch/arm64/include/asm/hugetlb.h | 3 arch/arm64/include/asm/memory.h | 2 arch/arm64/include/asm/page.h | 4 arch/arm64/include/asm/pgalloc.h | 1 arch/arm64/include/asm/pgtable.h | 2 arch/arm64/kernel/setup.c | 1 arch/arm64/kvm/mmu.c | 2 arch/arm64/mm/hugetlbpage.c | 5 arch/arm64/mm/init.c | 51 arch/arm64/mm/ioremap.c | 4 arch/arm64/mm/mmu.c | 22 arch/csky/include/asm/pgalloc.h | 2 arch/csky/include/asm/pgtable.h | 1 arch/hexagon/include/asm/pgtable.h | 4 arch/ia64/Kconfig | 7 arch/ia64/include/asm/pal.h | 1 arch/ia64/include/asm/pgalloc.h | 1 arch/ia64/include/asm/pgtable.h | 1 arch/m68k/Kconfig | 5 arch/m68k/include/asm/mcf_pgalloc.h | 2 arch/m68k/include/asm/mcf_pgtable.h | 2 arch/m68k/include/asm/motorola_pgalloc.h | 1 arch/m68k/include/asm/motorola_pgtable.h | 2 arch/m68k/include/asm/pgtable_mm.h | 1 arch/m68k/include/asm/sun3_pgalloc.h | 1 arch/microblaze/Kconfig | 4 arch/microblaze/include/asm/pgalloc.h | 2 arch/microblaze/include/asm/pgtable.h | 2 arch/mips/Kconfig | 10 arch/mips/include/asm/pgalloc.h | 1 arch/mips/include/asm/pgtable-32.h | 1 arch/mips/include/asm/pgtable-64.h | 1 arch/mips/include/uapi/asm/mman.h | 3 arch/mips/kernel/relocate.c | 1 arch/mips/sgi-ip22/ip22-reset.c | 1 arch/mips/sgi-ip32/ip32-reset.c | 1 arch/nds32/include/asm/pgalloc.h | 5 arch/nios2/include/asm/pgalloc.h | 1 arch/nios2/include/asm/pgtable.h | 2 arch/openrisc/include/asm/pgalloc.h | 2 arch/openrisc/include/asm/pgtable.h | 1 arch/parisc/include/asm/pgalloc.h | 1 arch/parisc/include/asm/pgtable.h | 2 arch/parisc/include/uapi/asm/mman.h | 3 arch/parisc/kernel/pdc_chassis.c | 1 arch/powerpc/Kconfig | 6 arch/powerpc/include/asm/book3s/pgtable.h | 1 arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h | 5 arch/powerpc/include/asm/nohash/32/mmu-8xx.h | 43 arch/powerpc/include/asm/nohash/32/pgtable.h | 1 arch/powerpc/include/asm/nohash/64/pgtable.h | 2 arch/powerpc/include/asm/pgalloc.h | 5 arch/powerpc/include/asm/pgtable.h | 6 arch/powerpc/kernel/setup-common.c | 1 arch/powerpc/platforms/Kconfig.cputype | 1 arch/riscv/Kconfig | 5 arch/riscv/include/asm/pgalloc.h | 2 arch/riscv/include/asm/pgtable.h | 2 arch/s390/Kconfig | 6 arch/s390/include/asm/pgalloc.h | 3 arch/s390/include/asm/pgtable.h | 5 arch/s390/kernel/ipl.c | 1 arch/s390/kernel/kprobes.c | 5 arch/s390/mm/pgtable.c | 2 arch/sh/include/asm/pgalloc.h | 1 arch/sh/include/asm/pgtable.h | 2 arch/sparc/Kconfig | 5 arch/sparc/include/asm/pgalloc_32.h | 1 arch/sparc/include/asm/pgalloc_64.h | 1 arch/sparc/include/asm/pgtable_32.h | 3 arch/sparc/include/asm/pgtable_64.h | 8 arch/sparc/kernel/sstate.c | 1 arch/sparc/mm/hugetlbpage.c | 6 arch/sparc/mm/init_64.c | 1 arch/um/drivers/mconsole_kern.c | 1 arch/um/include/asm/pgalloc.h | 1 arch/um/include/asm/pgtable-2level.h | 1 arch/um/include/asm/pgtable-3level.h | 1 arch/um/kernel/um_arch.c | 1 arch/x86/Kconfig | 17 arch/x86/include/asm/desc.h | 1 arch/x86/include/asm/pgalloc.h | 2 arch/x86/include/asm/pgtable_types.h | 2 arch/x86/kernel/cpu/mshyperv.c | 1 arch/x86/kernel/kprobes/core.c | 6 arch/x86/kernel/setup.c | 1 arch/x86/mm/init_64.c | 21 arch/x86/mm/pgtable.c | 34 arch/x86/purgatory/purgatory.c | 2 arch/x86/xen/enlighten.c | 1 arch/xtensa/include/asm/pgalloc.h | 2 arch/xtensa/include/asm/pgtable.h | 1 arch/xtensa/include/uapi/asm/mman.h | 3 arch/xtensa/platforms/iss/setup.c | 1 drivers/block/zram/zram_drv.h | 2 drivers/bus/brcmstb_gisb.c | 1 drivers/char/ipmi/ipmi_msghandler.c | 1 drivers/clk/analogbits/wrpll-cln28hpc.c | 4 drivers/edac/altera_edac.c | 1 drivers/firmware/google/gsmi.c | 1 drivers/gpu/drm/nouveau/include/nvif/if000c.h | 1 drivers/gpu/drm/nouveau/nouveau_svm.c | 162 ++- drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmm.h | 1 drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmmgp100.c | 6 drivers/hv/vmbus_drv.c | 1 drivers/hwtracing/coresight/coresight-cpu-debug.c | 1 drivers/leds/trigger/ledtrig-activity.c | 1 drivers/leds/trigger/ledtrig-heartbeat.c | 1 drivers/leds/trigger/ledtrig-panic.c | 1 drivers/misc/bcm-vk/bcm_vk_dev.c | 1 drivers/misc/ibmasm/heartbeat.c | 1 drivers/misc/pvpanic/pvpanic.c | 1 drivers/net/ipa/ipa_smp2p.c | 1 drivers/parisc/power.c | 1 drivers/power/reset/ltc2952-poweroff.c | 1 drivers/remoteproc/remoteproc_core.c | 1 drivers/s390/char/con3215.c | 1 drivers/s390/char/con3270.c | 1 drivers/s390/char/sclp.c | 1 drivers/s390/char/sclp_con.c | 1 drivers/s390/char/sclp_vt220.c | 1 drivers/s390/char/zcore.c | 1 drivers/soc/bcm/brcmstb/pm/pm-arm.c | 1 drivers/staging/olpc_dcon/olpc_dcon.c | 1 drivers/video/fbdev/hyperv_fb.c | 1 drivers/virtio/virtio_mem.c | 2 fs/Kconfig | 15 fs/exec.c | 3 fs/hfsplus/inode.c | 5 fs/hfsplus/xattr.c | 1 fs/nfsd/nfs4state.c | 2 fs/nilfs2/btree.c | 1 fs/open.c | 13 fs/proc/base.c | 6 fs/proc/fd.c | 20 fs/proc/kcore.c | 136 ++ fs/proc/task_mmu.c | 34 fs/seq_file.c | 43 fs/userfaultfd.c | 15 include/asm-generic/bug.h | 3 include/linux/ascii85.h | 3 include/linux/bootmem_info.h | 68 + include/linux/compat.h | 2 include/linux/compiler-clang.h | 17 include/linux/compiler-gcc.h | 6 include/linux/compiler_types.h | 2 include/linux/huge_mm.h | 74 - include/linux/hugetlb.h | 80 + include/linux/hugetlb_cgroup.h | 19 include/linux/kcore.h | 3 include/linux/kernel.h | 227 ---- include/linux/kprobes.h | 1 include/linux/kstrtox.h | 155 ++ include/linux/memblock.h | 4 include/linux/memory_hotplug.h | 27 include/linux/mempolicy.h | 9 include/linux/memremap.h | 2 include/linux/migrate.h | 27 include/linux/mm.h | 18 include/linux/mm_types.h | 2 include/linux/mmu_notifier.h | 26 include/linux/mmzone.h | 27 include/linux/mpi.h | 4 include/linux/page-flags.h | 22 include/linux/panic.h | 98 + include/linux/panic_notifier.h | 12 include/linux/pgtable.h | 44 include/linux/rmap.h | 13 include/linux/seq_file.h | 10 include/linux/shmem_fs.h | 19 include/linux/signal.h | 2 include/linux/string.h | 7 include/linux/string_helpers.h | 31 include/linux/sunrpc/cache.h | 1 include/linux/swap.h | 19 include/linux/swapops.h | 171 +-- include/linux/thread_info.h | 1 include/linux/userfaultfd_k.h | 5 include/linux/vmalloc.h | 15 include/linux/zbud.h | 23 include/trace/events/vmscan.h | 41 include/uapi/asm-generic/mman-common.h | 3 include/uapi/linux/mempolicy.h | 1 include/uapi/linux/userfaultfd.h | 7 init/main.c | 42 ipc/msg.c | 6 ipc/sem.c | 25 ipc/shm.c | 6 ipc/util.c | 44 ipc/util.h | 3 kernel/hung_task.c | 1 kernel/kexec_core.c | 1 kernel/kprobes.c | 2 kernel/panic.c | 1 kernel/rcu/tree.c | 2 kernel/signal.c | 14 kernel/sysctl.c | 4 kernel/trace/trace.c | 1 lib/Kconfig.debug | 12 lib/decompress_bunzip2.c | 6 lib/decompress_unlz4.c | 8 lib/decompress_unlzo.c | 3 lib/decompress_unxz.c | 2 lib/decompress_unzstd.c | 4 lib/kstrtox.c | 5 lib/lz4/lz4_decompress.c | 2 lib/math/Makefile | 1 lib/math/rational-test.c | 56 + lib/math/rational.c | 16 lib/mpi/longlong.h | 4 lib/mpi/mpicoder.c | 6 lib/mpi/mpiutil.c | 2 lib/parser.c | 1 lib/string.c | 2 lib/string_helpers.c | 142 +- lib/test-string_helpers.c | 157 ++- lib/test_hmm.c | 127 ++ lib/test_hmm_uapi.h | 2 lib/test_string.c | 5 lib/vsprintf.c | 1 lib/xz/xz_dec_bcj.c | 2 lib/xz/xz_dec_lzma2.c | 8 lib/zlib_inflate/inffast.c | 2 lib/zstd/huf.h | 2 mm/Kconfig | 16 mm/Makefile | 2 mm/bootmem_info.c | 127 ++ mm/compaction.c | 20 mm/debug_vm_pgtable.c | 109 -- mm/gup.c | 58 + mm/hmm.c | 12 mm/huge_memory.c | 269 ++--- mm/hugetlb.c | 369 +++++-- mm/hugetlb_vmemmap.c | 332 ++++++ mm/hugetlb_vmemmap.h | 53 - mm/internal.h | 29 mm/kfence/core.c | 4 mm/khugepaged.c | 20 mm/madvise.c | 66 + mm/mapping_dirty_helpers.c | 2 mm/memblock.c | 28 mm/memcontrol.c | 4 mm/memory-failure.c | 38 mm/memory.c | 239 +++- mm/memory_hotplug.c | 161 --- mm/mempolicy.c | 323 ++---- mm/migrate.c | 268 +---- mm/mlock.c | 12 mm/mmap_lock.c | 59 - mm/mprotect.c | 18 mm/nommu.c | 5 mm/oom_kill.c | 2 mm/page_alloc.c | 5 mm/page_vma_mapped.c | 15 mm/rmap.c | 644 +++++++++--- mm/shmem.c | 125 -- mm/sparse-vmemmap.c | 432 +++++++- mm/sparse.c | 1 mm/swap.c | 2 mm/swapfile.c | 2 mm/userfaultfd.c | 249 ++-- mm/util.c | 40 mm/vmalloc.c | 37 mm/vmscan.c | 20 mm/workingset.c | 10 mm/z3fold.c | 39 mm/zbud.c | 235 ++-- mm/zsmalloc.c | 5 mm/zswap.c | 26 scripts/checkpatch.pl | 16 tools/testing/selftests/vm/.gitignore | 3 tools/testing/selftests/vm/Makefile | 5 tools/testing/selftests/vm/hmm-tests.c | 158 +++ tools/testing/selftests/vm/khugepaged.c | 4 tools/testing/selftests/vm/madv_populate.c | 342 ++++++ tools/testing/selftests/vm/pkey-x86.h | 1 tools/testing/selftests/vm/protection_keys.c | 85 + tools/testing/selftests/vm/run_vmtests.sh | 16 tools/testing/selftests/vm/userfaultfd.c | 1094 ++++++++++----------- 299 files changed, 6277 insertions(+), 3183 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-07-01 1:46 incoming Andrew Morton @ 2021-07-03 0:28 ` Linus Torvalds 2021-07-03 1:06 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2021-07-03 0:28 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Wed, Jun 30, 2021 at 6:46 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > This is the rest of the -mm tree, less 66 patches which are dependent on > things which are (or were recently) in linux-next. I'll trickle that > material over next week. I haven't bisected this yet, but with the current -git I'm getting watchdog: BUG: soft lockup - CPU#41 stuck for 49s! and the common call chain seems to be in flush_tlb_mm_range -> on_each_cpu_cond_mask. Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking at the pulls and merges I've done since, this -mm series looks like the obvious culprit. I'll go start bisection, but I thought I'd give a heads-up in case somebody else has seen TLB-flush-related lockups and already figured out the guilty party.. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-07-03 0:28 ` incoming Linus Torvalds @ 2021-07-03 1:06 ` Linus Torvalds 0 siblings, 0 replies; 322+ messages in thread From: Linus Torvalds @ 2021-07-03 1:06 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Fri, Jul 2, 2021 at 5:28 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking > at the pulls and merges I've done since, this -mm series looks like > the obvious culprit. No, unless my bisection is wrong, the -mm branch is innocent, and was discarded from the suspects on the very first bisection trial. So never mind. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-06-29 2:32 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-06-29 2:32 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2. Subsystems affected by this patch series: mm/gup mm/pagealloc kthread ia64 scripts ntfs squashfs ocfs2 z kernel/watchdog mm/slab mm/slub mm/kmemleak mm/dax mm/debug mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/mprotect mm/bootmem mm/dma mm/tracing mm/vmalloc mm/kasan mm/initialization mm/pagealloc mm/memory-failure Subsystem: mm/gup Jann Horn <jannh@google.com>: mm/gup: fix try_grab_compound_head() race with split_huge_page() Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: mm/page_alloc: fix memory map initialization for descending nodes Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: correct return value of populated elements if bulk array is populated Subsystem: kthread Jonathan Neuschäfer <j.neuschaefer@gmx.net>: kthread: switch to new kerneldoc syntax for named variable macro argument Petr Mladek <pmladek@suse.com>: kthread_worker: fix return value when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync() Subsystem: ia64 Randy Dunlap <rdunlap@infradead.org>: ia64: headers: drop duplicated words Arnd Bergmann <arnd@arndb.de>: ia64: mca_drv: fix incorrect array size calculation Subsystem: scripts "Steven Rostedt (VMware)" <rostedt@goodmis.org>: Patch series "streamline_config.pl: Fix Perl spacing": streamline_config.pl: make spacing consistent streamline_config.pl: add softtabstop=4 for vim users Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ntfs Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>: ntfs: fix validity check for file name attribute Subsystem: squashfs Vincent Whitchurch <vincent.whitchurch@axis.com>: squashfs: add option to panic on errors Subsystem: ocfs2 Yang Yingliang <yangyingliang@huawei.com>: ocfs2: remove unnecessary INIT_LIST_HEAD() Subsystem: z Dan Carpenter <dan.carpenter@oracle.com>: ocfs2: fix snprintf() checking Colin Ian King <colin.king@canonical.com>: ocfs2: remove redundant assignment to pointer queue Wan Jiabing <wanjiabing@vivo.com>: ocfs2: remove repeated uptodate check for buffer Chen Huang <chenhuang5@huawei.com>: ocfs2: replace simple_strtoull() with kstrtoull() Colin Ian King <colin.king@canonical.com>: ocfs2: remove redundant initialization of variable ret Subsystem: kernel/watchdog Wang Qing <wangqing@vivo.com>: kernel: watchdog: modify the explanation related to watchdog thread doc: watchdog: modify the explanation related to watchdog thread doc: watchdog: modify the doc related to "watchdog/%u" Subsystem: mm/slab gumingtao <gumingtao1225@gmail.com>: slab: use __func__ to trace function name Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: kunit: make test->lock irq safe Oliver Glitta <glittao@gmail.com>: mm/slub, kunit: add a KUnit test for SLUB debugging functionality slub: remove resiliency_test() function Hyeonggon Yoo <42.hyeyoo@gmail.com>: mm, slub: change run-time assertion in kmalloc_index() to compile-time Stephen Boyd <swboyd@chromium.org>: slub: restore slub_debug=- behavior slub: actually use 'message' in restore_bytes() Joe Perches <joe@perches.com>: slub: indicate slab_fix() uses printf formats Stephen Boyd <swboyd@chromium.org>: slub: force on no_hash_pointers when slub_debug is enabled Faiyaz Mohammed <faiyazm@codeaurora.org>: mm: slub: move sysfs slab alloc/free interfaces to debugfs Georgi Djakov <quic_c_gdjako@quicinc.com>: mm/slub: add taint after the errors are printed Subsystem: mm/kmemleak Yanfei Xu <yanfei.xu@windriver.com>: mm/kmemleak: fix possible wrong memory scanning period Subsystem: mm/dax Jan Kara <jack@suse.cz>: dax: fix ENOMEM handling in grab_mapping_entry() Subsystem: mm/debug Tang Bin <tangbin@cmss.chinamobile.com>: tools/vm/page_owner_sort.c: check malloc() return Anshuman Khandual <anshuman.khandual@arm.com>: mm/debug_vm_pgtable: ensure THP availability via has_transparent_hugepage() Nicolas Saenz Julienne <nsaenzju@redhat.com>: mm: mmap_lock: use local locks instead of disabling preemption Gavin Shan <gshan@redhat.com>: Patch series "mm/page_reporting: Make page reporting work on arm64 with 64KB page size", v4: mm/page_reporting: fix code style in __page_reporting_request() mm/page_reporting: export reporting order as module parameter mm/page_reporting: allow driver to specify reporting order virtio_balloon: specify page reporting order if needed Subsystem: mm/pagecache Kefeng Wang <wangkefeng.wang@huawei.com>: mm: page-writeback: kill get_writeback_state() comments Chi Wu <wuchi.zero@gmail.com>: mm/page-writeback: Fix performance when BDI's share of ratio is 0. mm/page-writeback: update the comment of Dirty position control mm/page-writeback: use __this_cpu_inc() in account_page_dirtied() Roman Gushchin <guro@fb.com>: Patch series "cgroup, blkcg: prevent dirty inodes to pin dying memory cgroups", v9: writeback, cgroup: do not switch inodes with I_WILL_FREE flag writeback, cgroup: add smp_mb() to cgroup_writeback_umount() writeback, cgroup: increment isw_nr_in_flight before grabbing an inode writeback, cgroup: switch to rcu_work API in inode_switch_wbs() writeback, cgroup: keep list of inodes attached to bdi_writeback writeback, cgroup: split out the functional part of inode_switch_wbs_work_fn() writeback, cgroup: support switching multiple inodes at once writeback, cgroup: release dying cgwbs by switching attached inodes Christoph Hellwig <hch@lst.de>: Patch series "remove the implicit .set_page_dirty default": fs: unexport __set_page_dirty fs: move ramfs_aops to libfs mm: require ->set_page_dirty to be explicitly wired up "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Further set_page_dirty cleanups": mm/writeback: move __set_page_dirty() to core mm mm/writeback: use __set_page_dirty in __set_page_dirty_nobuffers iomap: use __set_page_dirty_nobuffers fs: remove anon_set_page_dirty() fs: remove noop_set_page_dirty() mm: move page dirtying prototypes from mm.h Subsystem: mm/gup Peter Xu <peterx@redhat.com>: Patch series "mm/gup: Fix pin page write cache bouncing on has_pinned", v2: mm/gup_benchmark: support threading Andrea Arcangeli <aarcange@redhat.com>: mm: gup: allow FOLL_PIN to scale in SMP mm: gup: pack has_pinned in MMF_HAS_PINNED Christophe Leroy <christophe.leroy@csgroup.eu>: mm: pagewalk: fix walk for hugepage tables Subsystem: mm/swap Miaohe Lin <linmiaohe@huawei.com>: Patch series "close various race windows for swap", v6: mm/swapfile: use percpu_ref to serialize against concurrent swapoff swap: fix do_swap_page() race with swapoff mm/swap: remove confusing checking for non_swap_entry() in swap_ra_info() mm/shmem: fix shmem_swapin() race with swapoff Patch series "Cleanups for swap", v2: mm/swapfile: move get_swap_page_of_type() under CONFIG_HIBERNATION mm/swap: remove unused local variable nr_shadows mm/swap_slots.c: delete meaningless forward declarations Huang Ying <ying.huang@intel.com>: mm, swap: remove unnecessary smp_rmb() in swap_type_to_swap_info() mm: free idle swap cache page after COW swap: check mapping_empty() for swap cache before being freed Subsystem: mm/memcg Waiman Long <longman@redhat.com>: Patch series "mm/memcg: Reduce kmemcache memory accounting overhead", v6: mm/memcg: move mod_objcg_state() to memcontrol.c mm/memcg: cache vmstat data in percpu memcg_stock_pcp mm/memcg: improve refill_obj_stock() performance mm/memcg: optimize user context object stock access Patch series "mm: memcg/slab: Fix objcg pointer array handling problem", v4: mm: memcg/slab: properly set up gfp flags for objcg pointer array mm: memcg/slab: create a new set of kmalloc-cg-<n> caches mm: memcg/slab: disable cache merging for KMALLOC_NORMAL caches Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: fix root_mem_cgroup charging Patch series "memcontrol code cleanup and simplification", v3: mm: memcontrol: fix page charging in page replacement mm: memcontrol: bail out early when !mm in get_mem_cgroup_from_mm mm: memcontrol: remove the pgdata parameter of mem_cgroup_page_lruvec mm: memcontrol: simplify lruvec_holds_page_lru_lock mm: memcontrol: rename lruvec_holds_page_lru_lock to page_matches_lruvec mm: memcontrol: simplify the logic of objcg pinning memcg mm: memcontrol: move obj_cgroup_uncharge_pages() out of css_set_lock mm: vmscan: remove noinline_for_stack wenhuizhang <wenhui@gwmail.gwu.edu>: memcontrol: use flexible-array member Dan Schatzberg <schatzberg.dan@gmail.com>: Patch series "Charge loop device i/o to issuing cgroup", v14: loop: use worker per cgroup instead of kworker mm: charge active memcg when no mm is set loop: charge i/o to mem and blk cg Huilong Deng <denghuilong@cdjrlc.com>: mm: memcontrol: remove trailing semicolon in macros Subsystem: mm/pagemap David Hildenbrand <david@redhat.com>: Patch series "perf/binfmt/mm: remove in-tree usage of MAP_EXECUTABLE": perf: MAP_EXECUTABLE does not indicate VM_MAYEXEC binfmt: remove in-tree usage of MAP_EXECUTABLE mm: ignore MAP_EXECUTABLE in ksys_mmap_pgoff() Gonzalo Matias Juarez Tello <gmjuareztello@gmail.com>: mm/mmap.c: logic of find_vma_intersection repeated in __do_munmap Liam Howlett <liam.howlett@oracle.com>: mm/mmap: introduce unlock_range() for code cleanup mm/mmap: use find_vma_intersection() in do_mmap() for overlap Liu Xiang <liu.xiang@zlingsmart.com>: mm/memory.c: fix comment of finish_mkwrite_fault() Liam Howlett <liam.howlett@oracle.com>: Patch series "mm: Add vma_lookup()", v2: mm: add vma_lookup(), update find_vma_intersection() comments drm/i915/selftests: use vma_lookup() in __igt_mmap() arch/arc/kernel/troubleshoot: use vma_lookup() instead of find_vma() arch/arm64/kvm: use vma_lookup() instead of find_vma_intersection() arch/powerpc/kvm/book3s_hv_uvmem: use vma_lookup() instead of find_vma_intersection() arch/powerpc/kvm/book3s: use vma_lookup() in kvmppc_hv_setup_htab_rma() arch/mips/kernel/traps: use vma_lookup() instead of find_vma() arch/m68k/kernel/sys_m68k: use vma_lookup() in sys_cacheflush() x86/sgx: use vma_lookup() in sgx_encl_find() virt/kvm: use vma_lookup() instead of find_vma_intersection() vfio: use vma_lookup() instead of find_vma_intersection() net/ipv5/tcp: use vma_lookup() in tcp_zerocopy_receive() drm/amdgpu: use vma_lookup() in amdgpu_ttm_tt_get_user_pages() media: videobuf2: use vma_lookup() in get_vaddr_frames() misc/sgi-gru/grufault: use vma_lookup() in gru_find_vma() kernel/events/uprobes: use vma_lookup() in find_active_uprobe() lib/test_hmm: use vma_lookup() in dmirror_migrate() mm/ksm: use vma_lookup() in find_mergeable_vma() mm/migrate: use vma_lookup() in do_pages_stat_array() mm/mremap: use vma_lookup() in vma_to_resize() mm/memory.c: use vma_lookup() in __access_remote_vm() mm/mempolicy: use vma_lookup() in __access_remote_vm() Chen Li <chenli@uniontech.com>: mm: update legacy flush_tlb_* to use vma Subsystem: mm/mprotect Peter Collingbourne <pcc@google.com>: mm: improve mprotect(R|W) efficiency on pages referenced once Subsystem: mm/bootmem Souptick Joarder <jrdr.linux@gmail.com>: h8300: remove unused variable Subsystem: mm/dma YueHaibing <yuehaibing@huawei.com>: mm/dmapool: use DEVICE_ATTR_RO macro Subsystem: mm/tracing Vincent Whitchurch <vincent.whitchurch@axis.com>: mm, tracing: unify PFN format strings Subsystem: mm/vmalloc "Uladzislau Rezki (Sony)" <urezki@gmail.com>: Patch series "vmalloc() vs bulk allocator", v2: mm/page_alloc: add an alloc_pages_bulk_array_node() helper mm/vmalloc: switch to bulk allocator in __vmalloc_area_node() mm/vmalloc: print a warning message first on failure mm/vmalloc: remove quoted strings split across lines Uladzislau Rezki <urezki@gmail.com>: mm/vmalloc: fallback to a single page allocator Rafael Aquini <aquini@redhat.com>: mm: vmalloc: add cond_resched() in __vunmap() Subsystem: mm/kasan Alexander Potapenko <glider@google.com>: printk: introduce dump_stack_lvl() kasan: use dump_stack_lvl(KERN_ERR) to print stacks David Gow <davidgow@google.com>: kasan: test: improve failure message in KUNIT_EXPECT_KASAN_FAIL() Daniel Axtens <dja@axtens.net>: Patch series "KASAN core changes for ppc64 radix KASAN", v16: kasan: allow an architecture to disable inline instrumentation kasan: allow architectures to provide an outline readiness check mm: define default MAX_PTRS_PER_* in include/pgtable.h kasan: use MAX_PTRS_PER_* for early shadow tables Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: Patch series "kasan: add memory corruption identification support for hw tag-based kasan", v4: kasan: rename CONFIG_KASAN_SW_TAGS_IDENTIFY to CONFIG_KASAN_TAGS_IDENTIFY kasan: integrate the common part of two KASAN tag-based modes kasan: add memory corruption identification support for hardware tag-based mode Subsystem: mm/initialization Jungseung Lee <js07.lee@samsung.com>: mm: report which part of mem is being freed on initmem case Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: mm/mmzone.h: simplify is_highmem_idx() "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Constify struct page arguments": mm: make __dump_page static Aaron Tomlin <atomlin@redhat.com>: mm/page_alloc: bail out on fatal signal during reclaim/compaction retry attempt "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/debug: factor PagePoisoned out of __dump_page mm/page_owner: constify dump_page_owner mm: make compound_head const-preserving mm: constify get_pfnblock_flags_mask and get_pfnblock_migratetype mm: constify page_count and page_ref_count mm: optimise nth_page for contiguous memmap Heiner Kallweit <hkallweit1@gmail.com>: mm/page_alloc: switch to pr_debug Andrii Nakryiko <andrii@kernel.org>: kbuild: skip per-CPU BTF generation for pahole v1.18-v1.21 Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: split per cpu page lists and zone stats mm/page_alloc: convert per-cpu list protection to local_lock mm/vmstat: convert NUMA statistics to basic NUMA counters mm/vmstat: inline NUMA event counter updates mm/page_alloc: batch the accounting updates in the bulk allocator mm/page_alloc: reduce duration that IRQs are disabled for VM counters mm/page_alloc: explicitly acquire the zone lock in __free_pages_ok mm/page_alloc: avoid conflating IRQs disabled with zone->lock mm/page_alloc: update PGFREE outside the zone lock in __free_pages_ok Minchan Kim <minchan@kernel.org>: mm: page_alloc: dump migrate-failed pages only at -EBUSY Mel Gorman <mgorman@techsingularity.net>: Patch series "Calculate pcp->high based on zone sizes and active CPUs", v2: mm/page_alloc: delete vm.percpu_pagelist_fraction mm/page_alloc: disassociate the pcp->high from pcp->batch mm/page_alloc: adjust pcp->high after CPU hotplug events mm/page_alloc: scale the number of pages that are batch freed mm/page_alloc: limit the number of pages on PCP lists when reclaim is active mm/page_alloc: introduce vm.percpu_pagelist_high_fraction Dong Aisheng <aisheng.dong@nxp.com>: mm: drop SECTION_SHIFT in code comments mm/page_alloc: improve memmap_pages dbg msg Liu Shixin <liushixin2@huawei.com>: mm/page_alloc: fix counting of managed_pages Mel Gorman <mgorman@techsingularity.net>: Patch series "Allow high order pages to be stored on PCP", v2: mm/page_alloc: move free_the_page Mike Rapoport <rppt@linux.ibm.com>: Patch series "Remove DISCONTIGMEM memory model", v3: alpha: remove DISCONTIGMEM and NUMA arc: update comment about HIGHMEM implementation arc: remove support for DISCONTIGMEM m68k: remove support for DISCONTIGMEM mm: remove CONFIG_DISCONTIGMEM arch, mm: remove stale mentions of DISCONIGMEM docs: remove description of DISCONTIGMEM mm: replace CONFIG_NEED_MULTIPLE_NODES with CONFIG_NUMA mm: replace CONFIG_FLAT_NODE_MEM_MAP with CONFIG_FLATMEM Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: allow high-order pages to be stored on the per-cpu lists mm/page_alloc: split pcp->high across all online CPUs for cpuless nodes Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm,hwpoison: send SIGBUS with error virutal address mm,hwpoison: make get_hwpoison_page() call get_any_page() Documentation/admin-guide/kernel-parameters.txt | 6 Documentation/admin-guide/lockup-watchdogs.rst | 4 Documentation/admin-guide/sysctl/kernel.rst | 10 Documentation/admin-guide/sysctl/vm.rst | 52 - Documentation/dev-tools/kasan.rst | 9 Documentation/vm/memory-model.rst | 45 arch/alpha/Kconfig | 22 arch/alpha/include/asm/machvec.h | 6 arch/alpha/include/asm/mmzone.h | 100 -- arch/alpha/include/asm/pgtable.h | 4 arch/alpha/include/asm/topology.h | 39 arch/alpha/kernel/core_marvel.c | 53 - arch/alpha/kernel/core_wildfire.c | 29 arch/alpha/kernel/pci_iommu.c | 29 arch/alpha/kernel/proto.h | 8 arch/alpha/kernel/setup.c | 16 arch/alpha/kernel/sys_marvel.c | 5 arch/alpha/kernel/sys_wildfire.c | 5 arch/alpha/mm/Makefile | 2 arch/alpha/mm/init.c | 3 arch/alpha/mm/numa.c | 223 ---- arch/arc/Kconfig | 13 arch/arc/include/asm/mmzone.h | 40 arch/arc/kernel/troubleshoot.c | 8 arch/arc/mm/init.c | 21 arch/arm/include/asm/tlbflush.h | 13 arch/arm/mm/tlb-v6.S | 2 arch/arm/mm/tlb-v7.S | 2 arch/arm64/Kconfig | 2 arch/arm64/kvm/mmu.c | 2 arch/h8300/kernel/setup.c | 2 arch/ia64/Kconfig | 2 arch/ia64/include/asm/pal.h | 2 arch/ia64/include/asm/spinlock.h | 2 arch/ia64/include/asm/uv/uv_hub.h | 2 arch/ia64/kernel/efi_stub.S | 2 arch/ia64/kernel/mca_drv.c | 2 arch/ia64/kernel/topology.c | 5 arch/ia64/mm/numa.c | 5 arch/m68k/Kconfig.cpu | 10 arch/m68k/include/asm/mmzone.h | 10 arch/m68k/include/asm/page.h | 2 arch/m68k/include/asm/page_mm.h | 35 arch/m68k/include/asm/tlbflush.h | 2 arch/m68k/kernel/sys_m68k.c | 4 arch/m68k/mm/init.c | 20 arch/mips/Kconfig | 2 arch/mips/include/asm/mmzone.h | 8 arch/mips/include/asm/page.h | 2 arch/mips/kernel/traps.c | 4 arch/mips/mm/init.c | 7 arch/nds32/include/asm/memory.h | 6 arch/openrisc/include/asm/tlbflush.h | 2 arch/powerpc/Kconfig | 2 arch/powerpc/include/asm/mmzone.h | 4 arch/powerpc/kernel/setup_64.c | 2 arch/powerpc/kernel/smp.c | 2 arch/powerpc/kexec/core.c | 4 arch/powerpc/kvm/book3s_hv.c | 4 arch/powerpc/kvm/book3s_hv_uvmem.c | 2 arch/powerpc/mm/Makefile | 2 arch/powerpc/mm/mem.c | 4 arch/riscv/Kconfig | 2 arch/s390/Kconfig | 2 arch/s390/include/asm/pgtable.h | 2 arch/sh/include/asm/mmzone.h | 4 arch/sh/kernel/topology.c | 2 arch/sh/mm/Kconfig | 2 arch/sh/mm/init.c | 2 arch/sparc/Kconfig | 2 arch/sparc/include/asm/mmzone.h | 4 arch/sparc/kernel/smp_64.c | 2 arch/sparc/mm/init_64.c | 12 arch/x86/Kconfig | 2 arch/x86/ia32/ia32_aout.c | 4 arch/x86/kernel/cpu/mce/core.c | 13 arch/x86/kernel/cpu/sgx/encl.h | 4 arch/x86/kernel/setup_percpu.c | 6 arch/x86/mm/init_32.c | 4 arch/xtensa/include/asm/page.h | 4 arch/xtensa/include/asm/tlbflush.h | 4 drivers/base/node.c | 18 drivers/block/loop.c | 270 ++++- drivers/block/loop.h | 15 drivers/dax/device.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c | 4 drivers/gpu/drm/i915/gem/selftests/i915_gem_mman.c | 2 drivers/media/common/videobuf2/frame_vector.c | 2 drivers/misc/sgi-gru/grufault.c | 4 drivers/vfio/vfio_iommu_type1.c | 2 drivers/virtio/virtio_balloon.c | 17 fs/adfs/inode.c | 1 fs/affs/file.c | 2 fs/bfs/file.c | 1 fs/binfmt_aout.c | 4 fs/binfmt_elf.c | 2 fs/binfmt_elf_fdpic.c | 11 fs/binfmt_flat.c | 2 fs/block_dev.c | 1 fs/buffer.c | 25 fs/configfs/inode.c | 8 fs/dax.c | 3 fs/ecryptfs/mmap.c | 13 fs/exfat/inode.c | 1 fs/ext2/inode.c | 4 fs/ext4/inode.c | 2 fs/fat/inode.c | 1 fs/fs-writeback.c | 366 +++++--- fs/fuse/dax.c | 3 fs/gfs2/aops.c | 2 fs/gfs2/meta_io.c | 2 fs/hfs/inode.c | 2 fs/hfsplus/inode.c | 2 fs/hpfs/file.c | 1 fs/iomap/buffered-io.c | 27 fs/jfs/inode.c | 1 fs/kernfs/inode.c | 8 fs/libfs.c | 44 fs/minix/inode.c | 1 fs/nilfs2/mdt.c | 1 fs/ntfs/inode.c | 2 fs/ocfs2/aops.c | 4 fs/ocfs2/cluster/heartbeat.c | 7 fs/ocfs2/cluster/nodemanager.c | 2 fs/ocfs2/dlm/dlmmaster.c | 2 fs/ocfs2/filecheck.c | 6 fs/ocfs2/stackglue.c | 8 fs/omfs/file.c | 1 fs/proc/task_mmu.c | 2 fs/ramfs/inode.c | 9 fs/squashfs/block.c | 5 fs/squashfs/squashfs_fs_sb.h | 1 fs/squashfs/super.c | 86 + fs/sysv/itree.c | 1 fs/udf/file.c | 1 fs/udf/inode.c | 1 fs/ufs/inode.c | 1 fs/xfs/xfs_aops.c | 4 fs/zonefs/super.c | 4 include/asm-generic/memory_model.h | 37 include/asm-generic/pgtable-nop4d.h | 1 include/asm-generic/topology.h | 2 include/kunit/test.h | 5 include/linux/backing-dev-defs.h | 20 include/linux/cpuhotplug.h | 2 include/linux/fs.h | 6 include/linux/gfp.h | 13 include/linux/iomap.h | 1 include/linux/kasan.h | 7 include/linux/kernel.h | 2 include/linux/kthread.h | 2 include/linux/memblock.h | 6 include/linux/memcontrol.h | 60 - include/linux/mm.h | 53 - include/linux/mm_types.h | 10 include/linux/mman.h | 2 include/linux/mmdebug.h | 3 include/linux/mmzone.h | 96 +- include/linux/page-flags.h | 10 include/linux/page_owner.h | 6 include/linux/page_ref.h | 4 include/linux/page_reporting.h | 3 include/linux/pageblock-flags.h | 2 include/linux/pagemap.h | 4 include/linux/pgtable.h | 22 include/linux/printk.h | 5 include/linux/sched/coredump.h | 8 include/linux/slab.h | 59 + include/linux/swap.h | 19 include/linux/swapops.h | 5 include/linux/vmstat.h | 69 - include/linux/writeback.h | 1 include/trace/events/cma.h | 4 include/trace/events/filemap.h | 2 include/trace/events/kmem.h | 12 include/trace/events/page_pool.h | 4 include/trace/events/pagemap.h | 4 include/trace/events/vmscan.h | 2 kernel/cgroup/cgroup.c | 1 kernel/crash_core.c | 4 kernel/events/core.c | 2 kernel/events/uprobes.c | 4 kernel/fork.c | 1 kernel/kthread.c | 19 kernel/sysctl.c | 16 kernel/watchdog.c | 12 lib/Kconfig.debug | 15 lib/Kconfig.kasan | 16 lib/Makefile | 1 lib/dump_stack.c | 20 lib/kunit/test.c | 18 lib/slub_kunit.c | 152 +++ lib/test_hmm.c | 5 lib/test_kasan.c | 11 lib/vsprintf.c | 2 mm/Kconfig | 38 mm/backing-dev.c | 66 + mm/compaction.c | 2 mm/debug.c | 27 mm/debug_vm_pgtable.c | 63 + mm/dmapool.c | 5 mm/filemap.c | 2 mm/gup.c | 81 + mm/hugetlb.c | 2 mm/internal.h | 9 mm/kasan/Makefile | 4 mm/kasan/common.c | 6 mm/kasan/generic.c | 3 mm/kasan/hw_tags.c | 22 mm/kasan/init.c | 6 mm/kasan/kasan.h | 12 mm/kasan/report.c | 6 mm/kasan/report_hw_tags.c | 5 mm/kasan/report_sw_tags.c | 45 mm/kasan/report_tags.c | 51 + mm/kasan/shadow.c | 6 mm/kasan/sw_tags.c | 45 mm/kasan/tags.c | 59 + mm/kfence/kfence_test.c | 5 mm/kmemleak.c | 18 mm/ksm.c | 6 mm/memblock.c | 8 mm/memcontrol.c | 385 ++++++-- mm/memory-failure.c | 344 +++++-- mm/memory.c | 22 mm/memory_hotplug.c | 6 mm/mempolicy.c | 4 mm/migrate.c | 4 mm/mmap.c | 54 - mm/mmap_lock.c | 33 mm/mprotect.c | 52 + mm/mremap.c | 5 mm/nommu.c | 2 mm/page-writeback.c | 89 + mm/page_alloc.c | 950 +++++++++++++-------- mm/page_ext.c | 2 mm/page_owner.c | 2 mm/page_reporting.c | 19 mm/page_reporting.h | 5 mm/pagewalk.c | 58 + mm/shmem.c | 18 mm/slab.h | 24 mm/slab_common.c | 60 - mm/slub.c | 420 +++++---- mm/sparse.c | 2 mm/swap.c | 4 mm/swap_slots.c | 2 mm/swap_state.c | 20 mm/swapfile.c | 177 +-- mm/vmalloc.c | 181 ++-- mm/vmscan.c | 43 mm/vmstat.c | 282 ++---- mm/workingset.c | 2 net/ipv4/tcp.c | 4 scripts/kconfig/streamline_config.pl | 76 - scripts/link-vmlinux.sh | 4 scripts/spelling.txt | 16 tools/testing/selftests/vm/gup_test.c | 96 +- tools/vm/page_owner_sort.c | 4 virt/kvm/kvm_main.c | 2 260 files changed, 3989 insertions(+), 2996 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-06-25 1:38 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-06-25 1:38 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 24 patches, based on 4a09d388f2ab382f217a764e6a152b3f614246f6. Subsystems affected by this patch series: mm/thp nilfs2 mm/vmalloc kthread mm/hugetlb mm/memory-failure mm/pagealloc MAINTAINERS mailmap Subsystem: mm/thp Hugh Dickins <hughd@google.com>: Patch series "mm: page_vma_mapped_walk() cleanup and THP fixes": mm: page_vma_mapped_walk(): use page for pvmw->page mm: page_vma_mapped_walk(): settle PageHuge on entry mm: page_vma_mapped_walk(): use pmde for *pvmw->pmd mm: page_vma_mapped_walk(): prettify PVMW_MIGRATION block mm: page_vma_mapped_walk(): crossing page table boundary mm: page_vma_mapped_walk(): add a level of indentation mm: page_vma_mapped_walk(): use goto instead of while (1) mm: page_vma_mapped_walk(): get vma_address_end() earlier mm/thp: fix page_vma_mapped_walk() if THP mapped by ptes mm/thp: another PVMW_SYNC fix in page_vma_mapped_walk() Subsystem: nilfs2 Pavel Skripkin <paskripkin@gmail.com>: nilfs2: fix memory leak in nilfs_sysfs_delete_device_group Subsystem: mm/vmalloc Claudio Imbrenda <imbrenda@linux.ibm.com>: Patch series "mm: add vmalloc_no_huge and use it", v4: mm/vmalloc: add vmalloc_no_huge KVM: s390: prepare for hugepage vmalloc Daniel Axtens <dja@axtens.net>: mm/vmalloc: unbreak kasan vmalloc support Subsystem: kthread Petr Mladek <pmladek@suse.com>: Patch series "kthread_worker: Fix race between kthread_mod_delayed_work(): kthread_worker: split code for canceling the delayed work timer kthread: prevent deadlock when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync() Subsystem: mm/hugetlb Hugh Dickins <hughd@google.com>: mm, futex: fix shared futex pgoff on shmem huge page Subsystem: mm/memory-failure Tony Luck <tony.luck@intel.com>: Patch series "mm,hwpoison: fix sending SIGBUS for Action Required MCE", v5: mm/memory-failure: use a mutex to avoid memory_failure() races Aili Yao <yaoaili@kingsoft.com>: mm,hwpoison: return -EHWPOISON to denote that the page has already been poisoned Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/hwpoison: do not lock page again when me_huge_page() successfully recovers Subsystem: mm/pagealloc Rasmus Villemoes <linux@rasmusvillemoes.dk>: mm/page_alloc: __alloc_pages_bulk(): do bounds check before accessing array Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: do bulk array bounds check after checking populated elements Subsystem: MAINTAINERS Marek Behún <kabel@kernel.org>: MAINTAINERS: fix Marek's identity again Subsystem: mailmap Marek Behún <kabel@kernel.org>: mailmap: add Marek's other e-mail address and identity without diacritics .mailmap | 2 MAINTAINERS | 4 arch/s390/kvm/pv.c | 7 + fs/nilfs2/sysfs.c | 1 include/linux/hugetlb.h | 16 --- include/linux/pagemap.h | 13 +- include/linux/vmalloc.h | 1 kernel/futex.c | 3 kernel/kthread.c | 81 ++++++++++------ mm/hugetlb.c | 5 - mm/memory-failure.c | 83 +++++++++++------ mm/page_alloc.c | 6 + mm/page_vma_mapped.c | 233 +++++++++++++++++++++++++++--------------------- mm/vmalloc.c | 41 ++++++-- 14 files changed, 297 insertions(+), 199 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-06-16 1:22 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-06-16 1:22 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 18 patches, based on 94f0b2d4a1d0c52035aef425da5e022bd2cb1c71. Subsystems affected by this patch series: mm/memory-failure mm/swap mm/slub mm/hugetlb mm/memory-failure coredump mm/slub mm/thp mm/sparsemem Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm,hwpoison: fix race with hugetlb page allocation Subsystem: mm/swap Peter Xu <peterx@redhat.com>: mm/swap: fix pte_same_as_swp() not removing uffd-wp bit when compare Subsystem: mm/slub Kees Cook <keescook@chromium.org>: Patch series "Actually fix freelist pointer vs redzoning", v4: mm/slub: clarify verification reporting mm/slub: fix redzoning for small allocations mm/slub: actually fix freelist pointer vs redzoning Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: mm/hugetlb: expand restore_reserve_on_error functionality Subsystem: mm/memory-failure yangerkun <yangerkun@huawei.com>: mm/memory-failure: make sure wait for page writeback in memory_failure Subsystem: coredump Pingfan Liu <kernelfans@gmail.com>: crash_core, vmcoreinfo: append 'SECTION_SIZE_BITS' to vmcoreinfo Subsystem: mm/slub Andrew Morton <akpm@linux-foundation.org>: mm/slub.c: include swab.h Subsystem: mm/thp Xu Yu <xuyu@linux.alibaba.com>: mm, thp: use head page in __migration_entry_wait() Hugh Dickins <hughd@google.com>: Patch series "mm/thp: fix THP splitting unmap BUGs and related", v10: mm/thp: fix __split_huge_pmd_locked() on shmem migration entry mm/thp: make is_huge_zero_pmd() safe and quicker mm/thp: try_to_unmap() use TTU_SYNC for safe splitting mm/thp: fix vma_address() if virtual address below file offset Jue Wang <juew@google.com>: mm/thp: fix page_address_in_vma() on file THP tails Hugh Dickins <hughd@google.com>: mm/thp: unmap_mapping_page() to fix THP truncate_cleanup_page() Yang Shi <shy828301@gmail.com>: mm: thp: replace DEBUG_VM BUG with VM_WARN when unmap fails for split Subsystem: mm/sparsemem Miles Chen <miles.chen@mediatek.com>: mm/sparse: fix check_usemap_section_nr warnings Documentation/vm/slub.rst | 10 +-- fs/hugetlbfs/inode.c | 1 include/linux/huge_mm.h | 8 ++ include/linux/hugetlb.h | 8 ++ include/linux/mm.h | 3 + include/linux/rmap.h | 1 include/linux/swapops.h | 15 +++-- kernel/crash_core.c | 1 mm/huge_memory.c | 58 ++++++++++--------- mm/hugetlb.c | 137 +++++++++++++++++++++++++++++++++++++--------- mm/internal.h | 51 ++++++++++++----- mm/memory-failure.c | 36 +++++++++++- mm/memory.c | 41 +++++++++++++ mm/migrate.c | 1 mm/page_vma_mapped.c | 27 +++++---- mm/pgtable-generic.c | 5 - mm/rmap.c | 41 +++++++++---- mm/slab_common.c | 3 - mm/slub.c | 37 +++++------- mm/sparse.c | 13 +++- mm/swapfile.c | 2 mm/truncate.c | 43 ++++++-------- 22 files changed, 388 insertions(+), 154 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-06-05 3:00 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-06-05 3:00 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 13 patches, based on 16f0596fc1d78a1f3ae4628cff962bb297dc908c. Subsystems affected by this patch series: mips mm/kfence init mm/debug mm/pagealloc mm/memory-hotplug mm/hugetlb proc mm/kasan mm/hugetlb lib ocfs2 mailmap Subsystem: mips Thomas Bogendoerfer <tsbogend@alpha.franken.de>: Revert "MIPS: make userspace mapping young by default" Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: use TASK_IDLE when awaiting allocation Subsystem: init Mark Rutland <mark.rutland@arm.com>: pid: take a reference when initializing `cad_pid` Subsystem: mm/debug Gerald Schaefer <gerald.schaefer@linux.ibm.com>: mm/debug_vm_pgtable: fix alignment for pmd/pud_advanced_tests() Subsystem: mm/pagealloc Ding Hui <dinghui@sangfor.com.cn>: mm/page_alloc: fix counting of free pages after take off from buddy Subsystem: mm/memory-hotplug David Hildenbrand <david@redhat.com>: drivers/base/memory: fix trying offlining memory blocks with memory holes on aarch64 Subsystem: mm/hugetlb Naoya Horiguchi <naoya.horiguchi@nec.com>: hugetlb: pass head page to remove_hugetlb_page() Subsystem: proc David Matlack <dmatlack@google.com>: proc: add .gitignore for proc-subset-pid selftest Subsystem: mm/kasan Yu Kuai <yukuai3@huawei.com>: mm/kasan/init.c: fix doc warning Subsystem: mm/hugetlb Mina Almasry <almasrymina@google.com>: mm, hugetlb: fix simple resv_huge_pages underflow on UFFDIO_COPY Subsystem: lib YueHaibing <yuehaibing@huawei.com>: lib: crc64: fix kernel-doc warning Subsystem: ocfs2 Junxiao Bi <junxiao.bi@oracle.com>: ocfs2: fix data corruption by fallocate Subsystem: mailmap Michel Lespinasse <michel@lespinasse.org>: mailmap: use private address for Michel Lespinasse .mailmap | 3 + arch/mips/mm/cache.c | 30 ++++++++--------- drivers/base/memory.c | 6 +-- fs/ocfs2/file.c | 55 +++++++++++++++++++++++++++++--- include/linux/pgtable.h | 8 ++++ init/main.c | 2 - lib/crc64.c | 2 - mm/debug_vm_pgtable.c | 4 +- mm/hugetlb.c | 16 +++++++-- mm/kasan/init.c | 4 +- mm/kfence/core.c | 6 +-- mm/memory.c | 4 ++ mm/page_alloc.c | 2 + tools/testing/selftests/proc/.gitignore | 1 14 files changed, 107 insertions(+), 36 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-05-23 0:41 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-05-23 0:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 10 patches, based on 4ff2473bdb4cf2bb7d208ccf4418d3d7e6b1652c. Subsystems affected by this patch series: mm/pagealloc mm/gup ipc selftests mm/kasan kernel/watchdog bitmap procfs lib mm/userfaultfd Subsystem: mm/pagealloc Arnd Bergmann <arnd@arndb.de>: mm/shuffle: fix section mismatch warning Subsystem: mm/gup Michal Hocko <mhocko@suse.com>: Revert "mm/gup: check page posion status for coredump." Subsystem: ipc Varad Gautam <varad.gautam@suse.com>: ipc/mqueue, msg, sem: avoid relying on a stack reference past its expiry Subsystem: selftests Yang Yingliang <yangyingliang@huawei.com>: tools/testing/selftests/exec: fix link error Subsystem: mm/kasan Alexander Potapenko <glider@google.com>: kasan: slab: always reset the tag in get_freepointer_safe() Subsystem: kernel/watchdog Petr Mladek <pmladek@suse.com>: watchdog: reliable handling of timestamps Subsystem: bitmap Rikard Falkeborn <rikard.falkeborn@gmail.com>: linux/bits.h: fix compilation error with GENMASK Subsystem: procfs Alexey Dobriyan <adobriyan@gmail.com>: proc: remove Alexey from MAINTAINERS Subsystem: lib Zhen Lei <thunder.leizhen@huawei.com>: lib: kunit: suppress a compilation warning of frame size Subsystem: mm/userfaultfd Mike Kravetz <mike.kravetz@oracle.com>: userfaultfd: hugetlbfs: fix new flag usage in error path MAINTAINERS | 1 - fs/hugetlbfs/inode.c | 2 +- include/linux/bits.h | 2 +- include/linux/const.h | 8 ++++++++ include/linux/minmax.h | 10 ++-------- ipc/mqueue.c | 6 ++++-- ipc/msg.c | 6 ++++-- ipc/sem.c | 6 ++++-- kernel/watchdog.c | 34 ++++++++++++++++++++-------------- lib/Makefile | 1 + mm/gup.c | 4 ---- mm/internal.h | 20 -------------------- mm/shuffle.h | 4 ++-- mm/slub.c | 1 + mm/userfaultfd.c | 28 ++++++++++++++-------------- tools/include/linux/bits.h | 2 +- tools/include/linux/const.h | 8 ++++++++ tools/testing/selftests/exec/Makefile | 6 +++--- 18 files changed, 74 insertions(+), 75 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-05-15 0:26 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-05-15 0:26 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 13 patches, based on bd3c9cdb21a2674dd0db70199df884828e37abd4. Subsystems affected by this patch series: mm/hugetlb mm/slub resource squashfs mm/userfaultfd mm/ksm mm/pagealloc mm/kasan mm/pagemap hfsplus modprobe mm/ioremap Subsystem: mm/hugetlb Peter Xu <peterx@redhat.com>: Patch series "mm/hugetlb: Fix issues on file sealing and fork", v2: mm/hugetlb: fix F_SEAL_FUTURE_WRITE mm/hugetlb: fix cow where page writtable in child Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: mm, slub: move slub_debug static key enabling outside slab_mutex Subsystem: resource Alistair Popple <apopple@nvidia.com>: kernel/resource: fix return code check in __request_free_mem_region Subsystem: squashfs Phillip Lougher <phillip@squashfs.org.uk>: squashfs: fix divide error in calculate_skip() Subsystem: mm/userfaultfd Axel Rasmussen <axelrasmussen@google.com>: userfaultfd: release page in error path to avoid BUG_ON Subsystem: mm/ksm Hugh Dickins <hughd@google.com>: ksm: revert "use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()" Subsystem: mm/pagealloc "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: fix struct page layout on 32-bit systems Subsystem: mm/kasan Peter Collingbourne <pcc@google.com>: kasan: fix unit tests with CONFIG_UBSAN_LOCAL_BOUNDS enabled Subsystem: mm/pagemap "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap: fix readahead return types Subsystem: hfsplus Jouni Roivas <jouni.roivas@tuxera.com>: hfsplus: prevent corruption in shrinking truncate Subsystem: modprobe Rasmus Villemoes <linux@rasmusvillemoes.dk>: docs: admin-guide: update description for kernel.modprobe sysctl Subsystem: mm/ioremap Christophe Leroy <christophe.leroy@csgroup.eu>: mm/ioremap: fix iomap_max_page_shift Documentation/admin-guide/sysctl/kernel.rst | 9 ++++--- fs/hfsplus/extents.c | 7 +++-- fs/hugetlbfs/inode.c | 5 ++++ fs/iomap/buffered-io.c | 4 +-- fs/squashfs/file.c | 6 ++-- include/linux/mm.h | 32 ++++++++++++++++++++++++++ include/linux/mm_types.h | 4 +-- include/linux/pagemap.h | 6 ++-- include/net/page_pool.h | 12 +++++++++ kernel/resource.c | 2 - lib/test_kasan.c | 29 ++++++++++++++++++----- mm/hugetlb.c | 1 mm/ioremap.c | 6 ++-- mm/ksm.c | 3 +- mm/shmem.c | 34 ++++++++++++---------------- mm/slab_common.c | 10 ++++++++ mm/slub.c | 9 ------- net/core/page_pool.c | 12 +++++---- 18 files changed, 129 insertions(+), 62 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-05-07 1:01 Andrew Morton 2021-05-07 7:12 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2021-05-07 1:01 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm This is everything else from -mm for this merge window, with the possible exception of Mike Rapoport's "secretmem" syscall patch series (https://lkml.kernel.org/r/20210303162209.8609-1-rppt@kernel.org). I've been wobbly about the secretmem patches due to doubts about whether the feature is sufficiently useful to justify inclusion, but developers are now weighing in with helpful information and I've asked Mike for an extensively updated [0/n] changelog. This will take a few days to play out so it is possible that I will prevail upon you for a post-rc1 merge. If that's a problem, there's always 5.13-rc1. 91 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus previously sent patches. Thanks. Subsystems affected by this patch series: alpha procfs sysctl misc core-kernel bitmap lib compat checkpatch epoll isofs nilfs2 hpfs exit fork kexec gcov panic delayacct gdb resource selftests async initramfs ipc mm/cleanups drivers/char mm/slub spelling Subsystem: alpha Randy Dunlap <rdunlap@infradead.org>: alpha: eliminate old-style function definitions alpha: csum_partial_copy.c: add function prototypes from <net/checksum.h> Subsystem: procfs Colin Ian King <colin.king@canonical.com>: fs/proc/generic.c: fix incorrect pde_is_permanent check Alexey Dobriyan <adobriyan@gmail.com>: proc: save LOC in __xlate_proc_name() proc: mandate ->proc_lseek in "struct proc_ops" proc: delete redundant subset=pid check selftests: proc: test subset=pid Subsystem: sysctl zhouchuangao <zhouchuangao@vivo.com>: proc/sysctl: fix function name error in comments Subsystem: misc "Matthew Wilcox (Oracle)" <willy@infradead.org>: include: remove pagemap.h from blkdev.h Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: drop inclusion in bitmap.h Wan Jiabing <wanjiabing@vivo.com>: linux/profile.h: remove unnecessary declaration Subsystem: core-kernel Rasmus Villemoes <linux@rasmusvillemoes.dk>: kernel/async.c: fix pr_debug statement kernel/cred.c: make init_groups static Subsystem: bitmap Yury Norov <yury.norov@gmail.com>: Patch series "lib/find_bit: fast path for small bitmaps", v6: tools: disable -Wno-type-limits tools: bitmap: sync function declarations with the kernel tools: sync BITMAP_LAST_WORD_MASK() macro with the kernel arch: rearrange headers inclusion order in asm/bitops for m68k, sh and h8300 lib: extend the scope of small_const_nbits() macro tools: sync small_const_nbits() macro with the kernel lib: inline _find_next_bit() wrappers tools: sync find_next_bit implementation lib: add fast path for find_next_*_bit() lib: add fast path for find_first_*_bit() and find_last_bit() tools: sync lib/find_bit implementation MAINTAINERS: add entry for the bitmap API Subsystem: lib Bhaskar Chowdhury <unixbhaskar@gmail.com>: lib/bch.c: fix a typo in the file bch.c Wang Qing <wangqing@vivo.com>: lib: fix inconsistent indenting in process_bit1() ToastC <mrtoastcheng@gmail.com>: lib/list_sort.c: fix typo in function description Bhaskar Chowdhury <unixbhaskar@gmail.com>: lib/genalloc.c: Fix a typo Richard Fitzgerald <rf@opensource.cirrus.com>: lib: crc8: pointer to data block should be const Zqiang <qiang.zhang@windriver.com>: lib: stackdepot: turn depot_lock spinlock to raw_spinlock Alex Shi <alexs@kernel.org>: lib/percpu_counter: tame kernel-doc compile warning lib/genalloc: add parameter description to fix doc compile warning Randy Dunlap <rdunlap@infradead.org>: lib: parser: clean up kernel-doc Subsystem: compat Masahiro Yamada <masahiroy@kernel.org>: include/linux/compat.h: remove unneeded declaration from COMPAT_SYSCALL_DEFINEx() Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: warn when missing newline in return sysfs_emit() formats Vincent Mailhol <mailhol.vincent@wanadoo.fr>: checkpatch: exclude four preprocessor sub-expressions from MACRO_ARG_REUSE Christophe JAILLET <christophe.jaillet@wanadoo.fr>: checkpatch: improve ALLOC_ARRAY_ARGS test Subsystem: epoll Davidlohr Bueso <dave@stgolabs.net>: Patch series "fs/epoll: restore user-visible behavior upon event ready": kselftest: introduce new epoll test case fs/epoll: restore waking from ep_done_scan() Subsystem: isofs "Gustavo A. R. Silva" <gustavoars@kernel.org>: isofs: fix fall-through warnings for Clang Subsystem: nilfs2 Liu xuzhi <liu.xuzhi@zte.com.cn>: fs/nilfs2: fix misspellings using codespell tool Lu Jialin <lujialin4@huawei.com>: nilfs2: fix typos in comments Subsystem: hpfs "Gustavo A. R. Silva" <gustavoars@kernel.org>: hpfs: replace one-element array with flexible-array member Subsystem: exit Jim Newsome <jnewsome@torproject.org>: do_wait: make PIDTYPE_PID case O(1) instead of O(n) Subsystem: fork Rolf Eike Beer <eb@emlix.com>: kernel/fork.c: simplify copy_mm() Xiaofeng Cao <cxfcosmos@gmail.com>: kernel/fork.c: fix typos Subsystem: kexec Saeed Mirzamohammadi <saeed.mirzamohammadi@oracle.com>: kernel/crash_core: add crashkernel=auto for vmcore creation Joe LeVeque <jolevequ@microsoft.com>: kexec: Add kexec reboot string Jia-Ju Bai <baijiaju1990@gmail.com>: kernel: kexec_file: fix error return code of kexec_calculate_store_digests() Pavel Tatashin <pasha.tatashin@soleen.com>: kexec: dump kmessage before machine_kexec Subsystem: gcov Johannes Berg <johannes.berg@intel.com>: gcov: combine common code gcov: simplify buffer allocation gcov: use kvmalloc() Nick Desaulniers <ndesaulniers@google.com>: gcov: clang: drop support for clang-10 and older Subsystem: panic He Ying <heying24@huawei.com>: smp: kernel/panic.c - silence warnings Subsystem: delayacct Yafang Shao <laoar.shao@gmail.com>: delayacct: clear right task's flag after blkio completes Subsystem: gdb Johannes Berg <johannes.berg@intel.com>: gdb: lx-symbols: store the abspath() Barry Song <song.bao.hua@hisilicon.com>: Patch series "scripts/gdb: clarify the platforms supporting lx_current and add arm64 support", v2: scripts/gdb: document lx_current is only supported by x86 scripts/gdb: add lx_current support for arm64 Subsystem: resource David Hildenbrand <david@redhat.com>: Patch series "kernel/resource: make walk_system_ram_res() and walk_mem_res() search the whole tree", v2: kernel/resource: make walk_system_ram_res() find all busy IORESOURCE_SYSTEM_RAM resources kernel/resource: make walk_mem_res() find all busy IORESOURCE_MEM resources kernel/resource: remove first_lvl / siblings_only logic Alistair Popple <apopple@nvidia.com>: kernel/resource: allow region_intersects users to hold resource_lock kernel/resource: refactor __request_region to allow external locking kernel/resource: fix locking in request_free_mem_region Subsystem: selftests Zhang Yunkai <zhang.yunkai@zte.com.cn>: selftests: remove duplicate include Subsystem: async Rasmus Villemoes <linux@rasmusvillemoes.dk>: kernel/async.c: stop guarding pr_debug() statements kernel/async.c: remove async_unregister_domain() Subsystem: initramfs Rasmus Villemoes <linux@rasmusvillemoes.dk>: Patch series "background initramfs unpacking, and CONFIG_MODPROBE_PATH", v3: init/initramfs.c: do unpacking asynchronously modules: add CONFIG_MODPROBE_PATH Subsystem: ipc Bhaskar Chowdhury <unixbhaskar@gmail.com>: ipc/sem.c: mundane typo fixes Subsystem: mm/cleanups Shijie Luo <luoshijie1@huawei.com>: mm: fix some typos and code style problems Subsystem: drivers/char David Hildenbrand <david@redhat.com>: Patch series "drivers/char: remove /dev/kmem for good": drivers/char: remove /dev/kmem for good mm: remove xlate_dev_kmem_ptr() mm/vmalloc: remove vwrite() Subsystem: mm/slub Maninder Singh <maninder1.s@samsung.com>: arm: print alloc free paths for address in registers Subsystem: spelling Drew Fustini <drew@beagleboard.org>: scripts/spelling.txt: add "overlfow" zuoqilin <zuoqilin@yulong.com>: scripts/spelling.txt: Add "diabled" typo Drew Fustini <drew@beagleboard.org>: scripts/spelling.txt: add "overflw" Colin Ian King <colin.king@canonical.com>: mm/slab.c: fix spelling mistake "disired" -> "desired" Bhaskar Chowdhury <unixbhaskar@gmail.com>: include/linux/pgtable.h: few spelling fixes zhouchuangao <zhouchuangao@vivo.com>: kernel/umh.c: fix some spelling mistakes Xiaofeng Cao <cxfcosmos@gmail.com>: kernel/user_namespace.c: fix typos Bhaskar Chowdhury <unixbhaskar@gmail.com>: kernel/up.c: fix typo Xiaofeng Cao <caoxiaofeng@yulong.com>: kernel/sys.c: fix typo dingsenjie <dingsenjie@yulong.com>: fs: fat: fix spelling typo of values Bhaskar Chowdhury <unixbhaskar@gmail.com>: ipc/sem.c: spelling fix Masahiro Yamada <masahiroy@kernel.org>: treewide: remove editor modelines and cruft Ingo Molnar <mingo@kernel.org>: mm: fix typos in comments Lu Jialin <lujialin4@huawei.com>: mm: fix typos in comments Documentation/admin-guide/devices.txt | 2 Documentation/admin-guide/kdump/kdump.rst | 3 Documentation/admin-guide/kernel-parameters.txt | 18 Documentation/dev-tools/gdb-kernel-debugging.rst | 4 MAINTAINERS | 16 arch/Kconfig | 20 arch/alpha/include/asm/io.h | 5 arch/alpha/kernel/pc873xx.c | 4 arch/alpha/lib/csum_partial_copy.c | 1 arch/arm/configs/dove_defconfig | 1 arch/arm/configs/magician_defconfig | 1 arch/arm/configs/moxart_defconfig | 1 arch/arm/configs/mps2_defconfig | 1 arch/arm/configs/mvebu_v5_defconfig | 1 arch/arm/configs/xcep_defconfig | 1 arch/arm/include/asm/bug.h | 1 arch/arm/include/asm/io.h | 5 arch/arm/kernel/process.c | 11 arch/arm/kernel/traps.c | 1 arch/h8300/include/asm/bitops.h | 8 arch/hexagon/configs/comet_defconfig | 1 arch/hexagon/include/asm/io.h | 1 arch/ia64/include/asm/io.h | 1 arch/ia64/include/asm/uaccess.h | 18 arch/m68k/atari/time.c | 7 arch/m68k/configs/amcore_defconfig | 1 arch/m68k/include/asm/bitops.h | 6 arch/m68k/include/asm/io_mm.h | 5 arch/mips/include/asm/io.h | 5 arch/openrisc/configs/or1ksim_defconfig | 1 arch/parisc/include/asm/io.h | 5 arch/parisc/include/asm/pdc_chassis.h | 1 arch/powerpc/include/asm/io.h | 5 arch/s390/include/asm/io.h | 5 arch/sh/configs/edosk7705_defconfig | 1 arch/sh/configs/se7206_defconfig | 1 arch/sh/configs/sh2007_defconfig | 1 arch/sh/configs/sh7724_generic_defconfig | 1 arch/sh/configs/sh7770_generic_defconfig | 1 arch/sh/configs/sh7785lcr_32bit_defconfig | 1 arch/sh/include/asm/bitops.h | 5 arch/sh/include/asm/io.h | 5 arch/sparc/configs/sparc64_defconfig | 1 arch/sparc/include/asm/io_64.h | 5 arch/um/drivers/cow.h | 7 arch/xtensa/configs/xip_kc705_defconfig | 1 block/blk-settings.c | 1 drivers/auxdisplay/panel.c | 7 drivers/base/firmware_loader/main.c | 2 drivers/block/brd.c | 1 drivers/block/loop.c | 1 drivers/char/Kconfig | 10 drivers/char/mem.c | 231 -------- drivers/gpu/drm/qxl/qxl_drv.c | 1 drivers/isdn/capi/kcapi_proc.c | 1 drivers/md/bcache/super.c | 1 drivers/media/usb/pwc/pwc-uncompress.c | 3 drivers/net/ethernet/adaptec/starfire.c | 8 drivers/net/ethernet/amd/atarilance.c | 8 drivers/net/ethernet/amd/pcnet32.c | 7 drivers/net/wireless/intersil/hostap/hostap_proc.c | 1 drivers/net/wireless/intersil/orinoco/orinoco_nortel.c | 8 drivers/net/wireless/intersil/orinoco/orinoco_pci.c | 8 drivers/net/wireless/intersil/orinoco/orinoco_plx.c | 8 drivers/net/wireless/intersil/orinoco/orinoco_tmd.c | 8 drivers/nvdimm/btt.c | 1 drivers/nvdimm/pmem.c | 1 drivers/parport/parport_ip32.c | 12 drivers/platform/x86/dell/dell_rbu.c | 3 drivers/scsi/53c700.c | 1 drivers/scsi/53c700.h | 1 drivers/scsi/ch.c | 6 drivers/scsi/esas2r/esas2r_main.c | 1 drivers/scsi/ips.c | 20 drivers/scsi/ips.h | 20 drivers/scsi/lasi700.c | 1 drivers/scsi/megaraid/mbox_defs.h | 2 drivers/scsi/megaraid/mega_common.h | 2 drivers/scsi/megaraid/megaraid_mbox.c | 2 drivers/scsi/megaraid/megaraid_mbox.h | 2 drivers/scsi/qla1280.c | 12 drivers/scsi/scsicam.c | 1 drivers/scsi/sni_53c710.c | 1 drivers/video/fbdev/matrox/matroxfb_base.c | 9 drivers/video/fbdev/vga16fb.c | 10 fs/configfs/configfs_internal.h | 4 fs/configfs/dir.c | 4 fs/configfs/file.c | 4 fs/configfs/inode.c | 4 fs/configfs/item.c | 4 fs/configfs/mount.c | 4 fs/configfs/symlink.c | 4 fs/eventpoll.c | 6 fs/fat/fatent.c | 2 fs/hpfs/hpfs.h | 3 fs/isofs/rock.c | 1 fs/nfs/dir.c | 7 fs/nfs/nfs4proc.c | 6 fs/nfs/nfs4renewd.c | 6 fs/nfs/nfs4state.c | 6 fs/nfs/nfs4xdr.c | 6 fs/nfsd/nfs4proc.c | 6 fs/nfsd/nfs4xdr.c | 6 fs/nfsd/xdr4.h | 6 fs/nilfs2/cpfile.c | 2 fs/nilfs2/ioctl.c | 4 fs/nilfs2/segment.c | 4 fs/nilfs2/the_nilfs.c | 2 fs/ocfs2/acl.c | 4 fs/ocfs2/acl.h | 4 fs/ocfs2/alloc.c | 4 fs/ocfs2/alloc.h | 4 fs/ocfs2/aops.c | 4 fs/ocfs2/aops.h | 4 fs/ocfs2/blockcheck.c | 4 fs/ocfs2/blockcheck.h | 4 fs/ocfs2/buffer_head_io.c | 4 fs/ocfs2/buffer_head_io.h | 4 fs/ocfs2/cluster/heartbeat.c | 4 fs/ocfs2/cluster/heartbeat.h | 4 fs/ocfs2/cluster/masklog.c | 4 fs/ocfs2/cluster/masklog.h | 4 fs/ocfs2/cluster/netdebug.c | 4 fs/ocfs2/cluster/nodemanager.c | 4 fs/ocfs2/cluster/nodemanager.h | 4 fs/ocfs2/cluster/ocfs2_heartbeat.h | 4 fs/ocfs2/cluster/ocfs2_nodemanager.h | 4 fs/ocfs2/cluster/quorum.c | 4 fs/ocfs2/cluster/quorum.h | 4 fs/ocfs2/cluster/sys.c | 4 fs/ocfs2/cluster/sys.h | 4 fs/ocfs2/cluster/tcp.c | 4 fs/ocfs2/cluster/tcp.h | 4 fs/ocfs2/cluster/tcp_internal.h | 4 fs/ocfs2/dcache.c | 4 fs/ocfs2/dcache.h | 4 fs/ocfs2/dir.c | 4 fs/ocfs2/dir.h | 4 fs/ocfs2/dlm/dlmapi.h | 4 fs/ocfs2/dlm/dlmast.c | 4 fs/ocfs2/dlm/dlmcommon.h | 4 fs/ocfs2/dlm/dlmconvert.c | 4 fs/ocfs2/dlm/dlmconvert.h | 4 fs/ocfs2/dlm/dlmdebug.c | 4 fs/ocfs2/dlm/dlmdebug.h | 4 fs/ocfs2/dlm/dlmdomain.c | 4 fs/ocfs2/dlm/dlmdomain.h | 4 fs/ocfs2/dlm/dlmlock.c | 4 fs/ocfs2/dlm/dlmmaster.c | 4 fs/ocfs2/dlm/dlmrecovery.c | 4 fs/ocfs2/dlm/dlmthread.c | 4 fs/ocfs2/dlm/dlmunlock.c | 4 fs/ocfs2/dlmfs/dlmfs.c | 4 fs/ocfs2/dlmfs/userdlm.c | 4 fs/ocfs2/dlmfs/userdlm.h | 4 fs/ocfs2/dlmglue.c | 4 fs/ocfs2/dlmglue.h | 4 fs/ocfs2/export.c | 4 fs/ocfs2/export.h | 4 fs/ocfs2/extent_map.c | 4 fs/ocfs2/extent_map.h | 4 fs/ocfs2/file.c | 4 fs/ocfs2/file.h | 4 fs/ocfs2/filecheck.c | 4 fs/ocfs2/filecheck.h | 4 fs/ocfs2/heartbeat.c | 4 fs/ocfs2/heartbeat.h | 4 fs/ocfs2/inode.c | 4 fs/ocfs2/inode.h | 4 fs/ocfs2/journal.c | 4 fs/ocfs2/journal.h | 4 fs/ocfs2/localalloc.c | 4 fs/ocfs2/localalloc.h | 4 fs/ocfs2/locks.c | 4 fs/ocfs2/locks.h | 4 fs/ocfs2/mmap.c | 4 fs/ocfs2/move_extents.c | 4 fs/ocfs2/move_extents.h | 4 fs/ocfs2/namei.c | 4 fs/ocfs2/namei.h | 4 fs/ocfs2/ocfs1_fs_compat.h | 4 fs/ocfs2/ocfs2.h | 4 fs/ocfs2/ocfs2_fs.h | 4 fs/ocfs2/ocfs2_ioctl.h | 4 fs/ocfs2/ocfs2_lockid.h | 4 fs/ocfs2/ocfs2_lockingver.h | 4 fs/ocfs2/refcounttree.c | 4 fs/ocfs2/refcounttree.h | 4 fs/ocfs2/reservations.c | 4 fs/ocfs2/reservations.h | 4 fs/ocfs2/resize.c | 4 fs/ocfs2/resize.h | 4 fs/ocfs2/slot_map.c | 4 fs/ocfs2/slot_map.h | 4 fs/ocfs2/stack_o2cb.c | 4 fs/ocfs2/stack_user.c | 4 fs/ocfs2/stackglue.c | 4 fs/ocfs2/stackglue.h | 4 fs/ocfs2/suballoc.c | 4 fs/ocfs2/suballoc.h | 4 fs/ocfs2/super.c | 4 fs/ocfs2/super.h | 4 fs/ocfs2/symlink.c | 4 fs/ocfs2/symlink.h | 4 fs/ocfs2/sysfile.c | 4 fs/ocfs2/sysfile.h | 4 fs/ocfs2/uptodate.c | 4 fs/ocfs2/uptodate.h | 4 fs/ocfs2/xattr.c | 4 fs/ocfs2/xattr.h | 4 fs/proc/generic.c | 13 fs/proc/inode.c | 18 fs/proc/proc_sysctl.c | 2 fs/reiserfs/procfs.c | 10 include/asm-generic/bitops/find.h | 108 +++ include/asm-generic/bitops/le.h | 38 + include/asm-generic/bitsperlong.h | 12 include/asm-generic/io.h | 11 include/linux/align.h | 15 include/linux/async.h | 1 include/linux/bitmap.h | 11 include/linux/bitops.h | 12 include/linux/blkdev.h | 1 include/linux/compat.h | 1 include/linux/configfs.h | 4 include/linux/crc8.h | 2 include/linux/cred.h | 1 include/linux/delayacct.h | 20 include/linux/fs.h | 2 include/linux/genl_magic_func.h | 1 include/linux/genl_magic_struct.h | 1 include/linux/gfp.h | 2 include/linux/init_task.h | 1 include/linux/initrd.h | 2 include/linux/kernel.h | 9 include/linux/mm.h | 2 include/linux/mmzone.h | 2 include/linux/pgtable.h | 10 include/linux/proc_fs.h | 1 include/linux/profile.h | 3 include/linux/smp.h | 8 include/linux/swap.h | 1 include/linux/vmalloc.h | 7 include/uapi/linux/if_bonding.h | 11 include/uapi/linux/nfs4.h | 6 include/xen/interface/elfnote.h | 10 include/xen/interface/hvm/hvm_vcpu.h | 10 include/xen/interface/io/xenbus.h | 10 init/Kconfig | 12 init/initramfs.c | 38 + init/main.c | 1 ipc/sem.c | 12 kernel/async.c | 68 -- kernel/configs/android-base.config | 1 kernel/crash_core.c | 7 kernel/cred.c | 2 kernel/exit.c | 67 ++ kernel/fork.c | 23 kernel/gcov/Kconfig | 1 kernel/gcov/base.c | 49 + kernel/gcov/clang.c | 282 ---------- kernel/gcov/fs.c | 146 ++++- kernel/gcov/gcc_4_7.c | 173 ------ kernel/gcov/gcov.h | 14 kernel/kexec_core.c | 4 kernel/kexec_file.c | 4 kernel/kmod.c | 2 kernel/resource.c | 198 ++++--- kernel/sys.c | 14 kernel/umh.c | 8 kernel/up.c | 2 kernel/user_namespace.c | 6 lib/bch.c | 2 lib/crc8.c | 2 lib/decompress_unlzma.c | 2 lib/find_bit.c | 68 -- lib/genalloc.c | 7 lib/list_sort.c | 2 lib/parser.c | 61 +- lib/percpu_counter.c | 2 lib/stackdepot.c | 6 mm/balloon_compaction.c | 4 mm/compaction.c | 4 mm/filemap.c | 2 mm/gup.c | 2 mm/highmem.c | 2 mm/huge_memory.c | 6 mm/hugetlb.c | 6 mm/internal.h | 2 mm/kasan/kasan.h | 8 mm/kasan/quarantine.c | 4 mm/kasan/shadow.c | 4 mm/kfence/report.c | 2 mm/khugepaged.c | 2 mm/ksm.c | 6 mm/madvise.c | 4 mm/memcontrol.c | 18 mm/memory-failure.c | 2 mm/memory.c | 18 mm/mempolicy.c | 6 mm/migrate.c | 8 mm/mmap.c | 4 mm/mprotect.c | 2 mm/mremap.c | 2 mm/nommu.c | 10 mm/oom_kill.c | 2 mm/page-writeback.c | 4 mm/page_alloc.c | 16 mm/page_owner.c | 2 mm/page_vma_mapped.c | 2 mm/percpu-internal.h | 2 mm/percpu.c | 2 mm/pgalloc-track.h | 6 mm/rmap.c | 2 mm/slab.c | 8 mm/slub.c | 2 mm/swap.c | 4 mm/swap_slots.c | 2 mm/swap_state.c | 2 mm/vmalloc.c | 124 ---- mm/vmstat.c | 2 mm/z3fold.c | 2 mm/zpool.c | 2 mm/zsmalloc.c | 6 samples/configfs/configfs_sample.c | 2 scripts/checkpatch.pl | 15 scripts/gdb/linux/cpus.py | 23 scripts/gdb/linux/symbols.py | 3 scripts/spelling.txt | 3 tools/include/asm-generic/bitops/find.h | 85 ++- tools/include/asm-generic/bitsperlong.h | 3 tools/include/linux/bitmap.h | 18 tools/lib/bitmap.c | 4 tools/lib/find_bit.c | 56 - tools/scripts/Makefile.include | 1 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 44 + tools/testing/selftests/kvm/lib/sparsebit.c | 1 tools/testing/selftests/mincore/mincore_selftest.c | 1 tools/testing/selftests/powerpc/mm/tlbie_test.c | 1 tools/testing/selftests/proc/Makefile | 1 tools/testing/selftests/proc/proc-subset-pid.c | 121 ++++ tools/testing/selftests/proc/read.c | 4 tools/usb/hcd-tests.sh | 2 343 files changed, 1383 insertions(+), 2119 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-05-07 1:01 incoming Andrew Morton @ 2021-05-07 7:12 ` Linus Torvalds 0 siblings, 0 replies; 322+ messages in thread From: Linus Torvalds @ 2021-05-07 7:12 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Thu, May 6, 2021 at 6:01 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > I've been wobbly about the secretmem patches due to doubts about > whether the feature is sufficiently useful to justify inclusion, but > developers are now weighing in with helpful information and I've asked Mike > for an extensively updated [0/n] changelog. This will take a few days > to play out so it is possible that I will prevail upon you for a post-rc1 > merge. Oh, much too late for this release by now. > If that's a problem, there's always 5.13-rc1. 5.13-rc1 is two days from now, it would be for 5.14-rc1.. How time - and version numbers - fly. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-05-05 1:32 Andrew Morton 2021-05-05 1:47 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits The remainder of the main mm/ queue. 143 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus previously sent patches. Subsystems affected by this patch series: mm/pagecache mm/hugetlb mm/userfaultfd mm/vmscan mm/compaction mm/migration mm/cma mm/ksm mm/vmstat mm/mmap mm/kconfig mm/util mm/memory-hotplug mm/zswap mm/zsmalloc mm/highmem mm/cleanups mm/kfence Subsystem: mm/pagecache "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Remove nrexceptional tracking", v2: mm: introduce and use mapping_empty() mm: stop accounting shadow entries dax: account DAX entries as nrpages mm: remove nrexceptional from inode Hugh Dickins <hughd@google.com>: mm: remove nrexceptional from inode: remove BUG_ON Subsystem: mm/hugetlb Peter Xu <peterx@redhat.com>: Patch series "hugetlb: Disable huge pmd unshare for uffd-wp", v4: hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share() hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: remove redundant reservation check condition in alloc_huge_page() Anshuman Khandual <anshuman.khandual@arm.com>: mm: generalize HUGETLB_PAGE_SIZE_VARIABLE Miaohe Lin <linmiaohe@huawei.com>: Patch series "Some cleanups for hugetlb": mm/hugetlb: use some helper functions to cleanup code mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state() mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate() mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page() mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case Patch series "Cleanup and fixup for khugepaged", v2: khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps() khugepaged: reuse the smp_wmb() inside __SetPageUptodate() khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter() khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate() mm/huge_memory.c: remove unnecessary local variable ret2 Patch series "Some cleanups for huge_memory", v3: mm/huge_memory.c: rework the function vma_adjust_trans_huge() mm/huge_memory.c: make get_huge_zero_page() return bool mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly mm/huge_memory.c: remove redundant PageCompound() check mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG mm/huge_memory.c: use helper function migration_entry_to_page() Yanfei Xu <yanfei.xu@windriver.com>: mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup for khugepaged": khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp() khugepaged: remove unnecessary out label in collapse_huge_page() khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd() Zi Yan <ziy@nvidia.com>: mm: huge_memory: a new debugfs interface for splitting THP tests mm: huge_memory: debugfs for file-backed THP split Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for hugetlb", v2: mm/hugeltb: remove redundant VM_BUG_ON() in region_add() mm/hugeltb: simplify the return code of __vma_reservation_common() mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages() mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts() mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages() Mike Kravetz <mike.kravetz@oracle.com>: Patch series "make hugetlb put_page safe for all calling contexts", v5: mm/cma: change cma mutex to irq safe spinlock hugetlb: no need to drop hugetlb_lock to call cma_release hugetlb: add per-hstate mutex to synchronize user adjustments hugetlb: create remove_hugetlb_page() to separate functionality hugetlb: call update_and_free_page without hugetlb_lock hugetlb: change free_pool_huge_page to remove_pool_huge_page hugetlb: make free_huge_page irq safe hugetlb: add lockdep_assert_held() calls for hugetlb_lock Oscar Salvador <osalvador@suse.de>: Patch series "Make alloc_contig_range handle Hugetlb pages", v10: mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range mm,compaction: let isolate_migratepages_{range,block} return error codes mm,hugetlb: drop clearing of flag from prep_new_huge_page mm,hugetlb: split prep_new_huge_page functionality mm: make alloc_contig_range handle free hugetlb pages mm: make alloc_contig_range handle in-use hugetlb pages mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig Subsystem: mm/userfaultfd Axel Rasmussen <axelrasmussen@google.com>: Patch series "userfaultfd: add minor fault handling", v9: userfaultfd: add minor fault registration mode userfaultfd: disable huge PMD sharing for MINOR registered VMAs userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled userfaultfd: add UFFDIO_CONTINUE ioctl userfaultfd: update documentation to describe minor fault handling userfaultfd/selftests: add test exercising minor fault handling Subsystem: mm/vmscan Dave Hansen <dave.hansen@linux.intel.com>: mm/vmscan: move RECLAIM* bits to uapi header mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks Yang Shi <shy828301@gmail.com>: Patch series "Make shrinker's nr_deferred memcg aware", v10: mm: vmscan: use nid from shrink_control for tracepoint mm: vmscan: consolidate shrinker_maps handling code mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation mm: vmscan: remove memcg_shrinker_map_size mm: vmscan: use kvfree_rcu instead of call_rcu mm: memcontrol: rename shrinker_map to shrinker_info mm: vmscan: add shrinker_info_protected() helper mm: vmscan: use a new flag to indicate shrinker is registered mm: vmscan: add per memcg shrinker nr_deferred mm: vmscan: use per memcg nr_deferred of shrinker mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers mm: memcontrol: reparent nr_deferred when memcg offline mm: vmscan: shrink deferred objects proportional to priority Subsystem: mm/compaction Pintu Kumar <pintu@codeaurora.org>: mm/compaction: remove unused variable sysctl_compact_memory Charan Teja Reddy <charante@codeaurora.org>: mm: compaction: update the COMPACT[STALL|FAIL] events properly Subsystem: mm/migration Minchan Kim <minchan@kernel.org>: mm: disable LRU pagevec during the migration temporarily mm: replace migrate_[prep|finish] with lru_cache_[disable|enable] mm: fs: invalidate BH LRU during page migration Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for mm/migrate.c", v3: mm/migrate.c: make putback_movable_page() static mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page() mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole() Revert "mm: migrate: skip shared exec THP for NUMA balancing" Subsystem: mm/cma Minchan Kim <minchan@kernel.org>: mm: vmstat: add cma statistics Baolin Wang <baolin.wang@linux.alibaba.com>: mm: cma: use pr_err_ratelimited for CMA warning Liam Mark <lmark@codeaurora.org>: mm: cma: add trace events for CMA alloc perf testing Minchan Kim <minchan@kernel.org>: mm: cma: support sysfs mm: cma: add the CMA instance name to cma trace events mm: use proper type for cma_[alloc|release] Subsystem: mm/ksm Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for ksm": ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search() ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree() ksm: remove dedicated macro KSM_FLAG_MASK ksm: fix potential missing rmap_item for stable_node Chengyang Fan <cy.fan@huawei.com>: mm/ksm: remove unused parameter from remove_trailing_rmap_items() Subsystem: mm/vmstat Hugh Dickins <hughd@google.com>: mm: restore node stat checking in /proc/sys/vm/stat_refresh mm: no more EINVAL from /proc/sys/vm/stat_refresh mm: /proc/sys/vm/stat_refresh skip checking known negative stats mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats Saravanan D <saravanand@fb.com>: x86/mm: track linear mapping split events Subsystem: mm/mmap Liam Howlett <liam.howlett@oracle.com>: mm/mmap.c: don't unlock VMAs in remap_file_pages() Subsystem: mm/kconfig Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm: some config cleanups", v2: mm: generalize ARCH_HAS_CACHE_LINE_SIZE mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS) mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION mm: drop redundant ARCH_ENABLE_SPLIT_PMD_PTLOCK mm: drop redundant HAVE_ARCH_TRANSPARENT_HUGEPAGE Subsystem: mm/util Joe Perches <joe@perches.com>: mm/util.c: reduce mem_dump_obj() object size Bhaskar Chowdhury <unixbhaskar@gmail.com>: mm/util.c: fix typo Subsystem: mm/memory-hotplug Pavel Tatashin <pasha.tatashin@soleen.com>: Patch series "prohibit pinning pages in ZONE_MOVABLE", v11: mm/gup: don't pin migrated cma pages in movable zone mm/gup: check every subpage of a compound page during isolation mm/gup: return an error on migration failure mm/gup: check for isolation errors mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN mm: apply per-task gfp constraints in fast path mm: honor PF_MEMALLOC_PIN for all movable pages mm/gup: do not migrate zero page mm/gup: migrate pinned pages out of movable zone memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning mm/gup: change index type to long as it counts pages mm/gup: longterm pin migration cleanup selftests/vm: gup_test: fix test flag selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages Mel Gorman <mgorman@techsingularity.net>: mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove Oscar Salvador <osalvador@suse.de>: Patch series "Allocate memmap from hotadded memory (per device)", v10: drivers/base/memory: introduce memory_block_{online,offline} mm,memory_hotplug: relax fully spanned sections check David Hildenbrand <david@redhat.com>: mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count() Oscar Salvador <osalvador@suse.de>: mm,memory_hotplug: allocate memmap from the added memory range acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported mm,memory_hotplug: add kernel boot option to enable memmap_on_memory x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE Subsystem: mm/zswap Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/zswap.c: switch from strlcpy to strscpy Subsystem: mm/zsmalloc zhouchuangao <zhouchuangao@vivo.com>: mm/zsmalloc: use BUG_ON instead of if condition followed by BUG. Subsystem: mm/highmem Ira Weiny <ira.weiny@intel.com>: Patch series "btrfs: Convert kmap/memset/kunmap to memzero_user()": iov_iter: lift memzero_page() to highmem.h btrfs: use memzero_page() instead of open coded kmap pattern songqiang <songqiang@uniontech.com>: mm/highmem.c: fix coding style issue Subsystem: mm/cleanups Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/mempool: minor coding style tweaks Zhang Yunkai <zhang.yunkai@zte.com.cn>: mm/process_vm_access.c: remove duplicate include Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: zero guard page after out-of-bounds access Patch series "kfence: optimize timer scheduling", v2: kfence: await for allocation using wait_event kfence: maximize allocation wait timeout duration kfence: use power-efficient work queue to run delayed work Documentation/ABI/testing/sysfs-kernel-mm-cma | 25 Documentation/admin-guide/kernel-parameters.txt | 17 Documentation/admin-guide/mm/memory-hotplug.rst | 9 Documentation/admin-guide/mm/userfaultfd.rst | 105 +- arch/arc/Kconfig | 9 arch/arm/Kconfig | 10 arch/arm64/Kconfig | 34 arch/arm64/mm/hugetlbpage.c | 7 arch/ia64/Kconfig | 14 arch/ia64/mm/hugetlbpage.c | 3 arch/mips/Kconfig | 6 arch/mips/mm/hugetlbpage.c | 4 arch/parisc/Kconfig | 5 arch/parisc/mm/hugetlbpage.c | 2 arch/powerpc/Kconfig | 17 arch/powerpc/mm/hugetlbpage.c | 3 arch/powerpc/platforms/Kconfig.cputype | 16 arch/riscv/Kconfig | 5 arch/s390/Kconfig | 12 arch/s390/mm/hugetlbpage.c | 2 arch/sh/Kconfig | 7 arch/sh/mm/Kconfig | 8 arch/sh/mm/hugetlbpage.c | 2 arch/sparc/mm/hugetlbpage.c | 2 arch/x86/Kconfig | 33 arch/x86/mm/pat/set_memory.c | 8 drivers/acpi/acpi_memhotplug.c | 5 drivers/base/memory.c | 105 ++ fs/Kconfig | 5 fs/block_dev.c | 2 fs/btrfs/compression.c | 5 fs/btrfs/extent_io.c | 22 fs/btrfs/inode.c | 33 fs/btrfs/reflink.c | 6 fs/btrfs/zlib.c | 5 fs/btrfs/zstd.c | 5 fs/buffer.c | 36 fs/dax.c | 8 fs/gfs2/glock.c | 3 fs/hugetlbfs/inode.c | 9 fs/inode.c | 11 fs/proc/task_mmu.c | 3 fs/userfaultfd.c | 149 +++ include/linux/buffer_head.h | 4 include/linux/cma.h | 4 include/linux/compaction.h | 1 include/linux/fs.h | 2 include/linux/gfp.h | 2 include/linux/highmem.h | 7 include/linux/huge_mm.h | 3 include/linux/hugetlb.h | 37 include/linux/memcontrol.h | 27 include/linux/memory.h | 8 include/linux/memory_hotplug.h | 15 include/linux/memremap.h | 2 include/linux/migrate.h | 11 include/linux/mm.h | 28 include/linux/mmzone.h | 20 include/linux/pagemap.h | 5 include/linux/pgtable.h | 12 include/linux/sched.h | 2 include/linux/sched/mm.h | 27 include/linux/shrinker.h | 7 include/linux/swap.h | 21 include/linux/userfaultfd_k.h | 55 + include/linux/vm_event_item.h | 8 include/trace/events/cma.h | 92 +- include/trace/events/migrate.h | 25 include/trace/events/mmflags.h | 7 include/uapi/linux/mempolicy.h | 7 include/uapi/linux/userfaultfd.h | 36 init/Kconfig | 5 kernel/sysctl.c | 2 lib/Kconfig.kfence | 1 lib/iov_iter.c | 8 mm/Kconfig | 28 mm/Makefile | 6 mm/cma.c | 70 + mm/cma.h | 25 mm/cma_debug.c | 8 mm/cma_sysfs.c | 112 ++ mm/compaction.c | 113 ++ mm/filemap.c | 24 mm/frontswap.c | 12 mm/gup.c | 264 +++--- mm/gup_test.c | 29 mm/gup_test.h | 3 mm/highmem.c | 11 mm/huge_memory.c | 326 +++++++- mm/hugetlb.c | 843 ++++++++++++++-------- mm/hugetlb_cgroup.c | 9 mm/internal.h | 10 mm/kfence/core.c | 61 + mm/khugepaged.c | 63 - mm/ksm.c | 17 mm/list_lru.c | 6 mm/memcontrol.c | 137 --- mm/memory_hotplug.c | 220 +++++ mm/mempolicy.c | 16 mm/mempool.c | 2 mm/migrate.c | 103 -- mm/mlock.c | 4 mm/mmap.c | 18 mm/oom_kill.c | 2 mm/page_alloc.c | 83 +- mm/process_vm_access.c | 1 mm/shmem.c | 2 mm/sparse.c | 4 mm/swap.c | 69 + mm/swap_state.c | 4 mm/swapfile.c | 4 mm/truncate.c | 19 mm/userfaultfd.c | 39 - mm/util.c | 26 mm/vmalloc.c | 2 mm/vmscan.c | 543 +++++++++----- mm/vmstat.c | 45 - mm/workingset.c | 1 mm/zsmalloc.c | 6 mm/zswap.c | 2 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 1 tools/testing/selftests/vm/gup_test.c | 38 tools/testing/selftests/vm/split_huge_page_test.c | 400 ++++++++++ tools/testing/selftests/vm/userfaultfd.c | 164 ++++ 125 files changed, 3596 insertions(+), 1668 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-05-05 1:32 incoming Andrew Morton @ 2021-05-05 1:47 ` Linus Torvalds 2021-05-05 3:16 ` incoming Andrew Morton 0 siblings, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2021-05-05 1:47 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 143 patches Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing. Maybe just some mail delay? But at least right now https://lore.kernel.org/mm-commits/ doesn't show them (and thus 'b4' doesn't work). I'll check again later. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-05-05 1:47 ` incoming Linus Torvalds @ 2021-05-05 3:16 ` Andrew Morton 2021-05-05 17:10 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2021-05-05 3:16 UTC (permalink / raw) To: Linus Torvalds; +Cc: Linux-MM, mm-commits On Tue, 4 May 2021 18:47:19 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > 143 patches > > Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing. > > Maybe just some mail delay? But at least right now > > https://lore.kernel.org/mm-commits/ > > doesn't show them (and thus 'b4' doesn't work). > > I'll check again later. > Well that's strange. I see all three via cc:me, but not on linux-mm or mm-commits. Let me resend right now with the same in-reply-to. Hopefully they will land in the correct place. ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-05-05 3:16 ` incoming Andrew Morton @ 2021-05-05 17:10 ` Linus Torvalds 2021-05-05 17:44 ` incoming Andrew Morton 0 siblings, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2021-05-05 17:10 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > Let me resend right now with the same in-reply-to. Hopefully they will > land in the correct place. Well, you re-sent it twice, and I have three copies in my own mailbox, bot they still don't show up on the mm-commits mailing list. So the list hates them for some odd reason. I've picked them up locally, but adding Konstantin to the participants to see if he can see what's up. Konstantin: patches 103/106/107 are missing on lore out of Andrew's series of 143. Odd. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-05-05 17:10 ` incoming Linus Torvalds @ 2021-05-05 17:44 ` Andrew Morton 2021-05-06 3:19 ` incoming Anshuman Khandual 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2021-05-05 17:44 UTC (permalink / raw) To: Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits [-- Attachment #1: Type: text/plain, Size: 1387 bytes --] On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > Let me resend right now with the same in-reply-to. Hopefully they will > > land in the correct place. > > Well, you re-sent it twice, and I have three copies in my own mailbox, > bot they still don't show up on the mm-commits mailing list. > > So the list hates them for some odd reason. > > I've picked them up locally, but adding Konstantin to the participants > to see if he can see what's up. > > Konstantin: patches 103/106/107 are missing on lore out of Andrew's > series of 143. Odd. It's weird. They don't turn up on linux-mm either, and that's running at kvack.org, also majordomo. They don't get through when sent with either heirloom-mailx or with sylpheed. Also, it seems that when Anshuman originally sent the patch, linux-mm and linux-kernel didn't send it back out. So perhaps a spam filter triggered? I'm seeing https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/ which is via linux-arm-kernel@lists.infradead.org but the linux-kernel server massacred that patch series. Searching https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7 email series. One of the emails (as sent my me) is attached, if that helps. [-- Attachment #2: x.txt --] [-- Type: text/plain, Size: 21048 bytes --] Return-Path: <akpm@linux-foundation.org> X-Spam-Checker-Version: SpamAssassin 3.4.1 (2015-04-28) on y X-Spam-Level: (none) X-Spam-Status: No, score=-101.5 required=2.5 tests=BAYES_00,T_DKIM_INVALID, USER_IN_WHITELIST autolearn=ham autolearn_force=no version=3.4.1 Received: from localhost.localdomain (localhost.localdomain [127.0.0.1]) by localhost.localdomain (8.15.2/8.15.2/Debian-8ubuntu1) with ESMTP id 1453H2fk032202 for <akpm@localhost>; Tue, 4 May 2021 20:17:03 -0700 Received: from imap.fastmail.com [66.111.4.135] by localhost.localdomain with IMAP (fetchmail-6.3.26) for <akpm@localhost> (single-drop); Tue, 04 May 2021 20:17:03 -0700 (PDT) Received: from compute1.internal (compute1.nyi.internal [10.202.2.41]) by sloti11d1t06 (Cyrus 3.5.0-alpha0-442-g5daca166b9-fm-20210428.001-g5daca166) with LMTPA; Tue, 04 May 2021 23:16:31 -0400 X-Cyrus-Session-Id: sloti11d1t06-1620184591-1699471-2-6359664467419938249 X-Sieve: CMU Sieve 3.0 X-Resolved-to: akpm@mbx.kernel.org X-Delivered-to: akpm@mbx.kernel.org X-Mail-from: akpm@linux-foundation.org Received: from mx6 ([10.202.2.205]) by compute1.internal (LMTPProxy); Tue, 04 May 2021 23:16:31 -0400 Received: from mx6.messagingengine.com (localhost [127.0.0.1]) by mailmx.nyi.internal (Postfix) with ESMTP id 40796C800E1 for <akpm@mbx.kernel.org>; Tue, 4 May 2021 23:16:31 -0400 (EDT) Received: from mx6.messagingengine.com (localhost [127.0.0.1]) by mx6.messagingengine.com (Authentication Milter) with ESMTP id 14870833D7F; Tue, 4 May 2021 23:16:31 -0400 ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=messagingengine.com; s=fm2; t= 1620184591; b=FBo7Gf3JFN+4QYg5Byan0oNm6RESv+sIf5HcaslVNsUd9SOTGS yI0+IsXr1CUpGH783hE6fmgEq9SyfOwQVZjdikLaJS1+7u0JtfAYQFU3RORCtXlr djJWrScfjVa8nAHX4rQCtzvtPYuzx5w7cTgGgeILgoJMxgLj7EC9xcT8BIf68+9W Lw+ohAmcuiKhL2ez+de4SMuwdh3dh2FwAIHQOsSjEU1/NV+WGxMLwYbxWgTrqQGH RQIzFNdq30qslW9huK47+e80uHOX2tXwxtshwbThFEn458bdV5LL6Y8Oh4ZWMbv1 tFgTt515DVedonZknxc07XsXtAjaJyB8bfHw== ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=date:from:to:subject:message-id :in-reply-to; s=fm2; t=1620184591; bh=LuH7mbm3+zp863vKBEqKeoZtnp uFxYpIb5oTVwf56Es=; b=m5E1fbz2b+an/X406oY3BuG0Zm4/W05vWAki8Lsnud gPCc1LfPUFSuXaMppcEDPbLKprp4hH3T52itK4pivXMQCLEOyme7kVStaLMVTiky Xxqh5ZdhOWvygBfda/GjfuLBSbbj2gfm8HPKpbL7CA5foelknIBhJHDzGkJyxetZ YagZfVvtdo2OEwnC1mmjUCpKPO5+m5kaZO0ol6rPdl+TV0MKGhjLg+/i6Ia+0nFp zDwV4VeACvVcGb2xY7KG5Z+BtqVxeVFn+w5JcqpWUtxEKoSBR4bWARzjwHg6eouh 7psOOKPTt/NzDKk+3f49lso5KlPiTF2xEU/+5SIttCkQ== ARC-Authentication-Results: i=2; mx6.messagingengine.com; arc=pass (as.1.google.com=pass, ams.1.google.com=pass) smtp.remote-ip=209.85.215.198; bimi=skipped (DMARC did not pass); dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256 header.s=korg x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=linux-foundation.org; iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com); spf=pass smtp.mailfrom=akpm@linux-foundation.org smtp.helo=mail-pg1-f198.google.com; x-aligned-from=pass (Address match); x-arc-spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1 x-arc-domain=google.com (Trusted from aar.1.google.com); x-csa=none; x-google-dkim=fail (message has been altered, 2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf; x-me-sender=none; x-ptr=pass smtp.helo=mail-pg1-f198.google.com policy.ptr=mail-pg1-f198.google.com; x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM); x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM); x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384 smtp.bits=256/256; x-vs=clean score=40 state=0 Authentication-Results: mx6.messagingengine.com; arc=pass (as.1.google.com=pass, ams.1.google.com=pass) smtp.remote-ip=209.85.215.198; bimi=skipped (DMARC did not pass); dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256 header.s=korg x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=linux-foundation.org; iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com); spf=pass smtp.mailfrom=akpm@linux-foundation.org smtp.helo=mail-pg1-f198.google.com; x-aligned-from=pass (Address match); x-arc-spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1 x-arc-domain=google.com (Trusted from aar.1.google.com); x-csa=none; x-google-dkim=fail (message has been altered, 2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf; x-me-sender=none; x-ptr=pass smtp.helo=mail-pg1-f198.google.com policy.ptr=mail-pg1-f198.google.com; x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM); x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM); x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384 smtp.bits=256/256; x-vs=clean score=40 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrvdefjedgieegucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucgoufhorhhtvggutfgvtg hiphdvucdlgedtmdenucfjughrpeffhffvuffkjggfsedttdertddtredtnecuhfhrohhm peetnhgurhgvficuofhorhhtohhnuceorghkphhmsehlihhnuhigqdhfohhunhgurghtih honhdrohhrgheqnecuggftrfgrthhtvghrnhepjeevfeduveffvddvudetkefhgeduveeu geevvdfhhfevhfekkedtieefgfduheeinecuffhomhgrihhnpehkvghrnhgvlhdrohhrgh enucfkphepvddtledrkeehrddvudehrdduleekpdduleekrddugeehrddvledrleelnecu uegrugftvghpuhhtkfhppeduleekrddugeehrddvledrleelnecuvehluhhsthgvrhfuih iivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudehrdduleekpdhhvghl ohepmhgrihhlqdhpghduqdhfudelkedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomh epoegrkhhpmheslhhinhhugidqfhhouhhnuggrthhiohhnrdhorhhgqe X-ME-VSScore: 40 X-ME-VSCategory: clean X-ME-CSA: none Received-SPF: pass (linux-foundation.org: Sender is authorized to use 'akpm@linux-foundation.org' in 'mfrom' identity (mechanism 'include:_spf.google.com' matched)) receiver=mx6.messagingengine.com; identity=mailfrom; envelope-from="akpm@linux-foundation.org"; helo=mail-pg1-f198.google.com; client-ip=209.85.215.198 Received: from mail-pg1-f198.google.com (mail-pg1-f198.google.com [209.85.215.198]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by mx6.messagingengine.com (Postfix) with ESMTPS for <akpm@mbx.kernel.org>; Tue, 4 May 2021 23:16:31 -0400 (EDT) Received: by mail-pg1-f198.google.com with SMTP id g5-20020a63f4050000b02901f6c7b9a6d0so593624pgi.5 for <akpm@mbx.kernel.org>; Tue, 04 May 2021 20:16:30 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:dkim-signature:date:from:to:subject:message-id :in-reply-to:user-agent; bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=; b=VZuDOxUfeHXJz1/CiFfcxuMVHkmW5RznvqYS+Py8Ub6nHHXprQJGE9Ze3WgH+1ylSe NJLEC7xgv15SR9A+e/MT4RTj3OVOwtd1Zi2vPav39a9K4tP+2uL2Ei+5d7FtT3LLZsjo feek/DqCGSkJ/EC5woLyU9BBkfLUuQ9/2HiDCk10BMetEfWdor69Slb39NOXES8br02X 25Btabu9ZCWroyjQj7W5gwGr5Z6Hs2nbnnfAb+e92FalcUD/4ql77lNzRcWGi4/9TT8s ntqI2g46Xv+k5LURaRH5CRBpxkkKgzcrioRPYFUHkEgOEWy1hPzg9QPk8ZO35Xm9R9d2 vl3Q== X-Gm-Message-State: AOAM531IlYUTVWcMrsTunnxZWB7SKeeOmoZj5mZ1A5tl7N/JlZUueN8L tvyRKnvxHr6a5mDaGHN9Tb1N/iCzT0U5oQgRVTxTnj1qFGibRa9+leLQNKX0aGlNg9JiaMfromb xyOlCUpVXOlVvchuwTUSTn7rXum+Hh3PWQZm5II/EX+0AkzKqez62Z8U= X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203271pjq.53.1620184589161; Tue, 04 May 2021 20:16:29 -0700 (PDT) X-Google-Smtp-Source: ABdhPJxffoGdRqAjUagWoMVD5p/Lk1KTEDftEhkWh8ewatgDmZLlxh0lO1hxYIdYYwoO5dsJ/i0z X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203198pjq.53.1620184588109; Tue, 04 May 2021 20:16:28 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1620184588; cv=none; d=google.com; s=arc-20160816; b=Fr2b2AMXJr6OeNpSql45tq1korkuDOunp7t+DpARuEBnwvQnKfagyipQ93jywsRf/c /i/mP2eTmJwOLWNORClh1MGF/0VfBx1ULoB9W4CI3LpVgGFXGGFis8LTcvUYD5yvhlsV 50rm2j34iS9lyo04FB/hbhGkwLtUhz2PGkLGuqHspTd+pUpUCf5SLxGJbZC5uCcUEsbO 8WSDBWyvaCPjFzJQZK60gK70ticKW+fCG1xHtOG4qsFCbqEpFKBy8eVK83OBazo/dQDr DOheWNWyw2o/WMP4GpZMvZuj30dx3j8xnBahIpnMIQJaog6wLMcVX9pkQ8UJym3/PGNm pO/g== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=user-agent:in-reply-to:message-id:subject:to:from:date :dkim-signature; bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=; b=vVN16NPMKjoxSJQ6b36VXFCkZqnmG7wABfilgE069txZqmHpEMyZb8lRStkHy557LM Kn7UfJFP3xwsP8ZTCipVDZ6tpFW/hYFU9o4th9G8asWs+MOf9xpWX2LQZ1FTmaao2Fg5 uCHypz39cnAh0Z1EJfNsTcaTGIrkbBd6zje+mtBgs8hnfH8HcWBYTPCHCCx950Z928tb XOPd/Igs7yzD1ioBiGXZj/ciwPbWVTaZXBg4JOZSApxkDMfuMyfyLLOs++EVkyxJHUme TmgwvLkixcwEtKF7gIeqEhwvOUSVvilLuJLFVaLumwTcjJ1amVfGcJhBE7LIM9C3SMpA rOOg== ARC-Authentication-Results: i=1; mx.google.com; dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9"; spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org Received: from mail.kernel.org (mail.kernel.org. [198.145.29.99]) by mx.google.com with ESMTPS id c85si20173199pfb.8.2021.05.04.20.16.27 (version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128); Tue, 04 May 2021 20:16:28 -0700 (PDT) Received-SPF: pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) client-ip=198.145.29.99; Authentication-Results: mx.google.com; dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9"; spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org Received: by mail.kernel.org (Postfix) with ESMTPSA id A4DB4610D2; Wed, 5 May 2021 03:16:26 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=linux-foundation.org; s=korg; t=1620184587; bh=TxN4wgKcKf2UUem+5pL09m9GL/7U592mEalo2U6vwAU=; h=Date:From:To:Subject:In-Reply-To:From; b=Gdz/3wY9ktH3hOmn2DAOkfh0JXwPdMJ8xsNQFa9eI25K39Z3iHdRGo9jX3QtMDtog D4Zakt52CQCYsV91c9oCai8KnCTkkAjJq/Ez7p8UHpz97Go3yYYxqg6DDl6d8HCQvN H47dTaZAgeH2sw29bjB9fRzNuTx7k4RAPlqZIpiE= Date: Tue, 04 May 2021 20:16:26 -0700 From: Andrew Morton <akpm@linux-foundation.org> To: akpm@linux-foundation.org, anshuman.khandual@arm.com, aou@eecs.berkeley.edu, arnd@arndb.de, benh@kernel.crashing.org, borntraeger@de.ibm.com, bp@alien8.de, catalin.marinas@arm.com, dalias@libc.org, deller@gmx.de, gor@linux.ibm.com, hca@linux.ibm.com, hpa@zytor.com, James.Bottomley@HansenPartnership.com, linux-mm@kvack.org, linux@armlinux.org.uk, mingo@redhat.com, mm-commits@vger.kernel.org, mpe@ellerman.id.au, palmerdabbelt@google.com, paul.walmsley@sifive.com, paulus@samba.org, tglx@linutronix.de, torvalds@linux-foundation.org, tsbogend@alpha.franken.de, vgupta@synopsys.com, viro@zeniv.linux.org.uk, will@kernel.org, ysato@users.osdn.me Subject: [patch 103/143] mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS) Message-ID: <20210505031626.c8o4WL7KE%akpm@linux-foundation.org> In-Reply-To: <20210504183219.a3cc46aee4013d77402276c5@linux-foundation.org> User-Agent: s-nail v14.8.16 X-Gm-Original-To: akpm@linux-foundation.org From: Anshuman Khandual <anshuman.khandual@arm.com> Subject: mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS) SYS_SUPPORTS_HUGETLBFS config has duplicate definitions on platforms that subscribe it. Instead, just make it a generic option which can be selected on applicable platforms. Also rename it as ARCH_SUPPORTS_HUGETLBFS instead. This reduces code duplication and makes it cleaner. Link: https://lkml.kernel.org/r/1617259448-22529-3-git-send-email-anshuman.khandual@arm.com Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com> Acked-by: Catalin Marinas <catalin.marinas@arm.com> [arm64] Acked-by: Palmer Dabbelt <palmerdabbelt@google.com> [riscv] Acked-by: Michael Ellerman <mpe@ellerman.id.au> [powerpc] Cc: Russell King <linux@armlinux.org.uk> Cc: Will Deacon <will@kernel.org> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com> Cc: Helge Deller <deller@gmx.de> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Albert Ou <aou@eecs.berkeley.edu> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Cc: Rich Felker <dalias@libc.org> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Arnd Bergmann <arnd@arndb.de> Cc: Borislav Petkov <bp@alien8.de> Cc: Christian Borntraeger <borntraeger@de.ibm.com> Cc: Heiko Carstens <hca@linux.ibm.com> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Vasily Gorbik <gor@linux.ibm.com> Cc: Vineet Gupta <vgupta@synopsys.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm/Kconfig | 5 +---- arch/arm64/Kconfig | 4 +--- arch/mips/Kconfig | 6 +----- arch/parisc/Kconfig | 5 +---- arch/powerpc/Kconfig | 3 --- arch/powerpc/platforms/Kconfig.cputype | 6 +++--- arch/riscv/Kconfig | 5 +---- arch/sh/Kconfig | 5 +---- fs/Kconfig | 5 ++++- 9 files changed, 13 insertions(+), 31 deletions(-) --- a/arch/arm64/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/arm64/Kconfig @@ -73,6 +73,7 @@ config ARM64 select ARCH_USE_QUEUED_SPINLOCKS select ARCH_USE_SYM_ANNOTATIONS select ARCH_SUPPORTS_DEBUG_PAGEALLOC + select ARCH_SUPPORTS_HUGETLBFS select ARCH_SUPPORTS_MEMORY_FAILURE select ARCH_SUPPORTS_SHADOW_CALL_STACK if CC_HAVE_SHADOW_CALL_STACK select ARCH_SUPPORTS_LTO_CLANG if CPU_LITTLE_ENDIAN @@ -1072,9 +1073,6 @@ config HW_PERF_EVENTS def_bool y depends on ARM_PMU -config SYS_SUPPORTS_HUGETLBFS - def_bool y - config ARCH_HAS_FILTER_PGPROT def_bool y --- a/arch/arm/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/arm/Kconfig @@ -31,6 +31,7 @@ config ARM select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT if CPU_V7 select ARCH_SUPPORTS_ATOMIC_RMW + select ARCH_SUPPORTS_HUGETLBFS if ARM_LPAE select ARCH_USE_BUILTIN_BSWAP select ARCH_USE_CMPXCHG_LOCKREF select ARCH_USE_MEMTEST @@ -1511,10 +1512,6 @@ config HW_PERF_EVENTS def_bool y depends on ARM_PMU -config SYS_SUPPORTS_HUGETLBFS - def_bool y - depends on ARM_LPAE - config HAVE_ARCH_TRANSPARENT_HUGEPAGE def_bool y depends on ARM_LPAE --- a/arch/mips/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/mips/Kconfig @@ -19,6 +19,7 @@ config MIPS select ARCH_USE_MEMTEST select ARCH_USE_QUEUED_RWLOCKS select ARCH_USE_QUEUED_SPINLOCKS + select ARCH_SUPPORTS_HUGETLBFS if CPU_SUPPORTS_HUGEPAGES select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU select ARCH_WANT_IPC_PARSE_VERSION select ARCH_WANT_LD_ORPHAN_WARN @@ -1287,11 +1288,6 @@ config SYS_SUPPORTS_BIG_ENDIAN config SYS_SUPPORTS_LITTLE_ENDIAN bool -config SYS_SUPPORTS_HUGETLBFS - bool - depends on CPU_SUPPORTS_HUGEPAGES - default y - config MIPS_HUGE_TLB_SUPPORT def_bool HUGETLB_PAGE || TRANSPARENT_HUGEPAGE --- a/arch/parisc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/parisc/Kconfig @@ -12,6 +12,7 @@ config PARISC select ARCH_HAS_STRICT_KERNEL_RWX select ARCH_HAS_UBSAN_SANITIZE_ALL select ARCH_NO_SG_CHAIN + select ARCH_SUPPORTS_HUGETLBFS if PA20 select ARCH_SUPPORTS_MEMORY_FAILURE select DMA_OPS select RTC_CLASS @@ -138,10 +139,6 @@ config PGTABLE_LEVELS default 3 if 64BIT && PARISC_PAGE_SIZE_4KB default 2 -config SYS_SUPPORTS_HUGETLBFS - def_bool y if PA20 - - menu "Processor type and features" choice --- a/arch/powerpc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/powerpc/Kconfig @@ -697,9 +697,6 @@ config ARCH_SPARSEMEM_DEFAULT def_bool y depends on PPC_BOOK3S_64 -config SYS_SUPPORTS_HUGETLBFS - bool - config ILLEGAL_POINTER_VALUE hex # This is roughly half way between the top of user space and the bottom --- a/arch/powerpc/platforms/Kconfig.cputype~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/powerpc/platforms/Kconfig.cputype @@ -40,8 +40,8 @@ config PPC_85xx config PPC_8xx bool "Freescale 8xx" + select ARCH_SUPPORTS_HUGETLBFS select FSL_SOC - select SYS_SUPPORTS_HUGETLBFS select PPC_HAVE_KUEP select PPC_HAVE_KUAP select HAVE_ARCH_VMAP_STACK @@ -95,9 +95,9 @@ config PPC_BOOK3S_64 bool "Server processors" select PPC_FPU select PPC_HAVE_PMU_SUPPORT - select SYS_SUPPORTS_HUGETLBFS select HAVE_ARCH_TRANSPARENT_HUGEPAGE select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE + select ARCH_SUPPORTS_HUGETLBFS select ARCH_SUPPORTS_NUMA_BALANCING select IRQ_WORK select PPC_MM_SLICES @@ -278,9 +278,9 @@ config FSL_BOOKE # this is for common code between PPC32 & PPC64 FSL BOOKE config PPC_FSL_BOOK3E bool + select ARCH_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64 select FSL_EMB_PERFMON select PPC_SMP_MUXED_IPI - select SYS_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64 select PPC_DOORBELL default y if FSL_BOOKE --- a/arch/riscv/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/riscv/Kconfig @@ -30,6 +30,7 @@ config RISCV select ARCH_HAS_STRICT_KERNEL_RWX if MMU select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT + select ARCH_SUPPORTS_HUGETLBFS if MMU select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU select ARCH_WANT_FRAME_POINTERS select ARCH_WANT_HUGE_PMD_SHARE if 64BIT @@ -165,10 +166,6 @@ config ARCH_WANT_GENERAL_HUGETLB config ARCH_SUPPORTS_UPROBES def_bool y -config SYS_SUPPORTS_HUGETLBFS - depends on MMU - def_bool y - config STACKTRACE_SUPPORT def_bool y --- a/arch/sh/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/sh/Kconfig @@ -101,9 +101,6 @@ config SYS_SUPPORTS_APM_EMULATION bool select ARCH_SUSPEND_POSSIBLE -config SYS_SUPPORTS_HUGETLBFS - bool - config SYS_SUPPORTS_SMP bool @@ -175,12 +172,12 @@ config CPU_SH3 config CPU_SH4 bool + select ARCH_SUPPORTS_HUGETLBFS if MMU select CPU_HAS_INTEVT select CPU_HAS_SR_RB select CPU_HAS_FPU if !CPU_SH4AL_DSP select SH_INTC select SYS_SUPPORTS_SH_TMU - select SYS_SUPPORTS_HUGETLBFS if MMU config CPU_SH4A bool --- a/fs/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/fs/Kconfig @@ -223,10 +223,13 @@ config TMPFS_INODE64 If unsure, say N. +config ARCH_SUPPORTS_HUGETLBFS + def_bool n + config HUGETLBFS bool "HugeTLB file system support" depends on X86 || IA64 || SPARC64 || (S390 && 64BIT) || \ - SYS_SUPPORTS_HUGETLBFS || BROKEN + ARCH_SUPPORTS_HUGETLBFS || BROKEN help hugetlbfs is a filesystem backing for HugeTLB pages, based on ramfs. For architectures that support it, say Y here and read _ ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-05-05 17:44 ` incoming Andrew Morton @ 2021-05-06 3:19 ` Anshuman Khandual 0 siblings, 0 replies; 322+ messages in thread From: Anshuman Khandual @ 2021-05-06 3:19 UTC (permalink / raw) To: Andrew Morton, Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits On 5/5/21 11:14 PM, Andrew Morton wrote: > On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > >> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote: >>> Let me resend right now with the same in-reply-to. Hopefully they will >>> land in the correct place. >> Well, you re-sent it twice, and I have three copies in my own mailbox, >> bot they still don't show up on the mm-commits mailing list. >> >> So the list hates them for some odd reason. >> >> I've picked them up locally, but adding Konstantin to the participants >> to see if he can see what's up. >> >> Konstantin: patches 103/106/107 are missing on lore out of Andrew's >> series of 143. Odd. > It's weird. They don't turn up on linux-mm either, and that's running > at kvack.org, also majordomo. They don't get through when sent with > either heirloom-mailx or with sylpheed. > > Also, it seems that when Anshuman originally sent the patch, linux-mm > and linux-kernel didn't send it back out. So perhaps a spam filter > triggered? > > I'm seeing > > https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/ > > which is via linux-arm-kernel@lists.infradead.org but the linux-kernel > server massacred that patch series. Searching > https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7 > email series. Yeah these patches faced problem from the very beginning getting into the MM/LKML list for some strange reason. ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-04-30 5:52 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-04-30 5:52 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits A few misc subsystems and some of MM. 178 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0. Subsystems affected by this patch series: ia64 kbuild scripts sh ocfs2 kfifo vfs kernel/watchdog mm/slab-generic mm/slub mm/kmemleak mm/debug mm/pagecache mm/msync mm/gup mm/memremap mm/memcg mm/pagemap mm/mremap mm/dma mm/sparsemem mm/vmalloc mm/documentation mm/kasan mm/initialization mm/pagealloc mm/memory-failure Subsystem: ia64 Zhang Yunkai <zhang.yunkai@zte.com.cn>: arch/ia64/kernel/head.S: remove duplicate include Bhaskar Chowdhury <unixbhaskar@gmail.com>: arch/ia64/kernel/fsys.S: fix typos arch/ia64/include/asm/pgtable.h: minor typo fixes Valentin Schneider <valentin.schneider@arm.com>: ia64: ensure proper NUMA distance and possible map initialization Sergei Trofimovich <slyfox@gentoo.org>: ia64: drop unused IA64_FW_EMU ifdef ia64: simplify code flow around swiotlb init Bhaskar Chowdhury <unixbhaskar@gmail.com>: ia64: trivial spelling fixes Sergei Trofimovich <slyfox@gentoo.org>: ia64: fix EFI_DEBUG build ia64: mca: always make IA64_MCA_DEBUG an expression ia64: drop marked broken DISCONTIGMEM and VIRTUAL_MEM_MAP ia64: module: fix symbolizer crash on fdescr Subsystem: kbuild Luc Van Oostenryck <luc.vanoostenryck@gmail.com>: include/linux/compiler-gcc.h: sparse can do constant folding of __builtin_bswap*() Subsystem: scripts Tom Saeger <tom.saeger@oracle.com>: scripts/spelling.txt: add entries for recent discoveries Wan Jiabing <wanjiabing@vivo.com>: scripts: a new script for checking duplicate struct declaration Subsystem: sh Zhang Yunkai <zhang.yunkai@zte.com.cn>: arch/sh/include/asm/tlb.h: remove duplicate include Subsystem: ocfs2 Yang Li <yang.lee@linux.alibaba.com>: ocfs2: replace DEFINE_SIMPLE_ATTRIBUTE with DEFINE_DEBUGFS_ATTRIBUTE Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: map flags directly in flags_to_o2dlm() Bhaskar Chowdhury <unixbhaskar@gmail.com>: ocfs2: fix a typo Jiapeng Chong <jiapeng.chong@linux.alibaba.com>: ocfs2/dlm: remove unused function Subsystem: kfifo Dan Carpenter <dan.carpenter@oracle.com>: kfifo: fix ternary sign extension bugs Subsystem: vfs Randy Dunlap <rdunlap@infradead.org>: vfs: fs_parser: clean up kernel-doc warnings Subsystem: kernel/watchdog Petr Mladek <pmladek@suse.com>: Patch series "watchdog/softlockup: Report overall time and some cleanup", v2: watchdog: rename __touch_watchdog() to a better descriptive name watchdog: explicitly update timestamp when reporting softlockup watchdog/softlockup: report the overall time of softlockups watchdog/softlockup: remove logic that tried to prevent repeated reports watchdog: fix barriers when printing backtraces from all CPUs watchdog: cleanup handling of false positives Subsystem: mm/slab-generic Rafael Aquini <aquini@redhat.com>: mm/slab_common: provide "slab_merge" option for !IS_ENABLED(CONFIG_SLAB_MERGE_DEFAULT) builds Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: mm, slub: enable slub_debug static key when creating cache with explicit debug flags Oliver Glitta <glittao@gmail.com>: kunit: add a KUnit test for SLUB debugging functionality slub: remove resiliency_test() function Bhaskar Chowdhury <unixbhaskar@gmail.com>: mm/slub.c: trivial typo fixes Subsystem: mm/kmemleak Bhaskar Chowdhury <unixbhaskar@gmail.com>: mm/kmemleak.c: fix a typo Subsystem: mm/debug Georgi Djakov <georgi.djakov@linaro.org>: mm/page_owner: record the timestamp of all pages during free zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>: mm, page_owner: remove unused parameter in __set_page_owner_handle Sergei Trofimovich <slyfox@gentoo.org>: mm: page_owner: fetch backtrace only for tracked pages mm: page_owner: use kstrtobool() to parse bool option mm: page_owner: detect page_owner recursion via task_struct mm: page_poison: print page info when corruption is caught Anshuman Khandual <anshuman.khandual@arm.com>: mm/memtest: add ARCH_USE_MEMTEST Subsystem: mm/pagecache Jens Axboe <axboe@kernel.dk>: Patch series "Improve IOCB_NOWAIT O_DIRECT reads", v3: mm: provide filemap_range_needs_writeback() helper mm: use filemap_range_needs_writeback() for O_DIRECT reads iomap: use filemap_range_needs_writeback() for O_DIRECT reads "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap: use filemap_read_page in filemap_fault mm/filemap: drop check for truncated page after I/O Johannes Weiner <hannes@cmpxchg.org>: mm: page-writeback: simplify memcg handling in test_clear_page_writeback() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: move page_mapping_file to pagemap.h Rui Sun <sunrui26@huawei.com>: mm/filemap: update stale comment Subsystem: mm/msync Nikita Ermakov <sh1r4s3@mail.si-head.nl>: mm/msync: exit early when the flags is an MS_ASYNC and start < vm_start Subsystem: mm/gup Joao Martins <joao.m.martins@oracle.com>: Patch series "mm/gup: page unpining improvements", v4: mm/gup: add compound page list iterator mm/gup: decrement head page once for group of subpages mm/gup: add a range variant of unpin_user_pages_dirty_lock() RDMA/umem: batch page unpin in __ib_umem_release() Yang Shi <shy828301@gmail.com>: mm: gup: remove FOLL_SPLIT Subsystem: mm/memremap Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/memremap.c: fix improper SPDX comment style Subsystem: mm/memcg Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: fix kernel stack account Shakeel Butt <shakeelb@google.com>: memcg: cleanup root memcg checks memcg: enable memcg oom-kill for __GFP_NOFAIL Johannes Weiner <hannes@cmpxchg.org>: Patch series "mm: memcontrol: switch to rstat", v3: mm: memcontrol: fix cpuhotplug statistics flushing mm: memcontrol: kill mem_cgroup_nodeinfo() mm: memcontrol: privatize memcg_page_state query functions cgroup: rstat: support cgroup1 cgroup: rstat: punt root-level optimization to individual controllers mm: memcontrol: switch to rstat mm: memcontrol: consolidate lruvec stat flushing kselftests: cgroup: update kmem test for new vmstat implementation Shakeel Butt <shakeelb@google.com>: memcg: charge before adding to swapcache on swapin Muchun Song <songmuchun@bytedance.com>: Patch series "Use obj_cgroup APIs to charge kmem pages", v5: mm: memcontrol: slab: fix obtain a reference to a freeing memcg mm: memcontrol: introduce obj_cgroup_{un}charge_pages mm: memcontrol: directly access page->memcg_data in mm/page_alloc.c mm: memcontrol: change ug->dummy_page only if memcg changed mm: memcontrol: use obj_cgroup APIs to charge kmem pages mm: memcontrol: inline __memcg_kmem_{un}charge() into obj_cgroup_{un}charge_pages() mm: memcontrol: move PageMemcgKmem to the scope of CONFIG_MEMCG_KMEM Wan Jiabing <wanjiabing@vivo.com>: linux/memcontrol.h: remove duplicate struct declaration Johannes Weiner <hannes@cmpxchg.org>: mm: page_counter: mitigate consequences of a page_counter underflow Subsystem: mm/pagemap Wang Qing <wangqing@vivo.com>: mm/memory.c: do_numa_page(): delete bool "migrated" Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/interval_tree: add comments to improve code readability Oscar Salvador <osalvador@suse.de>: Patch series "Cleanup and fixups for vmemmap handling", v6: x86/vmemmap: drop handling of 4K unaligned vmemmap range x86/vmemmap: drop handling of 1GB vmemmap ranges x86/vmemmap: handle unpopulated sub-pmd ranges x86/vmemmap: optimize for consecutive sections in partial populated PMDs Ovidiu Panait <ovidiu.panait@windriver.com>: mm, tracing: improve rss_stat tracepoint message Christoph Hellwig <hch@lst.de>: Patch series "add remap_pfn_range_notrack instead of reinventing it in i915", v2: mm: add remap_pfn_range_notrack mm: add a io_mapping_map_user helper i915: use io_mapping_map_user i915: fix remap_io_sg to verify the pgprot Huang Ying <ying.huang@intel.com>: NUMA balancing: reduce TLB flush via delaying mapping on hint page fault Subsystem: mm/mremap Brian Geffon <bgeffon@google.com>: Patch series "mm: Extend MREMAP_DONTUNMAP to non-anonymous mappings", v5: mm: extend MREMAP_DONTUNMAP to non-anonymous mappings Revert "mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio" selftests: add a MREMAP_DONTUNMAP selftest for shmem Subsystem: mm/dma Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/dmapool: switch from strlcpy to strscpy Subsystem: mm/sparsemem Wang Wensheng <wangwensheng4@huawei.com>: mm/sparse: add the missing sparse_buffer_fini() in error branch Subsystem: mm/vmalloc Christoph Hellwig <hch@lst.de>: Patch series "remap_vmalloc_range cleanups": samples/vfio-mdev/mdpy: use remap_vmalloc_range mm: unexport remap_vmalloc_range_partial Serapheim Dimitropoulos <serapheim.dimitro@delphix.com>: mm/vmalloc: use rb_tree instead of list for vread() lookups Nicholas Piggin <npiggin@gmail.com>: Patch series "huge vmalloc mappings", v13: ARM: mm: add missing pud_page define to 2-level page tables mm/vmalloc: fix HUGE_VMAP regression by enabling huge pages in vmalloc_to_page mm: apply_to_pte_range warn and fail if a large pte is encountered mm/vmalloc: rename vmap_*_range vmap_pages_*_range mm/ioremap: rename ioremap_*_range to vmap_*_range mm: HUGE_VMAP arch support cleanup powerpc: inline huge vmap supported functions arm64: inline huge vmap supported functions x86: inline huge vmap supported functions mm/vmalloc: provide fallback arch huge vmap support functions mm: move vmap_range from mm/ioremap.c to mm/vmalloc.c mm/vmalloc: add vmap_range_noflush variant mm/vmalloc: hugepage vmalloc mappings Patch series "mm/vmalloc: cleanup after hugepage series", v2: mm/vmalloc: remove map_kernel_range kernel/dma: remove unnecessary unmap_kernel_range powerpc/xive: remove unnecessary unmap_kernel_range mm/vmalloc: remove unmap_kernel_range mm/vmalloc: improve allocation failure error messages Vijayanand Jitta <vjitta@codeaurora.org>: mm: vmalloc: prevent use after free in _vm_unmap_aliases "Uladzislau Rezki (Sony)" <urezki@gmail.com>: lib/test_vmalloc.c: remove two kvfree_rcu() tests lib/test_vmalloc.c: add a new 'nr_threads' parameter vm/test_vmalloc.sh: adapt for updated driver interface mm/vmalloc: refactor the preloading loagic mm/vmalloc: remove an empty line Subsystem: mm/documentation "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/doc: fix fault_flag_allow_retry_first kerneldoc mm/doc: fix page_maybe_dma_pinned kerneldoc mm/doc: turn fault flags into an enum mm/doc: add mm.h and mm_types.h to the mm-api document Lukas Bulwahn <lukas.bulwahn@gmail.com>: Patch series "kernel-doc and MAINTAINERS clean-up": MAINTAINERS: assign pagewalk.h to MEMORY MANAGEMENT pagewalk: prefix struct kernel-doc descriptions Subsystem: mm/kasan Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/kasan: switch from strlcpy to strscpy Peter Collingbourne <pcc@google.com>: kasan: fix kasan_byte_accessible() to be consistent with actual checks Andrey Konovalov <andreyknvl@google.com>: kasan: initialize shadow to TAG_INVALID for SW_TAGS mm, kasan: don't poison boot memory with tag-based modes Patch series "kasan: integrate with init_on_alloc/free", v3: arm64: kasan: allow to init memory when setting tags kasan: init memory in kasan_(un)poison for HW_TAGS kasan, mm: integrate page_alloc init with HW_TAGS kasan, mm: integrate slab init_on_alloc with HW_TAGS kasan, mm: integrate slab init_on_free with HW_TAGS kasan: docs: clean up sections kasan: docs: update overview section kasan: docs: update usage section kasan: docs: update error reports section kasan: docs: update boot parameters section kasan: docs: update GENERIC implementation details section kasan: docs: update SW_TAGS implementation details section kasan: docs: update HW_TAGS implementation details section kasan: docs: update shadow memory section kasan: docs: update ignoring accesses section kasan: docs: update tests section Walter Wu <walter-zh.wu@mediatek.com>: kasan: record task_work_add() call stack Andrey Konovalov <andreyknvl@google.com>: kasan: detect false-positives in tests Zqiang <qiang.zhang@windriver.com>: irq_work: record irq_work_queue() call stack Subsystem: mm/initialization Kefeng Wang <wangkefeng.wang@huawei.com>: mm: move mem_init_print_info() into mm_init() Subsystem: mm/pagealloc David Hildenbrand <david@redhat.com>: mm/page_alloc: drop pr_info_ratelimited() in alloc_contig_range() Minchan Kim <minchan@kernel.org>: mm: remove lru_add_drain_all in alloc_contig_range Yu Zhao <yuzhao@google.com>: include/linux/page-flags-layout.h: correctly determine LAST_CPUPID_WIDTH include/linux/page-flags-layout.h: cleanups "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Rationalise __alloc_pages wrappers", v3: mm/page_alloc: rename alloc_mask to alloc_gfp mm/page_alloc: rename gfp_mask to gfp mm/page_alloc: combine __alloc_pages and __alloc_pages_nodemask mm/mempolicy: rename alloc_pages_current to alloc_pages mm/mempolicy: rewrite alloc_pages documentation mm/mempolicy: rewrite alloc_pages_vma documentation mm/mempolicy: fix mpol_misplaced kernel-doc Minchan Kim <minchan@kernel.org>: mm: page_alloc: dump migrate-failed pages Geert Uytterhoeven <geert@linux-m68k.org>: mm/Kconfig: remove default DISCONTIGMEM_MANUAL Kefeng Wang <wangkefeng.wang@huawei.com>: mm, page_alloc: avoid page_to_pfn() in move_freepages() zhouchuangao <zhouchuangao@vivo.com>: mm/page_alloc: duplicate include linux/vmalloc.h Mel Gorman <mgorman@techsingularity.net>: Patch series "Introduce a bulk order-0 page allocator with two in-tree users", v6: mm/page_alloc: rename alloced to allocated mm/page_alloc: add a bulk page allocator mm/page_alloc: add an array-based interface to the bulk page allocator Jesper Dangaard Brouer <brouer@redhat.com>: mm/page_alloc: optimize code layout for __alloc_pages_bulk mm/page_alloc: inline __rmqueue_pcplist Chuck Lever <chuck.lever@oracle.com>: Patch series "SUNRPC consumer for the bulk page allocator": SUNRPC: set rq_page_end differently SUNRPC: refresh rq_pages using a bulk page allocator Jesper Dangaard Brouer <brouer@redhat.com>: net: page_pool: refactor dma_map into own function page_pool_dma_map net: page_pool: use alloc_pages_bulk in refill code path Sergei Trofimovich <slyfox@gentoo.org>: mm: page_alloc: ignore init_on_free=1 for debug_pagealloc=1 huxiang <huxiang@uniontech.com>: mm/page_alloc: redundant definition variables of pfn in for loop Mike Rapoport <rppt@linux.ibm.com>: mm/mmzone.h: fix existing kernel-doc comments and link them to core-api Subsystem: mm/memory-failure Jane Chu <jane.chu@oracle.com>: mm/memory-failure: unnecessary amount of unmapping Documentation/admin-guide/kernel-parameters.txt | 7 Documentation/admin-guide/mm/transhuge.rst | 2 Documentation/core-api/cachetlb.rst | 4 Documentation/core-api/mm-api.rst | 6 Documentation/dev-tools/kasan.rst | 355 +++++----- Documentation/vm/page_owner.rst | 2 Documentation/vm/transhuge.rst | 5 MAINTAINERS | 1 arch/Kconfig | 11 arch/alpha/mm/init.c | 1 arch/arc/mm/init.c | 1 arch/arm/Kconfig | 1 arch/arm/include/asm/pgtable-3level.h | 2 arch/arm/include/asm/pgtable.h | 3 arch/arm/mm/copypage-v4mc.c | 1 arch/arm/mm/copypage-v6.c | 1 arch/arm/mm/copypage-xscale.c | 1 arch/arm/mm/init.c | 2 arch/arm64/Kconfig | 1 arch/arm64/include/asm/memory.h | 4 arch/arm64/include/asm/mte-kasan.h | 39 - arch/arm64/include/asm/vmalloc.h | 38 - arch/arm64/mm/init.c | 4 arch/arm64/mm/mmu.c | 36 - arch/csky/abiv1/cacheflush.c | 1 arch/csky/mm/init.c | 1 arch/h8300/mm/init.c | 2 arch/hexagon/mm/init.c | 1 arch/ia64/Kconfig | 23 arch/ia64/configs/bigsur_defconfig | 1 arch/ia64/include/asm/meminit.h | 11 arch/ia64/include/asm/module.h | 6 arch/ia64/include/asm/page.h | 25 arch/ia64/include/asm/pgtable.h | 7 arch/ia64/kernel/Makefile | 2 arch/ia64/kernel/acpi.c | 7 arch/ia64/kernel/efi.c | 11 arch/ia64/kernel/fsys.S | 4 arch/ia64/kernel/head.S | 6 arch/ia64/kernel/ia64_ksyms.c | 12 arch/ia64/kernel/machine_kexec.c | 2 arch/ia64/kernel/mca.c | 4 arch/ia64/kernel/module.c | 29 arch/ia64/kernel/pal.S | 6 arch/ia64/mm/Makefile | 1 arch/ia64/mm/contig.c | 4 arch/ia64/mm/discontig.c | 21 arch/ia64/mm/fault.c | 15 arch/ia64/mm/init.c | 221 ------ arch/m68k/mm/init.c | 1 arch/microblaze/mm/init.c | 1 arch/mips/Kconfig | 1 arch/mips/loongson64/numa.c | 1 arch/mips/mm/cache.c | 1 arch/mips/mm/init.c | 1 arch/mips/sgi-ip27/ip27-memory.c | 1 arch/nds32/mm/init.c | 1 arch/nios2/mm/cacheflush.c | 1 arch/nios2/mm/init.c | 1 arch/openrisc/mm/init.c | 2 arch/parisc/mm/init.c | 2 arch/powerpc/Kconfig | 1 arch/powerpc/include/asm/vmalloc.h | 34 - arch/powerpc/kernel/isa-bridge.c | 4 arch/powerpc/kernel/pci_64.c | 2 arch/powerpc/mm/book3s64/radix_pgtable.c | 29 arch/powerpc/mm/ioremap.c | 2 arch/powerpc/mm/mem.c | 1 arch/powerpc/sysdev/xive/common.c | 4 arch/riscv/mm/init.c | 1 arch/s390/mm/init.c | 2 arch/sh/include/asm/tlb.h | 10 arch/sh/mm/cache-sh4.c | 1 arch/sh/mm/cache-sh7705.c | 1 arch/sh/mm/init.c | 1 arch/sparc/include/asm/pgtable_32.h | 3 arch/sparc/mm/init_32.c | 2 arch/sparc/mm/init_64.c | 1 arch/sparc/mm/tlb.c | 1 arch/um/kernel/mem.c | 1 arch/x86/Kconfig | 1 arch/x86/include/asm/vmalloc.h | 42 - arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 2 arch/x86/mm/init_32.c | 2 arch/x86/mm/init_64.c | 222 ++++-- arch/x86/mm/ioremap.c | 33 arch/x86/mm/pgtable.c | 13 arch/xtensa/Kconfig | 1 arch/xtensa/mm/init.c | 1 block/blk-cgroup.c | 17 drivers/gpu/drm/i915/Kconfig | 1 drivers/gpu/drm/i915/gem/i915_gem_mman.c | 9 drivers/gpu/drm/i915/i915_drv.h | 3 drivers/gpu/drm/i915/i915_mm.c | 117 --- drivers/infiniband/core/umem.c | 12 drivers/pci/pci.c | 2 fs/aio.c | 5 fs/fs_parser.c | 2 fs/iomap/direct-io.c | 24 fs/ocfs2/blockcheck.c | 2 fs/ocfs2/dlm/dlmrecovery.c | 7 fs/ocfs2/stack_o2cb.c | 36 - fs/ocfs2/stackglue.c | 2 include/linux/compiler-gcc.h | 8 include/linux/fs.h | 2 include/linux/gfp.h | 45 - include/linux/io-mapping.h | 3 include/linux/io.h | 9 include/linux/kasan.h | 51 + include/linux/memcontrol.h | 271 ++++---- include/linux/mm.h | 50 - include/linux/mmzone.h | 43 - include/linux/page-flags-layout.h | 64 - include/linux/pagemap.h | 10 include/linux/pagewalk.h | 4 include/linux/sched.h | 4 include/linux/slab.h | 2 include/linux/slub_def.h | 2 include/linux/vmalloc.h | 73 +- include/linux/vmstat.h | 24 include/net/page_pool.h | 2 include/trace/events/kmem.h | 24 init/main.c | 2 kernel/cgroup/cgroup.c | 34 - kernel/cgroup/rstat.c | 61 + kernel/dma/remap.c | 1 kernel/fork.c | 13 kernel/irq_work.c | 7 kernel/task_work.c | 3 kernel/watchdog.c | 102 +-- lib/Kconfig.debug | 14 lib/Makefile | 1 lib/test_kasan.c | 59 - lib/test_slub.c | 124 +++ lib/test_vmalloc.c | 128 +-- mm/Kconfig | 4 mm/Makefile | 1 mm/debug_vm_pgtable.c | 4 mm/dmapool.c | 2 mm/filemap.c | 61 + mm/gup.c | 145 +++- mm/hugetlb.c | 2 mm/internal.h | 25 mm/interval_tree.c | 2 mm/io-mapping.c | 29 mm/ioremap.c | 361 ++-------- mm/kasan/common.c | 53 - mm/kasan/generic.c | 12 mm/kasan/kasan.h | 28 mm/kasan/report_generic.c | 2 mm/kasan/shadow.c | 10 mm/kasan/sw_tags.c | 12 mm/kmemleak.c | 2 mm/memcontrol.c | 798 ++++++++++++------------ mm/memory-failure.c | 2 mm/memory.c | 191 +++-- mm/mempolicy.c | 78 -- mm/mempool.c | 4 mm/memremap.c | 2 mm/migrate.c | 2 mm/mm_init.c | 4 mm/mmap.c | 6 mm/mremap.c | 6 mm/msync.c | 6 mm/page-writeback.c | 9 mm/page_alloc.c | 430 +++++++++--- mm/page_counter.c | 8 mm/page_owner.c | 68 -- mm/page_poison.c | 6 mm/percpu-vm.c | 7 mm/slab.c | 43 - mm/slab.h | 24 mm/slab_common.c | 10 mm/slub.c | 215 ++---- mm/sparse.c | 1 mm/swap_state.c | 13 mm/util.c | 10 mm/vmalloc.c | 728 ++++++++++++++++----- net/core/page_pool.c | 127 ++- net/sunrpc/svc_xprt.c | 38 - samples/kfifo/bytestream-example.c | 8 samples/kfifo/inttype-example.c | 8 samples/kfifo/record-example.c | 8 samples/vfio-mdev/mdpy.c | 4 scripts/checkdeclares.pl | 53 + scripts/spelling.txt | 26 tools/testing/selftests/cgroup/test_kmem.c | 22 tools/testing/selftests/vm/mremap_dontunmap.c | 52 + tools/testing/selftests/vm/test_vmalloc.sh | 21 189 files changed, 3642 insertions(+), 3013 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-04-23 21:28 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-04-23 21:28 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 5 patches, based on 5bfc75d92efd494db37f5c4c173d3639d4772966. Subsystems affected by this patch series: coda overlayfs mm/pagecache mm/memcg Subsystem: coda Christian König <christian.koenig@amd.com>: coda: fix reference counting in coda_file_mmap error path Subsystem: overlayfs Christian König <christian.koenig@amd.com>: ovl: fix reference counting in ovl_mmap error path Subsystem: mm/pagecache Hugh Dickins <hughd@google.com>: mm/filemap: fix find_lock_entries hang on 32-bit THP mm/filemap: fix mapping_seek_hole_data on THP & 32-bit Subsystem: mm/memcg Vasily Averin <vvs@virtuozzo.com>: tools/cgroup/slabinfo.py: updated to work on current kernel fs/coda/file.c | 6 +++--- fs/overlayfs/file.c | 11 +---------- mm/filemap.c | 31 +++++++++++++++++++------------ tools/cgroup/memcg_slabinfo.py | 8 ++++---- 4 files changed, 27 insertions(+), 29 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-04-16 22:45 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-04-16 22:45 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 12 patches, based on 06c2aac4014c38247256fe49c61b7f55890271e7. Subsystems affected by this patch series: mm/documentation mm/kasan csky ia64 mm/pagemap gcov lib Subsystem: mm/documentation Randy Dunlap <rdunlap@infradead.org>: mm: eliminate "expecting prototype" kernel-doc warnings Subsystem: mm/kasan Arnd Bergmann <arnd@arndb.de>: kasan: fix hwasan build for gcc Walter Wu <walter-zh.wu@mediatek.com>: kasan: remove redundant config option Subsystem: csky Randy Dunlap <rdunlap@infradead.org>: csky: change a Kconfig symbol name to fix e1000 build error Subsystem: ia64 Randy Dunlap <rdunlap@infradead.org>: ia64: remove duplicate entries in generic_defconfig ia64: fix discontig.c section mismatches John Paul Adrian Glaubitz <glaubitz () physik ! fu-berlin ! de>: ia64: tools: remove inclusion of ia64-specific version of errno.h header John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>: ia64: tools: remove duplicate definition of ia64_mf() on ia64 Subsystem: mm/pagemap Zack Rusin <zackr@vmware.com>: mm/mapping_dirty_helpers: guard hugepage pud's usage Christophe Leroy <christophe.leroy@csgroup.eu>: mm: ptdump: fix build failure Subsystem: gcov Johannes Berg <johannes.berg@intel.com>: gcov: clang: fix clang-11+ build Subsystem: lib Randy Dunlap <rdunlap@infradead.org>: lib: remove "expecting prototype" kernel-doc warnings arch/arm64/kernel/sleep.S | 2 +- arch/csky/Kconfig | 2 +- arch/csky/include/asm/page.h | 2 +- arch/ia64/configs/generic_defconfig | 2 -- arch/ia64/mm/discontig.c | 6 +++--- arch/x86/kernel/acpi/wakeup_64.S | 2 +- include/linux/kasan.h | 2 +- kernel/gcov/clang.c | 2 +- lib/Kconfig.kasan | 9 ++------- lib/earlycpio.c | 4 ++-- lib/lru_cache.c | 3 ++- lib/parman.c | 4 ++-- lib/radix-tree.c | 11 ++++++----- mm/kasan/common.c | 2 +- mm/kasan/kasan.h | 2 +- mm/kasan/report_generic.c | 2 +- mm/mapping_dirty_helpers.c | 2 ++ mm/mmu_gather.c | 29 +++++++++++++++++++---------- mm/oom_kill.c | 2 +- mm/ptdump.c | 2 +- mm/shuffle.c | 4 ++-- scripts/Makefile.kasan | 22 ++++++++++++++-------- security/Kconfig.hardening | 4 ++-- tools/arch/ia64/include/asm/barrier.h | 3 --- tools/include/uapi/asm/errno.h | 2 -- 25 files changed, 67 insertions(+), 60 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-04-09 20:26 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-04-09 20:26 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 16 patches, based on 17e7124aad766b3f158943acb51467f86220afe9. Subsystems affected by this patch series: MAINTAINERS mailmap mm/kasan mm/gup nds32 gcov ocfs2 ia64 mm/pagecache mm/kasan mm/kfence lib Subsystem: MAINTAINERS Marek Behún <kabel@kernel.org>: MAINTAINERS: update CZ.NIC's Turris information treewide: change my e-mail address, fix my name Subsystem: mailmap Jordan Crouse <jordan@cosmicpenguin.net>: mailmap: update email address for Jordan Crouse Matthew Wilcox <willy@infradead.org>: .mailmap: fix old email addresses Subsystem: mm/kasan Arnd Bergmann <arnd@arndb.de>: kasan: fix hwasan build for gcc Walter Wu <walter-zh.wu@mediatek.com>: kasan: remove redundant config option Subsystem: mm/gup Aili Yao <yaoaili@kingsoft.com>: mm/gup: check page posion status for coredump. Subsystem: nds32 Mike Rapoport <rppt@linux.ibm.com>: nds32: flush_dcache_page: use page_mapping_file to avoid races with swapoff Subsystem: gcov Nick Desaulniers <ndesaulniers@google.com>: gcov: re-fix clang-11+ support Subsystem: ocfs2 Wengang Wang <wen.gang.wang@oracle.com>: ocfs2: fix deadlock between setattr and dio_end_io_write Subsystem: ia64 Sergei Trofimovich <slyfox@gentoo.org>: ia64: fix user_stack_pointer() for ptrace() Subsystem: mm/pagecache Jack Qiu <jack.qiu@huawei.com>: fs: direct-io: fix missing sdio->boundary Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: fix conflict with page poisoning Andrew Morton <akpm@linux-foundation.org>: lib/test_kasan_module.c: suppress unused var warning Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence, x86: fix preemptible warning on KPTI-enabled systems Subsystem: lib Julian Braha <julianbraha@gmail.com>: lib: fix kconfig dependency on ARCH_WANT_FRAME_POINTERS .mailmap | 7 ++ Documentation/ABI/testing/debugfs-moxtet | 4 - Documentation/ABI/testing/debugfs-turris-mox-rwtm | 2 Documentation/ABI/testing/sysfs-bus-moxtet-devices | 6 +- Documentation/ABI/testing/sysfs-class-led-driver-turris-omnia | 2 Documentation/ABI/testing/sysfs-firmware-turris-mox-rwtm | 10 +-- Documentation/devicetree/bindings/leds/cznic,turris-omnia-leds.yaml | 2 MAINTAINERS | 13 +++- arch/arm64/boot/dts/marvell/armada-3720-turris-mox.dts | 2 arch/arm64/kernel/sleep.S | 2 arch/ia64/include/asm/ptrace.h | 8 -- arch/nds32/mm/cacheflush.c | 2 arch/x86/include/asm/kfence.h | 7 ++ arch/x86/kernel/acpi/wakeup_64.S | 2 drivers/bus/moxtet.c | 4 - drivers/firmware/turris-mox-rwtm.c | 4 - drivers/gpio/gpio-moxtet.c | 4 - drivers/leds/leds-turris-omnia.c | 4 - drivers/mailbox/armada-37xx-rwtm-mailbox.c | 4 - drivers/watchdog/armada_37xx_wdt.c | 4 - fs/direct-io.c | 5 + fs/ocfs2/aops.c | 11 --- fs/ocfs2/file.c | 8 ++ include/dt-bindings/bus/moxtet.h | 2 include/linux/armada-37xx-rwtm-mailbox.h | 2 include/linux/kasan.h | 2 include/linux/moxtet.h | 2 kernel/gcov/clang.c | 29 ++++++---- lib/Kconfig.debug | 6 +- lib/Kconfig.kasan | 9 --- lib/test_kasan_module.c | 2 mm/gup.c | 4 + mm/internal.h | 20 ++++++ mm/kasan/common.c | 2 mm/kasan/kasan.h | 2 mm/kasan/report_generic.c | 2 mm/page_poison.c | 4 + scripts/Makefile.kasan | 18 ++++-- security/Kconfig.hardening | 4 - 39 files changed, 136 insertions(+), 91 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-03-25 4:36 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-03-25 4:36 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 14 patches, based on 7acac4b3196caee5e21fb5ea53f8bc124e6a16fc. Subsystems affected by this patch series: mm/hugetlb mm/kasan mm/gup mm/selftests mm/z3fold squashfs ia64 gcov mm/kfence mm/memblock mm/highmem mailmap Subsystem: mm/hugetlb Miaohe Lin <linmiaohe@huawei.com>: hugetlb_cgroup: fix imbalanced css_get and css_put pair for shared mappings Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: fix per-page tags for non-page_alloc pages Subsystem: mm/gup Sean Christopherson <seanjc@google.com>: mm/mmu_notifiers: ensure range_end() is paired with range_start() Subsystem: mm/selftests Rong Chen <rong.a.chen@intel.com>: selftests/vm: fix out-of-tree build Subsystem: mm/z3fold Thomas Hebb <tommyhebb@gmail.com>: z3fold: prevent reclaim/free race for headless pages Subsystem: squashfs Sean Nyekjaer <sean@geanix.com>: squashfs: fix inode lookup sanity checks Phillip Lougher <phillip@squashfs.org.uk>: squashfs: fix xattr id and id lookup sanity checks Subsystem: ia64 Sergei Trofimovich <slyfox@gentoo.org>: ia64: mca: allocate early mca with GFP_ATOMIC ia64: fix format strings for err_inject Subsystem: gcov Nick Desaulniers <ndesaulniers@google.com>: gcov: fix clang-11+ support Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: make compatible with kmemleak Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: mm: memblock: fix section mismatch warning again Subsystem: mm/highmem Ira Weiny <ira.weiny@intel.com>: mm/highmem: fix CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP Subsystem: mailmap Andrey Konovalov <andreyknvl@google.com>: mailmap: update Andrey Konovalov's email address .mailmap | 1 arch/ia64/kernel/err_inject.c | 22 +++++------ arch/ia64/kernel/mca.c | 2 - fs/squashfs/export.c | 8 +++- fs/squashfs/id.c | 6 ++- fs/squashfs/squashfs_fs.h | 1 fs/squashfs/xattr_id.c | 6 ++- include/linux/hugetlb_cgroup.h | 15 ++++++- include/linux/memblock.h | 4 +- include/linux/mm.h | 18 +++++++-- include/linux/mmu_notifier.h | 10 ++--- kernel/gcov/clang.c | 69 ++++++++++++++++++++++++++++++++++++ mm/highmem.c | 4 +- mm/hugetlb.c | 41 +++++++++++++++++++-- mm/hugetlb_cgroup.c | 10 ++++- mm/kfence/core.c | 9 ++++ mm/kmemleak.c | 3 + mm/mmu_notifier.c | 23 ++++++++++++ mm/z3fold.c | 16 +++++++- tools/testing/selftests/vm/Makefile | 4 +- 20 files changed, 230 insertions(+), 42 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-03-13 5:06 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-03-13 5:06 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 29 patches, based on f78d76e72a4671ea52d12752d92077788b4f5d50. Subsystems affected by this patch series: mm/memblock core-kernel kconfig mm/pagealloc fork mm/hugetlb mm/highmem binfmt MAINTAINERS kbuild mm/kfence mm/oom-kill mm/madvise mm/kasan mm/userfaultfd mm/memory-failure ia64 mm/memcg mm/zram Subsystem: mm/memblock Arnd Bergmann <arnd@arndb.de>: memblock: fix section mismatch warning Subsystem: core-kernel Arnd Bergmann <arnd@arndb.de>: stop_machine: mark helpers __always_inline Subsystem: kconfig Masahiro Yamada <masahiroy@kernel.org>: init/Kconfig: make COMPILE_TEST depend on HAS_IOMEM Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: mm/page_alloc.c: refactor initialization of struct page for holes in memory layout Subsystem: fork Fenghua Yu <fenghua.yu@intel.com>: mm/fork: clear PASID for new mm Subsystem: mm/hugetlb Peter Xu <peterx@redhat.com>: Patch series "mm/hugetlb: Early cow on fork, and a few cleanups", v5: hugetlb: dedup the code to add a new file_region hugetlb: break earlier in add_reservation_in_range() when we can mm: introduce page_needs_cow_for_dma() for deciding whether cow mm: use is_cow_mapping() across tree where proper hugetlb: do early cow when page pinned on src mm Subsystem: mm/highmem OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>: mm/highmem.c: fix zero_user_segments() with start > end Subsystem: binfmt Lior Ribak <liorribak@gmail.com>: binfmt_misc: fix possible deadlock in bm_register_write Subsystem: MAINTAINERS Vlastimil Babka <vbabka@suse.cz>: MAINTAINERS: exclude uapi directories in API/ABI section Subsystem: kbuild Arnd Bergmann <arnd@arndb.de>: linux/compiler-clang.h: define HAVE_BUILTIN_BSWAP* Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: fix printk format for ptrdiff_t kfence, slab: fix cache_alloc_debugcheck_after() for bulk allocations kfence: fix reports if constant function prefixes exist Subsystem: mm/oom-kill "Matthew Wilcox (Oracle)" <willy@infradead.org>: include/linux/sched/mm.h: use rcu_dereference in in_vfork() Subsystem: mm/madvise Suren Baghdasaryan <surenb@google.com>: mm/madvise: replace ptrace attach requirement for process_madvise Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan, mm: fix crash with HW_TAGS and DEBUG_PAGEALLOC kasan: fix KASAN_STACK dependency for HW_TAGS Subsystem: mm/userfaultfd Nadav Amit <namit@vmware.com>: mm/userfaultfd: fix memory corruption due to writeprotect Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm, hwpoison: do not lock page again when me_huge_page() successfully recovers Subsystem: ia64 Sergei Trofimovich <slyfox@gentoo.org>: ia64: fix ia64_syscall_get_set_arguments() for break-based syscalls ia64: fix ptrace(PTRACE_SYSCALL_INFO_EXIT) sign Subsystem: mm/memcg Zhou Guanghui <zhouguanghui1@huawei.com>: mm/memcg: rename mem_cgroup_split_huge_fixup to split_page_memcg and add nr_pages argument mm/memcg: set memcg when splitting page Subsystem: mm/zram Minchan Kim <minchan@kernel.org>: zram: fix return value on writeback_store zram: fix broken page writeback MAINTAINERS | 4 arch/ia64/include/asm/syscall.h | 2 arch/ia64/kernel/ptrace.c | 24 +++- drivers/block/zram/zram_drv.c | 17 +- drivers/gpu/drm/vmwgfx/vmwgfx_page_dirty.c | 4 drivers/gpu/drm/vmwgfx/vmwgfx_ttm_glue.c | 2 fs/binfmt_misc.c | 29 ++--- fs/proc/task_mmu.c | 2 include/linux/compiler-clang.h | 6 + include/linux/memblock.h | 4 include/linux/memcontrol.h | 6 - include/linux/mm.h | 21 +++ include/linux/mm_types.h | 1 include/linux/sched/mm.h | 3 include/linux/stop_machine.h | 11 + init/Kconfig | 3 kernel/fork.c | 8 + lib/Kconfig.kasan | 1 mm/highmem.c | 17 ++ mm/huge_memory.c | 10 - mm/hugetlb.c | 123 +++++++++++++++------ mm/internal.h | 5 mm/kfence/report.c | 30 +++-- mm/madvise.c | 13 ++ mm/memcontrol.c | 15 +- mm/memory-failure.c | 4 mm/memory.c | 16 +- mm/page_alloc.c | 167 ++++++++++++++--------------- mm/slab.c | 2 29 files changed, 334 insertions(+), 216 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-02-26 1:14 Andrew Morton 2021-02-26 17:55 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2021-02-26 1:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - The rest of MM. Includes kfence - another runtime memory validator. Not as thorough as KASAN, but it has unmeasurable overhead and is intended to be usable in production builds. - Everything else 118 patches, based on 6fbd6cf85a3be127454a1ad58525a3adcf8612ab. Subsystems affected by this patch series: mm/thp mm/cma mm/vmstat mm/memory-hotplug mm/mlock mm/rmap mm/zswap mm/zsmalloc mm/cleanups mm/kfence mm/kasan2 alpha procfs sysctl misc core-kernel MAINTAINERS lib bitops checkpatch init coredump seq_file gdb ubsan initramfs mm/pagemap2 Subsystem: mm/thp "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Overhaul multi-page lookups for THP", v4: mm: make pagecache tagged lookups return only head pages mm/shmem: use pagevec_lookup in shmem_unlock_mapping mm/swap: optimise get_shadow_from_swap_cache mm: add FGP_ENTRY mm/filemap: rename find_get_entry to mapping_get_entry mm/filemap: add helper for finding pages mm/filemap: add mapping_seek_hole_data iomap: use mapping_seek_hole_data mm: add and use find_lock_entries mm: add an 'end' parameter to find_get_entries mm: add an 'end' parameter to pagevec_lookup_entries mm: remove nr_entries parameter from pagevec_lookup_entries mm: pass pvec directly to find_get_entries mm: remove pagevec_lookup_entries Rik van Riel <riel@surriel.com>: Patch series "mm,thp,shm: limit shmem THP alloc gfp_mask", v6: mm,thp,shmem: limit shmem THP alloc gfp_mask mm,thp,shm: limit gfp mask to no more than specified mm,thp,shmem: make khugepaged obey tmpfs mount flags mm,shmem,thp: limit shmem THP allocations to requested zones Subsystem: mm/cma Roman Gushchin <guro@fb.com>: mm: cma: allocate cma areas bottom-up David Hildenbrand <david@redhat.com>: mm/cma: expose all pages to the buddy if activation of an area fails mm/page_alloc: count CMA pages per zone and print them in /proc/zoneinfo Patrick Daly <pdaly@codeaurora.org>: mm: cma: print region name on failure Subsystem: mm/vmstat Johannes Weiner <hannes@cmpxchg.org>: mm: vmstat: fix NOHZ wakeups for node stat changes mm: vmstat: add some comments on internal storage of byte items Jiang Biao <benbjiang@tencent.com>: mm/vmstat.c: erase latency in vmstat_shepherd Subsystem: mm/memory-hotplug Dan Williams <dan.j.williams@intel.com>: Patch series "mm: Fix pfn_to_online_page() with respect to ZONE_DEVICE", v4: mm: move pfn_to_online_page() out of line mm: teach pfn_to_online_page() to consider subsection validity mm: teach pfn_to_online_page() about ZONE_DEVICE section collisions mm: fix memory_failure() handling of dax-namespace metadata Anshuman Khandual <anshuman.khandual@arm.com>: mm/memory_hotplug: rename all existing 'memhp' into 'mhp' David Hildenbrand <david@redhat.com>: mm/memory_hotplug: MEMHP_MERGE_RESOURCE -> MHP_MERGE_RESOURCE Miaohe Lin <linmiaohe@huawei.com>: mm/memory_hotplug: use helper function zone_end_pfn() to get end_pfn David Hildenbrand <david@redhat.com>: drivers/base/memory: don't store phys_device in memory blocks Documentation: sysfs/memory: clarify some memory block device properties Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/memory_hotplug: Pre-validate the address range with platform", v5: mm/memory_hotplug: prevalidate the address range being added with platform arm64/mm: define arch_get_mappable_range() s390/mm: define arch_get_mappable_range() David Hildenbrand <david@redhat.com>: virtio-mem: check against mhp_get_pluggable_range() which memory we can hotplug Subsystem: mm/mlock Miaohe Lin <linmiaohe@huawei.com>: mm/mlock: stop counting mlocked pages when none vma is found Subsystem: mm/rmap Miaohe Lin <linmiaohe@huawei.com>: mm/rmap: correct some obsolete comments of anon_vma mm/rmap: remove unneeded semicolon in page_not_mapped() mm/rmap: fix obsolete comment in __page_check_anon_rmap() mm/rmap: use page_not_mapped in try_to_unmap() mm/rmap: correct obsolete comment of page_get_anon_vma() mm/rmap: fix potential pte_unmap on an not mapped pte Subsystem: mm/zswap Randy Dunlap <rdunlap@infradead.org>: mm: zswap: clean up confusing comment Tian Tao <tiantao6@hisilicon.com>: Patch series "Fix the compatibility of zsmalloc and zswap": mm/zswap: add the flag can_sleep_mapped mm: set the sleep_mapped to true for zbud and z3fold Subsystem: mm/zsmalloc Miaohe Lin <linmiaohe@huawei.com>: mm/zsmalloc.c: convert to use kmem_cache_zalloc in cache_alloc_zspage() Rokudo Yan <wu-yan@tcl.com>: zsmalloc: account the number of compacted pages correctly Miaohe Lin <linmiaohe@huawei.com>: mm/zsmalloc.c: use page_private() to access page->private Subsystem: mm/cleanups Guo Ren <guoren@linux.alibaba.com>: mm: page-flags.h: Typo fix (It -> If) Daniel Vetter <daniel.vetter@ffwll.ch>: mm/dmapool: use might_alloc() mm/backing-dev.c: use might_alloc() Stephen Zhang <stephenzhangzsd@gmail.com>: mm/early_ioremap.c: use __func__ instead of function name Subsystem: mm/kfence Alexander Potapenko <glider@google.com>: Patch series "KFENCE: A low-overhead sampling-based memory safety error detector", v7: mm: add Kernel Electric-Fence infrastructure x86, kfence: enable KFENCE for x86 Marco Elver <elver@google.com>: arm64, kfence: enable KFENCE for ARM64 kfence: use pt_regs to generate stack trace on faults Alexander Potapenko <glider@google.com>: mm, kfence: insert KFENCE hooks for SLAB mm, kfence: insert KFENCE hooks for SLUB kfence, kasan: make KFENCE compatible with KASAN Marco Elver <elver@google.com>: kfence, Documentation: add KFENCE documentation kfence: add test suite MAINTAINERS: add entry for KFENCE kfence: report sensitive information based on no_hash_pointers Alexander Potapenko <glider@google.com>: Patch series "Add error_report_end tracepoint to KFENCE and KASAN", v3: tracing: add error_report_end trace point kfence: use error_report_end tracepoint kasan: use error_report_end tracepoint Subsystem: mm/kasan2 Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: optimizations and fixes for HW_TAGS", v4: kasan, mm: don't save alloc stacks twice kasan, mm: optimize kmalloc poisoning kasan: optimize large kmalloc poisoning kasan: clean up setting free info in kasan_slab_free kasan: unify large kfree checks kasan: rework krealloc tests kasan, mm: fail krealloc on freed objects kasan, mm: optimize krealloc poisoning kasan: ensure poisoning size alignment arm64: kasan: simplify and inline MTE functions kasan: inline HW_TAGS helper functions kasan: clarify that only first bug is reported in HW_TAGS Subsystem: alpha Randy Dunlap <rdunlap@infradead.org>: alpha: remove CONFIG_EXPERIMENTAL from defconfigs Subsystem: procfs Helge Deller <deller@gmx.de>: proc/wchan: use printk format instead of lookup_symbol_name() Josef Bacik <josef@toxicpanda.com>: proc: use kvzalloc for our kernel buffer Subsystem: sysctl Lin Feng <linf@wangsu.com>: sysctl.c: fix underflow value setting risk in vm_table Subsystem: misc Randy Dunlap <rdunlap@infradead.org>: include/linux: remove repeated words Miguel Ojeda <ojeda@kernel.org>: treewide: Miguel has moved Subsystem: core-kernel Hubert Jasudowicz <hubert.jasudowicz@gmail.com>: groups: use flexible-array member in struct group_info groups: simplify struct group_info allocation Randy Dunlap <rdunlap@infradead.org>: kernel: delete repeated words in comments Subsystem: MAINTAINERS Vlastimil Babka <vbabka@suse.cz>: MAINTAINERS: add uapi directories to API/ABI section Subsystem: lib Huang Shijie <sjhuang@iluvatar.ai>: lib/genalloc.c: change return type to unsigned long for bitmap_set_ll Francis Laniel <laniel_francis@privacyrequired.com>: string.h: move fortified functions definitions in a dedicated header. Yogesh Lal <ylal@codeaurora.org>: lib: stackdepot: add support to configure STACK_HASH_SIZE Vijayanand Jitta <vjitta@codeaurora.org>: lib: stackdepot: add support to disable stack depot lib: stackdepot: fix ignoring return value warning Masahiro Yamada <masahiroy@kernel.org>: lib/cmdline: remove an unneeded local variable in next_arg() Subsystem: bitops Geert Uytterhoeven <geert+renesas@glider.be>: include/linux/bitops.h: spelling s/synomyn/synonym/ Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: improve blank line after declaration test Peng Wang <rocking@linux.alibaba.com>: checkpatch: ignore warning designated initializers using NR_CPUS Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: trivial style fixes Joe Perches <joe@perches.com>: checkpatch: prefer ftrace over function entry/exit printks checkpatch: improve TYPECAST_INT_CONSTANT test message Aditya Srivastava <yashsri421@gmail.com>: checkpatch: add warning for avoiding .L prefix symbols in assembly files Joe Perches <joe@perches.com>: checkpatch: add kmalloc_array_node to unnecessary OOM message check Chris Down <chris@chrisdown.name>: checkpatch: don't warn about colon termination in linker scripts Song Liu <songliubraving@fb.com>: checkpatch: do not apply "initialise globals to 0" check to BPF progs Subsystem: init Masahiro Yamada <masahiroy@kernel.org>: init/version.c: remove Version_<LINUX_VERSION_CODE> symbol init: clean up early_param_on_off() macro Bhaskar Chowdhury <unixbhaskar@gmail.com>: init/Kconfig: fix a typo in CC_VERSION_TEXT help text Subsystem: coredump Ira Weiny <ira.weiny@intel.com>: fs/coredump: use kmap_local_page() Subsystem: seq_file NeilBrown <neilb@suse.de>: Patch series "Fix some seq_file users that were recently broken": seq_file: document how per-entry resources are managed. x86: fix seq_file iteration for pat/memtype.c Subsystem: gdb George Prekas <prekageo@amazon.com>: scripts/gdb: fix list_for_each Sumit Garg <sumit.garg@linaro.org>: kgdb: fix to kill breakpoints on initmem after boot Subsystem: ubsan Andrey Ryabinin <ryabinin.a.a@gmail.com>: ubsan: remove overflow checks Subsystem: initramfs Florian Fainelli <f.fainelli@gmail.com>: initramfs: panic with memory information Subsystem: mm/pagemap2 Huang Pei <huangpei@loongson.cn>: MIPS: make userspace mapping young by default .mailmap | 1 CREDITS | 9 Documentation/ABI/testing/sysfs-devices-memory | 58 - Documentation/admin-guide/auxdisplay/cfag12864b.rst | 2 Documentation/admin-guide/auxdisplay/ks0108.rst | 2 Documentation/admin-guide/kernel-parameters.txt | 6 Documentation/admin-guide/mm/memory-hotplug.rst | 20 Documentation/dev-tools/index.rst | 1 Documentation/dev-tools/kasan.rst | 8 Documentation/dev-tools/kfence.rst | 318 +++++++ Documentation/filesystems/seq_file.rst | 6 MAINTAINERS | 26 arch/alpha/configs/defconfig | 1 arch/arm64/Kconfig | 1 arch/arm64/include/asm/cache.h | 1 arch/arm64/include/asm/kasan.h | 1 arch/arm64/include/asm/kfence.h | 26 arch/arm64/include/asm/mte-def.h | 2 arch/arm64/include/asm/mte-kasan.h | 65 + arch/arm64/include/asm/mte.h | 2 arch/arm64/kernel/mte.c | 46 - arch/arm64/lib/mte.S | 16 arch/arm64/mm/fault.c | 8 arch/arm64/mm/mmu.c | 23 arch/mips/mm/cache.c | 30 arch/s390/mm/init.c | 1 arch/s390/mm/vmem.c | 14 arch/x86/Kconfig | 1 arch/x86/include/asm/kfence.h | 76 + arch/x86/mm/fault.c | 10 arch/x86/mm/pat/memtype.c | 4 drivers/auxdisplay/cfag12864b.c | 4 drivers/auxdisplay/cfag12864bfb.c | 4 drivers/auxdisplay/ks0108.c | 4 drivers/base/memory.c | 35 drivers/block/zram/zram_drv.c | 2 drivers/hv/hv_balloon.c | 2 drivers/virtio/virtio_mem.c | 43 drivers/xen/balloon.c | 2 fs/coredump.c | 4 fs/iomap/seek.c | 125 -- fs/proc/base.c | 21 fs/proc/proc_sysctl.c | 4 include/linux/bitops.h | 2 include/linux/cfag12864b.h | 2 include/linux/cred.h | 2 include/linux/fortify-string.h | 302 ++++++ include/linux/gfp.h | 2 include/linux/init.h | 4 include/linux/kasan.h | 25 include/linux/kfence.h | 230 +++++ include/linux/kgdb.h | 2 include/linux/khugepaged.h | 2 include/linux/ks0108.h | 2 include/linux/mdev.h | 2 include/linux/memory.h | 3 include/linux/memory_hotplug.h | 33 include/linux/memremap.h | 6 include/linux/mmzone.h | 49 - include/linux/page-flags.h | 4 include/linux/pagemap.h | 10 include/linux/pagevec.h | 10 include/linux/pgtable.h | 8 include/linux/ptrace.h | 2 include/linux/rmap.h | 3 include/linux/slab_def.h | 3 include/linux/slub_def.h | 3 include/linux/stackdepot.h | 9 include/linux/string.h | 282 ------ include/linux/vmstat.h | 6 include/linux/zpool.h | 3 include/linux/zsmalloc.h | 2 include/trace/events/error_report.h | 74 + include/uapi/linux/firewire-cdev.h | 2 include/uapi/linux/input.h | 2 init/Kconfig | 2 init/initramfs.c | 19 init/main.c | 6 init/version.c | 8 kernel/debug/debug_core.c | 11 kernel/events/core.c | 8 kernel/events/uprobes.c | 2 kernel/groups.c | 7 kernel/locking/rtmutex.c | 4 kernel/locking/rwsem.c | 2 kernel/locking/semaphore.c | 2 kernel/sched/fair.c | 2 kernel/sched/membarrier.c | 2 kernel/sysctl.c | 8 kernel/trace/Makefile | 1 kernel/trace/error_report-traces.c | 12 lib/Kconfig | 9 lib/Kconfig.debug | 1 lib/Kconfig.kfence | 84 + lib/Kconfig.ubsan | 17 lib/cmdline.c | 7 lib/genalloc.c | 3 lib/stackdepot.c | 41 lib/test_kasan.c | 111 ++ lib/test_ubsan.c | 49 - lib/ubsan.c | 68 - mm/Makefile | 1 mm/backing-dev.c | 3 mm/cma.c | 64 - mm/dmapool.c | 3 mm/early_ioremap.c | 12 mm/filemap.c | 361 +++++--- mm/huge_memory.c | 6 mm/internal.h | 6 mm/kasan/common.c | 213 +++- mm/kasan/generic.c | 3 mm/kasan/hw_tags.c | 2 mm/kasan/kasan.h | 97 +- mm/kasan/report.c | 8 mm/kasan/shadow.c | 78 + mm/kfence/Makefile | 6 mm/kfence/core.c | 875 +++++++++++++++++++- mm/kfence/kfence.h | 126 ++ mm/kfence/kfence_test.c | 860 +++++++++++++++++++ mm/kfence/report.c | 350 ++++++-- mm/khugepaged.c | 22 mm/memory-failure.c | 6 mm/memory.c | 4 mm/memory_hotplug.c | 178 +++- mm/memremap.c | 23 mm/mlock.c | 2 mm/page_alloc.c | 1 mm/rmap.c | 24 mm/shmem.c | 160 +-- mm/slab.c | 38 mm/slab_common.c | 29 mm/slub.c | 63 + mm/swap.c | 54 - mm/swap_state.c | 7 mm/truncate.c | 141 --- mm/vmstat.c | 35 mm/z3fold.c | 1 mm/zbud.c | 1 mm/zpool.c | 13 mm/zsmalloc.c | 22 mm/zswap.c | 57 + samples/auxdisplay/cfag12864b-example.c | 2 scripts/Makefile.ubsan | 2 scripts/checkpatch.pl | 152 ++- scripts/gdb/linux/lists.py | 5 145 files changed, 5046 insertions(+), 1682 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-02-26 1:14 incoming Andrew Morton @ 2021-02-26 17:55 ` Linus Torvalds 2021-02-26 19:16 ` incoming Andrew Morton 0 siblings, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2021-02-26 17:55 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > - The rest of MM. > > Includes kfence - another runtime memory validator. Not as > thorough as KASAN, but it has unmeasurable overhead and is intended > to be usable in production builds. > > - Everything else Just to clarify: you have nothing else really pending? I'm hoping to just do -rc1 this weekend after all - despite my late start due to loss of power for several days. I'll allow late stragglers with good reason through, but the fewer of those there are, the better, of course. Thanks, Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-02-26 17:55 ` incoming Linus Torvalds @ 2021-02-26 19:16 ` Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-02-26 19:16 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, Linux-MM On Fri, 26 Feb 2021 09:55:27 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > - The rest of MM. > > > > Includes kfence - another runtime memory validator. Not as > > thorough as KASAN, but it has unmeasurable overhead and is intended > > to be usable in production builds. > > > > - Everything else > > Just to clarify: you have nothing else really pending? Yes, that's it from me for -rc1. ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-02-24 19:58 Andrew Morton 2021-02-24 21:30 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2021-02-24 19:58 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits A few small subsystems and some of MM. 173 patches, based on c03c21ba6f4e95e406a1a7b4c34ef334b977c194. Subsystems affected by this patch series: hexagon scripts ntfs ocfs2 vfs mm/slab-generic mm/slab mm/slub mm/debug mm/pagecache mm/swap mm/memcg mm/pagemap mm/mprotect mm/mremap mm/page-reporting mm/vmalloc mm/kasan mm/pagealloc mm/memory-failure mm/hugetlb mm/vmscan mm/z3fold mm/compaction mm/mempolicy mm/oom-kill mm/hugetlbfs mm/migration Subsystem: hexagon Randy Dunlap <rdunlap@infradead.org>: hexagon: remove CONFIG_EXPERIMENTAL from defconfigs Subsystem: scripts tangchunyou <tangchunyou@yulong.com>: scripts/spelling.txt: increase error-prone spell checking zuoqilin <zuoqilin@yulong.com>: scripts/spelling.txt: check for "exeeds" dingsenjie <dingsenjie@yulong.com>: scripts/spelling.txt: add "allocted" and "exeeds" typo Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ntfs Randy Dunlap <rdunlap@infradead.org>: ntfs: layout.h: delete duplicated words Rustam Kovhaev <rkovhaev@gmail.com>: ntfs: check for valid standard information attribute Subsystem: ocfs2 Yi Li <yili@winhong.com>: ocfs2: remove redundant conditional before iput guozh <guozh88@chinatelecom.cn>: ocfs2: clean up some definitions which are not used any more Dan Carpenter <dan.carpenter@oracle.com>: ocfs2: fix a use after free on error Jiapeng Chong <jiapeng.chong@linux.alibaba.com>: ocfs2: simplify the calculation of variables Subsystem: vfs Randy Dunlap <rdunlap@infradead.org>: fs: delete repeated words in comments Alexey Dobriyan <adobriyan@gmail.com>: ramfs: support O_TMPFILE Subsystem: mm/slab-generic Jacob Wen <jian.w.wen@oracle.com>: mm, tracing: record slab name for kmem_cache_free() Nikolay Borisov <nborisov@suse.com>: mm/sl?b.c: remove ctor argument from kmem_cache_flags Subsystem: mm/slab Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/slab: minor coding style tweaks Subsystem: mm/slub Johannes Berg <johannes.berg@intel.com>: mm/slub: disable user tracing for kmemleak caches by default Vlastimil Babka <vbabka@suse.cz>: Patch series "mm, slab, slub: remove cpu and memory hotplug locks": mm, slub: stop freeing kmem_cache_node structures on node offline mm, slab, slub: stop taking memory hotplug lock mm, slab, slub: stop taking cpu hotplug lock mm, slub: splice cpu and page freelists in deactivate_slab() mm, slub: remove slub_memcg_sysfs boot param and CONFIG_SLUB_MEMCG_SYSFS_ON Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/slub: minor coding style tweaks Subsystem: mm/debug "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/debug: improve memcg debugging Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/debug_vm_pgtable: Some minor updates", v3: mm/debug_vm_pgtable/basic: add validation for dirtiness after write protect mm/debug_vm_pgtable/basic: iterate over entire protection_map[] Miaohe Lin <linmiaohe@huawei.com>: mm/page_owner: use helper function zone_end_pfn() to get end_pfn Subsystem: mm/pagecache Baolin Wang <baolin.wang@linux.alibaba.com>: mm/filemap: remove unused parameter and change to void type for replace_page_cache_page() Pavel Begunkov <asml.silence@gmail.com>: mm/filemap: don't revert iter on -EIOCBQUEUED "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Refactor generic_file_buffered_read", v5: mm/filemap: rename generic_file_buffered_read subfunctions mm/filemap: remove dynamically allocated array from filemap_read mm/filemap: convert filemap_get_pages to take a pagevec mm/filemap: use head pages in generic_file_buffered_read mm/filemap: pass a sleep state to put_and_wait_on_page_locked mm/filemap: support readpage splitting a page mm/filemap: inline __wait_on_page_locked_async into caller mm/filemap: don't call ->readpage if IOCB_WAITQ is set mm/filemap: change filemap_read_page calling conventions mm/filemap: change filemap_create_page calling conventions mm/filemap: convert filemap_update_page to return an errno mm/filemap: move the iocb checks into filemap_update_page mm/filemap: add filemap_range_uptodate mm/filemap: split filemap_readahead out of filemap_get_pages mm/filemap: restructure filemap_get_pages mm/filemap: don't relock the page after calling readpage Christoph Hellwig <hch@lst.de>: mm/filemap: rename generic_file_buffered_read to filemap_read mm/filemap: simplify generic_file_read_iter Yang Guo <guoyang2@huawei.com>: fs/buffer.c: add checking buffer head stat before clear Baolin Wang <baolin.wang@linux.alibaba.com>: mm: backing-dev: Remove duplicated macro definition Subsystem: mm/swap Yang Li <abaci-bugfix@linux.alibaba.com>: mm/swap_slots.c: remove redundant NULL check Stephen Zhang <stephenzhangzsd@gmail.com>: mm/swapfile.c: fix debugging information problem Georgi Djakov <georgi.djakov@linaro.org>: mm/page_io: use pr_alert_ratelimited for swap read/write errors Rikard Falkeborn <rikard.falkeborn@gmail.com>: mm/swap_state: constify static struct attribute_group Yu Zhao <yuzhao@google.com>: mm/swap: don't SetPageWorkingset unconditionally during swapin Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: memcg/slab: pre-allocate obj_cgroups for slab caches with SLAB_ACCOUNT Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: optimize per-lruvec stats counter memory usage Patch series "Convert all THP vmstat counters to pages", v6: mm: memcontrol: fix NR_ANON_THPS accounting in charge moving mm: memcontrol: convert NR_ANON_THPS account to pages mm: memcontrol: convert NR_FILE_THPS account to pages mm: memcontrol: convert NR_SHMEM_THPS account to pages mm: memcontrol: convert NR_SHMEM_PMDMAPPED account to pages mm: memcontrol: convert NR_FILE_PMDMAPPED account to pages mm: memcontrol: make the slab calculation consistent Alex Shi <alex.shi@linux.alibaba.com>: mm/memcg: revise the using condition of lock_page_lruvec function series mm/memcg: remove rcu locking for lock_page_lruvec function series Shakeel Butt <shakeelb@google.com>: mm: memcg: add swapcache stat for memcg v2 Roman Gushchin <guro@fb.com>: mm: kmem: make __memcg_kmem_(un)charge static Feng Tang <feng.tang@intel.com>: mm: page_counter: re-layout structure to reduce false sharing Yang Li <abaci-bugfix@linux.alibaba.com>: mm/memcontrol: remove redundant NULL check Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: replace the loop with a list_for_each_entry() Shakeel Butt <shakeelb@google.com>: mm/list_lru.c: remove kvfree_rcu_local() Johannes Weiner <hannes@cmpxchg.org>: fs: buffer: use raw page_memcg() on locked page Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: fix swap undercounting in cgroup2 mm: memcontrol: fix get_active_memcg return value mm: memcontrol: fix slub memory accounting Subsystem: mm/pagemap Adrian Huang <ahuang12@lenovo.com>: mm/mmap.c: remove unnecessary local variable Miaohe Lin <linmiaohe@huawei.com>: mm/memory.c: fix potential pte_unmap_unlock pte error mm/pgtable-generic.c: simplify the VM_BUG_ON condition in pmdp_huge_clear_flush() mm/pgtable-generic.c: optimize the VM_BUG_ON condition in pmdp_huge_clear_flush() mm/memory.c: fix potential pte_unmap_unlock pte error Subsystem: mm/mprotect Tianjia Zhang <tianjia.zhang@linux.alibaba.com>: mm/mprotect.c: optimize error detection in do_mprotect_pkey() Subsystem: mm/mremap Li Xinhai <lixinhai.lxh@gmail.com>: mm: rmap: explicitly reset vma->anon_vma in unlink_anon_vmas() mm: mremap: unlink anon_vmas when mremap with MREMAP_DONTUNMAP success Subsystem: mm/page-reporting sh <sh_def@163.com>: mm/page_reporting: use list_entry_is_head() in page_reporting_cycle() Subsystem: mm/vmalloc Yang Li <abaci-bugfix@linux.alibaba.com>: vmalloc: remove redundant NULL check Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: HW_TAGS tests support and fixes", v4: kasan: prefix global functions with kasan_ kasan: clarify HW_TAGS impact on TBI kasan: clean up comments in tests kasan: add macros to simplify checking test constraints kasan: add match-all tag tests kasan, arm64: allow using KUnit tests with HW_TAGS mode kasan: rename CONFIG_TEST_KASAN_MODULE kasan: add compiler barriers to KUNIT_EXPECT_KASAN_FAIL kasan: adapt kmalloc_uaf2 test to HW_TAGS mode kasan: fix memory corruption in kasan_bitops_tags test kasan: move _RET_IP_ to inline wrappers kasan: fix bug detection via ksize for HW_TAGS mode kasan: add proper page allocator tests kasan: add a test for kmem_cache_alloc/free_bulk kasan: don't run tests when KASAN is not enabled Walter Wu <walter-zh.wu@mediatek.com>: kasan: remove redundant config option Subsystem: mm/pagealloc Baoquan He <bhe@redhat.com>: Patch series "mm: clean up names and parameters of memmap_init_xxxx functions", v5: mm: fix prototype warning from kernel test robot mm: rename memmap_init() and memmap_init_zone() mm: simplify parater of function memmap_init_zone() mm: simplify parameter of setup_usemap() mm: remove unneeded local variable in free_area_init_core David Hildenbrand <david@redhat.com>: Patch series "mm: simplify free_highmem_page() and free_reserved_page()": video: fbdev: acornfb: remove free_unused_pages() mm: simplify free_highmem_page() and free_reserved_page() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/gfp: add kernel-doc for gfp_t Subsystem: mm/memory-failure Aili Yao <yaoaili@kingsoft.com>: mm,hwpoison: send SIGBUS to PF_MCE_EARLY processes on action required events Subsystem: mm/hugetlb Bibo Mao <maobibo@loongson.cn>: mm/huge_memory.c: update tlb entry if pmd is changed MIPS: do not call flush_tlb_all when setting pmd entry Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: fix potential double free in hugetlb_register_node() error path Li Xinhai <lixinhai.lxh@gmail.com>: mm/hugetlb.c: fix unnecessary address expansion of pmd sharing Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: avoid unnecessary hugetlb_acct_memory() call mm/hugetlb: use helper huge_page_order and pages_per_huge_page mm/hugetlb: fix use after free when subpool max_hpages accounting is not enabled Jiapeng Zhong <abaci-bugfix@linux.alibaba.com>: mm/hugetlb: simplify the calculation of variables Joao Martins <joao.m.martins@oracle.com>: Patch series "mm/hugetlb: follow_hugetlb_page() improvements", v2: mm/hugetlb: grab head page refcount once for group of subpages mm/hugetlb: refactor subpage recording Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: fix some comment typos Yanfei Xu <yanfei.xu@windriver.com>: mm/hugetlb: remove redundant check in preparing and destroying gigantic page Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/hugetlb.c: fix typos in comments Miaohe Lin <linmiaohe@huawei.com>: mm/huge_memory.c: remove unused return value of set_huge_zero_page() "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/pmem: avoid inserting hugepage PTE entry with fsdax if hugepage support is disabled Miaohe Lin <linmiaohe@huawei.com>: hugetlb_cgroup: use helper pages_per_huge_page() in hugetlb_cgroup mm/hugetlb: use helper function range_in_vma() in page_table_shareable() mm/hugetlb: remove unnecessary VM_BUG_ON_PAGE on putback_active_hugepage() mm/hugetlb: use helper huge_page_size() to get hugepage size Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: fix update_and_free_page contig page struct assumption hugetlb: fix copy_huge_page_from_user contig page struct assumption Chen Wandun <chenwandun@huawei.com>: mm/hugetlb: suppress wrong warning info when alloc gigantic page Subsystem: mm/vmscan Alex Shi <alex.shi@linux.alibaba.com>: mm/vmscan: __isolate_lru_page_prepare() cleanup Miaohe Lin <linmiaohe@huawei.com>: mm/workingset.c: avoid unnecessary max_nodes estimation in count_shadow_nodes() Yu Zhao <yuzhao@google.com>: Patch series "mm: lru related cleanups", v2: mm/vmscan.c: use add_page_to_lru_list() include/linux/mm_inline.h: shuffle lru list addition and deletion functions mm: don't pass "enum lru_list" to lru list addition functions mm/swap.c: don't pass "enum lru_list" to trace_mm_lru_insertion() mm/swap.c: don't pass "enum lru_list" to del_page_from_lru_list() mm: add __clear_page_lru_flags() to replace page_off_lru() mm: VM_BUG_ON lru page flags include/linux/mm_inline.h: fold page_lru_base_type() into its sole caller include/linux/mm_inline.h: fold __update_lru_size() into its sole caller mm/vmscan.c: make lruvec_lru_size() static Oscar Salvador <osalvador@suse.de>: mm: workingset: clarify eviction order and distance calculation Mike Kravetz <mike.kravetz@oracle.com>: Patch series "create hugetlb flags to consolidate state", v3: hugetlb: use page.private for hugetlb specific page flags hugetlb: convert page_huge_active() HPageMigratable flag hugetlb: convert PageHugeTemporary() to HPageTemporary flag hugetlb: convert PageHugeFreed to HPageFreed flag include/linux/hugetlb.h: add synchronization information for new hugetlb specific flags hugetlb: fix uninitialized subpool pointer Dave Hansen <dave.hansen@linux.intel.com>: mm/vmscan: restore zone_reclaim_mode ABI Subsystem: mm/z3fold Miaohe Lin <linmiaohe@huawei.com>: z3fold: remove unused attribute for release_z3fold_page z3fold: simplify the zhdr initialization code in init_z3fold_page() Subsystem: mm/compaction Alex Shi <alex.shi@linux.alibaba.com>: mm/compaction: remove rcu_read_lock during page compaction Miaohe Lin <linmiaohe@huawei.com>: mm/compaction: remove duplicated VM_BUG_ON_PAGE !PageLocked Charan Teja Reddy <charante@codeaurora.org>: mm/compaction: correct deferral logic for proactive compaction Wonhyuk Yang <vvghjk1234@gmail.com>: mm/compaction: fix misbehaviors of fast_find_migrateblock() Vlastimil Babka <vbabka@suse.cz>: mm, compaction: make fast_isolate_freepages() stay within zone Subsystem: mm/mempolicy Huang Ying <ying.huang@intel.com>: numa balancing: migrate on fault among multiple bound nodes Miaohe Lin <linmiaohe@huawei.com>: mm/mempolicy: use helper range_in_vma() in queue_pages_test_walk() Subsystem: mm/oom-kill Tang Yizhou <tangyizhou@huawei.com>: mm, oom: fix a comment in dump_task() Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: mm/hugetlb: change hugetlb_reserve_pages() to type bool hugetlbfs: remove special hugetlbfs_set_page_dirty() Miaohe Lin <linmiaohe@huawei.com>: hugetlbfs: remove useless BUG_ON(!inode) in hugetlbfs_setattr() hugetlbfs: use helper macro default_hstate in init_hugetlbfs_fs hugetlbfs: correct obsolete function name in hugetlbfs_read_iter() hugetlbfs: remove meaningless variable avoid_reserve hugetlbfs: make hugepage size conversion more readable hugetlbfs: correct some obsolete comments about inode i_mutex hugetlbfs: fix some comment typos hugetlbfs: remove unneeded return value of hugetlb_vmtruncate() Subsystem: mm/migration Chengyang Fan <cy.fan@huawei.com>: mm/migrate: remove unneeded semicolons Documentation/admin-guide/cgroup-v2.rst | 4 Documentation/admin-guide/kernel-parameters.txt | 8 Documentation/admin-guide/sysctl/vm.rst | 10 Documentation/core-api/mm-api.rst | 7 Documentation/dev-tools/kasan.rst | 24 Documentation/vm/arch_pgtable_helpers.rst | 8 arch/arm64/include/asm/memory.h | 1 arch/arm64/include/asm/mte-kasan.h | 12 arch/arm64/kernel/mte.c | 12 arch/arm64/kernel/sleep.S | 2 arch/arm64/mm/fault.c | 20 arch/hexagon/configs/comet_defconfig | 1 arch/ia64/include/asm/pgtable.h | 6 arch/ia64/mm/init.c | 18 arch/mips/mm/pgtable-32.c | 1 arch/mips/mm/pgtable-64.c | 1 arch/x86/kernel/acpi/wakeup_64.S | 2 drivers/base/node.c | 33 drivers/video/fbdev/acornfb.c | 34 fs/block_dev.c | 2 fs/btrfs/file.c | 2 fs/buffer.c | 7 fs/dcache.c | 4 fs/direct-io.c | 4 fs/exec.c | 4 fs/fhandle.c | 2 fs/fuse/dev.c | 6 fs/hugetlbfs/inode.c | 72 -- fs/ntfs/inode.c | 6 fs/ntfs/layout.h | 4 fs/ocfs2/cluster/heartbeat.c | 8 fs/ocfs2/dlm/dlmast.c | 10 fs/ocfs2/dlm/dlmcommon.h | 4 fs/ocfs2/refcounttree.c | 2 fs/ocfs2/super.c | 2 fs/pipe.c | 2 fs/proc/meminfo.c | 10 fs/proc/vmcore.c | 7 fs/ramfs/inode.c | 13 include/linux/fs.h | 4 include/linux/gfp.h | 14 include/linux/highmem-internal.h | 5 include/linux/huge_mm.h | 15 include/linux/hugetlb.h | 98 ++ include/linux/kasan-checks.h | 6 include/linux/kasan.h | 39 - include/linux/memcontrol.h | 43 - include/linux/migrate.h | 2 include/linux/mm.h | 28 include/linux/mm_inline.h | 123 +-- include/linux/mmzone.h | 30 include/linux/page-flags.h | 6 include/linux/page_counter.h | 9 include/linux/pagemap.h | 5 include/linux/swap.h | 8 include/trace/events/kmem.h | 24 include/trace/events/pagemap.h | 11 include/uapi/linux/mempolicy.h | 4 init/Kconfig | 14 lib/Kconfig.kasan | 14 lib/Makefile | 2 lib/test_kasan.c | 446 ++++++++---- lib/test_kasan_module.c | 5 mm/backing-dev.c | 6 mm/compaction.c | 73 +- mm/debug.c | 10 mm/debug_vm_pgtable.c | 86 ++ mm/filemap.c | 859 +++++++++++------------- mm/gup.c | 5 mm/huge_memory.c | 28 mm/hugetlb.c | 376 ++++------ mm/hugetlb_cgroup.c | 6 mm/kasan/common.c | 60 - mm/kasan/generic.c | 40 - mm/kasan/hw_tags.c | 16 mm/kasan/kasan.h | 87 +- mm/kasan/quarantine.c | 22 mm/kasan/report.c | 15 mm/kasan/report_generic.c | 10 mm/kasan/report_hw_tags.c | 8 mm/kasan/report_sw_tags.c | 8 mm/kasan/shadow.c | 27 mm/kasan/sw_tags.c | 22 mm/khugepaged.c | 6 mm/list_lru.c | 12 mm/memcontrol.c | 309 ++++---- mm/memory-failure.c | 34 mm/memory.c | 24 mm/memory_hotplug.c | 11 mm/mempolicy.c | 18 mm/mempool.c | 2 mm/migrate.c | 10 mm/mlock.c | 3 mm/mmap.c | 4 mm/mprotect.c | 7 mm/mremap.c | 8 mm/oom_kill.c | 5 mm/page_alloc.c | 70 - mm/page_io.c | 12 mm/page_owner.c | 4 mm/page_reporting.c | 2 mm/pgtable-generic.c | 9 mm/rmap.c | 35 mm/shmem.c | 2 mm/slab.c | 21 mm/slab.h | 20 mm/slab_common.c | 40 - mm/slob.c | 2 mm/slub.c | 169 ++-- mm/swap.c | 54 - mm/swap_slots.c | 3 mm/swap_state.c | 31 mm/swapfile.c | 8 mm/vmscan.c | 100 +- mm/vmstat.c | 14 mm/workingset.c | 7 mm/z3fold.c | 11 scripts/Makefile.kasan | 10 scripts/spelling.txt | 30 tools/objtool/check.c | 2 120 files changed, 2249 insertions(+), 1954 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-02-24 19:58 incoming Andrew Morton @ 2021-02-24 21:30 ` Linus Torvalds 2021-02-24 21:37 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2021-02-24 21:30 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Wed, Feb 24, 2021 at 11:58 AM Andrew Morton <akpm@linux-foundation.org> wrote: > > A few small subsystems and some of MM. Hmm. I haven't bisected things yet, but I suspect it's something with the KASAN patches. With this all applied, I get: lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’: lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=] and lib/bitfield_kunit.c: In function ‘test_bitfields_constants’: lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is larger than 2048 bytes [-Wframe-larger-than=] which is obviously not really acceptable. A 11kB stack frame _will_ cause issues. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-02-24 21:30 ` incoming Linus Torvalds @ 2021-02-24 21:37 ` Linus Torvalds 2021-02-25 8:53 ` incoming Arnd Bergmann 0 siblings, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2021-02-24 21:37 UTC (permalink / raw) To: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor, Arnd Bergmann, Andrey Konovalov Cc: Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > Hmm. I haven't bisected things yet, but I suspect it's something with > the KASAN patches. With this all applied, I get: > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’: > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=] > > and > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’: > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is > larger than 2048 bytes [-Wframe-larger-than=] > > which is obviously not really acceptable. A 11kB stack frame _will_ > cause issues. A quick bisect shoes that this was introduced by "[patch 101/173] kasan: remove redundant config option". I didn't check what part of that patch screws up, but it's definitely doing something bad. I will drop that patch. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-02-24 21:37 ` incoming Linus Torvalds @ 2021-02-25 8:53 ` Arnd Bergmann 2021-02-25 9:12 ` incoming Andrey Ryabinin 0 siblings, 1 reply; 322+ messages in thread From: Arnd Bergmann @ 2021-02-25 8:53 UTC (permalink / raw) To: Linus Torvalds Cc: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds > <torvalds@linux-foundation.org> wrote: > > > > Hmm. I haven't bisected things yet, but I suspect it's something with > > the KASAN patches. With this all applied, I get: > > > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’: > > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=] > > > > and > > > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’: > > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is > > larger than 2048 bytes [-Wframe-larger-than=] > > > > which is obviously not really acceptable. A 11kB stack frame _will_ > > cause issues. > > A quick bisect shoes that this was introduced by "[patch 101/173] > kasan: remove redundant config option". > > I didn't check what part of that patch screws up, but it's definitely > doing something bad. I'm not sure why that patch surfaced the bug, but it's worth pointing out that the underlying problem is asan-stack in combination with the structleak plugin. This will happen for every user of kunit. I sent a series[1] out earlier this year to turn off the structleak plugin as an alternative workaround, but need to follow up on the remaining patches. Someone suggested adding a more generic way to turn off the plugin for a file instead of open-coding the CLFAGS_REMOVE_*.o Makefile bit, which would help. I am also still hoping that someone can come up with a way to make kunit work better with the structleak plugin, as there shouldn't be a fundamental reason why it can't work, just that it the code pattern triggers a particularly bad case in the compiler. Arnd [1] https://lore.kernel.org/lkml/20210125124533.101339-1-arnd@kernel.org/ ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-02-25 8:53 ` incoming Arnd Bergmann @ 2021-02-25 9:12 ` Andrey Ryabinin 2021-02-25 11:07 ` incoming Walter Wu 0 siblings, 1 reply; 322+ messages in thread From: Andrey Ryabinin @ 2021-02-25 9:12 UTC (permalink / raw) To: Arnd Bergmann Cc: Linus Torvalds, Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote: > > On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds > <torvalds@linux-foundation.org> wrote: > > > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds > > <torvalds@linux-foundation.org> wrote: > > > > > > Hmm. I haven't bisected things yet, but I suspect it's something with > > > the KASAN patches. With this all applied, I get: > > > > > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’: > > > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of > > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=] > > > > > > and > > > > > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’: > > > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is > > > larger than 2048 bytes [-Wframe-larger-than=] > > > > > > which is obviously not really acceptable. A 11kB stack frame _will_ > > > cause issues. > > > > A quick bisect shoes that this was introduced by "[patch 101/173] > > kasan: remove redundant config option". > > > > I didn't check what part of that patch screws up, but it's definitely > > doing something bad. > > I'm not sure why that patch surfaced the bug, but it's worth pointing > out that the underlying problem is asan-stack in combination > with the structleak plugin. This will happen for every user of kunit. > The patch didn't update KASAN_STACK dependency in kconfig: config GCC_PLUGIN_STRUCTLEAK_BYREF .... depends on !(KASAN && KASAN_STACK=1) This 'depends on' stopped working with the patch ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-02-25 9:12 ` incoming Andrey Ryabinin @ 2021-02-25 11:07 ` Walter Wu 0 siblings, 0 replies; 322+ messages in thread From: Walter Wu @ 2021-02-25 11:07 UTC (permalink / raw) To: Andrey Ryabinin Cc: Arnd Bergmann, Linus Torvalds, Andrew Morton, Dmitry Vyukov, Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko Hi Andrey, On Thu, 2021-02-25 at 12:12 +0300, Andrey Ryabinin wrote: > On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote: > > > > On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds > > <torvalds@linux-foundation.org> wrote: > > > > > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds > > > <torvalds@linux-foundation.org> wrote: > > > > > > > > Hmm. I haven't bisected things yet, but I suspect it's something with > > > > the KASAN patches. With this all applied, I get: > > > > > > > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’: > > > > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of > > > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=] > > > > > > > > and > > > > > > > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’: > > > > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is > > > > larger than 2048 bytes [-Wframe-larger-than=] > > > > > > > > which is obviously not really acceptable. A 11kB stack frame _will_ > > > > cause issues. > > > > > > A quick bisect shoes that this was introduced by "[patch 101/173] > > > kasan: remove redundant config option". > > > > > > I didn't check what part of that patch screws up, but it's definitely > > > doing something bad. > > > > I'm not sure why that patch surfaced the bug, but it's worth pointing > > out that the underlying problem is asan-stack in combination > > with the structleak plugin. This will happen for every user of kunit. > > > > The patch didn't update KASAN_STACK dependency in kconfig: > config GCC_PLUGIN_STRUCTLEAK_BYREF > .... > depends on !(KASAN && KASAN_STACK=1) > > This 'depends on' stopped working with the patch Thanks for pointing out this problem. I will re-send that patch. Walter ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-02-13 4:52 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-02-13 4:52 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 6 patches, based on dcc0b49040c70ad827a7f3d58a21b01fdb14e749. Subsystems affected by this patch series: mm/pagemap scripts MAINTAINERS h8300 Subsystem: mm/pagemap Mike Rapoport <rppt@linux.ibm.com>: m68k: make __pfn_to_phys() and __phys_to_pfn() available for !MMU Subsystem: scripts Rong Chen <rong.a.chen@intel.com>: scripts/recordmcount.pl: support big endian for ARCH sh Subsystem: MAINTAINERS Andrey Konovalov <andreyknvl@google.com>: MAINTAINERS: update KASAN file list MAINTAINERS: update Andrey Konovalov's email address MAINTAINERS: add Andrey Konovalov to KASAN reviewers Subsystem: h8300 Randy Dunlap <rdunlap@infradead.org>: h8300: fix PREEMPTION build, TI_PRE_COUNT undefined MAINTAINERS | 8 +++++--- arch/h8300/kernel/asm-offsets.c | 3 +++ arch/m68k/include/asm/page.h | 2 +- scripts/recordmcount.pl | 6 +++++- 4 files changed, 14 insertions(+), 5 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-02-09 21:41 Andrew Morton 2021-02-10 19:30 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2021-02-09 21:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 14 patches, based on e0756cfc7d7cd08c98a53b6009c091a3f6a50be6. Subsystems affected by this patch series: squashfs mm/kasan firmware mm/mremap mm/tmpfs mm/selftests MAINTAINERS mm/memcg mm/slub nilfs2 Subsystem: squashfs Phillip Lougher <phillip@squashfs.org.uk>: Patch series "Squashfs: fix BIO migration regression and add sanity checks": squashfs: avoid out of bounds writes in decompressors squashfs: add more sanity checks in id lookup squashfs: add more sanity checks in inode lookup squashfs: add more sanity checks in xattr id lookup Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: fix stack traces dependency for HW_TAGS Subsystem: firmware Fangrui Song <maskray@google.com>: firmware_loader: align .builtin_fw to 8 Subsystem: mm/mremap Arnd Bergmann <arnd@arndb.de>: mm/mremap: fix BUILD_BUG_ON() error in get_extent Subsystem: mm/tmpfs Seth Forshee <seth.forshee@canonical.com>: tmpfs: disallow CONFIG_TMPFS_INODE64 on s390 tmpfs: disallow CONFIG_TMPFS_INODE64 on alpha Subsystem: mm/selftests Rong Chen <rong.a.chen@intel.com>: selftests/vm: rename file run_vmtests to run_vmtests.sh Subsystem: MAINTAINERS Andrey Ryabinin <ryabinin.a.a@gmail.com>: MAINTAINERS: update Andrey Ryabinin's email address Subsystem: mm/memcg Johannes Weiner <hannes@cmpxchg.org>: Revert "mm: memcontrol: avoid workload stalls when lowering memory.high" Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: mm, slub: better heuristic for number of cpus when calculating slab order Subsystem: nilfs2 Joachim Henke <joachim.henke@t-systems.com>: nilfs2: make splice write available again .mailmap | 1 Documentation/dev-tools/kasan.rst | 3 - MAINTAINERS | 2 - fs/Kconfig | 4 +- fs/nilfs2/file.c | 1 fs/squashfs/block.c | 8 ++++ fs/squashfs/export.c | 41 +++++++++++++++++++---- fs/squashfs/id.c | 40 ++++++++++++++++++----- fs/squashfs/squashfs_fs_sb.h | 1 fs/squashfs/super.c | 6 +-- fs/squashfs/xattr.h | 10 +++++ fs/squashfs/xattr_id.c | 66 ++++++++++++++++++++++++++++++++------ include/asm-generic/vmlinux.lds.h | 2 - mm/kasan/hw_tags.c | 8 +--- mm/memcontrol.c | 5 +- mm/mremap.c | 5 +- mm/slub.c | 18 +++++++++- 17 files changed, 172 insertions(+), 49 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-02-09 21:41 incoming Andrew Morton @ 2021-02-10 19:30 ` Linus Torvalds 0 siblings, 0 replies; 322+ messages in thread From: Linus Torvalds @ 2021-02-10 19:30 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits Hah. This series shows a small deficiency in your scripting wrt the diffstat: On Tue, Feb 9, 2021 at 1:41 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > .mailmap | 1 ... > mm/slub.c | 18 +++++++++- > 17 files changed, 172 insertions(+), 49 deletions(-) It actually has 18 files changed, but one of them is a pure rename (no change to the content), and apparently your diffstat tool can't handle that case. It *should* have ended with ... mm/slub.c | 18 +++++- .../selftests/vm/{run_vmtests => run_vmtests.sh} | 0 18 files changed, 172 insertions(+), 49 deletions(-) rename tools/testing/selftests/vm/{run_vmtests => run_vmtests.sh} (100%) if you'd done a proper "git diff -M --stat --summary" of the series. [ Ok, by default git would actually have said 18 files changed, 171 insertions(+), 48 deletions(-) but it looks like you use the patience diff option, which gives that extra insertion/deletion line because it generates the diff a bit differently ] Not a big deal,, but it made me briefly wonder "why doesn't my diffstat match yours". Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-02-05 2:31 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-02-05 2:31 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 18 patches, based on 5c279c4cf206e03995e04fd3404fa95ffd243a97. Subsystems affected by this patch series: mm/hugetlb mm/compaction mm/vmalloc gcov mm/shmem mm/memblock mailmap mm/pagecache mm/kasan ubsan mm/hugetlb MAINTAINERS Subsystem: mm/hugetlb Muchun Song <songmuchun@bytedance.com>: mm: hugetlbfs: fix cannot migrate the fallocated HugeTLB page mm: hugetlb: fix a race between freeing and dissolving the page mm: hugetlb: fix a race between isolating and freeing page mm: hugetlb: remove VM_BUG_ON_PAGE from page_huge_active mm: migrate: do not migrate HugeTLB page whose refcount is one Subsystem: mm/compaction Rokudo Yan <wu-yan@tcl.com>: mm, compaction: move high_pfn to the for loop scope Subsystem: mm/vmalloc Rick Edgecombe <rick.p.edgecombe@intel.com>: mm/vmalloc: separate put pages and flush VM flags Subsystem: gcov Johannes Berg <johannes.berg@intel.com>: init/gcov: allow CONFIG_CONSTRUCTORS on UML to fix module gcov Subsystem: mm/shmem Hugh Dickins <hughd@google.com>: mm: thp: fix MADV_REMOVE deadlock on shmem THP Subsystem: mm/memblock Roman Gushchin <guro@fb.com>: memblock: do not start bottom-up allocations with kernel_end Subsystem: mailmap Viresh Kumar <viresh.kumar@linaro.org>: mailmap: fix name/email for Viresh Kumar Manivannan Sadhasivam <manivannan.sadhasivam@linaro.org>: mailmap: add entries for Manivannan Sadhasivam Subsystem: mm/pagecache Waiman Long <longman@redhat.com>: mm/filemap: add missing mem_cgroup_uncharge() to __add_to_page_cache_locked() Subsystem: mm/kasan Vincenzo Frascino <vincenzo.frascino@arm.com>: Patch series "kasan: Fix metadata detection for KASAN_HW_TAGS", v5: kasan: add explicit preconditions to kasan_report() kasan: make addr_has_metadata() return true for valid addresses Subsystem: ubsan Nathan Chancellor <nathan@kernel.org>: ubsan: implement __ubsan_handle_alignment_assumption Subsystem: mm/hugetlb Muchun Song <songmuchun@bytedance.com>: mm: hugetlb: fix missing put_page in gather_surplus_pages() Subsystem: MAINTAINERS Nathan Chancellor <nathan@kernel.org>: MAINTAINERS/.mailmap: use my @kernel.org address .mailmap | 5 ++++ MAINTAINERS | 2 - fs/hugetlbfs/inode.c | 3 +- include/linux/hugetlb.h | 2 + include/linux/kasan.h | 7 ++++++ include/linux/vmalloc.h | 9 +------- init/Kconfig | 1 init/main.c | 8 ++++++- kernel/gcov/Kconfig | 2 - lib/ubsan.c | 31 ++++++++++++++++++++++++++++ lib/ubsan.h | 6 +++++ mm/compaction.c | 3 +- mm/filemap.c | 4 +++ mm/huge_memory.c | 37 ++++++++++++++++++++------------- mm/hugetlb.c | 53 ++++++++++++++++++++++++++++++++++++++++++------ mm/kasan/kasan.h | 2 - mm/memblock.c | 49 +++++--------------------------------------- mm/migrate.c | 6 +++++ 18 files changed, 153 insertions(+), 77 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-01-24 5:00 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2021-01-24 5:00 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 19 patches, based on e1ae4b0be15891faf46d390e9f3dc9bd71a8cae1. Subsystems affected by this patch series: mm/pagealloc mm/memcg mm/kasan ubsan mm/memory-failure mm/highmem proc MAINTAINERS Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: fix initialization of struct page for holes in memory layout", v3: x86/setup: don't remove E820_TYPE_RAM for pfn 0 mm: fix initialization of struct page for holes in memory layout Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: memcg/slab: optimize objcg stock draining Shakeel Butt <shakeelb@google.com>: mm: memcg: fix memcg file_dirty numa stat mm: fix numa stats for thp migration Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: prevent starvation when writing memory.high Subsystem: mm/kasan Lecopzer Chen <lecopzer@gmail.com>: kasan: fix unaligned address is unhandled in kasan_remove_zero_shadow kasan: fix incorrect arguments passing in kasan_add_zero_shadow Andrey Konovalov <andreyknvl@google.com>: kasan: fix HW_TAGS boot parameters kasan, mm: fix conflicts with init_on_alloc/free kasan, mm: fix resetting page_alloc tags for HW_TAGS Subsystem: ubsan Arnd Bergmann <arnd@arndb.de>: ubsan: disable unsigned-overflow check for i386 Subsystem: mm/memory-failure Dan Williams <dan.j.williams@intel.com>: mm: fix page reference leak in soft_offline_page() Subsystem: mm/highmem Thomas Gleixner <tglx@linutronix.de>: Patch series "mm/highmem: Fix fallout from generic kmap_local conversions": sparc/mm/highmem: flush cache and TLB mm/highmem: prepare for overriding set_pte_at() mips/mm/highmem: use set_pte() for kmap_local() powerpc/mm/highmem: use __set_pte_at() for kmap_local() Subsystem: proc Xiaoming Ni <nixiaoming@huawei.com>: proc_sysctl: fix oops caused by incorrect command parameters Subsystem: MAINTAINERS Nathan Chancellor <natechancellor@gmail.com>: MAINTAINERS: add a couple more files to the Clang/LLVM section Documentation/dev-tools/kasan.rst | 27 ++--------- MAINTAINERS | 2 arch/mips/include/asm/highmem.h | 1 arch/powerpc/include/asm/highmem.h | 2 arch/sparc/include/asm/highmem.h | 9 ++- arch/x86/kernel/setup.c | 20 +++----- fs/proc/proc_sysctl.c | 7 ++- lib/Kconfig.ubsan | 1 mm/highmem.c | 7 ++- mm/kasan/hw_tags.c | 77 +++++++++++++-------------------- mm/kasan/init.c | 23 +++++---- mm/memcontrol.c | 11 +--- mm/memory-failure.c | 20 ++++++-- mm/migrate.c | 27 ++++++----- mm/page_alloc.c | 86 ++++++++++++++++++++++--------------- mm/slub.c | 7 +-- 16 files changed, 173 insertions(+), 154 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2021-01-12 23:48 Andrew Morton 2021-01-15 23:32 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2021-01-12 23:48 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c. Subsystems affected by this patch series: mm/slub mm/pagealloc mm/memcg mm/kasan mm/vmalloc mm/migration mm/hugetlb MAINTAINERS mm/memory-failure mm/process_vm_access Subsystem: mm/slub Jann Horn <jannh@google.com>: mm, slub: consider rest of partial list if acquire_slab() fails Subsystem: mm/pagealloc Hailong liu <liu.hailong6@zte.com.cn>: mm/page_alloc: add a missing mm_page_alloc_zone_locked() tracepoint Subsystem: mm/memcg Hugh Dickins <hughd@google.com>: mm/memcontrol: fix warning in mem_cgroup_page_lruvec() Subsystem: mm/kasan Hailong Liu <liu.hailong6@zte.com.cn>: arm/kasan: fix the array size of kasan_early_shadow_pte[] Subsystem: mm/vmalloc Miaohe Lin <linmiaohe@huawei.com>: mm/vmalloc.c: fix potential memory leak Subsystem: mm/migration Jan Stancek <jstancek@redhat.com>: mm: migrate: initialize err in do_migrate_pages Subsystem: mm/hugetlb Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: fix potential missing huge page size info Subsystem: MAINTAINERS Vlastimil Babka <vbabka@suse.cz>: MAINTAINERS: add Vlastimil as slab allocators maintainer Subsystem: mm/memory-failure Oscar Salvador <osalvador@suse.de>: mm,hwpoison: fix printing of page flags Subsystem: mm/process_vm_access Andrew Morton <akpm@linux-foundation.org>: mm/process_vm_access.c: include compat.h MAINTAINERS | 1 + include/linux/kasan.h | 6 +++++- include/linux/memcontrol.h | 2 +- mm/hugetlb.c | 2 +- mm/kasan/init.c | 3 ++- mm/memory-failure.c | 2 +- mm/mempolicy.c | 2 +- mm/page_alloc.c | 31 ++++++++++++++++--------------- mm/process_vm_access.c | 1 + mm/slub.c | 2 +- mm/vmalloc.c | 4 +++- 11 files changed, 33 insertions(+), 23 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2021-01-12 23:48 incoming Andrew Morton @ 2021-01-15 23:32 ` Linus Torvalds 0 siblings, 0 replies; 322+ messages in thread From: Linus Torvalds @ 2021-01-15 23:32 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, Jan 12, 2021 at 3:48 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c. Whee. I had completely dropped the ball on this - I had built my usual "akpm" branch with the patches, but then had completely forgotten about it after doing my basic build tests. I tend to leave it for a while to see if people send belated ACK/NAK's for the patches, but that "for a while" is typically "overnight", not several days. So if you ever notice that I haven't merged your patch submission, and you haven't seen me comment on them, feel free to ping me to remind me. Because it might just have gotten lost in the shuffle for some random reason. Admittedly it's rare - I think this is the first time I just randomly noticed three days later that I'd never done the actual merge of the patch-series). Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-12-29 23:13 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-12-29 23:13 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 16 patches, based on dea8dcf2a9fa8cc540136a6cd885c3beece16ec3. Subsystems affected by this patch series: mm/selftests mm/hugetlb kbuild checkpatch mm/pagecache mm/mremap mm/kasan misc lib mm/slub Subsystem: mm/selftests Harish <harish@linux.ibm.com>: selftests/vm: fix building protection keys test Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: mm/hugetlb: fix deadlock in hugetlb_cow error path Subsystem: kbuild Masahiro Yamada <masahiroy@kernel.org>: Revert "kbuild: avoid static_assert for genksyms" Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: prefer strscpy to strlcpy Subsystem: mm/pagecache Souptick Joarder <jrdr.linux@gmail.com>: mm: add prototype for __add_to_page_cache_locked() Baoquan He <bhe@redhat.com>: mm: memmap defer init doesn't work as expected Subsystem: mm/mremap Kalesh Singh <kaleshsingh@google.com>: mm/mremap.c: fix extent calculation Nicholas Piggin <npiggin@gmail.com>: mm: generalise COW SMC TLB flushing race comment Subsystem: mm/kasan Walter Wu <walter-zh.wu@mediatek.com>: kasan: fix null pointer dereference in kasan_record_aux_stack Subsystem: misc Randy Dunlap <rdunlap@infradead.org>: local64.h: make <asm/local64.h> mandatory Huang Shijie <sjhuang@iluvatar.ai>: sizes.h: add SZ_8G/SZ_16G/SZ_32G macros Josh Poimboeuf <jpoimboe@redhat.com>: kdev_t: always inline major/minor helper functions Subsystem: lib Huang Shijie <sjhuang@iluvatar.ai>: lib/genalloc: fix the overflow when size is too big Ilya Leoshkevich <iii@linux.ibm.com>: lib/zlib: fix inflating zlib streams on s390 Randy Dunlap <rdunlap@infradead.org>: zlib: move EXPORT_SYMBOL() and MODULE_LICENSE() out of dfltcc_syms.c Subsystem: mm/slub Roman Gushchin <guro@fb.com>: mm: slub: call account_slab_page() after slab page initialization arch/alpha/include/asm/local64.h | 1 - arch/arc/include/asm/Kbuild | 1 - arch/arm/include/asm/Kbuild | 1 - arch/arm64/include/asm/Kbuild | 1 - arch/csky/include/asm/Kbuild | 1 - arch/h8300/include/asm/Kbuild | 1 - arch/hexagon/include/asm/Kbuild | 1 - arch/ia64/include/asm/local64.h | 1 - arch/ia64/mm/init.c | 4 ++-- arch/m68k/include/asm/Kbuild | 1 - arch/microblaze/include/asm/Kbuild | 1 - arch/mips/include/asm/Kbuild | 1 - arch/nds32/include/asm/Kbuild | 1 - arch/openrisc/include/asm/Kbuild | 1 - arch/parisc/include/asm/Kbuild | 1 - arch/powerpc/include/asm/Kbuild | 1 - arch/riscv/include/asm/Kbuild | 1 - arch/s390/include/asm/Kbuild | 1 - arch/sh/include/asm/Kbuild | 1 - arch/sparc/include/asm/Kbuild | 1 - arch/x86/include/asm/local64.h | 1 - arch/xtensa/include/asm/Kbuild | 1 - include/asm-generic/Kbuild | 1 + include/linux/build_bug.h | 5 ----- include/linux/kdev_t.h | 22 +++++++++++----------- include/linux/mm.h | 12 ++++++++++-- include/linux/sizes.h | 3 +++ lib/genalloc.c | 25 +++++++++++++------------ lib/zlib_dfltcc/Makefile | 2 +- lib/zlib_dfltcc/dfltcc.c | 6 +++++- lib/zlib_dfltcc/dfltcc_deflate.c | 3 +++ lib/zlib_dfltcc/dfltcc_inflate.c | 4 ++-- lib/zlib_dfltcc/dfltcc_syms.c | 17 ----------------- mm/hugetlb.c | 22 +++++++++++++++++++++- mm/kasan/generic.c | 2 ++ mm/memory.c | 8 +++++--- mm/memory_hotplug.c | 2 +- mm/mremap.c | 4 +++- mm/page_alloc.c | 8 +++++--- mm/slub.c | 5 ++--- scripts/checkpatch.pl | 6 ++++++ tools/testing/selftests/vm/Makefile | 10 +++++----- 42 files changed, 101 insertions(+), 91 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-12-22 19:58 Andrew Morton 2020-12-22 21:43 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2020-12-22 19:58 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e. Subsystems affected by this patch series: mm/kasan Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: add hardware tag-based mode for arm64", v11: kasan: drop unnecessary GPL text from comment headers kasan: KASAN_VMALLOC depends on KASAN_GENERIC kasan: group vmalloc code kasan: shadow declarations only for software modes kasan: rename (un)poison_shadow to (un)poison_range kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_* kasan: only build init.c for software modes kasan: split out shadow.c from common.c kasan: define KASAN_MEMORY_PER_SHADOW_PAGE kasan: rename report and tags files kasan: don't duplicate config dependencies kasan: hide invalid free check implementation kasan: decode stack frame only with KASAN_STACK_ENABLE kasan, arm64: only init shadow for software modes kasan, arm64: only use kasan_depth for software modes kasan, arm64: move initialization message kasan, arm64: rename kasan_init_tags and mark as __init kasan: rename addr_has_shadow to addr_has_metadata kasan: rename print_shadow_for_address to print_memory_metadata kasan: rename SHADOW layout macros to META kasan: separate metadata_fetch_row for each mode kasan: introduce CONFIG_KASAN_HW_TAGS Vincenzo Frascino <vincenzo.frascino@arm.com>: arm64: enable armv8.5-a asm-arch option arm64: mte: add in-kernel MTE helpers arm64: mte: reset the page tag in page->flags arm64: mte: add in-kernel tag fault handler arm64: kasan: allow enabling in-kernel MTE arm64: mte: convert gcr_user into an exclude mask arm64: mte: switch GCR_EL1 in kernel entry and exit kasan, mm: untag page address in free_reserved_area Andrey Konovalov <andreyknvl@google.com>: arm64: kasan: align allocations for HW_TAGS arm64: kasan: add arch layer for memory tagging helpers kasan: define KASAN_GRANULE_SIZE for HW_TAGS kasan, x86, s390: update undef CONFIG_KASAN kasan, arm64: expand CONFIG_KASAN checks kasan, arm64: implement HW_TAGS runtime kasan, arm64: print report from tag fault handler kasan, mm: reset tags when accessing metadata kasan, arm64: enable CONFIG_KASAN_HW_TAGS kasan: add documentation for hardware tag-based mode Vincenzo Frascino <vincenzo.frascino@arm.com>: kselftest/arm64: check GCR_EL1 after context switch Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: boot parameters for hardware tag-based mode", v4: kasan: simplify quarantine_put call site kasan: rename get_alloc/free_info kasan: introduce set_alloc_info kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK kasan: allow VMAP_STACK for HW_TAGS mode kasan: remove __kasan_unpoison_stack kasan: inline kasan_reset_tag for tag-based modes kasan: inline random_tag for HW_TAGS kasan: open-code kasan_unpoison_slab kasan: inline (un)poison_range and check_invalid_free kasan: add and integrate kasan boot parameters kasan, mm: check kasan_enabled in annotations kasan, mm: rename kasan_poison_kfree kasan: don't round_up too much kasan: simplify assign_tag and set_tag calls kasan: clarify comment in __kasan_kfree_large kasan: sanitize objects when metadata doesn't fit kasan, mm: allow cache merging with no metadata kasan: update documentation Documentation/dev-tools/kasan.rst | 274 ++- arch/Kconfig | 8 arch/arm64/Kconfig | 9 arch/arm64/Makefile | 7 arch/arm64/include/asm/assembler.h | 2 arch/arm64/include/asm/cache.h | 3 arch/arm64/include/asm/esr.h | 1 arch/arm64/include/asm/kasan.h | 17 arch/arm64/include/asm/memory.h | 15 arch/arm64/include/asm/mte-def.h | 16 arch/arm64/include/asm/mte-kasan.h | 67 arch/arm64/include/asm/mte.h | 22 arch/arm64/include/asm/processor.h | 2 arch/arm64/include/asm/string.h | 5 arch/arm64/include/asm/uaccess.h | 23 arch/arm64/kernel/asm-offsets.c | 3 arch/arm64/kernel/cpufeature.c | 3 arch/arm64/kernel/entry.S | 41 arch/arm64/kernel/head.S | 2 arch/arm64/kernel/hibernate.c | 5 arch/arm64/kernel/image-vars.h | 2 arch/arm64/kernel/kaslr.c | 3 arch/arm64/kernel/module.c | 6 arch/arm64/kernel/mte.c | 124 + arch/arm64/kernel/setup.c | 2 arch/arm64/kernel/sleep.S | 2 arch/arm64/kernel/smp.c | 2 arch/arm64/lib/mte.S | 16 arch/arm64/mm/copypage.c | 9 arch/arm64/mm/fault.c | 59 arch/arm64/mm/kasan_init.c | 41 arch/arm64/mm/mteswap.c | 9 arch/arm64/mm/proc.S | 23 arch/arm64/mm/ptdump.c | 6 arch/s390/boot/string.c | 1 arch/x86/boot/compressed/misc.h | 1 arch/x86/kernel/acpi/wakeup_64.S | 2 include/linux/kasan-checks.h | 2 include/linux/kasan.h | 423 ++++- include/linux/mm.h | 24 include/linux/moduleloader.h | 3 include/linux/page-flags-layout.h | 2 include/linux/sched.h | 2 include/linux/string.h | 2 init/init_task.c | 2 kernel/fork.c | 4 lib/Kconfig.kasan | 71 lib/test_kasan.c | 2 lib/test_kasan_module.c | 2 mm/kasan/Makefile | 33 mm/kasan/common.c | 1006 +++----------- mm/kasan/generic.c | 72 - mm/kasan/generic_report.c | 13 mm/kasan/hw_tags.c | 276 +++ mm/kasan/init.c | 25 mm/kasan/kasan.h | 195 ++ mm/kasan/quarantine.c | 35 mm/kasan/report.c | 363 +---- mm/kasan/report_generic.c | 169 ++ mm/kasan/report_hw_tags.c | 44 mm/kasan/report_sw_tags.c | 22 mm/kasan/shadow.c | 528 +++++++ mm/kasan/sw_tags.c | 34 mm/kasan/tags.c | 7 mm/kasan/tags_report.c | 7 mm/mempool.c | 4 mm/page_alloc.c | 9 mm/page_poison.c | 2 mm/ptdump.c | 13 mm/slab_common.c | 5 mm/slub.c | 29 scripts/Makefile.lib | 2 tools/testing/selftests/arm64/mte/Makefile | 2 tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c | 155 ++ 74 files changed, 2869 insertions(+), 1553 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-12-22 19:58 incoming Andrew Morton @ 2020-12-22 21:43 ` Linus Torvalds 0 siblings, 0 replies; 322+ messages in thread From: Linus Torvalds @ 2020-12-22 21:43 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, Dec 22, 2020 at 11:58 AM Andrew Morton <akpm@linux-foundation.org> wrote: > > 60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e. I see that you enabled renaming in the patches. Lovely. Can you also enable it in the diffstat? > 74 files changed, 2869 insertions(+), 1553 deletions(-) With -M in the diffstat, you should have seen 72 files changed, 2775 insertions(+), 1460 deletions(-) and if you add "--summary", you'll also see the rename part ofthe file create/delete summary: rename mm/kasan/{tags_report.c => report_sw_tags.c} (78%) which is often nice to see in addition to the line stats.. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-12-18 22:00 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-12-18 22:00 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 78 patches, based on a409ed156a90093a03fe6a93721ddf4c591eac87. Subsystems affected by this patch series: mm/memcg epoll mm/kasan mm/cleanups epoll Subsystem: mm/memcg Alex Shi <alex.shi@linux.alibaba.com>: Patch series "bail out early for memcg disable": mm/memcg: bail early from swap accounting if memcg disabled mm/memcg: warning on !memcg after readahead page charged Wei Yang <richard.weiyang@gmail.com>: mm/memcg: remove unused definitions Shakeel Butt <shakeelb@google.com>: mm, kvm: account kvm_vcpu_mmap to kmemcg Hui Su <sh_def@163.com>: mm/memcontrol:rewrite mem_cgroup_page_lruvec() Subsystem: epoll Soheil Hassas Yeganeh <soheil@google.com>: Patch series "simplify ep_poll": epoll: check for events when removing a timed out thread from the wait queue epoll: simplify signal handling epoll: pull fatal signal checks into ep_send_events() epoll: move eavail next to the list_empty_careful check epoll: simplify and optimize busy loop logic epoll: pull all code between fetch_events and send_event into the loop epoll: replace gotos with a proper loop epoll: eliminate unnecessary lock for zero timeout Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: add hardware tag-based mode for arm64", v11: kasan: drop unnecessary GPL text from comment headers kasan: KASAN_VMALLOC depends on KASAN_GENERIC kasan: group vmalloc code kasan: shadow declarations only for software modes kasan: rename (un)poison_shadow to (un)poison_range kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_* kasan: only build init.c for software modes kasan: split out shadow.c from common.c kasan: define KASAN_MEMORY_PER_SHADOW_PAGE kasan: rename report and tags files kasan: don't duplicate config dependencies kasan: hide invalid free check implementation kasan: decode stack frame only with KASAN_STACK_ENABLE kasan, arm64: only init shadow for software modes kasan, arm64: only use kasan_depth for software modes kasan, arm64: move initialization message kasan, arm64: rename kasan_init_tags and mark as __init kasan: rename addr_has_shadow to addr_has_metadata kasan: rename print_shadow_for_address to print_memory_metadata kasan: rename SHADOW layout macros to META kasan: separate metadata_fetch_row for each mode kasan: introduce CONFIG_KASAN_HW_TAGS Vincenzo Frascino <vincenzo.frascino@arm.com>: arm64: enable armv8.5-a asm-arch option arm64: mte: add in-kernel MTE helpers arm64: mte: reset the page tag in page->flags arm64: mte: add in-kernel tag fault handler arm64: kasan: allow enabling in-kernel MTE arm64: mte: convert gcr_user into an exclude mask arm64: mte: switch GCR_EL1 in kernel entry and exit kasan, mm: untag page address in free_reserved_area Andrey Konovalov <andreyknvl@google.com>: arm64: kasan: align allocations for HW_TAGS arm64: kasan: add arch layer for memory tagging helpers kasan: define KASAN_GRANULE_SIZE for HW_TAGS kasan, x86, s390: update undef CONFIG_KASAN kasan, arm64: expand CONFIG_KASAN checks kasan, arm64: implement HW_TAGS runtime kasan, arm64: print report from tag fault handler kasan, mm: reset tags when accessing metadata kasan, arm64: enable CONFIG_KASAN_HW_TAGS kasan: add documentation for hardware tag-based mode Vincenzo Frascino <vincenzo.frascino@arm.com>: kselftest/arm64: check GCR_EL1 after context switch Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: boot parameters for hardware tag-based mode", v4: kasan: simplify quarantine_put call site kasan: rename get_alloc/free_info kasan: introduce set_alloc_info kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK kasan: allow VMAP_STACK for HW_TAGS mode kasan: remove __kasan_unpoison_stack kasan: inline kasan_reset_tag for tag-based modes kasan: inline random_tag for HW_TAGS kasan: open-code kasan_unpoison_slab kasan: inline (un)poison_range and check_invalid_free kasan: add and integrate kasan boot parameters kasan, mm: check kasan_enabled in annotations kasan, mm: rename kasan_poison_kfree kasan: don't round_up too much kasan: simplify assign_tag and set_tag calls kasan: clarify comment in __kasan_kfree_large kasan: sanitize objects when metadata doesn't fit kasan, mm: allow cache merging with no metadata kasan: update documentation Subsystem: mm/cleanups Colin Ian King <colin.king@canonical.com>: mm/Kconfig: fix spelling mistake "whats" -> "what's" Subsystem: epoll Willem de Bruijn <willemb@google.com>: Patch series "add epoll_pwait2 syscall", v4: epoll: convert internal api to timespec64 epoll: add syscall epoll_pwait2 epoll: wire up syscall epoll_pwait2 selftests/filesystems: expand epoll with epoll_pwait2 Documentation/dev-tools/kasan.rst | 274 +- arch/Kconfig | 8 arch/alpha/kernel/syscalls/syscall.tbl | 1 arch/arm/tools/syscall.tbl | 1 arch/arm64/Kconfig | 9 arch/arm64/Makefile | 7 arch/arm64/include/asm/assembler.h | 2 arch/arm64/include/asm/cache.h | 3 arch/arm64/include/asm/esr.h | 1 arch/arm64/include/asm/kasan.h | 17 arch/arm64/include/asm/memory.h | 15 arch/arm64/include/asm/mte-def.h | 16 arch/arm64/include/asm/mte-kasan.h | 67 arch/arm64/include/asm/mte.h | 22 arch/arm64/include/asm/processor.h | 2 arch/arm64/include/asm/string.h | 5 arch/arm64/include/asm/uaccess.h | 23 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 2 arch/arm64/kernel/asm-offsets.c | 3 arch/arm64/kernel/cpufeature.c | 3 arch/arm64/kernel/entry.S | 41 arch/arm64/kernel/head.S | 2 arch/arm64/kernel/hibernate.c | 5 arch/arm64/kernel/image-vars.h | 2 arch/arm64/kernel/kaslr.c | 3 arch/arm64/kernel/module.c | 6 arch/arm64/kernel/mte.c | 124 + arch/arm64/kernel/setup.c | 2 arch/arm64/kernel/sleep.S | 2 arch/arm64/kernel/smp.c | 2 arch/arm64/lib/mte.S | 16 arch/arm64/mm/copypage.c | 9 arch/arm64/mm/fault.c | 59 arch/arm64/mm/kasan_init.c | 41 arch/arm64/mm/mteswap.c | 9 arch/arm64/mm/proc.S | 23 arch/arm64/mm/ptdump.c | 6 arch/ia64/kernel/syscalls/syscall.tbl | 1 arch/m68k/kernel/syscalls/syscall.tbl | 1 arch/microblaze/kernel/syscalls/syscall.tbl | 1 arch/mips/kernel/syscalls/syscall_n32.tbl | 1 arch/mips/kernel/syscalls/syscall_n64.tbl | 1 arch/mips/kernel/syscalls/syscall_o32.tbl | 1 arch/parisc/kernel/syscalls/syscall.tbl | 1 arch/powerpc/kernel/syscalls/syscall.tbl | 1 arch/s390/boot/string.c | 1 arch/s390/kernel/syscalls/syscall.tbl | 1 arch/sh/kernel/syscalls/syscall.tbl | 1 arch/sparc/kernel/syscalls/syscall.tbl | 1 arch/x86/boot/compressed/misc.h | 1 arch/x86/entry/syscalls/syscall_32.tbl | 1 arch/x86/entry/syscalls/syscall_64.tbl | 1 arch/x86/kernel/acpi/wakeup_64.S | 2 arch/x86/kvm/x86.c | 2 arch/xtensa/kernel/syscalls/syscall.tbl | 1 fs/eventpoll.c | 359 ++- include/linux/compat.h | 6 include/linux/kasan-checks.h | 2 include/linux/kasan.h | 423 ++-- include/linux/memcontrol.h | 137 - include/linux/mm.h | 24 include/linux/mmdebug.h | 13 include/linux/moduleloader.h | 3 include/linux/page-flags-layout.h | 2 include/linux/sched.h | 2 include/linux/string.h | 2 include/linux/syscalls.h | 5 include/uapi/asm-generic/unistd.h | 4 init/init_task.c | 2 kernel/fork.c | 4 kernel/sys_ni.c | 2 lib/Kconfig.kasan | 71 lib/test_kasan.c | 2 lib/test_kasan_module.c | 2 mm/Kconfig | 2 mm/kasan/Makefile | 33 mm/kasan/common.c | 1006 ++-------- mm/kasan/generic.c | 72 mm/kasan/generic_report.c | 13 mm/kasan/hw_tags.c | 294 ++ mm/kasan/init.c | 25 mm/kasan/kasan.h | 204 +- mm/kasan/quarantine.c | 35 mm/kasan/report.c | 363 +-- mm/kasan/report_generic.c | 169 + mm/kasan/report_hw_tags.c | 44 mm/kasan/report_sw_tags.c | 22 mm/kasan/shadow.c | 541 +++++ mm/kasan/sw_tags.c | 34 mm/kasan/tags.c | 7 mm/kasan/tags_report.c | 7 mm/memcontrol.c | 53 mm/mempool.c | 4 mm/page_alloc.c | 9 mm/page_poison.c | 2 mm/ptdump.c | 13 mm/slab_common.c | 5 mm/slub.c | 29 scripts/Makefile.lib | 2 tools/testing/selftests/arm64/mte/Makefile | 2 tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c | 155 + tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 72 virt/kvm/coalesced_mmio.c | 2 virt/kvm/kvm_main.c | 2 105 files changed, 3268 insertions(+), 1873 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-12-16 4:41 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-12-16 4:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - lots of little subsystems - a few post-linux-next MM material. Most of this awaits more merging of other trees. 95 patches, based on 489e9fea66f31086f85d9a18e61e4791d94a56a4. Subsystems affected by this patch series: mm/swap mm/memory-hotplug alpha procfs misc core-kernel bitmap lib lz4 bitops checkpatch nilfs kdump rapidio gcov bfs relay resource ubsan reboot fault-injection lzo apparmor mm/pagemap mm/cleanups mm/gup Subsystem: mm/swap Zhaoyang Huang <huangzhaoyang@gmail.com>: mm: fix a race on nr_swap_pages Subsystem: mm/memory-hotplug Laurent Dufour <ldufour@linux.ibm.com>: mm/memory_hotplug: quieting offline operation Subsystem: alpha Thomas Gleixner <tglx@linutronix.de>: alpha: replace bogus in_interrupt() Subsystem: procfs Randy Dunlap <rdunlap@infradead.org>: procfs: delete duplicated words + other fixes Anand K Mistry <amistry@google.com>: proc: provide details on indirect branch speculation Alexey Dobriyan <adobriyan@gmail.com>: proc: fix lookup in /proc/net subdirectories after setns(2) Hui Su <sh_def@163.com>: fs/proc: make pde_get() return nothing Subsystem: misc Christophe Leroy <christophe.leroy@csgroup.eu>: asm-generic: force inlining of get_order() to work around gcc10 poor decision Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: split out mathematical helpers Subsystem: core-kernel Hui Su <sh_def@163.com>: kernel/acct.c: use #elif instead of #end and #elif Subsystem: bitmap Andy Shevchenko <andriy.shevchenko@linux.intel.com>: include/linux/bitmap.h: convert bitmap_empty() / bitmap_full() to return boolean "Ma, Jianpeng" <jianpeng.ma@intel.com>: bitmap: remove unused function declaration Subsystem: lib Geert Uytterhoeven <geert@linux-m68k.org>: lib/test_free_pages.c: add basic progress indicators "Gustavo A. R. Silva" <gustavoars@kernel.org>: Patch series "] lib/stackdepot.c: Replace one-element array with flexible-array member": lib/stackdepot.c: replace one-element array with flexible-array member lib/stackdepot.c: use flex_array_size() helper in memcpy() lib/stackdepot.c: use array_size() helper in jhash2() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: lib/test_lockup.c: minimum fix to get it compiled on PREEMPT_RT Andy Shevchenko <andriy.shevchenko@linux.intel.com>: lib/list_kunit: follow new file name convention for KUnit tests lib/linear_ranges_kunit: follow new file name convention for KUnit tests lib/bits_kunit: follow new file name convention for KUnit tests lib/cmdline: fix get_option() for strings starting with hyphen lib/cmdline: allow NULL to be an output for get_option() lib/cmdline_kunit: add a new test suite for cmdline API Jakub Jelinek <jakub@redhat.com>: ilog2: improve ilog2 for constant arguments Nick Desaulniers <ndesaulniers@google.com>: lib/string: remove unnecessary #undefs Daniel Axtens <dja@axtens.net>: Patch series "Fortify strscpy()", v7: lib: string.h: detect intra-object overflow in fortified string functions lkdtm: tests for FORTIFY_SOURCE Francis Laniel <laniel_francis@privacyrequired.com>: string.h: add FORTIFY coverage for strscpy() drivers/misc/lkdtm: add new file in LKDTM to test fortified strscpy drivers/misc/lkdtm/lkdtm.h: correct wrong filenames in comment Alexey Dobriyan <adobriyan@gmail.com>: lib: cleanup kstrto*() usage Subsystem: lz4 Gao Xiang <hsiangkao@redhat.com>: lib/lz4: explicitly support in-place decompression Subsystem: bitops Syed Nayyar Waris <syednwaris@gmail.com>: Patch series "Introduce the for_each_set_clump macro", v12: bitops: introduce the for_each_set_clump macro lib/test_bitmap.c: add for_each_set_clump test cases gpio: thunderx: utilize for_each_set_clump macro gpio: xilinx: utilize generic bitmap_get_value and _set_value Subsystem: checkpatch Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: add new exception to repeated word check Aditya Srivastava <yashsri421@gmail.com>: checkpatch: fix false positives in REPEATED_WORD warning Łukasz Stelmach <l.stelmach@samsung.com>: checkpatch: ignore generated CamelCase defines and enum values Joe Perches <joe@perches.com>: checkpatch: prefer static const declarations checkpatch: allow --fix removal of unnecessary break statements Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: extend attributes check to handle more patterns Tom Rix <trix@redhat.com>: checkpatch: add a fixer for missing newline at eof Joe Perches <joe@perches.com>: checkpatch: update __attribute__((section("name"))) quote removal Aditya Srivastava <yashsri421@gmail.com>: checkpatch: add fix option for GERRIT_CHANGE_ID Joe Perches <joe@perches.com>: checkpatch: add __alias and __weak to suggested __attribute__ conversions Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: improve email parsing checkpatch: fix spelling errors and remove repeated word Aditya Srivastava <yashsri421@gmail.com>: checkpatch: avoid COMMIT_LOG_LONG_LINE warning for signature tags Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: fix unescaped left brace Aditya Srivastava <yashsri421@gmail.com>: checkpatch: add fix option for ASSIGNMENT_CONTINUATIONS checkpatch: add fix option for LOGICAL_CONTINUATIONS checkpatch: add fix and improve warning msg for non-standard signature Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: add warning for unnecessary use of %h[xudi] and %hh[xudi] checkpatch: add warning for lines starting with a '#' in commit log checkpatch: fix TYPO_SPELLING check for words with apostrophe Joe Perches <joe@perches.com>: checkpatch: add printk_once and printk_ratelimit to prefer pr_<level> warning Subsystem: nilfs Alex Shi <alex.shi@linux.alibaba.com>: fs/nilfs2: remove some unused macros to tame gcc Subsystem: kdump Alexander Egorenkov <egorenar@linux.ibm.com>: kdump: append uts_namespace.name offset to VMCOREINFO Subsystem: rapidio Sebastian Andrzej Siewior <bigeasy@linutronix.de>: rapidio: remove unused rio_get_asm() and rio_get_device() Subsystem: gcov Nick Desaulniers <ndesaulniers@google.com>: gcov: remove support for GCC < 4.9 Alex Shi <alex.shi@linux.alibaba.com>: gcov: fix kernel-doc markup issue Subsystem: bfs Randy Dunlap <rdunlap@infradead.org>: bfs: don't use WARNING: string when it's just info. Subsystem: relay Jani Nikula <jani.nikula@intel.com>: Patch series "relay: cleanup and const callbacks", v2: relay: remove unused buf_mapped and buf_unmapped callbacks relay: require non-NULL callbacks in relay_open() relay: make create_buf_file and remove_buf_file callbacks mandatory relay: allow the use of const callback structs drm/i915: make relay callbacks const ath10k: make relay callbacks const ath11k: make relay callbacks const ath9k: make relay callbacks const blktrace: make relay callbacks const Subsystem: resource Mauro Carvalho Chehab <mchehab+huawei@kernel.org>: kernel/resource.c: fix kernel-doc markups Subsystem: ubsan Kees Cook <keescook@chromium.org>: Patch series "Clean up UBSAN Makefile", v2: ubsan: remove redundant -Wno-maybe-uninitialized ubsan: move cc-option tests into Kconfig ubsan: disable object-size sanitizer under GCC ubsan: disable UBSAN_TRAP for all*config ubsan: enable for all*config builds ubsan: remove UBSAN_MISC in favor of individual options ubsan: expand tests and reporting Dmitry Vyukov <dvyukov@google.com>: kcov: don't instrument with UBSAN Zou Wei <zou_wei@huawei.com>: lib/ubsan.c: mark type_check_kinds with static keyword Subsystem: reboot Matteo Croce <mcroce@microsoft.com>: reboot: refactor and comment the cpu selection code reboot: allow to specify reboot mode via sysfs reboot: remove cf9_safe from allowed types and rename cf9_force Patch series "reboot: sysfs improvements": reboot: allow to override reboot type if quirks are found reboot: hide from sysfs not applicable settings Subsystem: fault-injection Barnabás Pőcze <pobrn@protonmail.com>: fault-injection: handle EI_ETYPE_TRUE Subsystem: lzo Jason Yan <yanaijie@huawei.com>: lib/lzo/lzo1x_compress.c: make lzogeneric1x_1_compress() static Subsystem: apparmor Andy Shevchenko <andriy.shevchenko@linux.intel.com>: apparmor: remove duplicate macro list_entry_is_head() Subsystem: mm/pagemap Christoph Hellwig <hch@lst.de>: Patch series "simplify follow_pte a bit": mm: unexport follow_pte_pmd mm: simplify follow_pte{,pmd} Subsystem: mm/cleanups Haitao Shi <shihaitao1@huawei.com>: mm: fix some spelling mistakes in comments Subsystem: mm/gup Jann Horn <jannh@google.com>: mmap locking API: don't check locking if the mm isn't live yet mm/gup: assert that the mmap lock is held in __get_user_pages() Documentation/ABI/testing/sysfs-kernel-reboot | 32 Documentation/admin-guide/kdump/vmcoreinfo.rst | 6 Documentation/dev-tools/ubsan.rst | 1 Documentation/filesystems/proc.rst | 2 MAINTAINERS | 5 arch/alpha/kernel/process.c | 2 arch/powerpc/kernel/vmlinux.lds.S | 4 arch/s390/pci/pci_mmio.c | 4 drivers/gpio/gpio-thunderx.c | 11 drivers/gpio/gpio-xilinx.c | 61 - drivers/gpu/drm/i915/gt/uc/intel_guc_log.c | 2 drivers/misc/lkdtm/Makefile | 1 drivers/misc/lkdtm/bugs.c | 50 + drivers/misc/lkdtm/core.c | 3 drivers/misc/lkdtm/fortify.c | 82 ++ drivers/misc/lkdtm/lkdtm.h | 19 drivers/net/wireless/ath/ath10k/spectral.c | 2 drivers/net/wireless/ath/ath11k/spectral.c | 2 drivers/net/wireless/ath/ath9k/common-spectral.c | 2 drivers/rapidio/rio.c | 81 -- fs/bfs/inode.c | 2 fs/dax.c | 9 fs/exec.c | 8 fs/nfs/callback_proc.c | 5 fs/nilfs2/segment.c | 5 fs/proc/array.c | 28 fs/proc/base.c | 2 fs/proc/generic.c | 24 fs/proc/internal.h | 10 fs/proc/proc_net.c | 20 include/asm-generic/bitops/find.h | 19 include/asm-generic/getorder.h | 2 include/linux/bitmap.h | 67 +- include/linux/bitops.h | 24 include/linux/dcache.h | 1 include/linux/iommu-helper.h | 4 include/linux/kernel.h | 173 ----- include/linux/log2.h | 3 include/linux/math.h | 177 +++++ include/linux/mm.h | 6 include/linux/mm_types.h | 10 include/linux/mmap_lock.h | 16 include/linux/proc_fs.h | 8 include/linux/rcu_node_tree.h | 2 include/linux/relay.h | 29 include/linux/rio_drv.h | 3 include/linux/string.h | 75 +- include/linux/units.h | 2 kernel/Makefile | 3 kernel/acct.c | 7 kernel/crash_core.c | 1 kernel/fail_function.c | 6 kernel/gcov/gcc_4_7.c | 10 kernel/reboot.c | 308 ++++++++- kernel/relay.c | 111 --- kernel/resource.c | 24 kernel/trace/blktrace.c | 2 lib/Kconfig.debug | 11 lib/Kconfig.ubsan | 154 +++- lib/Makefile | 7 lib/bits_kunit.c | 75 ++ lib/cmdline.c | 20 lib/cmdline_kunit.c | 100 +++ lib/errname.c | 1 lib/error-inject.c | 2 lib/errseq.c | 1 lib/find_bit.c | 17 lib/linear_ranges_kunit.c | 228 +++++++ lib/list-test.c | 748 ----------------------- lib/list_kunit.c | 748 +++++++++++++++++++++++ lib/lz4/lz4_decompress.c | 6 lib/lz4/lz4defs.h | 1 lib/lzo/lzo1x_compress.c | 2 lib/math/div64.c | 4 lib/math/int_pow.c | 2 lib/math/int_sqrt.c | 3 lib/math/reciprocal_div.c | 9 lib/stackdepot.c | 11 lib/string.c | 4 lib/test_bitmap.c | 143 ++++ lib/test_bits.c | 75 -- lib/test_firmware.c | 9 lib/test_free_pages.c | 5 lib/test_kmod.c | 26 lib/test_linear_ranges.c | 228 ------- lib/test_lockup.c | 16 lib/test_ubsan.c | 74 ++ lib/ubsan.c | 2 mm/filemap.c | 2 mm/gup.c | 2 mm/huge_memory.c | 2 mm/khugepaged.c | 2 mm/memblock.c | 2 mm/memory.c | 36 - mm/memory_hotplug.c | 2 mm/migrate.c | 2 mm/page_ext.c | 2 mm/swapfile.c | 11 scripts/Makefile.ubsan | 49 - scripts/checkpatch.pl | 495 +++++++++++---- security/apparmor/apparmorfs.c | 3 tools/testing/selftests/lkdtm/tests.txt | 1 102 files changed, 3022 insertions(+), 1899 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-12-15 20:32 Andrew Morton 2020-12-15 21:00 ` incoming Linus Torvalds 2020-12-15 22:48 ` incoming Linus Torvalds 0 siblings, 2 replies; 322+ messages in thread From: Andrew Morton @ 2020-12-15 20:32 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits - more MM work: a memcg scalability improvememt 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3. Subsystems affected by this patch series: Alex Shi <alex.shi@linux.alibaba.com>: Patch series "per memcg lru lock", v21: mm/thp: move lru_add_page_tail() to huge_memory.c mm/thp: use head for head page in lru_add_page_tail() mm/thp: simplify lru_add_page_tail() mm/thp: narrow lru locking mm/vmscan: remove unnecessary lruvec adding mm/rmap: stop store reordering issue on page->mapping Hugh Dickins <hughd@google.com>: mm: page_idle_get_page() does not need lru_lock Alex Shi <alex.shi@linux.alibaba.com>: mm/memcg: add debug checking in lock_page_memcg mm/swap.c: fold vm event PGROTATED into pagevec_move_tail_fn mm/lru: move lock into lru_note_cost mm/vmscan: remove lruvec reget in move_pages_to_lru mm/mlock: remove lru_lock on TestClearPageMlocked mm/mlock: remove __munlock_isolate_lru_page() mm/lru: introduce TestClearPageLRU() mm/compaction: do page isolation first in compaction mm/swap.c: serialize memcg changes in pagevec_lru_move_fn mm/lru: replace pgdat lru_lock with lruvec lock Alexander Duyck <alexander.h.duyck@linux.intel.com>: mm/lru: introduce relock_page_lruvec() Hugh Dickins <hughd@google.com>: mm/lru: revise the comments of lru_lock Documentation/admin-guide/cgroup-v1/memcg_test.rst | 15 - Documentation/admin-guide/cgroup-v1/memory.rst | 23 - Documentation/trace/events-kmem.rst | 2 Documentation/vm/unevictable-lru.rst | 22 - include/linux/memcontrol.h | 110 +++++++ include/linux/mm_types.h | 2 include/linux/mmzone.h | 6 include/linux/page-flags.h | 1 include/linux/swap.h | 4 mm/compaction.c | 98 ++++--- mm/filemap.c | 4 mm/huge_memory.c | 109 ++++--- mm/memcontrol.c | 84 +++++- mm/mlock.c | 93 ++---- mm/mmzone.c | 1 mm/page_alloc.c | 1 mm/page_idle.c | 4 mm/rmap.c | 12 mm/swap.c | 292 ++++++++------------- mm/vmscan.c | 239 ++++++++--------- mm/workingset.c | 2 21 files changed, 644 insertions(+), 480 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-12-15 20:32 incoming Andrew Morton @ 2020-12-15 21:00 ` Linus Torvalds 2020-12-15 22:48 ` incoming Linus Torvalds 1 sibling, 0 replies; 322+ messages in thread From: Linus Torvalds @ 2020-12-15 21:00 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > - more MM work: a memcg scalability improvememt > > 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3. I'm not seeing patch 10/19 at all. And patch 19/19 is corrupted and has an attachment with a '^P' character in it. I could fix it up, but with the missing patch in the middle I'm not going to even try. 'b4' is also very unhappy about that patch 19/19. I don't know what went wrong, but I'll ignore this send - please re-send the series at your leisure, ok? Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-12-15 20:32 incoming Andrew Morton 2020-12-15 21:00 ` incoming Linus Torvalds @ 2020-12-15 22:48 ` Linus Torvalds 2020-12-15 22:49 ` incoming Linus Torvalds 1 sibling, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2020-12-15 22:48 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > - more MM work: a memcg scalability improvememt > > 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3. With your re-send, I get all patches, but they don't actually apply cleanly. Is that base correct? I get error: patch failed: mm/huge_memory.c:2750 error: mm/huge_memory.c: patch does not apply Patch failed at 0004 mm/thp: narrow lru locking for that patch "[patch 04/19] mm/thp: narrow lru locking", and that's definitely true: the patch fragment has @@ -2750,7 +2751,7 @@ int split_huge_page_to_list(struct page __dec_lruvec_page_state(head, NR_FILE_THPS); } - __split_huge_page(page, list, end, flags); + __split_huge_page(page, list, end); ret = 0; } else { if (IS_ENABLED(CONFIG_DEBUG_VM) && mapcount) { but that __dec_lruvec_page_state() conversion was done by your previous commit series. So I have the feeling that what you actually mean by "base" isn't actually really the base for that series at all.. I will try to apply it on top of my merge of your previous series instead. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-12-15 22:48 ` incoming Linus Torvalds @ 2020-12-15 22:49 ` Linus Torvalds 2020-12-15 22:55 ` incoming Andrew Morton 0 siblings, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2020-12-15 22:49 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > I will try to apply it on top of my merge of your previous series instead. Yes, then it applies cleanly. So apparently we just have different concepts of what really constitutes a "base" for applying your series. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-12-15 22:49 ` incoming Linus Torvalds @ 2020-12-15 22:55 ` Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-12-15 22:55 UTC (permalink / raw) To: Linus Torvalds; +Cc: Linux-MM, mm-commits On Tue, 15 Dec 2020 14:49:24 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds > <torvalds@linux-foundation.org> wrote: > > > > I will try to apply it on top of my merge of your previous series instead. > > Yes, then it applies cleanly. So apparently we just have different > concepts of what really constitutes a "base" for applying your series. > oop, sorry, yes, the "based on" thing was wrong because I had two series in flight simultaneously. I've never tried that before.. ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-12-15 3:02 Andrew Morton 2020-12-15 3:25 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2020-12-15 3:02 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - a few random little subsystems - almost all of the MM patches which are staged ahead of linux-next material. I'll trickle to post-linux-next work in as the dependents get merged up. 200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442. Subsystems affected by this patch series: kthread kbuild ide ntfs ocfs2 arch mm/slab-generic mm/slab mm/slub mm/dax mm/debug mm/pagecache mm/gup mm/swap mm/shmem mm/memcg mm/pagemap mm/mremap mm/hmm mm/vmalloc mm/documentation mm/kasan mm/pagealloc mm/memory-failure mm/hugetlb mm/vmscan mm/z3fold mm/compaction mm/oom-kill mm/migration mm/cma mm/page-poison mm/userfaultfd mm/zswap mm/zsmalloc mm/uaccess mm/zram mm/cleanups Subsystem: kthread Rob Clark <robdclark@chromium.org>: kthread: add kthread_work tracepoints Petr Mladek <pmladek@suse.com>: kthread_worker: document CPU hotplug handling Subsystem: kbuild Petr Vorel <petr.vorel@gmail.com>: uapi: move constants from <linux/kernel.h> to <linux/const.h> Subsystem: ide Sebastian Andrzej Siewior <bigeasy@linutronix.de>: ide/falcon: remove in_interrupt() usage ide: remove BUG_ON(in_interrupt() || irqs_disabled()) from ide_unregister() Subsystem: ntfs Alex Shi <alex.shi@linux.alibaba.com>: fs/ntfs: remove unused varibles fs/ntfs: remove unused variable attr_len Subsystem: ocfs2 Tom Rix <trix@redhat.com>: fs/ocfs2/cluster/tcp.c: remove unneeded break Mauricio Faria de Oliveira <mfo@canonical.com>: ocfs2: ratelimit the 'max lookup times reached' notice Subsystem: arch Colin Ian King <colin.king@canonical.com>: arch/Kconfig: fix spelling mistakes Subsystem: mm/slab-generic Hui Su <sh_def@163.com>: mm/slab_common.c: use list_for_each_entry in dump_unreclaimable_slab() Bartosz Golaszewski <bgolaszewski@baylibre.com>: Patch series "slab: provide and use krealloc_array()", v3: mm: slab: clarify krealloc()'s behavior with __GFP_ZERO mm: slab: provide krealloc_array() ALSA: pcm: use krealloc_array() vhost: vringh: use krealloc_array() pinctrl: use krealloc_array() edac: ghes: use krealloc_array() drm: atomic: use krealloc_array() hwtracing: intel: use krealloc_array() dma-buf: use krealloc_array() Vlastimil Babka <vbabka@suse.cz>: mm, slab, slub: clear the slab_cache field when freeing page Subsystem: mm/slab Alexander Popov <alex.popov@linux.com>: mm/slab: rerform init_on_free earlier Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: mm, slub: use kmem_cache_debug_flags() in deactivate_slab() Bharata B Rao <bharata@linux.ibm.com>: mm/slub: let number of online CPUs determine the slub page order Subsystem: mm/dax Dan Williams <dan.j.williams@intel.com>: device-dax/kmem: use struct_size() Subsystem: mm/debug Zhenhua Huang <zhenhuah@codeaurora.org>: mm: fix page_owner initializing issue for arm32 Liam Mark <lmark@codeaurora.org>: mm/page_owner: record timestamp and pid Subsystem: mm/pagecache Kent Overstreet <kent.overstreet@gmail.com>: Patch series "generic_file_buffered_read() improvements", v2: mm/filemap/c: break generic_file_buffered_read up into multiple functions mm/filemap.c: generic_file_buffered_read() now uses find_get_pages_contig Alex Shi <alex.shi@linux.alibaba.com>: mm/truncate: add parameter explanation for invalidate_mapping_pagevec Hailong Liu <carver4lio@163.com>: mm/filemap.c: remove else after a return Subsystem: mm/gup John Hubbard <jhubbard@nvidia.com>: Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v3: mm/gup_benchmark: rename to mm/gup_test selftests/vm: use a common gup_test.h selftests/vm: rename run_vmtests --> run_vmtests.sh selftests/vm: minor cleanup: Makefile and gup_test.c selftests/vm: only some gup_test items are really benchmarks selftests/vm: gup_test: introduce the dump_pages() sub-test selftests/vm: run_vmtests.sh: update and clean up gup_test invocation selftests/vm: hmm-tests: remove the libhugetlbfs dependency selftests/vm: 2x speedup for run_vmtests.sh Barry Song <song.bao.hua@hisilicon.com>: mm/gup_test.c: mark gup_test_init as __init function mm/gup_test: GUP_TEST depends on DEBUG_FS Jason Gunthorpe <jgg@nvidia.com>: Patch series "Add a seqcount between gup_fast and copy_page_range()", v4: mm/gup: reorganize internal_get_user_pages_fast() mm/gup: prevent gup_fast from racing with COW during fork mm/gup: remove the vma allocation from gup_longterm_locked() mm/gup: combine put_compound_head() and unpin_user_page() Subsystem: mm/swap Ralph Campbell <rcampbell@nvidia.com>: mm: handle zone device pages in release_pages() Miaohe Lin <linmiaohe@huawei.com>: mm/swapfile.c: use helper function swap_count() in add_swap_count_continuation() mm/swap_state: skip meaningless swap cache readahead when ra_info.win == 0 mm/swapfile.c: remove unnecessary out label in __swap_duplicate() mm/swapfile.c: use memset to fill the swap_map with SWAP_HAS_CACHE Jeff Layton <jlayton@kernel.org>: mm: remove pagevec_lookup_range_nr_tag() Subsystem: mm/shmem Hui Su <sh_def@163.com>: mm/shmem.c: make shmem_mapping() inline Randy Dunlap <rdunlap@infradead.org>: tmpfs: fix Documentation nits Subsystem: mm/memcg Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: add file_thp, shmem_thp to memory.stat Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: remove unused mod_memcg_obj_state() Miaohe Lin <linmiaohe@huawei.com>: mm: memcontrol: eliminate redundant check in __mem_cgroup_insert_exceeded() Muchun Song <songmuchun@bytedance.com>: mm: memcg/slab: fix return of child memcg objcg for root memcg mm: memcg/slab: fix use after free in obj_cgroup_charge Shakeel Butt <shakeelb@google.com>: mm/rmap: always do TTU_IGNORE_ACCESS Alex Shi <alex.shi@linux.alibaba.com>: mm/memcg: update page struct member in comments Roman Gushchin <guro@fb.com>: mm: memcg: fix obsolete code comments Patch series "mm: memcg: deprecate cgroup v1 non-hierarchical mode", v1: mm: memcg: deprecate the non-hierarchical mode docs: cgroup-v1: reflect the deprecation of the non-hierarchical mode cgroup: remove obsoleted broken_hierarchy and warned_broken_hierarchy Hui Su <sh_def@163.com>: mm/page_counter: use page_counter_read in page_counter_set_max Lukas Bulwahn <lukas.bulwahn@gmail.com>: mm: memcg: remove obsolete memcg_has_children() Muchun Song <songmuchun@bytedance.com>: mm: memcg/slab: rename *_lruvec_slab_state to *_lruvec_kmem_state Kaixu Xia <kaixuxia@tencent.com>: mm: memcontrol: sssign boolean values to a bool variable Alex Shi <alex.shi@linux.alibaba.com>: mm/memcg: remove incorrect comment Shakeel Butt <shakeelb@google.com>: Patch series "memcg: add pagetable comsumption to memory.stat", v2: mm: move lruvec stats update functions to vmstat.h mm: memcontrol: account pagetables per node Subsystem: mm/pagemap Dan Williams <dan.j.williams@intel.com>: xen/unpopulated-alloc: consolidate pgmap manipulation Kalesh Singh <kaleshsingh@google.com>: Patch series "Speed up mremap on large regions", v4: kselftests: vm: add mremap tests mm: speedup mremap on 1GB or larger regions arm64: mremap speedup - enable HAVE_MOVE_PUD x86: mremap speedup - Enable HAVE_MOVE_PUD John Hubbard <jhubbard@nvidia.com>: mm: cleanup: remove unused tsk arg from __access_remote_vm Alex Shi <alex.shi@linux.alibaba.com>: mm/mapping_dirty_helpers: enhance the kernel-doc markups mm/page_vma_mapped.c: add colon to fix kernel-doc markups error for check_pte Axel Rasmussen <axelrasmussen@google.com>: mm: mmap_lock: add tracepoints around lock acquisition "Matthew Wilcox (Oracle)" <willy@infradead.org>: sparc: fix handling of page table constructor failure mm: move free_unref_page to mm/internal.h Subsystem: mm/mremap Dmitry Safonov <dima@arista.com>: Patch series "mremap: move_vma() fixes": mm/mremap: account memory on do_munmap() failure mm/mremap: for MREMAP_DONTUNMAP check security_vm_enough_memory_mm() mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio vm_ops: rename .split() callback to .may_split() mremap: check if it's possible to split original vma mm: forbid splitting special mappings Subsystem: mm/hmm Daniel Vetter <daniel.vetter@ffwll.ch>: mm: track mmu notifiers in fs_reclaim_acquire/release mm: extract might_alloc() debug check locking/selftests: add testcases for fs_reclaim Subsystem: mm/vmalloc Andrew Morton <akpm@linux-foundation.org>: mm/vmalloc.c:__vmalloc_area_node(): avoid 32-bit overflow "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: use free_vm_area() if an allocation fails mm/vmalloc: rework the drain logic Alex Shi <alex.shi@linux.alibaba.com>: mm/vmalloc: add 'align' parameter explanation for pvm_determine_end_from_reverse Baolin Wang <baolin.wang@linux.alibaba.com>: mm/vmalloc.c: remove unnecessary return statement Waiman Long <longman@redhat.com>: mm/vmalloc: Fix unlock order in s_stop() Subsystem: mm/documentation Alex Shi <alex.shi@linux.alibaba.com>: docs/vm: remove unused 3 items explanation for /proc/vmstat Subsystem: mm/kasan Vincenzo Frascino <vincenzo.frascino@arm.com>: mm/vmalloc.c: fix kasan shadow poisoning size Walter Wu <walter-zh.wu@mediatek.com>: Patch series "kasan: add workqueue stack for generic KASAN", v5: workqueue: kasan: record workqueue stack kasan: print workqueue stack lib/test_kasan.c: add workqueue test case kasan: update documentation for generic kasan Marco Elver <elver@google.com>: lkdtm: disable KASAN for rodata.o Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: Patch series "arch, mm: deprecate DISCONTIGMEM", v2: alpha: switch from DISCONTIGMEM to SPARSEMEM ia64: remove custom __early_pfn_to_nid() ia64: remove 'ifdef CONFIG_ZONE_DMA32' statements ia64: discontig: paging_init(): remove local max_pfn calculation ia64: split virtual map initialization out of paging_init() ia64: forbid using VIRTUAL_MEM_MAP with FLATMEM ia64: make SPARSEMEM default and disable DISCONTIGMEM arm: remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL arm, arm64: move free_unused_memmap() to generic mm arc: use FLATMEM with freeing of unused memory map instead of DISCONTIGMEM m68k/mm: make node data and node setup depend on CONFIG_DISCONTIGMEM m68k/mm: enable use of generic memory_model.h for !DISCONTIGMEM m68k: deprecate DISCONTIGMEM Patch series "arch, mm: improve robustness of direct map manipulation", v7: mm: introduce debug_pagealloc_{map,unmap}_pages() helpers PM: hibernate: make direct map manipulations more explicit arch, mm: restore dependency of __kernel_map_pages() on DEBUG_PAGEALLOC arch, mm: make kernel_page_present() always available Vlastimil Babka <vbabka@suse.cz>: Patch series "disable pcplists during memory offline", v3: mm, page_alloc: clean up pageset high and batch update mm, page_alloc: calculate pageset high and batch once per zone mm, page_alloc: remove setup_pageset() mm, page_alloc: simplify pageset_update() mm, page_alloc: cache pageset high and batch in struct zone mm, page_alloc: move draining pcplists to page isolation users mm, page_alloc: disable pcplists during memory offline Miaohe Lin <linmiaohe@huawei.com>: include/linux/page-flags.h: remove unused __[Set|Clear]PagePrivate "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/page-flags: fix comment mm/page_alloc: add __free_pages() documentation Zou Wei <zou_wei@huawei.com>: mm/page_alloc: mark some symbols with static keyword David Hildenbrand <david@redhat.com>: mm/page_alloc: clear all pages in post_alloc_hook() with init_on_alloc=1 Lin Feng <linf@wangsu.com>: init/main: fix broken buffer_init when DEFERRED_STRUCT_PAGE_INIT set Lorenzo Stoakes <lstoakes@gmail.com>: mm: page_alloc: refactor setup_per_zone_lowmem_reserve() Muchun Song <songmuchun@bytedance.com>: mm/page_alloc: speed up the iteration of max_order Subsystem: mm/memory-failure Oscar Salvador <osalvador@suse.de>: Patch series "HWpoison: further fixes and cleanups", v5: mm,hwpoison: drain pcplists before bailing out for non-buddy zero-refcount page mm,hwpoison: take free pages off the buddy freelists mm,hwpoison: drop unneeded pcplist draining Patch series "HWPoison: Refactor get page interface", v2: mm,hwpoison: refactor get_any_page mm,hwpoison: disable pcplists before grabbing a refcount mm,hwpoison: remove drain_all_pages from shake_page mm,memory_failure: always pin the page in madvise_inject_error mm,hwpoison: return -EBUSY when migration fails Subsystem: mm/hugetlb Hui Su <sh_def@163.com>: mm/hugetlb.c: just use put_page_testzero() instead of page_count() Ralph Campbell <rcampbell@nvidia.com>: include/linux/huge_mm.h: remove extern keyword Alex Shi <alex.shi@linux.alibaba.com>: khugepaged: add parameter explanations for kernel-doc markup Liu Xiang <liu.xiang@zlingsmart.com>: mm: hugetlb: fix type of delta parameter and related local variables in gather_surplus_pages() Oscar Salvador <osalvador@suse.de>: mm,hugetlb: remove unneeded initialization Dan Carpenter <dan.carpenter@oracle.com>: hugetlb: fix an error code in hugetlb_reserve_pages() Subsystem: mm/vmscan Johannes Weiner <hannes@cmpxchg.org>: mm: don't wake kswapd prematurely when watermark boosting is disabled Lukas Bulwahn <lukas.bulwahn@gmail.com>: mm/vmscan: drop unneeded assignment in kswapd() "logic.yu" <hymmsx.yu@gmail.com>: mm/vmscan.c: remove the filename in the top of file comment Muchun Song <songmuchun@bytedance.com>: mm/page_isolation: do not isolate the max order page Subsystem: mm/z3fold Vitaly Wool <vitaly.wool@konsulko.com>: Patch series "z3fold: stability / rt fixes": z3fold: simplify freeing slots z3fold: stricter locking and more careful reclaim z3fold: remove preempt disabled sections for RT Subsystem: mm/compaction Yanfei Xu <yanfei.xu@windriver.com>: mm/compaction: rename 'start_pfn' to 'iteration_start_pfn' in compact_zone() Hui Su <sh_def@163.com>: mm/compaction: move compaction_suitable's comment to right place mm/compaction: make defer_compaction and compaction_deferred static Subsystem: mm/oom-kill Hui Su <sh_def@163.com>: mm/oom_kill: change comment and rename is_dump_unreclaim_slabs() Subsystem: mm/migration Long Li <lonuxli.64@gmail.com>: mm/migrate.c: fix comment spelling Ralph Campbell <rcampbell@nvidia.com>: mm/migrate.c: optimize migrate_vma_pages() mmu notifier "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: support THPs in zero_user_segments Yang Shi <shy828301@gmail.com>: Patch series "mm: misc migrate cleanup and improvement", v3: mm: truncate_complete_page() does not exist any more mm: migrate: simplify the logic for handling permanent failure mm: migrate: skip shared exec THP for NUMA balancing mm: migrate: clean up migrate_prep{_local} mm: migrate: return -ENOSYS if THP migration is unsupported Stephen Zhang <starzhangzsd@gmail.com>: mm: migrate: remove unused parameter in migrate_vma_insert_page() Subsystem: mm/cma Lecopzer Chen <lecopzer.chen@mediatek.com>: mm/cma.c: remove redundant cma_mutex lock Charan Teja Reddy <charante@codeaurora.org>: mm: cma: improve pr_debug log in cma_release() Subsystem: mm/page-poison Vlastimil Babka <vbabka@suse.cz>: Patch series "cleanup page poisoning", v3: mm, page_alloc: do not rely on the order of page_poison and init_on_alloc/free parameters mm, page_poison: use static key more efficiently kernel/power: allow hibernation with page_poison sanity checking mm, page_poison: remove CONFIG_PAGE_POISONING_NO_SANITY mm, page_poison: remove CONFIG_PAGE_POISONING_ZERO Subsystem: mm/userfaultfd Lokesh Gidra <lokeshgidra@google.com>: Patch series "Control over userfaultfd kernel-fault handling", v6: userfaultfd: add UFFD_USER_MODE_ONLY userfaultfd: add user-mode only option to unprivileged_userfaultfd sysctl knob Axel Rasmussen <axelrasmussen@google.com>: userfaultfd: selftests: make __{s,u}64 format specifiers portable Peter Xu <peterx@redhat.com>: Patch series "userfaultfd: selftests: Small fixes": userfaultfd/selftests: always dump something in modes userfaultfd/selftests: fix retval check for userfaultfd_open() userfaultfd/selftests: hint the test runner on required privilege Subsystem: mm/zswap Joe Perches <joe@perches.com>: mm/zswap: make struct kernel_param_ops definitions const YueHaibing <yuehaibing@huawei.com>: mm/zswap: fix passing zero to 'PTR_ERR' warning Barry Song <song.bao.hua@hisilicon.com>: mm/zswap: move to use crypto_acomp API for hardware acceleration Subsystem: mm/zsmalloc Miaohe Lin <linmiaohe@huawei.com>: mm/zsmalloc.c: rework the list_add code in insert_zspage() Subsystem: mm/uaccess Colin Ian King <colin.king@canonical.com>: mm/process_vm_access: remove redundant initialization of iov_r Subsystem: mm/zram Minchan Kim <minchan@kernel.org>: zram: support page writeback zram: add stat to gather incompressible pages since zram set up Rui Salvaterra <rsalvaterra@gmail.com>: zram: break the strict dependency from lzo Subsystem: mm/cleanups Mauro Carvalho Chehab <mchehab+huawei@kernel.org>: mm: fix kernel-doc markups Joe Perches <joe@perches.com>: Patch series "mm: Convert sysfs sprintf family to sysfs_emit", v2: mm: use sysfs_emit for struct kobject * uses mm: huge_memory: convert remaining use of sprintf to sysfs_emit and neatening mm:backing-dev: use sysfs_emit in macro defining functions mm: shmem: convert shmem_enabled_show to use sysfs_emit_at mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at "Gustavo A. R. Silva" <gustavoars@kernel.org>: mm: fix fall-through warnings for Clang Alexey Dobriyan <adobriyan@gmail.com>: mm: cleanup kstrto*() usage /mmap_lock.h | 107 ++ a/Documentation/admin-guide/blockdev/zram.rst | 6 a/Documentation/admin-guide/cgroup-v1/memcg_test.rst | 8 a/Documentation/admin-guide/cgroup-v1/memory.rst | 42 a/Documentation/admin-guide/cgroup-v2.rst | 11 a/Documentation/admin-guide/mm/transhuge.rst | 15 a/Documentation/admin-guide/sysctl/vm.rst | 15 a/Documentation/core-api/memory-allocation.rst | 4 a/Documentation/core-api/pin_user_pages.rst | 8 a/Documentation/dev-tools/kasan.rst | 5 a/Documentation/filesystems/tmpfs.rst | 8 a/Documentation/vm/memory-model.rst | 3 a/Documentation/vm/page_owner.rst | 12 a/arch/Kconfig | 21 a/arch/alpha/Kconfig | 8 a/arch/alpha/include/asm/mmzone.h | 14 a/arch/alpha/include/asm/page.h | 7 a/arch/alpha/include/asm/pgtable.h | 12 a/arch/alpha/include/asm/sparsemem.h | 18 a/arch/alpha/kernel/setup.c | 1 a/arch/arc/Kconfig | 3 a/arch/arc/include/asm/page.h | 20 a/arch/arc/mm/init.c | 29 a/arch/arm/Kconfig | 12 a/arch/arm/kernel/vdso.c | 9 a/arch/arm/mach-bcm/Kconfig | 1 a/arch/arm/mach-davinci/Kconfig | 1 a/arch/arm/mach-exynos/Kconfig | 1 a/arch/arm/mach-highbank/Kconfig | 1 a/arch/arm/mach-omap2/Kconfig | 1 a/arch/arm/mach-s5pv210/Kconfig | 1 a/arch/arm/mach-tango/Kconfig | 1 a/arch/arm/mm/init.c | 78 - a/arch/arm64/Kconfig | 9 a/arch/arm64/include/asm/cacheflush.h | 1 a/arch/arm64/include/asm/pgtable.h | 1 a/arch/arm64/kernel/vdso.c | 41 a/arch/arm64/mm/init.c | 68 - a/arch/arm64/mm/pageattr.c | 12 a/arch/ia64/Kconfig | 11 a/arch/ia64/include/asm/meminit.h | 2 a/arch/ia64/mm/contig.c | 88 -- a/arch/ia64/mm/discontig.c | 44 - a/arch/ia64/mm/init.c | 14 a/arch/ia64/mm/numa.c | 30 a/arch/m68k/Kconfig.cpu | 31 a/arch/m68k/include/asm/page.h | 2 a/arch/m68k/include/asm/page_mm.h | 7 a/arch/m68k/include/asm/virtconvert.h | 7 a/arch/m68k/mm/init.c | 10 a/arch/mips/vdso/genvdso.c | 4 a/arch/nds32/mm/mm-nds32.c | 6 a/arch/powerpc/Kconfig | 5 a/arch/riscv/Kconfig | 4 a/arch/riscv/include/asm/pgtable.h | 2 a/arch/riscv/include/asm/set_memory.h | 1 a/arch/riscv/mm/pageattr.c | 31 a/arch/s390/Kconfig | 4 a/arch/s390/configs/debug_defconfig | 2 a/arch/s390/configs/defconfig | 2 a/arch/s390/kernel/vdso.c | 11 a/arch/sparc/Kconfig | 4 a/arch/sparc/mm/init_64.c | 2 a/arch/x86/Kconfig | 5 a/arch/x86/entry/vdso/vma.c | 17 a/arch/x86/include/asm/set_memory.h | 1 a/arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 2 a/arch/x86/kernel/tboot.c | 1 a/arch/x86/mm/pat/set_memory.c | 6 a/drivers/base/node.c | 2 a/drivers/block/zram/Kconfig | 42 a/drivers/block/zram/zcomp.c | 2 a/drivers/block/zram/zram_drv.c | 29 a/drivers/block/zram/zram_drv.h | 1 a/drivers/dax/device.c | 4 a/drivers/dax/kmem.c | 2 a/drivers/dma-buf/sync_file.c | 3 a/drivers/edac/ghes_edac.c | 4 a/drivers/firmware/efi/efi.c | 1 a/drivers/gpu/drm/drm_atomic.c | 3 a/drivers/hwtracing/intel_th/msu.c | 2 a/drivers/ide/falconide.c | 2 a/drivers/ide/ide-probe.c | 3 a/drivers/misc/lkdtm/Makefile | 1 a/drivers/pinctrl/pinctrl-utils.c | 2 a/drivers/vhost/vringh.c | 3 a/drivers/virtio/virtio_balloon.c | 6 a/drivers/xen/unpopulated-alloc.c | 14 a/fs/aio.c | 5 a/fs/ntfs/file.c | 5 a/fs/ntfs/inode.c | 2 a/fs/ntfs/logfile.c | 3 a/fs/ocfs2/cluster/tcp.c | 1 a/fs/ocfs2/namei.c | 4 a/fs/proc/kcore.c | 2 a/fs/proc/meminfo.c | 2 a/fs/userfaultfd.c | 20 a/include/linux/cgroup-defs.h | 15 a/include/linux/compaction.h | 12 a/include/linux/fs.h | 2 a/include/linux/gfp.h | 2 a/include/linux/highmem.h | 19 a/include/linux/huge_mm.h | 93 -- a/include/linux/memcontrol.h | 148 --- a/include/linux/migrate.h | 4 a/include/linux/mm.h | 118 +- a/include/linux/mm_types.h | 8 a/include/linux/mmap_lock.h | 94 ++ a/include/linux/mmzone.h | 50 - a/include/linux/page-flags.h | 6 a/include/linux/page_ext.h | 8 a/include/linux/pagevec.h | 3 a/include/linux/poison.h | 4 a/include/linux/rmap.h | 1 a/include/linux/sched/mm.h | 16 a/include/linux/set_memory.h | 5 a/include/linux/shmem_fs.h | 6 a/include/linux/slab.h | 18 a/include/linux/vmalloc.h | 8 a/include/linux/vmstat.h | 104 ++ a/include/trace/events/sched.h | 84 + a/include/uapi/linux/const.h | 5 a/include/uapi/linux/ethtool.h | 2 a/include/uapi/linux/kernel.h | 9 a/include/uapi/linux/lightnvm.h | 2 a/include/uapi/linux/mroute6.h | 2 a/include/uapi/linux/netfilter/x_tables.h | 2 a/include/uapi/linux/netlink.h | 2 a/include/uapi/linux/sysctl.h | 2 a/include/uapi/linux/userfaultfd.h | 9 a/init/main.c | 6 a/ipc/shm.c | 8 a/kernel/cgroup/cgroup.c | 12 a/kernel/fork.c | 3 a/kernel/kthread.c | 29 a/kernel/power/hibernate.c | 2 a/kernel/power/power.h | 2 a/kernel/power/snapshot.c | 52 + a/kernel/ptrace.c | 2 a/kernel/workqueue.c | 3 a/lib/locking-selftest.c | 47 + a/lib/test_kasan_module.c | 29 a/mm/Kconfig | 25 a/mm/Kconfig.debug | 28 a/mm/Makefile | 4 a/mm/backing-dev.c | 8 a/mm/cma.c | 6 a/mm/compaction.c | 29 a/mm/filemap.c | 823 ++++++++++--------- a/mm/gup.c | 329 ++----- a/mm/gup_benchmark.c | 210 ---- a/mm/gup_test.c | 299 ++++++ a/mm/gup_test.h | 40 a/mm/highmem.c | 52 + a/mm/huge_memory.c | 86 + a/mm/hugetlb.c | 28 a/mm/init-mm.c | 1 a/mm/internal.h | 5 a/mm/kasan/generic.c | 3 a/mm/kasan/report.c | 4 a/mm/khugepaged.c | 58 - a/mm/ksm.c | 50 - a/mm/madvise.c | 14 a/mm/mapping_dirty_helpers.c | 6 a/mm/memblock.c | 80 + a/mm/memcontrol.c | 170 +-- a/mm/memory-failure.c | 322 +++---- a/mm/memory.c | 24 a/mm/memory_hotplug.c | 44 - a/mm/mempolicy.c | 8 a/mm/migrate.c | 183 ++-- a/mm/mm_init.c | 1 a/mm/mmap.c | 22 a/mm/mmap_lock.c | 230 +++++ a/mm/mmu_notifier.c | 7 a/mm/mmzone.c | 14 a/mm/mremap.c | 282 ++++-- a/mm/nommu.c | 8 a/mm/oom_kill.c | 14 a/mm/page_alloc.c | 517 ++++++----- a/mm/page_counter.c | 4 a/mm/page_ext.c | 10 a/mm/page_isolation.c | 18 a/mm/page_owner.c | 17 a/mm/page_poison.c | 56 - a/mm/page_vma_mapped.c | 9 a/mm/process_vm_access.c | 2 a/mm/rmap.c | 9 a/mm/shmem.c | 39 a/mm/slab.c | 10 a/mm/slab.h | 9 a/mm/slab_common.c | 10 a/mm/slob.c | 6 a/mm/slub.c | 156 +-- a/mm/swap.c | 12 a/mm/swap_state.c | 7 a/mm/swapfile.c | 14 a/mm/truncate.c | 18 a/mm/vmalloc.c | 105 +- a/mm/vmscan.c | 21 a/mm/vmstat.c | 6 a/mm/workingset.c | 8 a/mm/z3fold.c | 215 ++-- a/mm/zsmalloc.c | 11 a/mm/zswap.c | 193 +++- a/sound/core/pcm_lib.c | 4 a/tools/include/linux/poison.h | 6 a/tools/testing/selftests/vm/.gitignore | 4 a/tools/testing/selftests/vm/Makefile | 41 a/tools/testing/selftests/vm/check_config.sh | 31 a/tools/testing/selftests/vm/config | 2 a/tools/testing/selftests/vm/gup_benchmark.c | 143 --- a/tools/testing/selftests/vm/gup_test.c | 258 +++++ a/tools/testing/selftests/vm/hmm-tests.c | 10 a/tools/testing/selftests/vm/mremap_test.c | 344 +++++++ a/tools/testing/selftests/vm/run_vmtests | 51 - a/tools/testing/selftests/vm/userfaultfd.c | 94 -- 217 files changed, 4817 insertions(+), 3369 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-12-15 3:02 incoming Andrew Morton @ 2020-12-15 3:25 ` Linus Torvalds 2020-12-15 3:30 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2020-12-15 3:25 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM On Mon, Dec 14, 2020 at 7:02 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442. I haven't actually processed the patches yet, but I have a question for Konstantin wrt b4. All the patches except for _one_ get a nice little green check-mark next to them when I use 'git am' on this series. The one that did not was [patch 192/200]. I have no idea why - and it doesn't matter a lot to me, it just stood out as being different. I'm assuming Andrew has started doing patch attestation, and that patch failed. But if so, maybe Konstantin wants to know what went wrong. Konstantin? Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-12-15 3:25 ` incoming Linus Torvalds @ 2020-12-15 3:30 ` Linus Torvalds 2020-12-15 14:04 ` incoming Konstantin Ryabitsev 0 siblings, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2020-12-15 3:30 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM On Mon, Dec 14, 2020 at 7:25 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > All the patches except for _one_ get a nice little green check-mark > next to them when I use 'git am' on this series. > > The one that did not was [patch 192/200]. > > I have no idea why Hmm. It looks like that patch is the only one in the series with the ">From" marker in the commit message, from the silly "clarify that this isn't the first line in a new message in mbox format". And "b4 am" has turned the single ">" into two, making the stupid marker worse, and actually corrupting the end result. Coincidence? Or cause? Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-12-15 3:30 ` incoming Linus Torvalds @ 2020-12-15 14:04 ` Konstantin Ryabitsev 0 siblings, 0 replies; 322+ messages in thread From: Konstantin Ryabitsev @ 2020-12-15 14:04 UTC (permalink / raw) To: Linus Torvalds; +Cc: Andrew Morton, mm-commits, Linux-MM On Mon, Dec 14, 2020 at 07:30:54PM -0800, Linus Torvalds wrote: > > All the patches except for _one_ get a nice little green check-mark > > next to them when I use 'git am' on this series. > > > > The one that did not was [patch 192/200]. > > > > I have no idea why > > Hmm. It looks like that patch is the only one in the series with the > ">From" marker in the commit message, from the silly "clarify that > this isn't the first line in a new message in mbox format". > > And "b4 am" has turned the single ">" into two, making the stupid > marker worse, and actually corrupting the end result. It's a bug in b4 that I overlooked. Public-inbox emits mboxrd-formatted .mbox files, while Python's mailbox.mbox consumes mboxo only. The main distinction between the two is precisely that mboxrd will convert ">From " into ">>From " in an attempt to avoid corruption during escape/unescape (it didn't end up fixing the problem 100% and mostly introduced incompatibilities like this one). I have a fix in master/stable-0.6.y and I'll release a 0.6.2 before the end of the week. Thanks for the report. -K ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-12-11 21:35 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-12-11 21:35 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 8 patches, based on 33dc9614dc208291d0c4bcdeb5d30d481dcd2c4c. Subsystems affected by this patch series: mm/pagecache proc selftests kbuild mm/kasan mm/hugetlb Subsystem: mm/pagecache Andrew Morton <akpm@linux-foundation.org>: revert "mm/filemap: add static for function __add_to_page_cache_locked" Subsystem: proc Miles Chen <miles.chen@mediatek.com>: proc: use untagged_addr() for pagemap_read addresses Subsystem: selftests Arnd Bergmann <arnd@arndb.de>: selftest/fpu: avoid clang warning Subsystem: kbuild Arnd Bergmann <arnd@arndb.de>: kbuild: avoid static_assert for genksyms initramfs: fix clang build failure elfcore: fix building with clang Subsystem: mm/kasan Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: kasan: fix object remaining in offline per-cpu quarantine Subsystem: mm/hugetlb Gerald Schaefer <gerald.schaefer@linux.ibm.com>: mm/hugetlb: clear compound_nr before freeing gigantic pages fs/proc/task_mmu.c | 8 ++++++-- include/linux/build_bug.h | 5 +++++ include/linux/elfcore.h | 22 ++++++++++++++++++++++ init/initramfs.c | 2 +- kernel/Makefile | 1 - kernel/elfcore.c | 26 -------------------------- lib/Makefile | 3 ++- mm/filemap.c | 2 +- mm/hugetlb.c | 1 + mm/kasan/quarantine.c | 39 +++++++++++++++++++++++++++++++++++++++ 10 files changed, 77 insertions(+), 32 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-12-06 6:14 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-12-06 6:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 12 patches, based on 33256ce194110874d4bc90078b577c59f9076c59. Subsystems affected by this patch series: lib coredump mm/memcg mm/zsmalloc mm/swap mailmap mm/selftests mm/pagecache mm/hugetlb mm/pagemap Subsystem: lib Randy Dunlap <rdunlap@infradead.org>: zlib: export S390 symbols for zlib modules Subsystem: coredump Menglong Dong <dong.menglong@zte.com.cn>: coredump: fix core_pattern parse error Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: memcg/slab: fix obj_cgroup_charge() return value handling Yang Shi <shy828301@gmail.com>: mm: list_lru: set shrinker map bit when child nr_items is not zero Subsystem: mm/zsmalloc Minchan Kim <minchan@kernel.org>: mm/zsmalloc.c: drop ZSMALLOC_PGTABLE_MAPPING Subsystem: mm/swap Qian Cai <qcai@redhat.com>: mm/swapfile: do not sleep with a spin lock held Subsystem: mailmap Uwe Kleine-König <u.kleine-koenig@pengutronix.de>: mailmap: add two more addresses of Uwe Kleine-König Subsystem: mm/selftests Xingxing Su <suxingxing@loongson.cn>: tools/testing/selftests/vm: fix build error Axel Rasmussen <axelrasmussen@google.com>: userfaultfd: selftests: fix SIGSEGV if huge mmap fails Subsystem: mm/pagecache Alex Shi <alex.shi@linux.alibaba.com>: mm/filemap: add static for function __add_to_page_cache_locked Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: hugetlb_cgroup: fix offline of hugetlb cgroup with reservations Subsystem: mm/pagemap Liu Zixian <liuzixian4@huawei.com>: mm/mmap.c: fix mmap return value when vma is merged after call_mmap() .mailmap | 2 + arch/arm/configs/omap2plus_defconfig | 1 fs/coredump.c | 3 + include/linux/zsmalloc.h | 1 lib/zlib_dfltcc/dfltcc_inflate.c | 3 + mm/Kconfig | 13 ------- mm/filemap.c | 2 - mm/hugetlb_cgroup.c | 8 +--- mm/list_lru.c | 10 ++--- mm/mmap.c | 26 ++++++-------- mm/slab.h | 40 +++++++++++++--------- mm/swapfile.c | 4 +- mm/zsmalloc.c | 54 ------------------------------- tools/testing/selftests/vm/Makefile | 4 ++ tools/testing/selftests/vm/userfaultfd.c | 25 +++++++++----- 15 files changed, 75 insertions(+), 121 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-11-22 6:16 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-11-22 6:16 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 8 patches, based on a349e4c659609fd20e4beea89e5c4a4038e33a95. Subsystems affected by this patch series: mm/madvise kbuild mm/pagemap mm/readahead mm/memcg mm/userfaultfd vfs-akpm mm/madvise Subsystem: mm/madvise Eric Dumazet <edumazet@google.com>: mm/madvise: fix memory leak from process_madvise Subsystem: kbuild Nick Desaulniers <ndesaulniers@google.com>: compiler-clang: remove version check for BPF Tracing Subsystem: mm/pagemap Dan Williams <dan.j.williams@intel.com>: mm: fix phys_to_target_node() and memory_add_physaddr_to_nid() exports Subsystem: mm/readahead "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: fix readahead_page_batch for retry entries Subsystem: mm/memcg Muchun Song <songmuchun@bytedance.com>: mm: memcg/slab: fix root memcg vmstats Subsystem: mm/userfaultfd Gerald Schaefer <gerald.schaefer@linux.ibm.com>: mm/userfaultfd: do not access vma->vm_mm after calling handle_userfault() Subsystem: vfs-akpm Yicong Yang <yangyicong@hisilicon.com>: libfs: fix error cast of negative value in simple_attr_write() Subsystem: mm/madvise "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: fix madvise WILLNEED performance problem arch/ia64/include/asm/sparsemem.h | 6 ++++++ arch/powerpc/include/asm/mmzone.h | 5 +++++ arch/powerpc/include/asm/sparsemem.h | 5 ++--- arch/powerpc/mm/mem.c | 1 + arch/x86/include/asm/sparsemem.h | 10 ++++++++++ arch/x86/mm/numa.c | 2 ++ drivers/dax/Kconfig | 1 - fs/libfs.c | 6 ++++-- include/linux/compiler-clang.h | 2 ++ include/linux/memory_hotplug.h | 14 -------------- include/linux/numa.h | 30 +++++++++++++++++++++++++++++- include/linux/pagemap.h | 2 ++ mm/huge_memory.c | 9 ++++----- mm/madvise.c | 4 +--- mm/memcontrol.c | 9 +++++++-- mm/memory_hotplug.c | 18 ------------------ 16 files changed, 75 insertions(+), 49 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-11-14 6:51 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-11-14 6:51 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 14 patches, based on 9e6a39eae450b81c8b2c8cbbfbdf8218e9b40c81. Subsystems affected by this patch series: mm/migration mm/vmscan mailmap mm/slub mm/gup kbuild reboot kernel/watchdog mm/memcg mm/hugetlbfs panic ocfs2 Subsystem: mm/migration Zi Yan <ziy@nvidia.com>: mm/compaction: count pages and stop correctly during page isolation mm/compaction: stop isolation if too many pages are isolated and we have pages to migrate Subsystem: mm/vmscan Nicholas Piggin <npiggin@gmail.com>: mm/vmscan: fix NR_ISOLATED_FILE corruption on 64-bit Subsystem: mailmap Dmitry Baryshkov <dbaryshkov@gmail.com>: mailmap: fix entry for Dmitry Baryshkov/Eremin-Solenikov Subsystem: mm/slub Laurent Dufour <ldufour@linux.ibm.com>: mm/slub: fix panic in slab_alloc_node() Subsystem: mm/gup Jason Gunthorpe <jgg@nvidia.com>: mm/gup: use unpin_user_pages() in __gup_longterm_locked() Subsystem: kbuild Arvind Sankar <nivedita@alum.mit.edu>: compiler.h: fix barrier_data() on clang Subsystem: reboot Matteo Croce <mcroce@microsoft.com>: Patch series "fix parsing of reboot= cmdline", v3: Revert "kernel/reboot.c: convert simple_strtoul to kstrtoint" reboot: fix overflow parsing reboot cpu number Subsystem: kernel/watchdog Santosh Sivaraj <santosh@fossix.org>: kernel/watchdog: fix watchdog_allowed_mask not used warning Subsystem: mm/memcg Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: fix missing wakeup polling thread Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: hugetlbfs: fix anon huge page migration race Subsystem: panic Christophe Leroy <christophe.leroy@csgroup.eu>: panic: don't dump stack twice on warn Subsystem: ocfs2 Wengang Wang <wen.gang.wang@oracle.com>: ocfs2: initialize ip_next_orphan .mailmap | 5 +- fs/ocfs2/super.c | 1 include/asm-generic/barrier.h | 1 include/linux/compiler-clang.h | 6 -- include/linux/compiler-gcc.h | 19 -------- include/linux/compiler.h | 18 +++++++- include/linux/memcontrol.h | 11 ++++- kernel/panic.c | 3 - kernel/reboot.c | 28 ++++++------ kernel/watchdog.c | 4 - mm/compaction.c | 12 +++-- mm/gup.c | 14 ++++-- mm/hugetlb.c | 90 ++--------------------------------------- mm/memory-failure.c | 36 +++++++--------- mm/migrate.c | 46 +++++++++++--------- mm/rmap.c | 5 -- mm/slub.c | 2 mm/vmscan.c | 5 +- 18 files changed, 119 insertions(+), 187 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-11-02 1:06 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-11-02 1:06 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 15 patches, based on 3cea11cd5e3b00d91caf0b4730194039b45c5891. Subsystems affected by this patch series: mm/memremap mm/memcg mm/slab-generic mm/kasan mm/mempolicy signals lib mm/pagecache kthread mm/oom-kill mm/pagemap epoll core-kernel Subsystem: mm/memremap Ralph Campbell <rcampbell@nvidia.com>: mm/mremap_pages: fix static key devmap_managed_key updates Subsystem: mm/memcg Mike Kravetz <mike.kravetz@oracle.com>: hugetlb_cgroup: fix reservation accounting zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>: mm: memcontrol: correct the NR_ANON_THPS counter of hierarchical memcg Roman Gushchin <guro@fb.com>: mm: memcg: link page counters to root if use_hierarchy is false Subsystem: mm/slab-generic Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: adopt KUNIT tests to SW_TAGS mode Subsystem: mm/mempolicy Shijie Luo <luoshijie1@huawei.com>: mm: mempolicy: fix potential pte_unmap_unlock pte error Subsystem: signals Oleg Nesterov <oleg@redhat.com>: ptrace: fix task_join_group_stop() for the case when current is traced Subsystem: lib Vasily Gorbik <gor@linux.ibm.com>: lib/crc32test: remove extra local_irq_disable/enable Subsystem: mm/pagecache Jason Yan <yanaijie@huawei.com>: mm/truncate.c: make __invalidate_mapping_pages() static Subsystem: kthread Zqiang <qiang.zhang@windriver.com>: kthread_worker: prevent queuing delayed work from timer_fn when it is being canceled Subsystem: mm/oom-kill Charles Haithcock <chaithco@redhat.com>: mm, oom: keep oom_adj under or at upper limit when printing Subsystem: mm/pagemap Jason Gunthorpe <jgg@nvidia.com>: mm: always have io_remap_pfn_range() set pgprot_decrypted() Subsystem: epoll Soheil Hassas Yeganeh <soheil@google.com>: epoll: check ep_events_available() upon timeout epoll: add a selftest for epoll timeout race Subsystem: core-kernel Lukas Bulwahn <lukas.bulwahn@gmail.com>: kernel/hung_task.c: make type annotations consistent fs/eventpoll.c | 16 + fs/proc/base.c | 2 include/linux/mm.h | 9 include/linux/pgtable.h | 4 kernel/hung_task.c | 3 kernel/kthread.c | 3 kernel/signal.c | 19 - lib/crc32test.c | 4 lib/test_kasan.c | 149 +++++++--- mm/hugetlb.c | 20 - mm/memcontrol.c | 25 + mm/mempolicy.c | 6 mm/memremap.c | 39 +- mm/truncate.c | 2 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 95 ++++++ 15 files changed, 290 insertions(+), 106 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-10-17 23:13 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-10-17 23:13 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 40 patches, based on 9d9af1007bc08971953ae915d88dc9bb21344b53. Subsystems affected by this patch series: ia64 mm/memcg mm/migration mm/pagemap mm/gup mm/madvise mm/vmalloc misc Subsystem: ia64 Krzysztof Kozlowski <krzk@kernel.org>: ia64: fix build error with !COREDUMP Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm, memcg: rework remote charging API to support nesting Patch series "mm: kmem: kernel memory accounting in an interrupt context": mm: kmem: move memcg_kmem_bypass() calls to get_mem/obj_cgroup_from_current() mm: kmem: remove redundant checks from get_obj_cgroup_from_current() mm: kmem: prepare remote memcg charging infra for interrupt contexts mm: kmem: enable kernel memcg accounting from interrupt contexts Subsystem: mm/migration Joonsoo Kim <iamjoonsoo.kim@lge.com>: mm/memory-failure: remove a wrapper for alloc_migration_target() mm/memory_hotplug: remove a wrapper for alloc_migration_target() Miaohe Lin <linmiaohe@huawei.com>: mm/migrate: avoid possible unnecessary process right check in kernel_move_pages() Subsystem: mm/pagemap "Liam R. Howlett" <Liam.Howlett@Oracle.com>: mm/mmap: add inline vma_next() for readability of mmap code mm/mmap: add inline munmap_vma_range() for code readability Subsystem: mm/gup Jann Horn <jannh@google.com>: mm/gup_benchmark: take the mmap lock around GUP binfmt_elf: take the mmap lock around find_extend_vma() mm/gup: assert that the mmap lock is held in __get_user_pages() John Hubbard <jhubbard@nvidia.com>: Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v2: mm/gup_benchmark: rename to mm/gup_test selftests/vm: use a common gup_test.h selftests/vm: rename run_vmtests --> run_vmtests.sh selftests/vm: minor cleanup: Makefile and gup_test.c selftests/vm: only some gup_test items are really benchmarks selftests/vm: gup_test: introduce the dump_pages() sub-test selftests/vm: run_vmtests.sh: update and clean up gup_test invocation selftests/vm: hmm-tests: remove the libhugetlbfs dependency selftests/vm: 10x speedup for hmm-tests Subsystem: mm/madvise Minchan Kim <minchan@kernel.org>: Patch series "introduce memory hinting API for external process", v9: mm/madvise: pass mm to do_madvise pid: move pidfd_get_pid() to pid.c mm/madvise: introduce process_madvise() syscall: an external memory hinting API Subsystem: mm/vmalloc "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "remove alloc_vm_area", v4: mm: update the documentation for vfree Christoph Hellwig <hch@lst.de>: mm: add a VM_MAP_PUT_PAGES flag for vmap mm: add a vmap_pfn function mm: allow a NULL fn callback in apply_to_page_range zsmalloc: switch from alloc_vm_area to get_vm_area drm/i915: use vmap in shmem_pin_map drm/i915: stop using kmap in i915_gem_object_map drm/i915: use vmap in i915_gem_object_map xen/xenbus: use apply_to_page_range directly in xenbus_map_ring_pv x86/xen: open code alloc_vm_area in arch_gnttab_valloc mm: remove alloc_vm_area Patch series "two small vmalloc cleanups": mm: cleanup the gfp_mask handling in __vmalloc_area_node mm: remove the filename in the top of file comment in vmalloc.c Subsystem: misc Tian Tao <tiantao6@hisilicon.com>: mm: remove duplicate include statement in mmu.c Documentation/core-api/pin_user_pages.rst | 8 arch/alpha/kernel/syscalls/syscall.tbl | 1 arch/arm/mm/mmu.c | 1 arch/arm/tools/syscall.tbl | 1 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 2 arch/ia64/kernel/Makefile | 2 arch/ia64/kernel/syscalls/syscall.tbl | 1 arch/m68k/kernel/syscalls/syscall.tbl | 1 arch/microblaze/kernel/syscalls/syscall.tbl | 1 arch/mips/kernel/syscalls/syscall_n32.tbl | 1 arch/mips/kernel/syscalls/syscall_n64.tbl | 1 arch/mips/kernel/syscalls/syscall_o32.tbl | 1 arch/parisc/kernel/syscalls/syscall.tbl | 1 arch/powerpc/kernel/syscalls/syscall.tbl | 1 arch/s390/configs/debug_defconfig | 2 arch/s390/configs/defconfig | 2 arch/s390/kernel/syscalls/syscall.tbl | 1 arch/sh/kernel/syscalls/syscall.tbl | 1 arch/sparc/kernel/syscalls/syscall.tbl | 1 arch/x86/entry/syscalls/syscall_32.tbl | 1 arch/x86/entry/syscalls/syscall_64.tbl | 1 arch/x86/xen/grant-table.c | 27 +- arch/xtensa/kernel/syscalls/syscall.tbl | 1 drivers/gpu/drm/i915/Kconfig | 1 drivers/gpu/drm/i915/gem/i915_gem_pages.c | 136 ++++------ drivers/gpu/drm/i915/gt/shmem_utils.c | 78 +----- drivers/xen/xenbus/xenbus_client.c | 30 +- fs/binfmt_elf.c | 3 fs/buffer.c | 6 fs/io_uring.c | 2 fs/notify/fanotify/fanotify.c | 5 fs/notify/inotify/inotify_fsnotify.c | 5 include/linux/memcontrol.h | 12 include/linux/mm.h | 2 include/linux/pid.h | 1 include/linux/sched/mm.h | 43 +-- include/linux/syscalls.h | 2 include/linux/vmalloc.h | 7 include/uapi/asm-generic/unistd.h | 4 kernel/exit.c | 19 - kernel/pid.c | 19 + kernel/sys_ni.c | 1 mm/Kconfig | 24 + mm/Makefile | 2 mm/gup.c | 2 mm/gup_benchmark.c | 225 ------------------ mm/gup_test.c | 295 +++++++++++++++++++++-- mm/gup_test.h | 40 ++- mm/madvise.c | 125 ++++++++-- mm/memcontrol.c | 83 ++++-- mm/memory-failure.c | 18 - mm/memory.c | 16 - mm/memory_hotplug.c | 46 +-- mm/migrate.c | 71 +++-- mm/mmap.c | 74 ++++- mm/nommu.c | 7 mm/percpu.c | 3 mm/slab.h | 3 mm/vmalloc.c | 147 +++++------ mm/zsmalloc.c | 10 tools/testing/selftests/vm/.gitignore | 3 tools/testing/selftests/vm/Makefile | 40 ++- tools/testing/selftests/vm/check_config.sh | 31 ++ tools/testing/selftests/vm/config | 2 tools/testing/selftests/vm/gup_benchmark.c | 143 ----------- tools/testing/selftests/vm/gup_test.c | 260 ++++++++++++++++++-- tools/testing/selftests/vm/hmm-tests.c | 12 tools/testing/selftests/vm/run_vmtests | 334 -------------------------- tools/testing/selftests/vm/run_vmtests.sh | 350 +++++++++++++++++++++++++++- 70 files changed, 1580 insertions(+), 1224 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-10-16 2:40 Andrew Morton 2020-10-16 3:03 ` incoming Andrew Morton 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2020-10-16 2:40 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - most of the rest of mm/ - various other subsystems 156 patches, based on 578a7155c5a1894a789d4ece181abf9d25dc6b0d. Subsystems affected by this patch series: mm/dax mm/debug mm/thp mm/readahead mm/page-poison mm/util mm/memory-hotplug mm/zram mm/cleanups misc core-kernel get_maintainer MAINTAINERS lib bitops checkpatch binfmt ramfs autofs nilfs rapidio panic relay kgdb ubsan romfs fault-injection Subsystem: mm/dax Dan Williams <dan.j.williams@intel.com>: device-dax/kmem: fix resource release Subsystem: mm/debug "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "mm/debug_vm_pgtable fixes", v4: powerpc/mm: add DEBUG_VM WARN for pmd_clear powerpc/mm: move setting pte specific flags to pfn_pte mm/debug_vm_pgtable/ppc64: avoid setting top bits in radom value mm/debug_vm_pgtables/hugevmap: use the arch helper to identify huge vmap support. mm/debug_vm_pgtable/savedwrite: enable savedwrite test with CONFIG_NUMA_BALANCING mm/debug_vm_pgtable/THP: mark the pte entry huge before using set_pmd/pud_at mm/debug_vm_pgtable/set_pte/pmd/pud: don't use set_*_at to update an existing pte entry mm/debug_vm_pgtable/locks: move non page table modifying test together mm/debug_vm_pgtable/locks: take correct page table lock mm/debug_vm_pgtable/thp: use page table depost/withdraw with THP mm/debug_vm_pgtable/pmd_clear: don't use pmd/pud_clear on pte entries mm/debug_vm_pgtable/hugetlb: disable hugetlb test on ppc64 mm/debug_vm_pgtable: avoid none pte in pte_clear_test mm/debug_vm_pgtable: avoid doing memory allocation with pgtable_t mapped. Subsystem: mm/thp "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Fix read-only THP for non-tmpfs filesystems": XArray: add xa_get_order XArray: add xas_split mm/filemap: fix storing to a THP shadow entry Patch series "Remove assumptions of THP size": mm/filemap: fix page cache removal for arbitrary sized THPs mm/memory: remove page fault assumption of compound page size mm/page_owner: change split_page_owner to take a count "Kirill A. Shutemov" <kirill@shutemov.name>: mm/huge_memory: fix total_mapcount assumption of page size mm/huge_memory: fix split assumption of page size "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/huge_memory: fix page_trans_huge_mapcount assumption of THP size mm/huge_memory: fix can_split_huge_page assumption of THP size mm/rmap: fix assumptions of THP size mm/truncate: fix truncation for pages of arbitrary size mm/page-writeback: support tail pages in wait_for_stable_page mm/vmscan: allow arbitrary sized pages to be paged out fs: add a filesystem flag for THPs fs: do not update nr_thps for mappings which support THPs Huang Ying <ying.huang@intel.com>: mm: fix a race during THP splitting Subsystem: mm/readahead "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Readahead patches for 5.9/5.10": mm/readahead: add DEFINE_READAHEAD mm/readahead: make page_cache_ra_unbounded take a readahead_control mm/readahead: make do_page_cache_ra take a readahead_control David Howells <dhowells@redhat.com>: mm/readahead: make ondemand_readahead take a readahead_control mm/readahead: pass readahead_control to force_page_cache_ra "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/readahead: add page_cache_sync_ra and page_cache_async_ra David Howells <dhowells@redhat.com>: mm/filemap: fold ra_submit into do_sync_mmap_readahead mm/readahead: pass a file_ra_state into force_page_cache_ra Subsystem: mm/page-poison Naoya Horiguchi <naoya.horiguchi@nec.com>: Patch series "HWPOISON: soft offline rework", v7: mm,hwpoison: cleanup unused PageHuge() check mm, hwpoison: remove recalculating hpage mm,hwpoison-inject: don't pin for hwpoison_filter Oscar Salvador <osalvador@suse.de>: mm,hwpoison: unexport get_hwpoison_page and make it static mm,hwpoison: refactor madvise_inject_error mm,hwpoison: kill put_hwpoison_page mm,hwpoison: unify THP handling for hard and soft offline mm,hwpoison: rework soft offline for free pages mm,hwpoison: rework soft offline for in-use pages mm,hwpoison: refactor soft_offline_huge_page and __soft_offline_page mm,hwpoison: return 0 if the page is already poisoned in soft-offline Naoya Horiguchi <naoya.horiguchi@nec.com>: mm,hwpoison: introduce MF_MSG_UNSPLIT_THP mm,hwpoison: double-check page count in __get_any_page() Oscar Salvador <osalvador@suse.de>: mm,hwpoison: try to narrow window race for free pages Mateusz Nosek <mateusznosek0@gmail.com>: mm/page_poison.c: replace bool variable with static key Miaohe Lin <linmiaohe@huawei.com>: mm/vmstat.c: use helper macro abs() Subsystem: mm/util Bartosz Golaszewski <bgolaszewski@baylibre.com>: mm/util.c: update the kerneldoc for kstrdup_const() Jann Horn <jannh@google.com>: mm/mmu_notifier: fix mmget() assert in __mmu_interval_notifier_insert Subsystem: mm/memory-hotplug David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: online_pages()/offline_pages() cleanups", v2: mm/memory_hotplug: inline __offline_pages() into offline_pages() mm/memory_hotplug: enforce section granularity when onlining/offlining mm/memory_hotplug: simplify page offlining mm/page_alloc: simplify __offline_isolated_pages() mm/memory_hotplug: drop nr_isolate_pageblock in offline_pages() mm/page_isolation: simplify return value of start_isolate_page_range() mm/memory_hotplug: simplify page onlining mm/page_alloc: drop stale pageblock comment in memmap_init_zone*() mm: pass migratetype into memmap_init_zone() and move_pfn_range_to_zone() mm/memory_hotplug: mark pageblocks MIGRATE_ISOLATE while onlining memory Patch series "selective merging of system ram resources", v4: kernel/resource: make release_mem_region_adjustable() never fail kernel/resource: move and rename IORESOURCE_MEM_DRIVER_MANAGED mm/memory_hotplug: guard more declarations by CONFIG_MEMORY_HOTPLUG mm/memory_hotplug: prepare passing flags to add_memory() and friends mm/memory_hotplug: MEMHP_MERGE_RESOURCE to specify merging of System RAM resources virtio-mem: try to merge system ram resources xen/balloon: try to merge system ram resources hv_balloon: try to merge system ram resources kernel/resource: make iomem_resource implicit in release_mem_region_adjustable() Laurent Dufour <ldufour@linux.ibm.com>: mm: don't panic when links can't be created in sysfs David Hildenbrand <david@redhat.com>: Patch series "mm: place pages to the freelist tail when onlining and undoing isolation", v2: mm/page_alloc: convert "report" flag of __free_one_page() to a proper flag mm/page_alloc: place pages to tail in __putback_isolated_page() mm/page_alloc: move pages to tail in move_to_free_list() mm/page_alloc: place pages to tail in __free_pages_core() mm/memory_hotplug: update comment regarding zone shuffling Subsystem: mm/zram Douglas Anderson <dianders@chromium.org>: zram: failing to decompress is WARN_ON worthy Subsystem: mm/cleanups YueHaibing <yuehaibing@huawei.com>: mm/slab.h: remove duplicate include Wei Yang <richard.weiyang@linux.alibaba.com>: mm/page_reporting.c: drop stale list head check in page_reporting_cycle Ira Weiny <ira.weiny@intel.com>: mm/highmem.c: clean up endif comments Yu Zhao <yuzhao@google.com>: mm: use self-explanatory macros rather than "2" Miaohe Lin <linmiaohe@huawei.com>: mm: fix some broken comments Chen Tao <chentao3@hotmail.com>: mm: fix some comments formatting Xiaofei Tan <tanxiaofei@huawei.com>: mm/workingset.c: fix some doc warnings Miaohe Lin <linmiaohe@huawei.com>: mm: use helper function put_write_access() Mike Rapoport <rppt@linux.ibm.com>: include/linux/mmzone.h: remove unused early_pfn_valid() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: rename page_order() to buddy_order() Subsystem: misc Randy Dunlap <rdunlap@infradead.org>: fs: configfs: delete repeated words in comments Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: split out min()/max() et al. helpers Subsystem: core-kernel Liao Pingfang <liao.pingfang@zte.com.cn>: kernel/sys.c: replace do_brk with do_brk_flags in comment of prctl_set_mm_map() Randy Dunlap <rdunlap@infradead.org>: kernel/: fix repeated words in comments kernel: acct.c: fix some kernel-doc nits Subsystem: get_maintainer Joe Perches <joe@perches.com>: get_maintainer: add test for file in VCS Subsystem: MAINTAINERS Joe Perches <joe@perches.com>: get_maintainer: exclude MAINTAINERS file(s) from --git-fallback Jarkko Sakkinen <jarkko.sakkinen@linux.intel.com>: MAINTAINERS: jarkko.sakkinen@linux.intel.com -> jarkko@kernel.org Subsystem: lib Randy Dunlap <rdunlap@infradead.org>: lib: bitmap: delete duplicated words lib: libcrc32c: delete duplicated words lib: decompress_bunzip2: delete duplicated words lib: dynamic_queue_limits: delete duplicated words + fix typo lib: earlycpio: delete duplicated words lib: radix-tree: delete duplicated words lib: syscall: delete duplicated words lib: test_sysctl: delete duplicated words lib/mpi/mpi-bit.c: fix spello of "functions" Stephen Boyd <swboyd@chromium.org>: lib/idr.c: document calling context for IDA APIs mustn't use locks lib/idr.c: document that ida_simple_{get,remove}() are deprecated Christophe JAILLET <christophe.jaillet@wanadoo.fr>: lib/scatterlist.c: avoid a double memset Miaohe Lin <linmiaohe@huawei.com>: lib/percpu_counter.c: use helper macro abs() Andy Shevchenko <andriy.shevchenko@linux.intel.com>: include/linux/list.h: add a macro to test if entry is pointing to the head Dan Carpenter <dan.carpenter@oracle.com>: lib/test_hmm.c: fix an error code in dmirror_allocate_chunk() Tobias Jordan <kernel@cdqe.de>: lib/crc32.c: fix trivial typo in preprocessor condition Subsystem: bitops Wei Yang <richard.weiyang@linux.alibaba.com>: bitops: simplify get_count_order_long() bitops: use the same mechanism for get_count_order[_long] Subsystem: checkpatch Jerome Forissier <jerome@forissier.org>: checkpatch: add --kconfig-prefix Joe Perches <joe@perches.com>: checkpatch: move repeated word test checkpatch: add test for comma use that should be semicolon Rikard Falkeborn <rikard.falkeborn@gmail.com>: const_structs.checkpatch: add phy_ops Nicolas Boichat <drinkcat@chromium.org>: checkpatch: warn if trace_printk and friends are called Rikard Falkeborn <rikard.falkeborn@gmail.com>: const_structs.checkpatch: add pinctrl_ops and pinmux_ops Joe Perches <joe@perches.com>: checkpatch: warn on self-assignments checkpatch: allow not using -f with files that are in git Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: extend author Signed-off-by check for split From: header Joe Perches <joe@perches.com>: checkpatch: emit a warning on embedded filenames Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: fix multi-statement macro checks for while blocks. Łukasz Stelmach <l.stelmach@samsung.com>: checkpatch: fix false positive on empty block comment lines Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: add new warnings to author signoff checks. Subsystem: binfmt Chris Kennelly <ckennelly@google.com>: Patch series "Selecting Load Addresses According to p_align", v3: fs/binfmt_elf: use PT_LOAD p_align values for suitable start address tools/testing/selftests: add self-test for verifying load alignment Jann Horn <jannh@google.com>: Patch series "Fix ELF / FDPIC ELF core dumping, and use mmap_lock properly in there", v5: binfmt_elf_fdpic: stop using dump_emit() on user pointers on !MMU coredump: let dump_emit() bail out on short writes coredump: refactor page range dumping into common helper coredump: rework elf/elf_fdpic vma_dump_size() into common helper binfmt_elf, binfmt_elf_fdpic: use a VMA list snapshot mm/gup: take mmap_lock in get_dump_page() mm: remove the now-unnecessary mmget_still_valid() hack Subsystem: ramfs Matthew Wilcox (Oracle) <willy@infradead.org>: ramfs: fix nommu mmap with gaps in the page cache Subsystem: autofs Matthew Wilcox <willy@infradead.org>: autofs: harden ioctl table Subsystem: nilfs Wang Hai <wanghai38@huawei.com>: nilfs2: fix some kernel-doc warnings for nilfs2 Subsystem: rapidio Souptick Joarder <jrdr.linux@gmail.com>: rapidio: fix error handling path Jing Xiangfeng <jingxiangfeng@huawei.com>: rapidio: fix the missed put_device() for rio_mport_add_riodev Subsystem: panic Alexey Kardashevskiy <aik@ozlabs.ru>: panic: dump registers on panic_on_warn Subsystem: relay Sudip Mukherjee <sudipm.mukherjee@gmail.com>: kernel/relay.c: drop unneeded initialization Subsystem: kgdb Ritesh Harjani <riteshh@linux.ibm.com>: scripts/gdb/proc: add struct mount & struct super_block addr in lx-mounts command scripts/gdb/tasks: add headers and improve spacing format Subsystem: ubsan Elena Petrova <lenaptr@google.com>: sched.h: drop in_ubsan field when UBSAN is in trap mode George Popescu <georgepope@android.com>: ubsan: introduce CONFIG_UBSAN_LOCAL_BOUNDS for Clang Subsystem: romfs Libing Zhou <libing.zhou@nokia-sbell.com>: ROMFS: support inode blocks calculation Subsystem: fault-injection Albert van der Linde <alinde@google.com>: Patch series "add fault injection to user memory access", v3: lib, include/linux: add usercopy failure capability lib, uaccess: add failure injection to usercopy functions .mailmap | 1 Documentation/admin-guide/kernel-parameters.txt | 1 Documentation/core-api/xarray.rst | 14 Documentation/fault-injection/fault-injection.rst | 7 MAINTAINERS | 6 arch/ia64/mm/init.c | 4 arch/powerpc/include/asm/book3s/64/pgtable.h | 29 + arch/powerpc/include/asm/nohash/pgtable.h | 5 arch/powerpc/mm/pgtable.c | 5 arch/powerpc/platforms/powernv/memtrace.c | 2 arch/powerpc/platforms/pseries/hotplug-memory.c | 2 drivers/acpi/acpi_memhotplug.c | 3 drivers/base/memory.c | 3 drivers/base/node.c | 33 +- drivers/block/zram/zram_drv.c | 2 drivers/dax/kmem.c | 50 ++- drivers/hv/hv_balloon.c | 4 drivers/infiniband/core/uverbs_main.c | 3 drivers/rapidio/devices/rio_mport_cdev.c | 18 - drivers/s390/char/sclp_cmd.c | 2 drivers/vfio/pci/vfio_pci.c | 38 +- drivers/virtio/virtio_mem.c | 5 drivers/xen/balloon.c | 4 fs/autofs/dev-ioctl.c | 8 fs/binfmt_elf.c | 267 +++------------- fs/binfmt_elf_fdpic.c | 176 ++-------- fs/configfs/dir.c | 2 fs/configfs/file.c | 2 fs/coredump.c | 238 +++++++++++++- fs/ext4/verity.c | 4 fs/f2fs/verity.c | 4 fs/inode.c | 2 fs/nilfs2/bmap.c | 2 fs/nilfs2/cpfile.c | 6 fs/nilfs2/page.c | 1 fs/nilfs2/sufile.c | 4 fs/proc/task_mmu.c | 18 - fs/ramfs/file-nommu.c | 2 fs/romfs/super.c | 1 fs/userfaultfd.c | 28 - include/linux/bitops.h | 13 include/linux/blkdev.h | 1 include/linux/bvec.h | 6 include/linux/coredump.h | 13 include/linux/fault-inject-usercopy.h | 22 + include/linux/fs.h | 28 - include/linux/idr.h | 13 include/linux/ioport.h | 15 include/linux/jiffies.h | 3 include/linux/kernel.h | 150 --------- include/linux/list.h | 29 + include/linux/memory_hotplug.h | 42 +- include/linux/minmax.h | 153 +++++++++ include/linux/mm.h | 5 include/linux/mmzone.h | 17 - include/linux/node.h | 16 include/linux/nodemask.h | 2 include/linux/page-flags.h | 6 include/linux/page_owner.h | 6 include/linux/pagemap.h | 111 ++++++ include/linux/sched.h | 2 include/linux/sched/mm.h | 25 - include/linux/uaccess.h | 12 include/linux/vmstat.h | 2 include/linux/xarray.h | 22 + include/ras/ras_event.h | 3 kernel/acct.c | 10 kernel/cgroup/cpuset.c | 2 kernel/dma/direct.c | 2 kernel/fork.c | 4 kernel/futex.c | 2 kernel/irq/timings.c | 2 kernel/jump_label.c | 2 kernel/kcsan/encoding.h | 2 kernel/kexec_core.c | 2 kernel/kexec_file.c | 2 kernel/kthread.c | 2 kernel/livepatch/state.c | 2 kernel/panic.c | 12 kernel/pid_namespace.c | 2 kernel/power/snapshot.c | 2 kernel/range.c | 3 kernel/relay.c | 2 kernel/resource.c | 114 +++++-- kernel/smp.c | 2 kernel/sys.c | 2 kernel/user_namespace.c | 2 lib/Kconfig.debug | 7 lib/Kconfig.ubsan | 14 lib/Makefile | 1 lib/bitmap.c | 2 lib/crc32.c | 2 lib/decompress_bunzip2.c | 2 lib/dynamic_queue_limits.c | 4 lib/earlycpio.c | 2 lib/fault-inject-usercopy.c | 39 ++ lib/find_bit.c | 1 lib/hexdump.c | 1 lib/idr.c | 9 lib/iov_iter.c | 5 lib/libcrc32c.c | 2 lib/math/rational.c | 2 lib/math/reciprocal_div.c | 1 lib/mpi/mpi-bit.c | 2 lib/percpu_counter.c | 2 lib/radix-tree.c | 2 lib/scatterlist.c | 2 lib/strncpy_from_user.c | 3 lib/syscall.c | 2 lib/test_hmm.c | 2 lib/test_sysctl.c | 2 lib/test_xarray.c | 65 ++++ lib/usercopy.c | 5 lib/xarray.c | 208 ++++++++++++ mm/Kconfig | 2 mm/compaction.c | 6 mm/debug_vm_pgtable.c | 267 ++++++++-------- mm/filemap.c | 58 ++- mm/gup.c | 73 ++-- mm/highmem.c | 4 mm/huge_memory.c | 47 +- mm/hwpoison-inject.c | 18 - mm/internal.h | 47 +- mm/khugepaged.c | 2 mm/madvise.c | 52 --- mm/memory-failure.c | 357 ++++++++++------------ mm/memory.c | 7 mm/memory_hotplug.c | 223 +++++-------- mm/memremap.c | 3 mm/migrate.c | 11 mm/mmap.c | 7 mm/mmu_notifier.c | 2 mm/page-writeback.c | 1 mm/page_alloc.c | 289 +++++++++++------ mm/page_isolation.c | 16 mm/page_owner.c | 10 mm/page_poison.c | 20 - mm/page_reporting.c | 4 mm/readahead.c | 174 ++++------ mm/rmap.c | 10 mm/shmem.c | 2 mm/shuffle.c | 2 mm/slab.c | 2 mm/slab.h | 1 mm/slub.c | 2 mm/sparse.c | 2 mm/swap_state.c | 2 mm/truncate.c | 6 mm/util.c | 3 mm/vmscan.c | 5 mm/vmstat.c | 8 mm/workingset.c | 2 scripts/Makefile.ubsan | 10 scripts/checkpatch.pl | 238 ++++++++++---- scripts/const_structs.checkpatch | 3 scripts/gdb/linux/proc.py | 15 scripts/gdb/linux/tasks.py | 9 scripts/get_maintainer.pl | 9 tools/testing/selftests/exec/.gitignore | 1 tools/testing/selftests/exec/Makefile | 9 tools/testing/selftests/exec/load_address.c | 68 ++++ 161 files changed, 2532 insertions(+), 1864 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-10-16 2:40 incoming Andrew Morton @ 2020-10-16 3:03 ` Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-10-16 3:03 UTC (permalink / raw) To: Linus Torvalds, mm-commits, linux-mm And... I forgot to set in-reply-to :( Shall resend, omitting linux-mm. ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-10-13 23:46 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-10-13 23:46 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 181 patches, based on 029f56db6ac248769f2c260bfaf3c3c0e23e904c. Subsystems affected by this patch series: kbuild scripts ntfs ocfs2 vfs mm/slab mm/slub mm/kmemleak mm/dax mm/debug mm/pagecache mm/fadvise mm/gup mm/swap mm/memremap mm/memcg mm/selftests mm/pagemap mm/mincore mm/hmm mm/dma mm/memory-failure mm/vmalloc mm/documentation mm/kasan mm/pagealloc mm/hugetlb mm/vmscan mm/z3fold mm/zbud mm/compaction mm/mempolicy mm/mempool mm/memblock mm/oom-kill mm/migration Subsystem: kbuild Nick Desaulniers <ndesaulniers@google.com>: Patch series "set clang minimum version to 10.0.1", v3: compiler-clang: add build check for clang 10.0.1 Revert "kbuild: disable clang's default use of -fmerge-all-constants" Revert "arm64: bti: Require clang >= 10.0.1 for in-kernel BTI support" Revert "arm64: vdso: Fix compilation with clang older than 8" Partially revert "ARM: 8905/1: Emit __gnu_mcount_nc when using Clang 10.0.0 or newer" Marco Elver <elver@google.com>: kasan: remove mentions of unsupported Clang versions Nick Desaulniers <ndesaulniers@google.com>: compiler-gcc: improve version error compiler.h: avoid escaped section names export.h: fix section name for CONFIG_TRIM_UNUSED_KSYMS for Clang Lukas Bulwahn <lukas.bulwahn@gmail.com>: kbuild: doc: describe proper script invocation Subsystem: scripts Wang Qing <wangqing@vivo.com>: scripts/spelling.txt: increase error-prone spell checking Naoki Hayama <naoki.hayama@lineo.co.jp>: scripts/spelling.txt: add "arbitrary" typo Borislav Petkov <bp@suse.de>: scripts/decodecode: add the capability to supply the program counter Subsystem: ntfs Rustam Kovhaev <rkovhaev@gmail.com>: ntfs: add check for mft record size in superblock Subsystem: ocfs2 Randy Dunlap <rdunlap@infradead.org>: ocfs2: delete repeated words in comments Gang He <ghe@suse.com>: ocfs2: fix potential soft lockup during fstrim Subsystem: vfs Randy Dunlap <rdunlap@infradead.org>: fs/xattr.c: fix kernel-doc warnings for setxattr & removexattr Luo Jiaxing <luojiaxing@huawei.com>: fs_parse: mark fs_param_bad_value() as static Subsystem: mm/slab Mateusz Nosek <mateusznosek0@gmail.com>: mm/slab.c: clean code by removing redundant if condition tangjianqiang <wyqt1985@gmail.com>: include/linux/slab.h: fix a typo error in comment Subsystem: mm/slub Abel Wu <wuyun.wu@huawei.com>: mm/slub.c: branch optimization in free slowpath mm/slub: fix missing ALLOC_SLOWPATH stat when bulk alloc mm/slub: make add_full() condition more explicit Subsystem: mm/kmemleak Davidlohr Bueso <dave@stgolabs.net>: mm/kmemleak: rely on rcu for task stack scanning Hui Su <sh_def@163.com>: mm,kmemleak-test.c: move kmemleak-test.c to samples dir Subsystem: mm/dax Dan Williams <dan.j.williams@intel.com>: Patch series "device-dax: Support sub-dividing soft-reserved ranges", v5: x86/numa: cleanup configuration dependent command-line options x86/numa: add 'nohmat' option efi/fake_mem: arrange for a resource entry per efi_fake_mem instance ACPI: HMAT: refactor hmat_register_target_device to hmem_register_device resource: report parent to walk_iomem_res_desc() callback mm/memory_hotplug: introduce default phys_to_target_node() implementation ACPI: HMAT: attach a device for each soft-reserved range device-dax: drop the dax_region.pfn_flags attribute device-dax: move instance creation parameters to 'struct dev_dax_data' device-dax: make pgmap optional for instance creation device-dax/kmem: introduce dax_kmem_range() device-dax/kmem: move resource name tracking to drvdata device-dax/kmem: replace release_resource() with release_mem_region() device-dax: add an allocation interface for device-dax instances device-dax: introduce 'struct dev_dax' typed-driver operations device-dax: introduce 'seed' devices drivers/base: make device_find_child_by_name() compatible with sysfs inputs device-dax: add resize support mm/memremap_pages: convert to 'struct range' mm/memremap_pages: support multiple ranges per invocation device-dax: add dis-contiguous resource support device-dax: introduce 'mapping' devices Joao Martins <joao.m.martins@oracle.com>: device-dax: make align a per-device property Dan Williams <dan.j.williams@intel.com>: device-dax: add an 'align' attribute Joao Martins <joao.m.martins@oracle.com>: dax/hmem: introduce dax_hmem.region_idle parameter device-dax: add a range mapping allocation attribute Subsystem: mm/debug "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/debug.c: do not dereference i_ino blindly John Hubbard <jhubbard@nvidia.com>: mm, dump_page: rename head_mapcount() --> head_compound_mapcount() Subsystem: mm/pagecache "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Return head pages from find_*_entry", v2: mm: factor find_get_incore_page out of mincore_page mm: use find_get_incore_page in memcontrol mm: optimise madvise WILLNEED proc: optimise smaps for shmem entries i915: use find_lock_page instead of find_lock_entry mm: convert find_get_entry to return the head page mm/shmem: return head page from find_lock_entry mm: add find_lock_head mm/filemap: fix filemap_map_pages for THP Subsystem: mm/fadvise Yafang Shao <laoar.shao@gmail.com>: mm, fadvise: improve the expensive remote LRU cache draining after FADV_DONTNEED Subsystem: mm/gup Barry Song <song.bao.hua@hisilicon.com>: mm/gup_benchmark: update the documentation in Kconfig mm/gup_benchmark: use pin_user_pages for FOLL_LONGTERM flag mm/gup: don't permit users to call get_user_pages with FOLL_LONGTERM John Hubbard <jhubbard@nvidia.com>: mm/gup: protect unpin_user_pages() against npages==-ERRNO Subsystem: mm/swap Gao Xiang <hsiangkao@redhat.com>: swap: rename SWP_FS to SWAP_FS_OPS to avoid ambiguity Yu Zhao <yuzhao@google.com>: mm: remove activate_page() from unuse_pte() mm: remove superfluous __ClearPageActive() Miaohe Lin <linmiaohe@huawei.com>: mm/swap.c: fix confusing comment in release_pages() mm/swap_slots.c: remove always zero and unused return value of enable_swap_slots_cache() mm/page_io.c: remove useless out label in __swap_writepage() mm/swap.c: fix incomplete comment in lru_cache_add_inactive_or_unevictable() mm/swapfile.c: remove unnecessary goto out in _swap_info_get() mm/swapfile.c: fix potential memory leak in sys_swapon Subsystem: mm/memremap Ira Weiny <ira.weiny@intel.com>: mm/memremap.c: convert devmap static branch to {inc,dec} Subsystem: mm/memcg "Gustavo A. R. Silva" <gustavoars@kernel.org>: mm: memcontrol: use flex_array_size() helper in memcpy() mm: memcontrol: use the preferred form for passing the size of a structure type Roman Gushchin <guro@fb.com>: mm: memcg/slab: fix racy access to page->mem_cgroup in mem_cgroup_from_obj() Miaohe Lin <linmiaohe@huawei.com>: mm: memcontrol: correct the comment of mem_cgroup_iter() Waiman Long <longman@redhat.com>: Patch series "mm/memcg: Miscellaneous cleanups and streamlining", v2: mm/memcg: clean up obsolete enum charge_type mm/memcg: simplify mem_cgroup_get_max() mm/memcg: unify swap and memsw page counters Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: add the missing numa_stat interface for cgroup v2 Miaohe Lin <linmiaohe@huawei.com>: mm/page_counter: correct the obsolete func name in the comment of page_counter_try_charge() mm: memcontrol: reword obsolete comment of mem_cgroup_unmark_under_oom() Bharata B Rao <bharata@linux.ibm.com>: mm: memcg/slab: uncharge during kmem_cache_free_bulk() Ralph Campbell <rcampbell@nvidia.com>: mm/memcg: fix device private memcg accounting Subsystem: mm/selftests John Hubbard <jhubbard@nvidia.com>: Patch series "selftests/vm: fix some minor aggravating factors in the Makefile": selftests/vm: fix false build success on the second and later attempts selftests/vm: fix incorrect gcc invocation in some cases Subsystem: mm/pagemap Matthew Wilcox <willy@infradead.org>: mm: account PMD tables like PTE tables Yanfei Xu <yanfei.xu@windriver.com>: mm/memory.c: fix typo in __do_fault() comment mm/memory.c: replace vmf->vma with variable vma Wei Yang <richard.weiyang@linux.alibaba.com>: mm/mmap: rename __vma_unlink_common() to __vma_unlink() mm/mmap: leverage vma_rb_erase_ignore() to implement vma_rb_erase() Chinwen Chang <chinwen.chang@mediatek.com>: Patch series "Try to release mmap_lock temporarily in smaps_rollup", v4: mmap locking API: add mmap_lock_is_contended() mm: smaps*: extend smap_gather_stats to support specified beginning mm: proc: smaps_rollup: do not stall write attempts on mmap_lock "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Fix PageDoubleMap": mm: move PageDoubleMap bit mm: simplify PageDoubleMap with PF_SECOND policy Wei Yang <richard.weiyang@linux.alibaba.com>: mm/mmap: leave adjust_next as virtual address instead of page frame number Randy Dunlap <rdunlap@infradead.org>: mm/memory.c: fix spello of "function" Wei Yang <richard.weiyang@linux.alibaba.com>: mm/mmap: not necessary to check mapping separately mm/mmap: check on file instead of the rb_root_cached of its address_space Miaohe Lin <linmiaohe@huawei.com>: mm: use helper function mapping_allow_writable() mm/mmap.c: use helper function allow_write_access() in __remove_shared_vm_struct() Liao Pingfang <liao.pingfang@zte.com.cn>: mm/mmap.c: replace do_brk with do_brk_flags in comment of insert_vm_struct() Peter Xu <peterx@redhat.com>: mm: remove src/dst mm parameter in copy_page_range() Subsystem: mm/mincore yuleixzhang <yulei.kernel@gmail.com>: include/linux/huge_mm.h: remove mincore_huge_pmd declaration Subsystem: mm/hmm Ralph Campbell <rcampbell@nvidia.com>: tools/testing/selftests/vm/hmm-tests.c: use the new SKIP() macro lib/test_hmm.c: remove unused dmirror_zero_page Subsystem: mm/dma Andy Shevchenko <andriy.shevchenko@linux.intel.com>: mm/dmapool.c: replace open-coded list_for_each_entry_safe() mm/dmapool.c: replace hard coded function name with __func__ Subsystem: mm/memory-failure Xianting Tian <tian.xianting@h3c.com>: mm/memory-failure: do pgoff calculation before for_each_process() Alex Shi <alex.shi@linux.alibaba.com>: mm/memory-failure.c: remove unused macro `writeback' Subsystem: mm/vmalloc Hui Su <sh_def@163.com>: mm/vmalloc.c: update the comment in __vmalloc_area_node() mm/vmalloc.c: fix the comment of find_vm_area Subsystem: mm/documentation Alexander Gordeev <agordeev@linux.ibm.com>: docs/vm: fix 'mm_count' vs 'mm_users' counter confusion Subsystem: mm/kasan Patricia Alfonso <trishalfonso@google.com>: Patch series "KASAN-KUnit Integration", v14: kasan/kunit: add KUnit Struct to Current Task KUnit: KASAN Integration KASAN: port KASAN Tests to KUnit KASAN: Testing Documentation David Gow <davidgow@google.com>: mm: kasan: do not panic if both panic_on_warn and kasan_multishot set Subsystem: mm/pagealloc David Hildenbrand <david@redhat.com>: Patch series "mm / virtio-mem: support ZONE_MOVABLE", v5: mm/page_alloc: tweak comments in has_unmovable_pages() mm/page_isolation: exit early when pageblock is isolated in set_migratetype_isolate() mm/page_isolation: drop WARN_ON_ONCE() in set_migratetype_isolate() mm/page_isolation: cleanup set_migratetype_isolate() virtio-mem: don't special-case ZONE_MOVABLE mm: document semantics of ZONE_MOVABLE Li Xinhai <lixinhai.lxh@gmail.com>: mm, isolation: avoid checking unmovable pages across pageblock boundary Mateusz Nosek <mateusznosek0@gmail.com>: mm/page_alloc.c: clean code by removing unnecessary initialization mm/page_alloc.c: micro-optimization remove unnecessary branch mm/page_alloc.c: fix early params garbage value accesses mm/page_alloc.c: clean code by merging two functions Yanfei Xu <yanfei.xu@windriver.com>: mm/page_alloc.c: __perform_reclaim should return 'unsigned long' Mateusz Nosek <mateusznosek0@gmail.com>: mmzone: clean code by removing unused macro parameter Ralph Campbell <rcampbell@nvidia.com>: mm: move call to compound_head() in release_pages() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/page_alloc.c: fix freeing non-compound pages Michal Hocko <mhocko@suse.com>: include/linux/gfp.h: clarify usage of GFP_ATOMIC in !preemptible contexts Subsystem: mm/hugetlb Baoquan He <bhe@redhat.com>: Patch series "mm/hugetlb: Small cleanup and improvement", v2: mm/hugetlb.c: make is_hugetlb_entry_hwpoisoned return bool mm/hugetlb.c: remove the unnecessary non_swap_entry() doc/vm: fix typo in the hugetlb admin documentation Wei Yang <richard.weiyang@linux.alibaba.com>: Patch series "mm/hugetlb: code refine and simplification", v4: mm/hugetlb: not necessary to coalesce regions recursively mm/hugetlb: remove VM_BUG_ON(!nrg) in get_file_region_entry_from_cache() mm/hugetlb: use list_splice to merge two list at once mm/hugetlb: count file_region to be added when regions_needed != NULL mm/hugetlb: a page from buddy is not on any list mm/hugetlb: narrow the hugetlb_lock protection area during preparing huge page mm/hugetlb: take the free hpage during the iteration directly Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: add lockdep check for i_mmap_rwsem held in huge_pmd_share Subsystem: mm/vmscan Chunxin Zang <zangchunxin@bytedance.com>: mm/vmscan: fix infinite loop in drop_slab_node Hui Su <sh_def@163.com>: mm/vmscan: fix comments for isolate_lru_page() Subsystem: mm/z3fold Hui Su <sh_def@163.com>: mm/z3fold.c: use xx_zalloc instead xx_alloc and memset Subsystem: mm/zbud Xiang Chen <chenxiang66@hisilicon.com>: mm/zbud: remove redundant initialization Subsystem: mm/compaction Mateusz Nosek <mateusznosek0@gmail.com>: mm/compaction.c: micro-optimization remove unnecessary branch include/linux/compaction.h: clean code by removing unused enum value John Hubbard <jhubbard@nvidia.com>: selftests/vm: 8x compaction_test speedup Subsystem: mm/mempolicy Wei Yang <richard.weiyang@linux.alibaba.com>: mm/mempolicy: remove or narrow the lock on current mm: remove unused alloc_page_vma_node() Subsystem: mm/mempool Miaohe Lin <linmiaohe@huawei.com>: mm/mempool: add 'else' to split mutually exclusive case Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: Patch series "memblock: seasonal cleaning^w cleanup", v3: KVM: PPC: Book3S HV: simplify kvm_cma_reserve() dma-contiguous: simplify cma_early_percent_memory() arm, xtensa: simplify initialization of high memory pages arm64: numa: simplify dummy_numa_init() h8300, nds32, openrisc: simplify detection of memory extents riscv: drop unneeded node initialization mircoblaze: drop unneeded NUMA and sparsemem initializations memblock: make for_each_memblock_type() iterator private memblock: make memblock_debug and related functionality private memblock: reduce number of parameters in for_each_mem_range() arch, mm: replace for_each_memblock() with for_each_mem_pfn_range() arch, drivers: replace for_each_membock() with for_each_mem_range() x86/setup: simplify initrd relocation and reservation x86/setup: simplify reserve_crashkernel() memblock: remove unused memblock_mem_size() memblock: implement for_each_reserved_mem_region() using __next_mem_region() memblock: use separate iterators for memory and reserved regions Subsystem: mm/oom-kill Suren Baghdasaryan <surenb@google.com>: mm, oom_adj: don't loop through tasks in __set_oom_adj when not necessary Subsystem: mm/migration Ralph Campbell <rcampbell@nvidia.com>: mm/migrate: remove cpages-- in migrate_vma_finalize() mm/migrate: remove obsolete comment about device public .clang-format | 7 Documentation/admin-guide/cgroup-v2.rst | 69 + Documentation/admin-guide/mm/hugetlbpage.rst | 2 Documentation/dev-tools/kasan.rst | 74 + Documentation/dev-tools/kmemleak.rst | 2 Documentation/kbuild/makefiles.rst | 20 Documentation/vm/active_mm.rst | 2 Documentation/x86/x86_64/boot-options.rst | 4 MAINTAINERS | 2 Makefile | 9 arch/arm/Kconfig | 2 arch/arm/include/asm/tlb.h | 1 arch/arm/kernel/setup.c | 18 arch/arm/mm/init.c | 59 - arch/arm/mm/mmu.c | 39 arch/arm/mm/pmsa-v7.c | 23 arch/arm/mm/pmsa-v8.c | 17 arch/arm/xen/mm.c | 7 arch/arm64/Kconfig | 2 arch/arm64/kernel/machine_kexec_file.c | 6 arch/arm64/kernel/setup.c | 4 arch/arm64/kernel/vdso/Makefile | 7 arch/arm64/mm/init.c | 11 arch/arm64/mm/kasan_init.c | 10 arch/arm64/mm/mmu.c | 11 arch/arm64/mm/numa.c | 15 arch/c6x/kernel/setup.c | 9 arch/h8300/kernel/setup.c | 8 arch/microblaze/mm/init.c | 23 arch/mips/cavium-octeon/dma-octeon.c | 14 arch/mips/kernel/setup.c | 31 arch/mips/netlogic/xlp/setup.c | 2 arch/nds32/kernel/setup.c | 8 arch/openrisc/kernel/setup.c | 9 arch/openrisc/mm/init.c | 8 arch/powerpc/kernel/fadump.c | 61 - arch/powerpc/kexec/file_load_64.c | 16 arch/powerpc/kvm/book3s_hv_builtin.c | 12 arch/powerpc/kvm/book3s_hv_uvmem.c | 14 arch/powerpc/mm/book3s64/hash_utils.c | 16 arch/powerpc/mm/book3s64/radix_pgtable.c | 10 arch/powerpc/mm/kasan/kasan_init_32.c | 8 arch/powerpc/mm/mem.c | 31 arch/powerpc/mm/numa.c | 7 arch/powerpc/mm/pgtable_32.c | 8 arch/riscv/mm/init.c | 36 arch/riscv/mm/kasan_init.c | 10 arch/s390/kernel/setup.c | 27 arch/s390/mm/page-states.c | 6 arch/s390/mm/vmem.c | 7 arch/sh/mm/init.c | 9 arch/sparc/mm/init_64.c | 12 arch/x86/include/asm/numa.h | 8 arch/x86/kernel/e820.c | 16 arch/x86/kernel/setup.c | 56 - arch/x86/mm/numa.c | 13 arch/x86/mm/numa_emulation.c | 3 arch/x86/xen/enlighten_pv.c | 2 arch/xtensa/mm/init.c | 55 - drivers/acpi/numa/hmat.c | 76 - drivers/acpi/numa/srat.c | 9 drivers/base/core.c | 2 drivers/bus/mvebu-mbus.c | 12 drivers/dax/Kconfig | 6 drivers/dax/Makefile | 3 drivers/dax/bus.c | 1237 +++++++++++++++++++++++---- drivers/dax/bus.h | 34 drivers/dax/dax-private.h | 74 + drivers/dax/device.c | 164 +-- drivers/dax/hmem.c | 56 - drivers/dax/hmem/Makefile | 8 drivers/dax/hmem/device.c | 100 ++ drivers/dax/hmem/hmem.c | 93 +- drivers/dax/kmem.c | 236 ++--- drivers/dax/pmem/compat.c | 2 drivers/dax/pmem/core.c | 36 drivers/firmware/efi/x86_fake_mem.c | 12 drivers/gpu/drm/i915/gem/i915_gem_shmem.c | 4 drivers/gpu/drm/nouveau/nouveau_dmem.c | 15 drivers/irqchip/irq-gic-v3-its.c | 2 drivers/nvdimm/badrange.c | 26 drivers/nvdimm/claim.c | 13 drivers/nvdimm/nd.h | 3 drivers/nvdimm/pfn_devs.c | 13 drivers/nvdimm/pmem.c | 27 drivers/nvdimm/region.c | 21 drivers/pci/p2pdma.c | 12 drivers/virtio/virtio_mem.c | 47 - drivers/xen/unpopulated-alloc.c | 45 fs/fs_parser.c | 2 fs/ntfs/inode.c | 6 fs/ocfs2/alloc.c | 6 fs/ocfs2/localalloc.c | 2 fs/proc/base.c | 3 fs/proc/task_mmu.c | 104 +- fs/xattr.c | 22 include/acpi/acpi_numa.h | 14 include/kunit/test.h | 5 include/linux/acpi.h | 2 include/linux/compaction.h | 3 include/linux/compiler-clang.h | 8 include/linux/compiler-gcc.h | 2 include/linux/compiler.h | 2 include/linux/dax.h | 8 include/linux/export.h | 2 include/linux/fs.h | 4 include/linux/gfp.h | 6 include/linux/huge_mm.h | 3 include/linux/kasan.h | 6 include/linux/memblock.h | 90 + include/linux/memcontrol.h | 13 include/linux/memory_hotplug.h | 23 include/linux/memremap.h | 15 include/linux/mm.h | 36 include/linux/mmap_lock.h | 5 include/linux/mmzone.h | 37 include/linux/numa.h | 11 include/linux/oom.h | 1 include/linux/page-flags.h | 42 include/linux/pagemap.h | 43 include/linux/range.h | 6 include/linux/sched.h | 4 include/linux/sched/coredump.h | 1 include/linux/slab.h | 2 include/linux/swap.h | 10 include/linux/swap_slots.h | 2 kernel/dma/contiguous.c | 11 kernel/fork.c | 25 kernel/resource.c | 11 lib/Kconfig.debug | 9 lib/Kconfig.kasan | 31 lib/Makefile | 5 lib/kunit/test.c | 13 lib/test_free_pages.c | 42 lib/test_hmm.c | 65 - lib/test_kasan.c | 732 ++++++--------- lib/test_kasan_module.c | 111 ++ mm/Kconfig | 4 mm/Makefile | 1 mm/compaction.c | 5 mm/debug.c | 18 mm/dmapool.c | 46 - mm/fadvise.c | 9 mm/filemap.c | 78 - mm/gup.c | 44 mm/gup_benchmark.c | 23 mm/huge_memory.c | 4 mm/hugetlb.c | 100 +- mm/internal.h | 3 mm/kasan/report.c | 34 mm/kmemleak-test.c | 99 -- mm/kmemleak.c | 8 mm/madvise.c | 21 mm/memblock.c | 102 -- mm/memcontrol.c | 262 +++-- mm/memory-failure.c | 5 mm/memory.c | 147 +-- mm/memory_hotplug.c | 10 mm/mempolicy.c | 8 mm/mempool.c | 18 mm/memremap.c | 344 ++++--- mm/migrate.c | 3 mm/mincore.c | 28 mm/mmap.c | 45 mm/oom_kill.c | 2 mm/page_alloc.c | 82 - mm/page_counter.c | 2 mm/page_io.c | 14 mm/page_isolation.c | 41 mm/shmem.c | 19 mm/slab.c | 4 mm/slab.h | 50 - mm/slub.c | 33 mm/sparse.c | 10 mm/swap.c | 14 mm/swap_slots.c | 3 mm/swap_state.c | 38 mm/swapfile.c | 12 mm/truncate.c | 58 - mm/vmalloc.c | 6 mm/vmscan.c | 5 mm/z3fold.c | 3 mm/zbud.c | 1 samples/Makefile | 1 samples/kmemleak/Makefile | 3 samples/kmemleak/kmemleak-test.c | 99 ++ scripts/decodecode | 29 scripts/spelling.txt | 4 tools/testing/nvdimm/dax-dev.c | 28 tools/testing/nvdimm/test/iomap.c | 2 tools/testing/selftests/vm/Makefile | 17 tools/testing/selftests/vm/compaction_test.c | 11 tools/testing/selftests/vm/gup_benchmark.c | 14 tools/testing/selftests/vm/hmm-tests.c | 4 194 files changed, 4273 insertions(+), 2777 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-10-11 6:15 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-10-11 6:15 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 5 patches, based on da690031a5d6d50a361e3f19f3eeabd086a6f20d. Subsystems affected by this patch series: MAINTAINERS mm/pagemap mm/swap mm/hugetlb Subsystem: MAINTAINERS Kees Cook <keescook@chromium.org>: MAINTAINERS: change hardening mailing list Antoine Tenart <atenart@kernel.org>: MAINTAINERS: Antoine Tenart's email address Subsystem: mm/pagemap Miaohe Lin <linmiaohe@huawei.com>: mm: mmap: Fix general protection fault in unlink_file_vma() Subsystem: mm/swap Minchan Kim <minchan@kernel.org>: mm: validate inode in mapping_set_error() Subsystem: mm/hugetlb Vijay Balakrishna <vijayb@linux.microsoft.com>: mm: khugepaged: recalculate min_free_kbytes after memory hotplug as expected by khugepaged .mailmap | 4 +++- MAINTAINERS | 8 ++++---- include/linux/khugepaged.h | 5 +++++ include/linux/pagemap.h | 3 ++- mm/khugepaged.c | 13 +++++++++++-- mm/mmap.c | 6 +++++- mm/page_alloc.c | 3 +++ 7 files changed, 33 insertions(+), 9 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-10-03 5:20 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-10-03 5:20 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 3 patches, based on d3d45f8220d60a0b2aaaacf8fb2be4e6ffd9008e. Subsystems affected by this patch series: mm/slub mm/cma scripts Subsystem: mm/slub Eric Farman <farman@linux.ibm.com>: mm, slub: restore initial kmem_cache flags Subsystem: mm/cma Joonsoo Kim <iamjoonsoo.kim@lge.com>: mm/page_alloc: handle a missing case for memalloc_nocma_{save/restore} APIs Subsystem: scripts Eric Biggers <ebiggers@google.com>: scripts/spelling.txt: fix malformed entry mm/page_alloc.c | 19 ++++++++++++++++--- mm/slub.c | 6 +----- scripts/spelling.txt | 2 +- 3 files changed, 18 insertions(+), 9 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-09-26 4:17 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-09-26 4:17 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 9 patches, based on 7c7ec3226f5f33f9c050d85ec20f18419c622ad6. Subsystems affected by this patch series: mm/thp mm/memcg mm/gup mm/migration lib x86 mm/memory-hotplug Subsystem: mm/thp Gao Xiang <hsiangkao@redhat.com>: mm, THP, swap: fix allocating cluster for swapfile by mistake Subsystem: mm/memcg Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: fix missing suffix of workingset_restore Subsystem: mm/gup Vasily Gorbik <gor@linux.ibm.com>: mm/gup: fix gup_fast with dynamic page table folding Subsystem: mm/migration Zi Yan <ziy@nvidia.com>: mm/migrate: correct thp migration stats Subsystem: lib Nick Desaulniers <ndesaulniers@google.com>: lib/string.c: implement stpcpy Jason Yan <yanaijie@huawei.com>: lib/memregion.c: include memregion.h Subsystem: x86 Mikulas Patocka <mpatocka@redhat.com>: arch/x86/lib/usercopy_64.c: fix __copy_user_flushcache() cache writeback Subsystem: mm/memory-hotplug Laurent Dufour <ldufour@linux.ibm.com>: Patch series "mm: fix memory to node bad links in sysfs", v3: mm: replace memmap_context by meminit_context mm: don't rely on system state to detect hot-plug operations Documentation/admin-guide/cgroup-v2.rst | 25 ++++++--- arch/ia64/mm/init.c | 6 +- arch/s390/include/asm/pgtable.h | 42 +++++++++++---- arch/x86/lib/usercopy_64.c | 2 drivers/base/node.c | 85 ++++++++++++++++++++------------ include/linux/mm.h | 2 include/linux/mmzone.h | 11 +++- include/linux/node.h | 11 ++-- include/linux/pgtable.h | 10 +++ lib/memregion.c | 1 lib/string.c | 24 +++++++++ mm/gup.c | 18 +++--- mm/memcontrol.c | 4 - mm/memory_hotplug.c | 5 + mm/migrate.c | 7 +- mm/page_alloc.c | 10 +-- mm/swapfile.c | 2 17 files changed, 181 insertions(+), 84 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-09-19 4:19 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-09-19 4:19 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 15 patches, based on 92ab97adeefccf375de7ebaad9d5b75d4125fe8b. Subsystems affected by this patch series: mailmap mm/hotfixes mm/thp mm/memory-hotplug misc kcsan Subsystem: mailmap Kees Cook <keescook@chromium.org>: mailmap: add older email addresses for Kees Cook Subsystem: mm/hotfixes Hugh Dickins <hughd@google.com>: Patch series "mm: fixes to past from future testing": ksm: reinstate memcg charge on copied pages mm: migration of hugetlbfs page skip memcg shmem: shmem_writepage() split unlikely i915 THP mm: fix check_move_unevictable_pages() on THP mlock: fix unevictable_pgs event counts on THP Byron Stanoszek <gandalf@winds.org>: tmpfs: restore functionality of nr_inodes=0 Muchun Song <songmuchun@bytedance.com>: kprobes: fix kill kprobe which has been marked as gone Subsystem: mm/thp Ralph Campbell <rcampbell@nvidia.com>: mm/thp: fix __split_huge_pmd_locked() for migration PMD Christophe Leroy <christophe.leroy@csgroup.eu>: selftests/vm: fix display of page size in map_hugetlb Subsystem: mm/memory-hotplug Pavel Tatashin <pasha.tatashin@soleen.com>: mm/memory_hotplug: drain per-cpu pages again during memory offline Subsystem: misc Tobias Klauser <tklauser@distanz.ch>: ftrace: let ftrace_enable_sysctl take a kernel pointer buffer stackleak: let stack_erasing_sysctl take a kernel pointer buffer fs/fs-writeback.c: adjust dirtytime_interval_handler definition to match prototype Subsystem: kcsan Changbin Du <changbin.du@gmail.com>: kcsan: kconfig: move to menu 'Generic Kernel Debugging Instruments' .mailmap | 4 ++ fs/fs-writeback.c | 2 - include/linux/ftrace.h | 3 -- include/linux/stackleak.h | 2 - kernel/kprobes.c | 9 +++++- kernel/stackleak.c | 2 - kernel/trace/ftrace.c | 3 -- lib/Kconfig.debug | 4 -- mm/huge_memory.c | 42 ++++++++++++++++--------------- mm/ksm.c | 4 ++ mm/memory_hotplug.c | 14 ++++++++++ mm/migrate.c | 3 +- mm/mlock.c | 24 +++++++++++------ mm/page_isolation.c | 8 +++++ mm/shmem.c | 20 +++++++++++--- mm/swap.c | 6 ++-- mm/vmscan.c | 10 +++++-- tools/testing/selftests/vm/map_hugetlb.c | 2 - 18 files changed, 111 insertions(+), 51 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-09-04 23:34 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-09-04 23:34 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 19 patches, based on 59126901f200f5fc907153468b03c64e0081b6e6. Subsystems affected by this patch series: mm/memcg mm/slub MAINTAINERS mm/pagemap ipc fork checkpatch mm/madvise mm/migration mm/hugetlb lib Subsystem: mm/memcg Michal Hocko <mhocko@suse.com>: memcg: fix use-after-free in uncharge_batch Xunlei Pang <xlpang@linux.alibaba.com>: mm: memcg: fix memcg reclaim soft lockup Subsystem: mm/slub Eugeniu Rosca <erosca@de.adit-jv.com>: mm: slub: fix conversion of freelist_corrupted() Subsystem: MAINTAINERS Robert Richter <rric@kernel.org>: MAINTAINERS: update Cavium/Marvell entries Nick Desaulniers <ndesaulniers@google.com>: MAINTAINERS: add LLVM maintainers Randy Dunlap <rdunlap@infradead.org>: MAINTAINERS: IA64: mark Status as Odd Fixes only Subsystem: mm/pagemap Joerg Roedel <jroedel@suse.de>: mm: track page table modifications in __apply_to_page_range() Subsystem: ipc Tobias Klauser <tklauser@distanz.ch>: ipc: adjust proc_ipc_sem_dointvec definition to match prototype Subsystem: fork Tobias Klauser <tklauser@distanz.ch>: fork: adjust sysctl_max_threads definition to match prototype Subsystem: checkpatch Mrinal Pandey <mrinalmni@gmail.com>: checkpatch: fix the usage of capture group ( ... ) Subsystem: mm/madvise Yang Shi <shy828301@gmail.com>: mm: madvise: fix vma user-after-free Subsystem: mm/migration Alistair Popple <alistair@popple.id.au>: mm/migrate: fixup setting UFFD_WP flag mm/rmap: fixup copying of soft dirty and uffd ptes Ralph Campbell <rcampbell@nvidia.com>: Patch series "mm/migrate: preserve soft dirty in remove_migration_pte()": mm/migrate: remove unnecessary is_zone_device_page() check mm/migrate: preserve soft dirty in remove_migration_pte() Subsystem: mm/hugetlb Li Xinhai <lixinhai.lxh@gmail.com>: mm/hugetlb: try preferred node first when alloc gigantic page from cma Muchun Song <songmuchun@bytedance.com>: mm/hugetlb: fix a race between hugetlb sysctl handlers David Howells <dhowells@redhat.com>: mm/khugepaged.c: fix khugepaged's request size in collapse_file Subsystem: lib Jason Gunthorpe <jgg@nvidia.com>: include/linux/log2.h: add missing () around n in roundup_pow_of_two() MAINTAINERS | 32 ++++++++++++++++---------------- include/linux/log2.h | 2 +- ipc/ipc_sysctl.c | 2 +- kernel/fork.c | 2 +- mm/hugetlb.c | 49 +++++++++++++++++++++++++++++++++++++------------ mm/khugepaged.c | 2 +- mm/madvise.c | 2 +- mm/memcontrol.c | 6 ++++++ mm/memory.c | 37 ++++++++++++++++++++++++------------- mm/migrate.c | 31 +++++++++++++++++++------------ mm/rmap.c | 9 +++++++-- mm/slub.c | 12 ++++++------ mm/vmscan.c | 8 ++++++++ scripts/checkpatch.pl | 4 ++-- 14 files changed, 130 insertions(+), 68 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-08-21 0:41 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-08-21 0:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 11 patches, based on 7eac66d0456fe12a462e5c14c68e97c7460989da. Subsystems affected by this patch series: misc mm/hugetlb mm/vmalloc mm/misc romfs relay uprobes squashfs mm/cma mm/pagealloc Subsystem: misc Nick Desaulniers <ndesaulniers@google.com>: mailmap: add Andi Kleen Subsystem: mm/hugetlb Xu Wang <vulab@iscas.ac.cn>: hugetlb_cgroup: convert comma to semicolon Hugh Dickins <hughd@google.com>: khugepaged: adjust VM_BUG_ON_MM() in __khugepaged_enter() Subsystem: mm/vmalloc "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/vunmap: add cond_resched() in vunmap_pmd_range Subsystem: mm/misc Leon Romanovsky <leonro@nvidia.com>: mm/rodata_test.c: fix missing function declaration Subsystem: romfs Jann Horn <jannh@google.com>: romfs: fix uninitialized memory leak in romfs_dev_read() Subsystem: relay Wei Yongjun <weiyongjun1@huawei.com>: kernel/relay.c: fix memleak on destroy relay channel Subsystem: uprobes Hugh Dickins <hughd@google.com>: uprobes: __replace_page() avoid BUG in munlock_vma_page() Subsystem: squashfs Phillip Lougher <phillip@squashfs.org.uk>: squashfs: avoid bio_alloc() failure with 1Mbyte blocks Subsystem: mm/cma Doug Berger <opendmb@gmail.com>: mm: include CMA pages in lowmem_reserve at boot Subsystem: mm/pagealloc Charan Teja Reddy <charante@codeaurora.org>: mm, page_alloc: fix core hung in free_pcppages_bulk() .mailmap | 1 + fs/romfs/storage.c | 4 +--- fs/squashfs/block.c | 6 +++++- kernel/events/uprobes.c | 2 +- kernel/relay.c | 1 + mm/hugetlb_cgroup.c | 4 ++-- mm/khugepaged.c | 2 +- mm/page_alloc.c | 7 ++++++- mm/rodata_test.c | 1 + mm/vmalloc.c | 2 ++ 10 files changed, 21 insertions(+), 9 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-08-15 0:29 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-08-15 0:29 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 39 patches, based on b923f1247b72fc100b87792fd2129d026bb10e66. Subsystems affected by this patch series: mm/hotfixes lz4 exec mailmap mm/thp autofs mm/madvise sysctl mm/kmemleak mm/misc lib Subsystem: mm/hotfixes Mike Rapoport <rppt@linux.ibm.com>: asm-generic: pgalloc.h: use correct #ifdef to enable pud_alloc_one() Baoquan He <bhe@redhat.com>: Revert "mm/vmstat.c: do not show lowmem reserve protection information of empty zone" Subsystem: lz4 Nick Terrell <terrelln@fb.com>: lz4: fix kernel decompression speed Subsystem: exec Kees Cook <keescook@chromium.org>: Patch series "Fix S_ISDIR execve() errno": exec: restore EACCES of S_ISDIR execve() selftests/exec: add file type errno tests Subsystem: mailmap Greg Kurz <groug@kaod.org>: mailmap: add entry for Greg Kurz Subsystem: mm/thp "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "THP prep patches": mm: store compound_nr as well as compound_order mm: move page-flags include to top of file mm: add thp_order mm: add thp_size mm: replace hpage_nr_pages with thp_nr_pages mm: add thp_head mm: introduce offset_in_thp Subsystem: autofs Randy Dunlap <rdunlap@infradead.org>: fs: autofs: delete repeated words in comments Subsystem: mm/madvise Minchan Kim <minchan@kernel.org>: Patch series "introduce memory hinting API for external process", v8: mm/madvise: pass task and mm to do_madvise pid: move pidfd_get_pid() to pid.c mm/madvise: introduce process_madvise() syscall: an external memory hinting API mm/madvise: check fatal signal pending of target process Subsystem: sysctl Xiaoming Ni <nixiaoming@huawei.com>: all arch: remove system call sys_sysctl Subsystem: mm/kmemleak Qian Cai <cai@lca.pw>: mm/kmemleak: silence KCSAN splats in checksum Subsystem: mm/misc Qian Cai <cai@lca.pw>: mm/frontswap: mark various intentional data races mm/page_io: mark various intentional data races mm/swap_state: mark various intentional data races Kirill A. Shutemov <kirill@shutemov.name>: mm/filemap.c: fix a data race in filemap_fault() Qian Cai <cai@lca.pw>: mm/swapfile: fix and annotate various data races mm/page_counter: fix various data races at memsw mm/memcontrol: fix a data race in scan count mm/list_lru: fix a data race in list_lru_count_one mm/mempool: fix a data race in mempool_free() mm/rmap: annotate a data race at tlb_flush_batched mm/swap.c: annotate data races for lru_rotate_pvecs mm: annotate a data race in page_zonenum() Romain Naour <romain.naour@gmail.com>: include/asm-generic/vmlinux.lds.h: align ro_after_init Kuninori Morimoto <kuninori.morimoto.gx@renesas.com>: sh: clkfwk: remove r8/r16/r32 sh: use generic strncpy() Subsystem: lib Krzysztof Kozlowski <krzk@kernel.org>: Patch series "iomap: Constify ioreadX() iomem argument", v3: iomap: constify ioreadX() iomem argument (as in generic implementation) rtl818x: constify ioreadX() iomem argument (as in generic implementation) ntb: intel: constify ioreadX() iomem argument (as in generic implementation) virtio: pci: constify ioreadX() iomem argument (as in generic implementation) .mailmap | 1 arch/alpha/include/asm/core_apecs.h | 6 arch/alpha/include/asm/core_cia.h | 6 arch/alpha/include/asm/core_lca.h | 6 arch/alpha/include/asm/core_marvel.h | 4 arch/alpha/include/asm/core_mcpcia.h | 6 arch/alpha/include/asm/core_t2.h | 2 arch/alpha/include/asm/io.h | 12 - arch/alpha/include/asm/io_trivial.h | 16 - arch/alpha/include/asm/jensen.h | 2 arch/alpha/include/asm/machvec.h | 6 arch/alpha/kernel/core_marvel.c | 2 arch/alpha/kernel/io.c | 12 - arch/alpha/kernel/syscalls/syscall.tbl | 3 arch/arm/configs/am200epdkit_defconfig | 1 arch/arm/tools/syscall.tbl | 3 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 6 arch/ia64/kernel/syscalls/syscall.tbl | 3 arch/m68k/kernel/syscalls/syscall.tbl | 3 arch/microblaze/kernel/syscalls/syscall.tbl | 3 arch/mips/configs/cu1000-neo_defconfig | 1 arch/mips/kernel/syscalls/syscall_n32.tbl | 3 arch/mips/kernel/syscalls/syscall_n64.tbl | 3 arch/mips/kernel/syscalls/syscall_o32.tbl | 3 arch/parisc/include/asm/io.h | 4 arch/parisc/kernel/syscalls/syscall.tbl | 3 arch/parisc/lib/iomap.c | 72 +++--- arch/powerpc/kernel/iomap.c | 28 +- arch/powerpc/kernel/syscalls/syscall.tbl | 3 arch/s390/kernel/syscalls/syscall.tbl | 3 arch/sh/configs/dreamcast_defconfig | 1 arch/sh/configs/espt_defconfig | 1 arch/sh/configs/hp6xx_defconfig | 1 arch/sh/configs/landisk_defconfig | 1 arch/sh/configs/lboxre2_defconfig | 1 arch/sh/configs/microdev_defconfig | 1 arch/sh/configs/migor_defconfig | 1 arch/sh/configs/r7780mp_defconfig | 1 arch/sh/configs/r7785rp_defconfig | 1 arch/sh/configs/rts7751r2d1_defconfig | 1 arch/sh/configs/rts7751r2dplus_defconfig | 1 arch/sh/configs/se7206_defconfig | 1 arch/sh/configs/se7343_defconfig | 1 arch/sh/configs/se7619_defconfig | 1 arch/sh/configs/se7705_defconfig | 1 arch/sh/configs/se7750_defconfig | 1 arch/sh/configs/se7751_defconfig | 1 arch/sh/configs/secureedge5410_defconfig | 1 arch/sh/configs/sh03_defconfig | 1 arch/sh/configs/sh7710voipgw_defconfig | 1 arch/sh/configs/sh7757lcr_defconfig | 1 arch/sh/configs/sh7763rdp_defconfig | 1 arch/sh/configs/shmin_defconfig | 1 arch/sh/configs/titan_defconfig | 1 arch/sh/include/asm/string_32.h | 26 -- arch/sh/kernel/iomap.c | 22 - arch/sh/kernel/syscalls/syscall.tbl | 3 arch/sparc/kernel/syscalls/syscall.tbl | 3 arch/x86/entry/syscalls/syscall_32.tbl | 3 arch/x86/entry/syscalls/syscall_64.tbl | 4 arch/xtensa/kernel/syscalls/syscall.tbl | 3 drivers/mailbox/bcm-pdc-mailbox.c | 2 drivers/net/wireless/realtek/rtl818x/rtl8180/rtl8180.h | 6 drivers/ntb/hw/intel/ntb_hw_gen1.c | 2 drivers/ntb/hw/intel/ntb_hw_gen3.h | 2 drivers/ntb/hw/intel/ntb_hw_intel.h | 2 drivers/nvdimm/btt.c | 4 drivers/nvdimm/pmem.c | 6 drivers/sh/clk/cpg.c | 25 -- drivers/virtio/virtio_pci_modern.c | 6 fs/autofs/dev-ioctl.c | 4 fs/io_uring.c | 2 fs/namei.c | 4 include/asm-generic/iomap.h | 28 +- include/asm-generic/pgalloc.h | 2 include/asm-generic/vmlinux.lds.h | 1 include/linux/compat.h | 5 include/linux/huge_mm.h | 58 ++++- include/linux/io-64-nonatomic-hi-lo.h | 4 include/linux/io-64-nonatomic-lo-hi.h | 4 include/linux/memcontrol.h | 2 include/linux/mm.h | 16 - include/linux/mm_inline.h | 6 include/linux/mm_types.h | 1 include/linux/pagemap.h | 6 include/linux/pid.h | 1 include/linux/syscalls.h | 4 include/linux/sysctl.h | 6 include/uapi/asm-generic/unistd.h | 4 kernel/Makefile | 2 kernel/exit.c | 17 - kernel/pid.c | 17 + kernel/sys_ni.c | 3 kernel/sysctl_binary.c | 171 -------------- lib/iomap.c | 30 +- lib/lz4/lz4_compress.c | 4 lib/lz4/lz4_decompress.c | 18 - lib/lz4/lz4defs.h | 10 lib/lz4/lz4hc_compress.c | 2 mm/compaction.c | 2 mm/filemap.c | 22 + mm/frontswap.c | 8 mm/gup.c | 2 mm/internal.h | 4 mm/kmemleak.c | 2 mm/list_lru.c | 2 mm/madvise.c | 190 ++++++++++++++-- mm/memcontrol.c | 10 mm/memory.c | 4 mm/memory_hotplug.c | 7 mm/mempolicy.c | 2 mm/mempool.c | 2 mm/migrate.c | 18 - mm/mlock.c | 9 mm/page_alloc.c | 5 mm/page_counter.c | 13 - mm/page_io.c | 12 - mm/page_vma_mapped.c | 6 mm/rmap.c | 10 mm/swap.c | 21 - mm/swap_state.c | 10 mm/swapfile.c | 33 +- mm/vmscan.c | 6 mm/vmstat.c | 12 - mm/workingset.c | 6 tools/perf/arch/powerpc/entry/syscalls/syscall.tbl | 2 tools/perf/arch/s390/entry/syscalls/syscall.tbl | 2 tools/perf/arch/x86/entry/syscalls/syscall_64.tbl | 2 tools/testing/selftests/exec/.gitignore | 1 tools/testing/selftests/exec/Makefile | 5 tools/testing/selftests/exec/non-regular.c | 196 +++++++++++++++++ 132 files changed, 815 insertions(+), 614 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-08-12 1:29 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-08-12 1:29 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - Most of the rest of MM - various other subsystems 165 patches, based on 00e4db51259a5f936fec1424b884f029479d3981. Subsystems affected by this patch series: mm/memcg mm/hugetlb mm/vmscan mm/proc mm/compaction mm/mempolicy mm/oom-kill mm/hugetlbfs mm/migration mm/thp mm/cma mm/util mm/memory-hotplug mm/cleanups mm/uaccess alpha misc sparse bitmap lib lz4 bitops checkpatch autofs minix nilfs ufs fat signals kmod coredump exec kdump rapidio panic kcov kgdb ipc mm/migration mm/gup mm/pagemap Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: Patch series "mm: memcg accounting of percpu memory", v3: percpu: return number of released bytes from pcpu_free_area() mm: memcg/percpu: account percpu memory to memory cgroups mm: memcg/percpu: per-memcg percpu memory statistics mm: memcg: charge memcg percpu memory to the parent cgroup kselftests: cgroup: add perpcu memory accounting test Subsystem: mm/hugetlb Muchun Song <songmuchun@bytedance.com>: mm/hugetlb: add mempolicy check in the reservation routine Subsystem: mm/vmscan Joonsoo Kim <iamjoonsoo.kim@lge.com>: Patch series "workingset protection/detection on the anonymous LRU list", v7: mm/vmscan: make active/inactive ratio as 1:1 for anon lru mm/vmscan: protect the workingset on anonymous LRU mm/workingset: prepare the workingset detection infrastructure for anon LRU mm/swapcache: support to handle the shadow entries mm/swap: implement workingset detection for anonymous LRU mm/vmscan: restore active/inactive ratio for anonymous LRU Subsystem: mm/proc Michal Koutný <mkoutny@suse.com>: /proc/PID/smaps: consistent whitespace output format Subsystem: mm/compaction Nitin Gupta <nigupta@nvidia.com>: mm: proactive compaction mm: fix compile error due to COMPACTION_HPAGE_ORDER mm: use unsigned types for fragmentation score Alex Shi <alex.shi@linux.alibaba.com>: mm/compaction: correct the comments of compact_defer_shift Subsystem: mm/mempolicy Krzysztof Kozlowski <krzk@kernel.org>: mm: mempolicy: fix kerneldoc of numa_map_to_online_node() Wenchao Hao <haowenchao22@gmail.com>: mm/mempolicy.c: check parameters first in kernel_get_mempolicy Yanfei Xu <yanfei.xu@windriver.com>: include/linux/mempolicy.h: fix typo Subsystem: mm/oom-kill Yafang Shao <laoar.shao@gmail.com>: mm, oom: make the calculation of oom badness more accurate Michal Hocko <mhocko@suse.com>: doc, mm: sync up oom_score_adj documentation doc, mm: clarify /proc/<pid>/oom_score value range Yafang Shao <laoar.shao@gmail.com>: mm, oom: show process exiting information in __oom_kill_process() Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: hugetlbfs: prevent filesystem stacking of hugetlbfs hugetlbfs: remove call to huge_pte_alloc without i_mmap_rwsem Subsystem: mm/migration Ralph Campbell <rcampbell@nvidia.com>: Patch series "mm/migrate: optimize migrate_vma_setup() for holes": mm/migrate: optimize migrate_vma_setup() for holes mm/migrate: add migrate-shared test for migrate_vma_*() Subsystem: mm/thp Yang Shi <yang.shi@linux.alibaba.com>: mm: thp: remove debug_cow switch Anshuman Khandual <anshuman.khandual@arm.com>: mm/vmstat: add events for THP migration without split Subsystem: mm/cma Jianqun Xu <jay.xu@rock-chips.com>: mm/cma.c: fix NULL pointer dereference when cma could not be activated Barry Song <song.bao.hua@hisilicon.com>: Patch series "mm: fix the names of general cma and hugetlb cma", v2: mm: cma: fix the name of CMA areas mm: hugetlb: fix the name of hugetlb CMA Mike Kravetz <mike.kravetz@oracle.com>: cma: don't quit at first error when activating reserved areas Subsystem: mm/util Waiman Long <longman@redhat.com>: include/linux/sched/mm.h: optimize current_gfp_context() Krzysztof Kozlowski <krzk@kernel.org>: mm: mmu_notifier: fix and extend kerneldoc Subsystem: mm/memory-hotplug Daniel Jordan <daniel.m.jordan@oracle.com>: x86/mm: use max memory block size on bare metal Jia He <justin.he@arm.com>: mm/memory_hotplug: introduce default dummy memory_add_physaddr_to_nid() mm/memory_hotplug: fix unpaired mem_hotplug_begin/done Charan Teja Reddy <charante@codeaurora.org>: mm, memory_hotplug: update pcp lists everytime onlining a memory block Subsystem: mm/cleanups Randy Dunlap <rdunlap@infradead.org>: mm: drop duplicated words in <linux/pgtable.h> mm: drop duplicated words in <linux/mm.h> include/linux/highmem.h: fix duplicated words in a comment include/linux/frontswap.h: drop duplicated word in a comment include/linux/memcontrol.h: drop duplicate word and fix spello Arvind Sankar <nivedita@alum.mit.edu>: sh/mm: drop unused MAX_PHYSADDR_BITS sparc: drop unused MAX_PHYSADDR_BITS Randy Dunlap <rdunlap@infradead.org>: mm/compaction.c: delete duplicated word mm/filemap.c: delete duplicated word mm/hmm.c: delete duplicated word mm/hugetlb.c: delete duplicated words mm/memcontrol.c: delete duplicated words mm/memory.c: delete duplicated words mm/migrate.c: delete duplicated word mm/nommu.c: delete duplicated words mm/page_alloc.c: delete or fix duplicated words mm/shmem.c: delete duplicated word mm/slab_common.c: delete duplicated word mm/usercopy.c: delete duplicated word mm/vmscan.c: delete or fix duplicated words mm/zpool.c: delete duplicated word and fix grammar mm/zsmalloc.c: fix duplicated words Subsystem: mm/uaccess Christoph Hellwig <hch@lst.de>: Patch series "clean up address limit helpers", v2: syscalls: use uaccess_kernel in addr_limit_user_check nds32: use uaccess_kernel in show_regs riscv: include <asm/pgtable.h> in <asm/uaccess.h> uaccess: remove segment_eq uaccess: add force_uaccess_{begin,end} helpers exec: use force_uaccess_begin during exec and exit Subsystem: alpha Luc Van Oostenryck <luc.vanoostenryck@gmail.com>: alpha: fix annotation of io{read,write}{16,32}be() Subsystem: misc Randy Dunlap <rdunlap@infradead.org>: include/linux/compiler-clang.h: drop duplicated word in a comment include/linux/exportfs.h: drop duplicated word in a comment include/linux/async_tx.h: drop duplicated word in a comment include/linux/xz.h: drop duplicated word Christoph Hellwig <hch@lst.de>: kernel: add a kernel_wait helper Feng Tang <feng.tang@intel.com>: ./Makefile: add debug option to enable function aligned on 32 bytes Arvind Sankar <nivedita@alum.mit.edu>: kernel.h: remove duplicate include of asm/div64.h "Alexander A. Klimov" <grandmaster@al2klimov.de>: include/: replace HTTP links with HTTPS ones Matthew Wilcox <willy@infradead.org>: include/linux/poison.h: remove obsolete comment Subsystem: sparse Luc Van Oostenryck <luc.vanoostenryck@gmail.com>: sparse: group the defines by functionality Subsystem: bitmap Stefano Brivio <sbrivio@redhat.com>: Patch series "lib: Fix bitmap_cut() for overlaps, add test": lib/bitmap.c: fix bitmap_cut() for partial overlapping case lib/test_bitmap.c: add test for bitmap_cut() Subsystem: lib Luc Van Oostenryck <luc.vanoostenryck@gmail.com>: lib/generic-radix-tree.c: remove unneeded __rcu Geert Uytterhoeven <geert@linux-m68k.org>: lib/test_bitops: do the full test during module init Wei Yongjun <weiyongjun1@huawei.com>: lib/test_lockup.c: make symbol 'test_works' static Tiezhu Yang <yangtiezhu@loongson.cn>: lib/Kconfig.debug: make TEST_LOCKUP depend on module lib/test_lockup.c: fix return value of test_lockup_init() "Alexander A. Klimov" <grandmaster@al2klimov.de>: lib/: replace HTTP links with HTTPS ones "Kars Mulder" <kerneldev@karsmulder.nl>: kstrto*: correct documentation references to simple_strto*() kstrto*: do not describe simple_strto*() as obsolete/replaced Subsystem: lz4 Nick Terrell <terrelln@fb.com>: lz4: fix kernel decompression speed Subsystem: bitops Rikard Falkeborn <rikard.falkeborn@gmail.com>: lib/test_bits.c: add tests of GENMASK Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: add test for possible misuse of IS_ENABLED() without CONFIG_ checkpatch: add --fix option for ASSIGN_IN_IF Quentin Monnet <quentin@isovalent.com>: checkpatch: fix CONST_STRUCT when const_structs.checkpatch is missing Joe Perches <joe@perches.com>: checkpatch: add test for repeated words checkpatch: remove missing switch/case break test Subsystem: autofs Randy Dunlap <rdunlap@infradead.org>: autofs: fix doubled word Subsystem: minix Eric Biggers <ebiggers@google.com>: Patch series "fs/minix: fix syzbot bugs and set s_maxbytes": fs/minix: check return value of sb_getblk() fs/minix: don't allow getting deleted inodes fs/minix: reject too-large maximum file size fs/minix: set s_maxbytes correctly fs/minix: fix block limit check for V1 filesystems fs/minix: remove expected error message in block_to_path() Subsystem: nilfs Eric Biggers <ebiggers@google.com>: Patch series "nilfs2 updates": nilfs2: only call unlock_new_inode() if I_NEW Joe Perches <joe@perches.com>: nilfs2: convert __nilfs_msg to integrate the level and format nilfs2: use a more common logging style Subsystem: ufs Colin Ian King <colin.king@canonical.com>: fs/ufs: avoid potential u32 multiplication overflow Subsystem: fat Yubo Feng <fengyubo3@huawei.com>: fatfs: switch write_lock to read_lock in fat_ioctl_get_attributes "Alexander A. Klimov" <grandmaster@al2klimov.de>: VFAT/FAT/MSDOS FILESYSTEM: replace HTTP links with HTTPS ones OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>: fat: fix fat_ra_init() for data clusters == 0 Subsystem: signals Helge Deller <deller@gmx.de>: fs/signalfd.c: fix inconsistent return codes for signalfd4 Subsystem: kmod Tiezhu Yang <yangtiezhu@loongson.cn>: Patch series "kmod/umh: a few fixes": selftests: kmod: use variable NAME in kmod_test_0001() kmod: remove redundant "be an" in the comment test_kmod: avoid potential double free in trigger_config_run_type() Subsystem: coredump Lepton Wu <ytht.net@gmail.com>: coredump: add %f for executable filename Subsystem: exec Kees Cook <keescook@chromium.org>: Patch series "Relocate execve() sanity checks", v2: exec: change uselib(2) IS_SREG() failure to EACCES exec: move S_ISREG() check earlier exec: move path_noexec() check earlier Subsystem: kdump Vijay Balakrishna <vijayb@linux.microsoft.com>: kdump: append kernel build-id string to VMCOREINFO Subsystem: rapidio "Gustavo A. R. Silva" <gustavoars@kernel.org>: drivers/rapidio/devices/rio_mport_cdev.c: use struct_size() helper drivers/rapidio/rio-scan.c: use struct_size() helper rapidio/rio_mport_cdev: use array_size() helper in copy_{from,to}_user() Subsystem: panic Tiezhu Yang <yangtiezhu@loongson.cn>: kernel/panic.c: make oops_may_print() return bool lib/Kconfig.debug: fix typo in the help text of CONFIG_PANIC_TIMEOUT Yue Hu <huyue2@yulong.com>: panic: make print_oops_end_marker() static Subsystem: kcov Marco Elver <elver@google.com>: kcov: unconditionally add -fno-stack-protector to compiler options Wei Yongjun <weiyongjun1@huawei.com>: kcov: make some symbols static Subsystem: kgdb Nick Desaulniers <ndesaulniers@google.com>: scripts/gdb: fix python 3.8 SyntaxWarning Subsystem: ipc Alexey Dobriyan <adobriyan@gmail.com>: ipc: uninline functions Liao Pingfang <liao.pingfang@zte.com.cn>: ipc/shm.c: remove the superfluous break Subsystem: mm/migration Joonsoo Kim <iamjoonsoo.kim@lge.com>: Patch series "clean-up the migration target allocation functions", v5: mm/page_isolation: prefer the node of the source page mm/migrate: move migration helper from .h to .c mm/hugetlb: unify migration callbacks mm/migrate: clear __GFP_RECLAIM to make the migration callback consistent with regular THP allocations mm/migrate: introduce a standard migration target allocation function mm/mempolicy: use a standard migration target allocation callback mm/page_alloc: remove a wrapper for alloc_migration_target() Subsystem: mm/gup Joonsoo Kim <iamjoonsoo.kim@lge.com>: mm/gup: restrict CMA region by using allocation scope API mm/hugetlb: make hugetlb migration callback CMA aware mm/gup: use a standard migration target allocation callback Subsystem: mm/pagemap Peter Xu <peterx@redhat.com>: Patch series "mm: Page fault accounting cleanups", v5: mm: do page fault accounting in handle_mm_fault mm/alpha: use general page fault accounting mm/arc: use general page fault accounting mm/arm: use general page fault accounting mm/arm64: use general page fault accounting mm/csky: use general page fault accounting mm/hexagon: use general page fault accounting mm/ia64: use general page fault accounting mm/m68k: use general page fault accounting mm/microblaze: use general page fault accounting mm/mips: use general page fault accounting mm/nds32: use general page fault accounting mm/nios2: use general page fault accounting mm/openrisc: use general page fault accounting mm/parisc: use general page fault accounting mm/powerpc: use general page fault accounting mm/riscv: use general page fault accounting mm/s390: use general page fault accounting mm/sh: use general page fault accounting mm/sparc32: use general page fault accounting mm/sparc64: use general page fault accounting mm/x86: use general page fault accounting mm/xtensa: use general page fault accounting mm: clean up the last pieces of page fault accountings mm/gup: remove task_struct pointer for all gup code Documentation/admin-guide/cgroup-v2.rst | 4 Documentation/admin-guide/sysctl/kernel.rst | 3 Documentation/admin-guide/sysctl/vm.rst | 15 + Documentation/filesystems/proc.rst | 11 - Documentation/vm/page_migration.rst | 27 +++ Makefile | 4 arch/alpha/include/asm/io.h | 8 arch/alpha/include/asm/uaccess.h | 2 arch/alpha/mm/fault.c | 10 - arch/arc/include/asm/segment.h | 3 arch/arc/kernel/process.c | 2 arch/arc/mm/fault.c | 20 -- arch/arm/include/asm/uaccess.h | 4 arch/arm/kernel/signal.c | 2 arch/arm/mm/fault.c | 27 --- arch/arm64/include/asm/uaccess.h | 2 arch/arm64/kernel/sdei.c | 2 arch/arm64/mm/fault.c | 31 --- arch/arm64/mm/numa.c | 10 - arch/csky/include/asm/segment.h | 2 arch/csky/mm/fault.c | 15 - arch/h8300/include/asm/segment.h | 2 arch/hexagon/mm/vm_fault.c | 11 - arch/ia64/include/asm/uaccess.h | 2 arch/ia64/mm/fault.c | 11 - arch/ia64/mm/numa.c | 2 arch/m68k/include/asm/segment.h | 2 arch/m68k/include/asm/tlbflush.h | 6 arch/m68k/mm/fault.c | 16 - arch/microblaze/include/asm/uaccess.h | 2 arch/microblaze/mm/fault.c | 11 - arch/mips/include/asm/uaccess.h | 2 arch/mips/kernel/unaligned.c | 27 +-- arch/mips/mm/fault.c | 16 - arch/nds32/include/asm/uaccess.h | 2 arch/nds32/kernel/process.c | 2 arch/nds32/mm/alignment.c | 7 arch/nds32/mm/fault.c | 21 -- arch/nios2/include/asm/uaccess.h | 2 arch/nios2/mm/fault.c | 16 - arch/openrisc/include/asm/uaccess.h | 2 arch/openrisc/mm/fault.c | 11 - arch/parisc/include/asm/uaccess.h | 2 arch/parisc/mm/fault.c | 10 - arch/powerpc/include/asm/uaccess.h | 3 arch/powerpc/mm/copro_fault.c | 7 arch/powerpc/mm/fault.c | 13 - arch/riscv/include/asm/uaccess.h | 6 arch/riscv/mm/fault.c | 18 -- arch/s390/include/asm/uaccess.h | 2 arch/s390/kvm/interrupt.c | 2 arch/s390/kvm/kvm-s390.c | 2 arch/s390/kvm/priv.c | 8 arch/s390/mm/fault.c | 18 -- arch/s390/mm/gmap.c | 4 arch/sh/include/asm/segment.h | 3 arch/sh/include/asm/sparsemem.h | 4 arch/sh/kernel/traps_32.c | 12 - arch/sh/mm/fault.c | 13 - arch/sh/mm/init.c | 9 - arch/sparc/include/asm/sparsemem.h | 1 arch/sparc/include/asm/uaccess_32.h | 2 arch/sparc/include/asm/uaccess_64.h | 2 arch/sparc/mm/fault_32.c | 15 - arch/sparc/mm/fault_64.c | 13 - arch/um/kernel/trap.c | 6 arch/x86/include/asm/uaccess.h | 2 arch/x86/mm/fault.c | 19 -- arch/x86/mm/init_64.c | 9 + arch/x86/mm/numa.c | 1 arch/xtensa/include/asm/uaccess.h | 2 arch/xtensa/mm/fault.c | 17 - drivers/firmware/arm_sdei.c | 5 drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 2 drivers/infiniband/core/umem_odp.c | 2 drivers/iommu/amd/iommu_v2.c | 2 drivers/iommu/intel/svm.c | 3 drivers/rapidio/devices/rio_mport_cdev.c | 7 drivers/rapidio/rio-scan.c | 8 drivers/vfio/vfio_iommu_type1.c | 4 fs/coredump.c | 17 + fs/exec.c | 38 ++-- fs/fat/Kconfig | 2 fs/fat/fatent.c | 3 fs/fat/file.c | 4 fs/hugetlbfs/inode.c | 6 fs/minix/inode.c | 48 ++++- fs/minix/itree_common.c | 8 fs/minix/itree_v1.c | 16 - fs/minix/itree_v2.c | 15 - fs/minix/minix.h | 1 fs/namei.c | 10 - fs/nilfs2/alloc.c | 38 ++-- fs/nilfs2/btree.c | 42 ++-- fs/nilfs2/cpfile.c | 10 - fs/nilfs2/dat.c | 14 - fs/nilfs2/direct.c | 14 - fs/nilfs2/gcinode.c | 2 fs/nilfs2/ifile.c | 4 fs/nilfs2/inode.c | 32 +-- fs/nilfs2/ioctl.c | 37 ++-- fs/nilfs2/mdt.c | 2 fs/nilfs2/namei.c | 6 fs/nilfs2/nilfs.h | 18 +- fs/nilfs2/page.c | 11 - fs/nilfs2/recovery.c | 32 +-- fs/nilfs2/segbuf.c | 2 fs/nilfs2/segment.c | 38 ++-- fs/nilfs2/sufile.c | 29 +-- fs/nilfs2/super.c | 73 ++++---- fs/nilfs2/sysfs.c | 29 +-- fs/nilfs2/the_nilfs.c | 85 ++++----- fs/open.c | 6 fs/proc/base.c | 11 + fs/proc/task_mmu.c | 4 fs/signalfd.c | 10 - fs/ufs/super.c | 2 include/asm-generic/uaccess.h | 4 include/clocksource/timer-ti-dm.h | 2 include/linux/async_tx.h | 2 include/linux/btree.h | 2 include/linux/compaction.h | 6 include/linux/compiler-clang.h | 2 include/linux/compiler_types.h | 44 ++--- include/linux/crash_core.h | 6 include/linux/delay.h | 2 include/linux/dma/k3-psil.h | 2 include/linux/dma/k3-udma-glue.h | 2 include/linux/dma/ti-cppi5.h | 2 include/linux/exportfs.h | 2 include/linux/frontswap.h | 2 include/linux/fs.h | 10 + include/linux/generic-radix-tree.h | 2 include/linux/highmem.h | 2 include/linux/huge_mm.h | 7 include/linux/hugetlb.h | 53 ++++-- include/linux/irqchip/irq-omap-intc.h | 2 include/linux/jhash.h | 2 include/linux/kernel.h | 12 - include/linux/leds-ti-lmu-common.h | 2 include/linux/memcontrol.h | 12 + include/linux/mempolicy.h | 18 +- include/linux/migrate.h | 42 +--- include/linux/mm.h | 20 +- include/linux/mmzone.h | 17 + include/linux/oom.h | 4 include/linux/pgtable.h | 12 - include/linux/platform_data/davinci-cpufreq.h | 2 include/linux/platform_data/davinci_asp.h | 2 include/linux/platform_data/elm.h | 2 include/linux/platform_data/gpio-davinci.h | 2 include/linux/platform_data/gpmc-omap.h | 2 include/linux/platform_data/mtd-davinci-aemif.h | 2 include/linux/platform_data/omap-twl4030.h | 2 include/linux/platform_data/uio_pruss.h | 2 include/linux/platform_data/usb-omap.h | 2 include/linux/poison.h | 4 include/linux/sched/mm.h | 8 include/linux/sched/task.h | 1 include/linux/soc/ti/k3-ringacc.h | 2 include/linux/soc/ti/knav_qmss.h | 2 include/linux/soc/ti/ti-msgmgr.h | 2 include/linux/swap.h | 25 ++ include/linux/syscalls.h | 2 include/linux/uaccess.h | 20 ++ include/linux/vm_event_item.h | 3 include/linux/wkup_m3_ipc.h | 2 include/linux/xxhash.h | 2 include/linux/xz.h | 4 include/linux/zlib.h | 2 include/soc/arc/aux.h | 2 include/trace/events/migrate.h | 17 + include/uapi/linux/auto_dev-ioctl.h | 2 include/uapi/linux/elf.h | 2 include/uapi/linux/map_to_7segment.h | 2 include/uapi/linux/types.h | 2 include/uapi/linux/usb/ch9.h | 2 ipc/sem.c | 3 ipc/shm.c | 4 kernel/Makefile | 2 kernel/crash_core.c | 50 +++++ kernel/events/callchain.c | 5 kernel/events/core.c | 5 kernel/events/uprobes.c | 8 kernel/exit.c | 18 +- kernel/futex.c | 2 kernel/kcov.c | 6 kernel/kmod.c | 5 kernel/kthread.c | 5 kernel/panic.c | 4 kernel/stacktrace.c | 5 kernel/sysctl.c | 11 + kernel/umh.c | 29 --- lib/Kconfig.debug | 27 ++- lib/Makefile | 1 lib/bitmap.c | 4 lib/crc64.c | 2 lib/decompress_bunzip2.c | 2 lib/decompress_unlzma.c | 6 lib/kstrtox.c | 20 -- lib/lz4/lz4_compress.c | 4 lib/lz4/lz4_decompress.c | 18 +- lib/lz4/lz4defs.h | 10 + lib/lz4/lz4hc_compress.c | 2 lib/math/rational.c | 2 lib/rbtree.c | 2 lib/test_bitmap.c | 58 ++++++ lib/test_bitops.c | 18 +- lib/test_bits.c | 75 ++++++++ lib/test_kmod.c | 2 lib/test_lockup.c | 6 lib/ts_bm.c | 2 lib/xxhash.c | 2 lib/xz/xz_crc32.c | 2 lib/xz/xz_dec_bcj.c | 2 lib/xz/xz_dec_lzma2.c | 2 lib/xz/xz_lzma2.h | 2 lib/xz/xz_stream.h | 2 mm/cma.c | 40 +--- mm/cma.h | 4 mm/compaction.c | 207 +++++++++++++++++++++-- mm/filemap.c | 2 mm/gup.c | 195 ++++++---------------- mm/hmm.c | 5 mm/huge_memory.c | 23 -- mm/hugetlb.c | 93 ++++------ mm/internal.h | 9 - mm/khugepaged.c | 2 mm/ksm.c | 3 mm/maccess.c | 22 +- mm/memcontrol.c | 42 +++- mm/memory-failure.c | 7 mm/memory.c | 107 +++++++++--- mm/memory_hotplug.c | 30 ++- mm/mempolicy.c | 49 +---- mm/migrate.c | 151 ++++++++++++++--- mm/mmu_notifier.c | 9 - mm/nommu.c | 4 mm/oom_kill.c | 24 +- mm/page_alloc.c | 14 + mm/page_isolation.c | 21 -- mm/percpu-internal.h | 55 ++++++ mm/percpu-km.c | 5 mm/percpu-stats.c | 36 ++-- mm/percpu-vm.c | 5 mm/percpu.c | 208 +++++++++++++++++++++--- mm/process_vm_access.c | 2 mm/rmap.c | 2 mm/shmem.c | 5 mm/slab_common.c | 2 mm/swap.c | 13 - mm/swap_state.c | 80 +++++++-- mm/swapfile.c | 4 mm/usercopy.c | 2 mm/userfaultfd.c | 2 mm/vmscan.c | 36 ++-- mm/vmstat.c | 32 +++ mm/workingset.c | 23 +- mm/zpool.c | 8 mm/zsmalloc.c | 2 scripts/checkpatch.pl | 116 +++++++++---- scripts/gdb/linux/rbtree.py | 4 security/tomoyo/domain.c | 2 tools/testing/selftests/cgroup/test_kmem.c | 70 +++++++- tools/testing/selftests/kmod/kmod.sh | 4 tools/testing/selftests/vm/hmm-tests.c | 35 ++++ virt/kvm/async_pf.c | 2 virt/kvm/kvm_main.c | 2 268 files changed, 2481 insertions(+), 1551 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-08-07 6:16 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-08-07 6:16 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - A few MM hotfixes - kthread, tools, scripts, ntfs and ocfs2 - Some of MM 163 patches, based on d6efb3ac3e6c19ab722b28bdb9252bae0b9676b6. Subsystems affected by this patch series: mm/pagemap mm/hofixes mm/pagealloc kthread tools scripts ntfs ocfs2 mm/slab-generic mm/slab mm/slub mm/kcsan mm/debug mm/pagecache mm/gup mm/swap mm/shmem mm/memcg mm/pagemap mm/mremap mm/mincore mm/sparsemem mm/vmalloc mm/kasan mm/pagealloc mm/hugetlb mm/vmscan Subsystem: mm/pagemap Yang Shi <yang.shi@linux.alibaba.com>: mm/memory.c: avoid access flag update TLB flush for retried page fault Subsystem: mm/hofixes Ralph Campbell <rcampbell@nvidia.com>: mm/migrate: fix migrate_pgmap_owner w/o CONFIG_MMU_NOTIFIER Subsystem: mm/pagealloc David Hildenbrand <david@redhat.com>: mm/shuffle: don't move pages between zones and don't read garbage memmaps Subsystem: kthread Peter Zijlstra <peterz@infradead.org>: mm: fix kthread_use_mm() vs TLB invalidate Ilias Stamatis <stamatis.iliass@gmail.com>: kthread: remove incorrect comment in kthread_create_on_cpu() Subsystem: tools "Alexander A. Klimov" <grandmaster@al2klimov.de>: tools/: replace HTTP links with HTTPS ones Gaurav Singh <gaurav1086@gmail.com>: tools/testing/selftests/cgroup/cgroup_util.c: cg_read_strcmp: fix null pointer dereference Subsystem: scripts Jialu Xu <xujialu@vimux.org>: scripts/tags.sh: collect compiled source precisely Nikolay Borisov <nborisov@suse.com>: scripts/bloat-o-meter: Support comparing library archives Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: scripts/decode_stacktrace.sh: skip missing symbols scripts/decode_stacktrace.sh: guess basepath if not specified scripts/decode_stacktrace.sh: guess path to modules scripts/decode_stacktrace.sh: guess path to vmlinux by release name Joe Perches <joe@perches.com>: const_structs.checkpatch: add regulator_ops Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ntfs Luca Stefani <luca.stefani.ge1@gmail.com>: ntfs: fix ntfs_test_inode and ntfs_init_locked_inode function type Subsystem: ocfs2 Gang He <ghe@suse.com>: ocfs2: fix remounting needed after setfacl command Randy Dunlap <rdunlap@infradead.org>: ocfs2: suballoc.h: delete a duplicated word Junxiao Bi <junxiao.bi@oracle.com>: ocfs2: change slot number type s16 to u16 "Alexander A. Klimov" <grandmaster@al2klimov.de>: ocfs2: replace HTTP links with HTTPS ones Pavel Machek <pavel@ucw.cz>: ocfs2: fix unbalanced locking Subsystem: mm/slab-generic Waiman Long <longman@redhat.com>: mm, treewide: rename kzfree() to kfree_sensitive() William Kucharski <william.kucharski@oracle.com>: mm: ksize() should silently accept a NULL pointer Subsystem: mm/slab Kees Cook <keescook@chromium.org>: Patch series "mm: Expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB": mm/slab: expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB mm/slab: add naive detection of double free Long Li <lonuxli.64@gmail.com>: mm, slab: check GFP_SLAB_BUG_MASK before alloc_pages in kmalloc_order Xiao Yang <yangx.jy@cn.fujitsu.com>: mm/slab.c: update outdated kmem_list3 in a comment Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: Patch series "slub_debug fixes and improvements": mm, slub: extend slub_debug syntax for multiple blocks mm, slub: make some slub_debug related attributes read-only mm, slub: remove runtime allocation order changes mm, slub: make remaining slub_debug related attributes read-only mm, slub: make reclaim_account attribute read-only mm, slub: introduce static key for slub_debug() mm, slub: introduce kmem_cache_debug_flags() mm, slub: extend checks guarded by slub_debug static key mm, slab/slub: move and improve cache_from_obj() mm, slab/slub: improve error reporting and overhead of cache_from_obj() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/slub.c: drop lockdep_assert_held() from put_map() Subsystem: mm/kcsan Marco Elver <elver@google.com>: mm, kcsan: instrument SLAB/SLUB free with "ASSERT_EXCLUSIVE_ACCESS" Subsystem: mm/debug Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/debug_vm_pgtable: Add some more tests", v5: mm/debug_vm_pgtable: add tests validating arch helpers for core MM features mm/debug_vm_pgtable: add tests validating advanced arch page table helpers mm/debug_vm_pgtable: add debug prints for individual tests Documentation/mm: add descriptions for arch page table helpers "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Improvements for dump_page()", v2: mm/debug: handle page->mapping better in dump_page mm/debug: dump compound page information on a second line mm/debug: print head flags in dump_page mm/debug: switch dump_page to get_kernel_nofault mm/debug: print the inode number in dump_page mm/debug: print hashed address of struct page John Hubbard <jhubbard@nvidia.com>: mm, dump_page: do not crash with bad compound_mapcount() Subsystem: mm/pagecache Yang Shi <yang.shi@linux.alibaba.com>: mm: filemap: clear idle flag for writes mm: filemap: add missing FGP_ flags in kerneldoc comment for pagecache_get_page Subsystem: mm/gup Tang Yizhou <tangyizhou@huawei.com>: mm/gup.c: fix the comment of return value for populate_vma_page_range() Subsystem: mm/swap Zhen Lei <thunder.leizhen@huawei.com>: Patch series "clean up some functions in mm/swap_slots.c": mm/swap_slots.c: simplify alloc_swap_slot_cache() mm/swap_slots.c: simplify enable_swap_slots_cache() mm/swap_slots.c: remove redundant check for swap_slot_cache_initialized Krzysztof Kozlowski <krzk@kernel.org>: mm: swap: fix kerneldoc of swap_vma_readahead() Xianting Tian <xianting_tian@126.com>: mm/page_io.c: use blk_io_schedule() for avoiding task hung in sync io Subsystem: mm/shmem Chris Down <chris@chrisdown.name>: Patch series "tmpfs: inode: Reduce risk of inum overflow", v7: tmpfs: per-superblock i_ino support tmpfs: support 64-bit inums per-sb Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: kmem: make memcg_kmem_enabled() irreversible Patch series "The new cgroup slab memory controller", v7: mm: memcg: factor out memcg- and lruvec-level changes out of __mod_lruvec_state() mm: memcg: prepare for byte-sized vmstat items mm: memcg: convert vmstat slab counters to bytes mm: slub: implement SLUB version of obj_to_index() Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: decouple reference counting from page accounting Roman Gushchin <guro@fb.com>: mm: memcg/slab: obj_cgroup API mm: memcg/slab: allocate obj_cgroups for non-root slab pages mm: memcg/slab: save obj_cgroup for non-root slab objects mm: memcg/slab: charge individual slab objects instead of pages mm: memcg/slab: deprecate memory.kmem.slabinfo mm: memcg/slab: move memcg_kmem_bypass() to memcontrol.h mm: memcg/slab: use a single set of kmem_caches for all accounted allocations mm: memcg/slab: simplify memcg cache creation mm: memcg/slab: remove memcg_kmem_get_cache() mm: memcg/slab: deprecate slab_root_caches mm: memcg/slab: remove redundant check in memcg_accumulate_slabinfo() mm: memcg/slab: use a single set of kmem_caches for all allocations kselftests: cgroup: add kernel memory accounting tests tools/cgroup: add memcg_slabinfo.py tool Shakeel Butt <shakeelb@google.com>: mm: memcontrol: account kernel stack per node Roman Gushchin <guro@fb.com>: mm: memcg/slab: remove unused argument by charge_slab_page() mm: slab: rename (un)charge_slab_page() to (un)account_slab_page() mm: kmem: switch to static_branch_likely() in memcg_kmem_enabled() mm: memcontrol: avoid workload stalls when lowering memory.high Chris Down <chris@chrisdown.name>: Patch series "mm, memcg: reclaim harder before high throttling", v2: mm, memcg: reclaim more aggressively before high allocator throttling mm, memcg: unify reclaim retry limits with page allocator Yafang Shao <laoar.shao@gmail.com>: Patch series "mm, memcg: memory.{low,min} reclaim fix & cleanup", v4: mm, memcg: avoid stale protection values when cgroup is above protection Chris Down <chris@chrisdown.name>: mm, memcg: decouple e{low,min} state mutations from protection checks Yafang Shao <laoar.shao@gmail.com>: memcg, oom: check memcg margin for parallel oom Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: restore proper dirty throttling when memory.high changes mm: memcontrol: don't count limit-setting reclaim as memory pressure Michal Koutný <mkoutny@suse.com>: mm/page_counter.c: fix protection usage propagation Subsystem: mm/pagemap Ralph Campbell <rcampbell@nvidia.com>: mm: remove redundant check non_swap_entry() Alex Zhang <zhangalex@google.com>: mm/memory.c: make remap_pfn_range() reject unaligned addr Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: cleanup usage of <asm/pgalloc.h>": mm: remove unneeded includes of <asm/pgalloc.h> opeinrisc: switch to generic version of pte allocation xtensa: switch to generic version of pte allocation asm-generic: pgalloc: provide generic pmd_alloc_one() and pmd_free_one() asm-generic: pgalloc: provide generic pud_alloc_one() and pud_free_one() asm-generic: pgalloc: provide generic pgd_free() mm: move lib/ioremap.c to mm/ Joerg Roedel <jroedel@suse.de>: mm: move p?d_alloc_track to separate header file Zhen Lei <thunder.leizhen@huawei.com>: mm/mmap: optimize a branch judgment in ksys_mmap_pgoff() Feng Tang <feng.tang@intel.com>: Patch series "make vm_committed_as_batch aware of vm overcommit policy", v6: proc/meminfo: avoid open coded reading of vm_committed_as mm/util.c: make vm_memory_committed() more accurate percpu_counter: add percpu_counter_sync() mm: adjust vm_committed_as_batch according to vm overcommit policy Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "arm64: Enable vmemmap mapping from device memory", v4: mm/sparsemem: enable vmem_altmap support in vmemmap_populate_basepages() mm/sparsemem: enable vmem_altmap support in vmemmap_alloc_block_buf() arm64/mm: enable vmem_altmap support for vmemmap mappings Miaohe Lin <linmiaohe@huawei.com>: mm: mmap: merge vma after call_mmap() if possible Peter Collingbourne <pcc@google.com>: mm: remove unnecessary wrapper function do_mmap_pgoff() Subsystem: mm/mremap Wei Yang <richard.weiyang@linux.alibaba.com>: Patch series "mm/mremap: cleanup move_page_tables() a little", v5: mm/mremap: it is sure to have enough space when extent meets requirement mm/mremap: calculate extent in one place mm/mremap: start addresses are properly aligned Subsystem: mm/mincore Ricardo Cañuelo <ricardo.canuelo@collabora.com>: selftests: add mincore() tests Subsystem: mm/sparsemem Wei Yang <richard.weiyang@linux.alibaba.com>: mm/sparse: never partially remove memmap for early section mm/sparse: only sub-section aligned range would be populated Mike Rapoport <rppt@linux.ibm.com>: mm/sparse: cleanup the code surrounding memory_present() Subsystem: mm/vmalloc "Matthew Wilcox (Oracle)" <willy@infradead.org>: vmalloc: convert to XArray "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: simplify merge_or_add_vmap_area() mm/vmalloc: simplify augment_tree_propagate_check() mm/vmalloc: switch to "propagate()" callback mm/vmalloc: update the header about KVA rework Mike Rapoport <rppt@linux.ibm.com>: mm: vmalloc: remove redundant assignment in unmap_kernel_range_noflush() "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc.c: remove BUG() from the find_va_links() Subsystem: mm/kasan Marco Elver <elver@google.com>: kasan: improve and simplify Kconfig.kasan kasan: update required compiler versions in documentation Walter Wu <walter-zh.wu@mediatek.com>: Patch series "kasan: memorize and print call_rcu stack", v8: rcu: kasan: record and print call_rcu() call stack kasan: record and print the free track kasan: add tests for call_rcu stack recording kasan: update documentation for generic kasan Vincenzo Frascino <vincenzo.frascino@arm.com>: kasan: remove kasan_unpoison_stack_above_sp_to() Walter Wu <walter-zh.wu@mediatek.com>: lib/test_kasan.c: fix KASAN unit tests for tag-based KASAN Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: support stack instrumentation for tag-based mode", v2: kasan: don't tag stacks allocated with pagealloc efi: provide empty efi_enter_virtual_mode implementation kasan, arm64: don't instrument functions that enable kasan kasan: allow enabling stack tagging for tag-based mode kasan: adjust kasan_stack_oob for tag-based mode Subsystem: mm/pagealloc Vlastimil Babka <vbabka@suse.cz>: mm, page_alloc: use unlikely() in task_capc() Jaewon Kim <jaewon31.kim@samsung.com>: page_alloc: consider highatomic reserve in watermark fast Charan Teja Reddy <charante@codeaurora.org>: mm, page_alloc: skip ->waternark_boost for atomic order-0 allocations David Hildenbrand <david@redhat.com>: mm: remove vm_total_pages mm/page_alloc: remove nr_free_pagecache_pages() mm/memory_hotplug: document why shuffle_zone() is relevant mm/shuffle: remove dynamic reconfiguration Wei Yang <richard.weiyang@linux.alibaba.com>: mm/page_alloc.c: replace the definition of NR_MIGRATETYPE_BITS with PB_migratetype_bits mm/page_alloc.c: extract the common part in pfn_to_bitidx() mm/page_alloc.c: simplify pageblock bitmap access mm/page_alloc.c: remove unnecessary end_bitidx for [set|get]_pfnblock_flags_mask() Qian Cai <cai@lca.pw>: mm/page_alloc: silence a KASAN false positive Wei Yang <richard.weiyang@linux.alibaba.com>: mm/page_alloc: fallbacks at most has 3 elements Muchun Song <songmuchun@bytedance.com>: mm/page_alloc.c: skip setting nodemask when we are in interrupt Joonsoo Kim <iamjoonsoo.kim@lge.com>: mm/page_alloc: fix memalloc_nocma_{save/restore} APIs Subsystem: mm/hugetlb "Alexander A. Klimov" <grandmaster@al2klimov.de>: mm: thp: replace HTTP links with HTTPS ones Peter Xu <peterx@redhat.com>: mm/hugetlb: fix calculation of adjust_range_if_pmd_sharing_possible Hugh Dickins <hughd@google.com>: khugepaged: collapse_pte_mapped_thp() flush the right range khugepaged: collapse_pte_mapped_thp() protect the pmd lock khugepaged: retract_page_tables() remember to test exit khugepaged: khugepaged_test_exit() check mmget_still_valid() Subsystem: mm/vmscan dylan-meiners <spacct.spacct@gmail.com>: mm/vmscan.c: fix typo Shakeel Butt <shakeelb@google.com>: mm: vmscan: consistent update to pgrefill Documentation/admin-guide/kernel-parameters.txt | 2 Documentation/dev-tools/kasan.rst | 10 Documentation/filesystems/dlmfs.rst | 2 Documentation/filesystems/ocfs2.rst | 2 Documentation/filesystems/tmpfs.rst | 18 Documentation/vm/arch_pgtable_helpers.rst | 258 +++++ Documentation/vm/memory-model.rst | 9 Documentation/vm/slub.rst | 51 - arch/alpha/include/asm/pgalloc.h | 21 arch/alpha/include/asm/tlbflush.h | 1 arch/alpha/kernel/core_irongate.c | 1 arch/alpha/kernel/core_marvel.c | 1 arch/alpha/kernel/core_titan.c | 1 arch/alpha/kernel/machvec_impl.h | 2 arch/alpha/kernel/smp.c | 1 arch/alpha/mm/numa.c | 1 arch/arc/mm/fault.c | 1 arch/arc/mm/init.c | 1 arch/arm/include/asm/pgalloc.h | 12 arch/arm/include/asm/tlb.h | 1 arch/arm/kernel/machine_kexec.c | 1 arch/arm/kernel/smp.c | 1 arch/arm/kernel/suspend.c | 1 arch/arm/mach-omap2/omap-mpuss-lowpower.c | 1 arch/arm/mm/hugetlbpage.c | 1 arch/arm/mm/init.c | 9 arch/arm/mm/mmu.c | 1 arch/arm64/include/asm/pgalloc.h | 39 arch/arm64/kernel/setup.c | 2 arch/arm64/kernel/smp.c | 1 arch/arm64/mm/hugetlbpage.c | 1 arch/arm64/mm/init.c | 6 arch/arm64/mm/ioremap.c | 1 arch/arm64/mm/mmu.c | 63 - arch/csky/include/asm/pgalloc.h | 7 arch/csky/kernel/smp.c | 1 arch/hexagon/include/asm/pgalloc.h | 7 arch/ia64/include/asm/pgalloc.h | 24 arch/ia64/include/asm/tlb.h | 1 arch/ia64/kernel/process.c | 1 arch/ia64/kernel/smp.c | 1 arch/ia64/kernel/smpboot.c | 1 arch/ia64/mm/contig.c | 1 arch/ia64/mm/discontig.c | 4 arch/ia64/mm/hugetlbpage.c | 1 arch/ia64/mm/tlb.c | 1 arch/m68k/include/asm/mmu_context.h | 2 arch/m68k/include/asm/sun3_pgalloc.h | 7 arch/m68k/kernel/dma.c | 2 arch/m68k/kernel/traps.c | 3 arch/m68k/mm/cache.c | 2 arch/m68k/mm/fault.c | 1 arch/m68k/mm/kmap.c | 2 arch/m68k/mm/mcfmmu.c | 1 arch/m68k/mm/memory.c | 1 arch/m68k/sun3x/dvma.c | 2 arch/microblaze/include/asm/pgalloc.h | 6 arch/microblaze/include/asm/tlbflush.h | 1 arch/microblaze/kernel/process.c | 1 arch/microblaze/kernel/signal.c | 1 arch/microblaze/mm/init.c | 3 arch/mips/include/asm/pgalloc.h | 19 arch/mips/kernel/setup.c | 8 arch/mips/loongson64/numa.c | 1 arch/mips/sgi-ip27/ip27-memory.c | 2 arch/mips/sgi-ip32/ip32-memory.c | 1 arch/nds32/mm/mm-nds32.c | 2 arch/nios2/include/asm/pgalloc.h | 7 arch/openrisc/include/asm/pgalloc.h | 33 arch/openrisc/include/asm/tlbflush.h | 1 arch/openrisc/kernel/or32_ksyms.c | 1 arch/parisc/include/asm/mmu_context.h | 1 arch/parisc/include/asm/pgalloc.h | 12 arch/parisc/kernel/cache.c | 1 arch/parisc/kernel/pci-dma.c | 1 arch/parisc/kernel/process.c | 1 arch/parisc/kernel/signal.c | 1 arch/parisc/kernel/smp.c | 1 arch/parisc/mm/hugetlbpage.c | 1 arch/parisc/mm/init.c | 5 arch/parisc/mm/ioremap.c | 2 arch/powerpc/include/asm/tlb.h | 1 arch/powerpc/mm/book3s64/hash_hugetlbpage.c | 1 arch/powerpc/mm/book3s64/hash_pgtable.c | 1 arch/powerpc/mm/book3s64/hash_tlb.c | 1 arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 1 arch/powerpc/mm/init_32.c | 1 arch/powerpc/mm/init_64.c | 4 arch/powerpc/mm/kasan/8xx.c | 1 arch/powerpc/mm/kasan/book3s_32.c | 1 arch/powerpc/mm/mem.c | 3 arch/powerpc/mm/nohash/40x.c | 1 arch/powerpc/mm/nohash/8xx.c | 1 arch/powerpc/mm/nohash/fsl_booke.c | 1 arch/powerpc/mm/nohash/kaslr_booke.c | 1 arch/powerpc/mm/nohash/tlb.c | 1 arch/powerpc/mm/numa.c | 1 arch/powerpc/mm/pgtable.c | 1 arch/powerpc/mm/pgtable_64.c | 1 arch/powerpc/mm/ptdump/hashpagetable.c | 2 arch/powerpc/mm/ptdump/ptdump.c | 1 arch/powerpc/platforms/pseries/cmm.c | 1 arch/riscv/include/asm/pgalloc.h | 18 arch/riscv/mm/fault.c | 1 arch/riscv/mm/init.c | 3 arch/s390/crypto/prng.c | 4 arch/s390/include/asm/tlb.h | 1 arch/s390/include/asm/tlbflush.h | 1 arch/s390/kernel/machine_kexec.c | 1 arch/s390/kernel/ptrace.c | 1 arch/s390/kvm/diag.c | 1 arch/s390/kvm/priv.c | 1 arch/s390/kvm/pv.c | 1 arch/s390/mm/cmm.c | 1 arch/s390/mm/init.c | 1 arch/s390/mm/mmap.c | 1 arch/s390/mm/pgtable.c | 1 arch/sh/include/asm/pgalloc.h | 4 arch/sh/kernel/idle.c | 1 arch/sh/kernel/machine_kexec.c | 1 arch/sh/mm/cache-sh3.c | 1 arch/sh/mm/cache-sh7705.c | 1 arch/sh/mm/hugetlbpage.c | 1 arch/sh/mm/init.c | 7 arch/sh/mm/ioremap_fixed.c | 1 arch/sh/mm/numa.c | 3 arch/sh/mm/tlb-sh3.c | 1 arch/sparc/include/asm/ide.h | 1 arch/sparc/include/asm/tlb_64.h | 1 arch/sparc/kernel/leon_smp.c | 1 arch/sparc/kernel/process_32.c | 1 arch/sparc/kernel/signal_32.c | 1 arch/sparc/kernel/smp_32.c | 1 arch/sparc/kernel/smp_64.c | 1 arch/sparc/kernel/sun4m_irq.c | 1 arch/sparc/mm/highmem.c | 1 arch/sparc/mm/init_64.c | 1 arch/sparc/mm/io-unit.c | 1 arch/sparc/mm/iommu.c | 1 arch/sparc/mm/tlb.c | 1 arch/um/include/asm/pgalloc.h | 9 arch/um/include/asm/pgtable-3level.h | 3 arch/um/kernel/mem.c | 17 arch/x86/ia32/ia32_aout.c | 1 arch/x86/include/asm/mmu_context.h | 1 arch/x86/include/asm/pgalloc.h | 42 arch/x86/kernel/alternative.c | 1 arch/x86/kernel/apic/apic.c | 1 arch/x86/kernel/mpparse.c | 1 arch/x86/kernel/traps.c | 1 arch/x86/mm/fault.c | 1 arch/x86/mm/hugetlbpage.c | 1 arch/x86/mm/init_32.c | 2 arch/x86/mm/init_64.c | 12 arch/x86/mm/kaslr.c | 1 arch/x86/mm/pgtable_32.c | 1 arch/x86/mm/pti.c | 1 arch/x86/platform/uv/bios_uv.c | 1 arch/x86/power/hibernate.c | 2 arch/xtensa/include/asm/pgalloc.h | 46 arch/xtensa/kernel/xtensa_ksyms.c | 1 arch/xtensa/mm/cache.c | 1 arch/xtensa/mm/fault.c | 1 crypto/adiantum.c | 2 crypto/ahash.c | 4 crypto/api.c | 2 crypto/asymmetric_keys/verify_pefile.c | 4 crypto/deflate.c | 2 crypto/drbg.c | 10 crypto/ecc.c | 8 crypto/ecdh.c | 2 crypto/gcm.c | 2 crypto/gf128mul.c | 4 crypto/jitterentropy-kcapi.c | 2 crypto/rng.c | 2 crypto/rsa-pkcs1pad.c | 6 crypto/seqiv.c | 2 crypto/shash.c | 2 crypto/skcipher.c | 2 crypto/testmgr.c | 6 crypto/zstd.c | 2 drivers/base/node.c | 10 drivers/block/xen-blkback/common.h | 1 drivers/crypto/allwinner/sun8i-ce/sun8i-ce-cipher.c | 2 drivers/crypto/allwinner/sun8i-ss/sun8i-ss-cipher.c | 2 drivers/crypto/amlogic/amlogic-gxl-cipher.c | 4 drivers/crypto/atmel-ecc.c | 2 drivers/crypto/caam/caampkc.c | 28 drivers/crypto/cavium/cpt/cptvf_main.c | 6 drivers/crypto/cavium/cpt/cptvf_reqmanager.c | 12 drivers/crypto/cavium/nitrox/nitrox_lib.c | 4 drivers/crypto/cavium/zip/zip_crypto.c | 6 drivers/crypto/ccp/ccp-crypto-rsa.c | 6 drivers/crypto/ccree/cc_aead.c | 4 drivers/crypto/ccree/cc_buffer_mgr.c | 4 drivers/crypto/ccree/cc_cipher.c | 6 drivers/crypto/ccree/cc_hash.c | 8 drivers/crypto/ccree/cc_request_mgr.c | 2 drivers/crypto/marvell/cesa/hash.c | 2 drivers/crypto/marvell/octeontx/otx_cptvf_main.c | 6 drivers/crypto/marvell/octeontx/otx_cptvf_reqmgr.h | 2 drivers/crypto/nx/nx.c | 4 drivers/crypto/virtio/virtio_crypto_algs.c | 12 drivers/crypto/virtio/virtio_crypto_core.c | 2 drivers/iommu/ipmmu-vmsa.c | 1 drivers/md/dm-crypt.c | 32 drivers/md/dm-integrity.c | 6 drivers/misc/ibmvmc.c | 6 drivers/net/ethernet/hisilicon/hns3/hns3pf/hclge_mbx.c | 2 drivers/net/ethernet/intel/ixgbe/ixgbe_ipsec.c | 6 drivers/net/ppp/ppp_mppe.c | 6 drivers/net/wireguard/noise.c | 4 drivers/net/wireguard/peer.c | 2 drivers/net/wireless/intel/iwlwifi/pcie/rx.c | 2 drivers/net/wireless/intel/iwlwifi/pcie/tx-gen2.c | 6 drivers/net/wireless/intel/iwlwifi/pcie/tx.c | 6 drivers/net/wireless/intersil/orinoco/wext.c | 4 drivers/s390/crypto/ap_bus.h | 4 drivers/staging/ks7010/ks_hostif.c | 2 drivers/staging/rtl8723bs/core/rtw_security.c | 2 drivers/staging/wlan-ng/p80211netdev.c | 2 drivers/target/iscsi/iscsi_target_auth.c | 2 drivers/xen/balloon.c | 1 drivers/xen/privcmd.c | 1 fs/Kconfig | 21 fs/aio.c | 6 fs/binfmt_elf_fdpic.c | 1 fs/cifs/cifsencrypt.c | 2 fs/cifs/connect.c | 10 fs/cifs/dfs_cache.c | 2 fs/cifs/misc.c | 8 fs/crypto/inline_crypt.c | 5 fs/crypto/keyring.c | 6 fs/crypto/keysetup_v1.c | 4 fs/ecryptfs/keystore.c | 4 fs/ecryptfs/messaging.c | 2 fs/hugetlbfs/inode.c | 2 fs/ntfs/dir.c | 2 fs/ntfs/inode.c | 27 fs/ntfs/inode.h | 4 fs/ntfs/mft.c | 4 fs/ocfs2/Kconfig | 6 fs/ocfs2/acl.c | 2 fs/ocfs2/blockcheck.c | 2 fs/ocfs2/dlmglue.c | 8 fs/ocfs2/ocfs2.h | 4 fs/ocfs2/suballoc.c | 4 fs/ocfs2/suballoc.h | 2 fs/ocfs2/super.c | 4 fs/proc/meminfo.c | 10 include/asm-generic/pgalloc.h | 80 + include/asm-generic/tlb.h | 1 include/crypto/aead.h | 2 include/crypto/akcipher.h | 2 include/crypto/gf128mul.h | 2 include/crypto/hash.h | 2 include/crypto/internal/acompress.h | 2 include/crypto/kpp.h | 2 include/crypto/skcipher.h | 2 include/linux/efi.h | 4 include/linux/fs.h | 17 include/linux/huge_mm.h | 2 include/linux/kasan.h | 4 include/linux/memcontrol.h | 209 +++- include/linux/mm.h | 86 - include/linux/mm_types.h | 5 include/linux/mman.h | 4 include/linux/mmu_notifier.h | 13 include/linux/mmzone.h | 54 - include/linux/pageblock-flags.h | 30 include/linux/percpu_counter.h | 4 include/linux/sched/mm.h | 8 include/linux/shmem_fs.h | 3 include/linux/slab.h | 11 include/linux/slab_def.h | 9 include/linux/slub_def.h | 31 include/linux/swap.h | 2 include/linux/vmstat.h | 14 init/Kconfig | 9 init/main.c | 2 ipc/shm.c | 2 kernel/fork.c | 54 - kernel/kthread.c | 8 kernel/power/snapshot.c | 2 kernel/rcu/tree.c | 2 kernel/scs.c | 2 kernel/sysctl.c | 2 lib/Kconfig.kasan | 39 lib/Makefile | 1 lib/ioremap.c | 287 ----- lib/mpi/mpiutil.c | 6 lib/percpu_counter.c | 19 lib/test_kasan.c | 87 + mm/Kconfig | 6 mm/Makefile | 2 mm/debug.c | 103 +- mm/debug_vm_pgtable.c | 666 +++++++++++++ mm/filemap.c | 9 mm/gup.c | 3 mm/huge_memory.c | 14 mm/hugetlb.c | 25 mm/ioremap.c | 289 +++++ mm/kasan/common.c | 41 mm/kasan/generic.c | 43 mm/kasan/generic_report.c | 1 mm/kasan/kasan.h | 25 mm/kasan/quarantine.c | 1 mm/kasan/report.c | 54 - mm/kasan/tags.c | 37 mm/khugepaged.c | 75 - mm/memcontrol.c | 832 ++++++++++------- mm/memory.c | 15 mm/memory_hotplug.c | 11 mm/migrate.c | 6 mm/mm_init.c | 20 mm/mmap.c | 45 mm/mremap.c | 19 mm/nommu.c | 6 mm/oom_kill.c | 2 mm/page-writeback.c | 6 mm/page_alloc.c | 226 ++-- mm/page_counter.c | 6 mm/page_io.c | 2 mm/pgalloc-track.h | 51 + mm/shmem.c | 133 ++ mm/shuffle.c | 46 mm/shuffle.h | 17 mm/slab.c | 129 +- mm/slab.h | 755 ++++++--------- mm/slab_common.c | 829 ++-------------- mm/slob.c | 12 mm/slub.c | 680 ++++--------- mm/sparse-vmemmap.c | 62 - mm/sparse.c | 31 mm/swap_slots.c | 45 mm/swap_state.c | 2 mm/util.c | 52 + mm/vmalloc.c | 176 +-- mm/vmscan.c | 39 mm/vmstat.c | 38 mm/workingset.c | 6 net/atm/mpoa_caches.c | 4 net/bluetooth/ecdh_helper.c | 6 net/bluetooth/smp.c | 24 net/core/sock.c | 2 net/ipv4/tcp_fastopen.c | 2 net/mac80211/aead_api.c | 4 net/mac80211/aes_gmac.c | 2 net/mac80211/key.c | 2 net/mac802154/llsec.c | 20 net/sctp/auth.c | 2 net/sunrpc/auth_gss/gss_krb5_crypto.c | 4 net/sunrpc/auth_gss/gss_krb5_keys.c | 6 net/sunrpc/auth_gss/gss_krb5_mech.c | 2 net/tipc/crypto.c | 10 net/wireless/core.c | 2 net/wireless/ibss.c | 4 net/wireless/lib80211_crypt_tkip.c | 2 net/wireless/lib80211_crypt_wep.c | 2 net/wireless/nl80211.c | 24 net/wireless/sme.c | 6 net/wireless/util.c | 2 net/wireless/wext-sme.c | 2 scripts/Makefile.kasan | 3 scripts/bloat-o-meter | 2 scripts/coccinelle/free/devm_free.cocci | 4 scripts/coccinelle/free/ifnullfree.cocci | 4 scripts/coccinelle/free/kfree.cocci | 6 scripts/coccinelle/free/kfreeaddr.cocci | 2 scripts/const_structs.checkpatch | 1 scripts/decode_stacktrace.sh | 85 + scripts/spelling.txt | 19 scripts/tags.sh | 18 security/apparmor/domain.c | 4 security/apparmor/include/file.h | 2 security/apparmor/policy.c | 24 security/apparmor/policy_ns.c | 6 security/apparmor/policy_unpack.c | 14 security/keys/big_key.c | 6 security/keys/dh.c | 14 security/keys/encrypted-keys/encrypted.c | 14 security/keys/trusted-keys/trusted_tpm1.c | 34 security/keys/user_defined.c | 6 tools/cgroup/memcg_slabinfo.py | 226 ++++ tools/include/linux/jhash.h | 2 tools/lib/rbtree.c | 2 tools/lib/traceevent/event-parse.h | 2 tools/testing/ktest/examples/README | 2 tools/testing/ktest/examples/crosstests.conf | 2 tools/testing/selftests/Makefile | 1 tools/testing/selftests/cgroup/.gitignore | 1 tools/testing/selftests/cgroup/Makefile | 2 tools/testing/selftests/cgroup/cgroup_util.c | 2 tools/testing/selftests/cgroup/test_kmem.c | 382 +++++++ tools/testing/selftests/mincore/.gitignore | 2 tools/testing/selftests/mincore/Makefile | 6 tools/testing/selftests/mincore/mincore_selftest.c | 361 +++++++ 397 files changed, 5547 insertions(+), 4072 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-07-24 4:14 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-07-24 4:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 15 patches, based on f37e99aca03f63aa3f2bd13ceaf769455d12c4b0. Subsystems affected by this patch series: mm/pagemap mm/shmem mm/hotfixes mm/memcg mm/hugetlb mailmap squashfs scripts io-mapping MAINTAINERS gdb Subsystem: mm/pagemap Yang Shi <yang.shi@linux.alibaba.com>: mm/memory.c: avoid access flag update TLB flush for retried page fault "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: mm/mmap.c: close race between munmap() and expand_upwards()/downwards() Subsystem: mm/shmem Chengguang Xu <cgxu519@mykernel.net>: vfs/xattr: mm/shmem: kernfs: release simple xattr entry in a right way Subsystem: mm/hotfixes Tom Rix <trix@redhat.com>: mm: initialize return of vm_insert_pages Bhupesh Sharma <bhsharma@redhat.com>: mm/memcontrol: fix OOPS inside mem_cgroup_get_nr_swap_pages() Subsystem: mm/memcg Hugh Dickins <hughd@google.com>: mm/memcg: fix refcount error while moving and swapping Muchun Song <songmuchun@bytedance.com>: mm: memcg/slab: fix memory leak at non-root kmem_cache destroy Subsystem: mm/hugetlb Barry Song <song.bao.hua@hisilicon.com>: mm/hugetlb: avoid hardcoding while checking if cma is enabled "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: khugepaged: fix null-pointer dereference due to race Subsystem: mailmap Mike Rapoport <rppt@linux.ibm.com>: mailmap: add entry for Mike Rapoport Subsystem: squashfs Phillip Lougher <phillip@squashfs.org.uk>: squashfs: fix length field overlap check in metadata reading Subsystem: scripts Pi-Hsun Shih <pihsun@chromium.org>: scripts/decode_stacktrace: strip basepath from all paths Subsystem: io-mapping "Michael J. Ruhl" <michael.j.ruhl@intel.com>: io-mapping: indicate mapping failure Subsystem: MAINTAINERS Andrey Konovalov <andreyknvl@google.com>: MAINTAINERS: add KCOV section Subsystem: gdb Stefano Garzarella <sgarzare@redhat.com>: scripts/gdb: fix lx-symbols 'gdb.error' while loading modules .mailmap | 3 +++ MAINTAINERS | 11 +++++++++++ fs/squashfs/block.c | 2 +- include/linux/io-mapping.h | 5 ++++- include/linux/xattr.h | 3 ++- mm/hugetlb.c | 15 ++++++++++----- mm/khugepaged.c | 3 +++ mm/memcontrol.c | 13 ++++++++++--- mm/memory.c | 9 +++++++-- mm/mmap.c | 16 ++++++++++++++-- mm/shmem.c | 2 +- mm/slab_common.c | 35 ++++++++++++++++++++++++++++------- scripts/decode_stacktrace.sh | 4 ++-- scripts/gdb/linux/symbols.py | 2 +- 14 files changed, 97 insertions(+), 26 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-07-03 22:14 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-07-03 22:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 5 patches, based on cdd3bb54332f82295ed90cd0c09c78cd0c0ee822. Subsystems affected by this patch series: mm/hugetlb samples mm/cma mm/vmalloc mm/pagealloc Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: mm/hugetlb.c: fix pages per hugetlb calculation Subsystem: samples Kees Cook <keescook@chromium.org>: samples/vfs: avoid warning in statx override Subsystem: mm/cma Barry Song <song.bao.hua@hisilicon.com>: mm/cma.c: use exact_nid true to fix possible per-numa cma leak Subsystem: mm/vmalloc Christoph Hellwig <hch@lst.de>: vmalloc: fix the owner argument for the new __vmalloc_node_range callers Subsystem: mm/pagealloc Joel Savitz <jsavitz@redhat.com>: mm/page_alloc: fix documentation error arch/arm64/kernel/probes/kprobes.c | 2 +- arch/x86/hyperv/hv_init.c | 3 ++- kernel/module.c | 2 +- mm/cma.c | 4 ++-- mm/hugetlb.c | 2 +- mm/page_alloc.c | 2 +- samples/vfs/test-statx.c | 2 ++ 7 files changed, 10 insertions(+), 7 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-06-26 3:28 Andrew Morton 2020-06-26 6:51 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2020-06-26 3:28 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a. Subsystems affected by this patch series: hotfixes mm/pagealloc kexec ocfs2 lib misc mm/slab mm/slab mm/slub mm/swap mm/pagemap mm/vmalloc mm/memcg mm/gup mm/thp mm/vmscan x86 mm/memory-hotplug MAINTAINERS Subsystem: hotfixes Stafford Horne <shorne@gmail.com>: openrisc: fix boot oops when DEBUG_VM is enabled Michal Hocko <mhocko@suse.com>: mm: do_swap_page(): fix up the error code Subsystem: mm/pagealloc Vlastimil Babka <vbabka@suse.cz>: mm, compaction: make capture control handling safe wrt interrupts Subsystem: kexec Lianbo Jiang <lijiang@redhat.com>: kexec: do not verify the signature without the lockdown or mandatory signature Subsystem: ocfs2 Junxiao Bi <junxiao.bi@oracle.com>: Patch series "ocfs2: fix nfsd over ocfs2 issues", v2: ocfs2: avoid inode removal while nfsd is accessing it ocfs2: load global_inode_alloc ocfs2: fix panic on nfs server over ocfs2 ocfs2: fix value of OCFS2_INVALID_SLOT Subsystem: lib Randy Dunlap <rdunlap@infradead.org>: lib: fix test_hmm.c reference after free Subsystem: misc Rikard Falkeborn <rikard.falkeborn@gmail.com>: linux/bits.h: fix unsigned less than zero warnings Subsystem: mm/slab Waiman Long <longman@redhat.com>: mm, slab: fix sign conversion problem in memcg_uncharge_slab() Subsystem: mm/slab Waiman Long <longman@redhat.com>: mm/slab: use memzero_explicit() in kzfree() Subsystem: mm/slub Sebastian Andrzej Siewior <bigeasy@linutronix.de>: slub: cure list_slab_objects() from double fix Subsystem: mm/swap Hugh Dickins <hughd@google.com>: mm: fix swap cache node allocation mask Subsystem: mm/pagemap Arjun Roy <arjunroy@google.com>: mm/memory.c: properly pte_offset_map_lock/unlock in vm_insert_pages() Christophe Leroy <christophe.leroy@csgroup.eu>: mm/debug_vm_pgtable: fix build failure with powerpc 8xx Stephen Rothwell <sfr@canb.auug.org.au>: make asm-generic/cacheflush.h more standalone Nathan Chancellor <natechancellor@gmail.com>: media: omap3isp: remove cacheflush.h Subsystem: mm/vmalloc Masanari Iida <standby24x7@gmail.com>: mm/vmalloc.c: fix a warning while make xmldocs Subsystem: mm/memcg Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: handle div0 crash race condition in memory.low Muchun Song <songmuchun@bytedance.com>: mm/memcontrol.c: add missed css_put() Chris Down <chris@chrisdown.name>: mm/memcontrol.c: prevent missed memory.low load tears Subsystem: mm/gup Souptick Joarder <jrdr.linux@gmail.com>: docs: mm/gup: minor documentation update Subsystem: mm/thp Yang Shi <yang.shi@linux.alibaba.com>: doc: THP CoW fault no longer allocate THP Subsystem: mm/vmscan Johannes Weiner <hannes@cmpxchg.org>: Patch series "fix for "mm: balance LRU lists based on relative thrashing" patchset": mm: workingset: age nonresident information alongside anonymous pages Joonsoo Kim <iamjoonsoo.kim@lge.com>: mm/swap: fix for "mm: workingset: age nonresident information alongside anonymous pages" mm/memory: fix IO cost for anonymous page Subsystem: x86 Christoph Hellwig <hch@lst.de>: Patch series "fix a hyperv W^X violation and remove vmalloc_exec": x86/hyperv: allocate the hypercall page with only read and execute bits arm64: use PAGE_KERNEL_ROX directly in alloc_insn_page mm: remove vmalloc_exec Subsystem: mm/memory-hotplug Ben Widawsky <ben.widawsky@intel.com>: mm/memory_hotplug.c: fix false softlockup during pfn range removal Subsystem: MAINTAINERS Luc Van Oostenryck <luc.vanoostenryck@gmail.com>: MAINTAINERS: update info for sparse Documentation/admin-guide/cgroup-v2.rst | 4 +- Documentation/admin-guide/mm/transhuge.rst | 3 - Documentation/core-api/pin_user_pages.rst | 2 - MAINTAINERS | 4 +- arch/arm64/kernel/probes/kprobes.c | 12 +------ arch/openrisc/kernel/dma.c | 5 +++ arch/x86/hyperv/hv_init.c | 4 +- arch/x86/include/asm/pgtable_types.h | 2 + drivers/media/platform/omap3isp/isp.c | 2 - drivers/media/platform/omap3isp/ispvideo.c | 1 fs/ocfs2/dlmglue.c | 17 ++++++++++ fs/ocfs2/ocfs2.h | 1 fs/ocfs2/ocfs2_fs.h | 4 +- fs/ocfs2/suballoc.c | 9 +++-- include/asm-generic/cacheflush.h | 5 +++ include/linux/bits.h | 3 + include/linux/mmzone.h | 4 +- include/linux/swap.h | 1 include/linux/vmalloc.h | 1 kernel/kexec_file.c | 36 ++++------------------ kernel/module.c | 4 +- lib/test_hmm.c | 3 - mm/compaction.c | 17 ++++++++-- mm/debug_vm_pgtable.c | 4 +- mm/memcontrol.c | 18 ++++++++--- mm/memory.c | 33 +++++++++++++------- mm/memory_hotplug.c | 13 ++++++-- mm/nommu.c | 17 ---------- mm/slab.h | 4 +- mm/slab_common.c | 2 - mm/slub.c | 19 ++--------- mm/swap.c | 3 - mm/swap_state.c | 4 +- mm/vmalloc.c | 21 ------------- mm/vmscan.c | 3 + mm/workingset.c | 46 +++++++++++++++++------------ 36 files changed, 168 insertions(+), 163 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-06-26 3:28 incoming Andrew Morton @ 2020-06-26 6:51 ` Linus Torvalds 2020-06-26 7:31 ` incoming Linus Torvalds 2020-06-26 17:39 ` incoming Konstantin Ryabitsev 0 siblings, 2 replies; 322+ messages in thread From: Linus Torvalds @ 2020-06-26 6:51 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits On Thu, Jun 25, 2020 at 8:28 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a. You didn't cc lkml, so now none of the nice 'b4' automation seems to work for this series.. Yes, this cover-letter went to linux-mm (which is on lore), but the individual patches didn't. Konstantin, maybe mm-commits could be on lore too and then they'd have been caught that way? Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-06-26 6:51 ` incoming Linus Torvalds @ 2020-06-26 7:31 ` Linus Torvalds 2020-06-26 17:39 ` incoming Konstantin Ryabitsev 1 sibling, 0 replies; 322+ messages in thread From: Linus Torvalds @ 2020-06-26 7:31 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits On Thu, Jun 25, 2020 at 11:51 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > You didn't cc lkml, so now none of the nice 'b4' automation seems to > work for this series.. Note that I've picked them up the old-fashioned way, so don't re-send them. So more of a note for "please, next time..." Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-06-26 6:51 ` incoming Linus Torvalds 2020-06-26 7:31 ` incoming Linus Torvalds @ 2020-06-26 17:39 ` Konstantin Ryabitsev 2020-06-26 17:40 ` incoming Konstantin Ryabitsev 1 sibling, 1 reply; 322+ messages in thread From: Konstantin Ryabitsev @ 2020-06-26 17:39 UTC (permalink / raw) To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits On Thu, Jun 25, 2020 at 11:51:06PM -0700, Linus Torvalds wrote: > On Thu, Jun 25, 2020 at 8:28 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > 32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a. > > You didn't cc lkml, so now none of the nice 'b4' automation seems to > work for this series.. > > Yes, this cover-letter went to linux-mm (which is on lore), but the > individual patches didn't. > > Konstantin, maybe mm-commits could be on lore too and then they'd have > been caught that way? Yes, I already have a request from Kees for linux-mm addition, so that should show up in archives before long. -K ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-06-26 17:39 ` incoming Konstantin Ryabitsev @ 2020-06-26 17:40 ` Konstantin Ryabitsev 0 siblings, 0 replies; 322+ messages in thread From: Konstantin Ryabitsev @ 2020-06-26 17:40 UTC (permalink / raw) To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits On Fri, 26 Jun 2020 at 13:39, Konstantin Ryabitsev <konstantin@linuxfoundation.org> wrote: > > Konstantin, maybe mm-commits could be on lore too and then they'd have > > been caught that way? > > Yes, I already have a request from Kees for linux-mm addition, so that > should show up in archives before long. correction: mm-commits, that is -K ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-06-12 0:30 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-06-12 0:30 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits A few fixes and stragglers. 5 patches, based on 623f6dc593eaf98b91916836785278eddddaacf8. Subsystems affected by this patch series: mm/memory-failure ocfs2 lib/lzo misc Subsystem: mm/memory-failure Naoya Horiguchi <nao.horiguchi@gmail.com>: Patch series "hwpoison: fixes signaling on memory error": mm/memory-failure: prioritize prctl(PR_MCE_KILL) over vm.memory_failure_early_kill mm/memory-failure: send SIGBUS(BUS_MCEERR_AR) only to current thread Subsystem: ocfs2 Tom Seewald <tseewald@gmail.com>: ocfs2: fix build failure when TCP/IP is disabled Subsystem: lib/lzo Dave Rodgman <dave.rodgman@arm.com>: lib/lzo: fix ambiguous encoding bug in lzo-rle Subsystem: misc Christoph Hellwig <hch@lst.de>: amdgpu: a NULL ->mm does not mean a thread is a kthread Documentation/lzo.txt | 8 ++++- drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 2 - fs/ocfs2/Kconfig | 2 - lib/lzo/lzo1x_compress.c | 13 ++++++++ mm/memory-failure.c | 43 +++++++++++++++++------------ 5 files changed, 47 insertions(+), 21 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-06-11 1:40 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-06-11 1:40 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - various hotfixes and minor things - hch's use_mm/unuse_mm clearnups - new syscall process_madvise(): perform madvise() on a process other than self 25 patches, based on 6f630784cc0d92fb58ea326e2bc01aa056279ecb. Subsystems affected by this patch series: mm/hugetlb scripts kcov lib nilfs checkpatch lib mm/debug ocfs2 lib misc mm/madvise Subsystem: mm/hugetlb Dan Carpenter <dan.carpenter@oracle.com>: khugepaged: selftests: fix timeout condition in wait_for_scan() Subsystem: scripts SeongJae Park <sjpark@amazon.de>: scripts/spelling: add a few more typos Subsystem: kcov Andrey Konovalov <andreyknvl@google.com>: kcov: check kcov_softirq in kcov_remote_stop() Subsystem: lib Joe Perches <joe@perches.com>: lib/lz4/lz4_decompress.c: document deliberate use of `&' Subsystem: nilfs Ryusuke Konishi <konishi.ryusuke@gmail.com>: nilfs2: fix null pointer dereference at nilfs_segctor_do_construct() Subsystem: checkpatch Tim Froidcoeur <tim.froidcoeur@tessares.net>: checkpatch: correct check for kernel parameters doc Subsystem: lib Alexander Gordeev <agordeev@linux.ibm.com>: lib: fix bitmap_parse() on 64-bit big endian archs Subsystem: mm/debug "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/debug_vm_pgtable: fix kernel crash by checking for THP support Subsystem: ocfs2 Keyur Patel <iamkeyur96@gmail.com>: ocfs2: fix spelling mistake and grammar Ben Widawsky <ben.widawsky@intel.com>: mm: add comments on pglist_data zones Subsystem: lib Wei Yang <richard.weiyang@gmail.com>: lib: test get_count_order/long in test_bitops.c Subsystem: misc Walter Wu <walter-zh.wu@mediatek.com>: stacktrace: cleanup inconsistent variable type Christoph Hellwig <hch@lst.de>: Patch series "improve use_mm / unuse_mm", v2: kernel: move use_mm/unuse_mm to kthread.c kernel: move use_mm/unuse_mm to kthread.c kernel: better document the use_mm/unuse_mm API contract kernel: set USER_DS in kthread_use_mm Subsystem: mm/madvise Minchan Kim <minchan@kernel.org>: Patch series "introduce memory hinting API for external process", v7: mm/madvise: pass task and mm to do_madvise mm/madvise: introduce process_madvise() syscall: an external memory hinting API mm/madvise: check fatal signal pending of target process pid: move pidfd_get_pid() to pid.c mm/madvise: support both pid and pidfd for process_madvise Oleksandr Natalenko <oleksandr@redhat.com>: mm/madvise: allow KSM hints for remote API Minchan Kim <minchan@kernel.org>: mm: support vector address ranges for process_madvise mm: use only pidfd for process_madvise syscall YueHaibing <yuehaibing@huawei.com>: mm/madvise.c: remove duplicated include arch/alpha/kernel/syscalls/syscall.tbl | 1 arch/arm/tools/syscall.tbl | 1 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 4 arch/ia64/kernel/syscalls/syscall.tbl | 1 arch/m68k/kernel/syscalls/syscall.tbl | 1 arch/microblaze/kernel/syscalls/syscall.tbl | 1 arch/mips/kernel/syscalls/syscall_n32.tbl | 3 arch/mips/kernel/syscalls/syscall_n64.tbl | 1 arch/mips/kernel/syscalls/syscall_o32.tbl | 3 arch/parisc/kernel/syscalls/syscall.tbl | 3 arch/powerpc/kernel/syscalls/syscall.tbl | 3 arch/powerpc/platforms/powernv/vas-fault.c | 4 arch/s390/kernel/syscalls/syscall.tbl | 3 arch/sh/kernel/syscalls/syscall.tbl | 1 arch/sparc/kernel/syscalls/syscall.tbl | 3 arch/x86/entry/syscalls/syscall_32.tbl | 3 arch/x86/entry/syscalls/syscall_64.tbl | 5 arch/xtensa/kernel/syscalls/syscall.tbl | 1 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 5 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_arcturus.c | 1 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v10.c | 1 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v9.c | 2 drivers/gpu/drm/i915/gvt/kvmgt.c | 2 drivers/usb/gadget/function/f_fs.c | 10 drivers/usb/gadget/legacy/inode.c | 6 drivers/vfio/vfio_iommu_type1.c | 6 drivers/vhost/vhost.c | 8 fs/aio.c | 1 fs/io-wq.c | 15 - fs/io_uring.c | 11 fs/nilfs2/segment.c | 2 fs/ocfs2/mmap.c | 2 include/linux/compat.h | 10 include/linux/kthread.h | 9 include/linux/mm.h | 3 include/linux/mmu_context.h | 5 include/linux/mmzone.h | 14 include/linux/pid.h | 1 include/linux/stacktrace.h | 2 include/linux/syscalls.h | 16 - include/uapi/asm-generic/unistd.h | 7 kernel/exit.c | 17 - kernel/kcov.c | 26 + kernel/kthread.c | 95 +++++- kernel/pid.c | 17 + kernel/sys_ni.c | 2 lib/Kconfig.debug | 10 lib/bitmap.c | 9 lib/lz4/lz4_decompress.c | 3 lib/test_bitops.c | 53 +++ mm/Makefile | 2 mm/debug_vm_pgtable.c | 6 mm/madvise.c | 295 ++++++++++++++------ mm/mmu_context.c | 64 ---- mm/oom_kill.c | 6 mm/vmacache.c | 4 scripts/checkpatch.pl | 4 scripts/spelling.txt | 9 tools/testing/selftests/vm/khugepaged.c | 2 62 files changed, 526 insertions(+), 285 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-06-09 4:29 Andrew Morton 2020-06-09 16:58 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2020-06-09 4:29 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - a kernel-wide sweep of show_stack() - pagetable cleanups - abstract out accesses to mmap_sem - prep for mmap_sem scalability work - hch's user acess work 93 patches, based on abfbb29297c27e3f101f348dc9e467b0fe70f919: Subsystems affected by this patch series: debug mm/pagemap mm/maccess mm/documentation Subsystem: debug Dmitry Safonov <dima@arista.com>: Patch series "Add log level to show_stack()", v3: kallsyms/printk: add loglvl to print_ip_sym() alpha: add show_stack_loglvl() arc: add show_stack_loglvl() arm/asm: add loglvl to c_backtrace() arm: add loglvl to unwind_backtrace() arm: add loglvl to dump_backtrace() arm: wire up dump_backtrace_{entry,stm} arm: add show_stack_loglvl() arm64: add loglvl to dump_backtrace() arm64: add show_stack_loglvl() c6x: add show_stack_loglvl() csky: add show_stack_loglvl() h8300: add show_stack_loglvl() hexagon: add show_stack_loglvl() ia64: pass log level as arg into ia64_do_show_stack() ia64: add show_stack_loglvl() m68k: add show_stack_loglvl() microblaze: add loglvl to microblaze_unwind_inner() microblaze: add loglvl to microblaze_unwind() microblaze: add show_stack_loglvl() mips: add show_stack_loglvl() nds32: add show_stack_loglvl() nios2: add show_stack_loglvl() openrisc: add show_stack_loglvl() parisc: add show_stack_loglvl() powerpc: add show_stack_loglvl() riscv: add show_stack_loglvl() s390: add show_stack_loglvl() sh: add loglvl to dump_mem() sh: remove needless printk() sh: add loglvl to printk_address() sh: add loglvl to show_trace() sh: add show_stack_loglvl() sparc: add show_stack_loglvl() um/sysrq: remove needless variable sp um: add show_stack_loglvl() unicore32: remove unused pmode argument in c_backtrace() unicore32: add loglvl to c_backtrace() unicore32: add show_stack_loglvl() x86: add missing const qualifiers for log_lvl x86: add show_stack_loglvl() xtensa: add loglvl to show_trace() xtensa: add show_stack_loglvl() sysrq: use show_stack_loglvl() x86/amd_gart: print stacktrace for a leak with KERN_ERR power: use show_stack_loglvl() kdb: don't play with console_loglevel sched: print stack trace with KERN_INFO kernel: use show_stack_loglvl() kernel: rename show_stack_loglvl() => show_stack() Subsystem: mm/pagemap Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: consolidate definitions of page table accessors", v2: mm: don't include asm/pgtable.h if linux/mm.h is already included mm: introduce include/linux/pgtable.h mm: reorder includes after introduction of linux/pgtable.h csky: replace definitions of __pXd_offset() with pXd_index() m68k/mm/motorola: move comment about page table allocation funcitons m68k/mm: move {cache,nocahe}_page() definitions close to their user x86/mm: simplify init_trampoline() and surrounding logic mm: pgtable: add shortcuts for accessing kernel PMD and PTE mm: consolidate pte_index() and pte_offset_*() definitions Michel Lespinasse <walken@google.com>: mmap locking API: initial implementation as rwsem wrappers MMU notifier: use the new mmap locking API DMA reservations: use the new mmap locking API mmap locking API: use coccinelle to convert mmap_sem rwsem call sites mmap locking API: convert mmap_sem call sites missed by coccinelle mmap locking API: convert nested write lock sites mmap locking API: add mmap_read_trylock_non_owner() mmap locking API: add MMAP_LOCK_INITIALIZER mmap locking API: add mmap_assert_locked() and mmap_assert_write_locked() mmap locking API: rename mmap_sem to mmap_lock mmap locking API: convert mmap_sem API comments mmap locking API: convert mmap_sem comments Subsystem: mm/maccess Christoph Hellwig <hch@lst.de>: Patch series "clean up and streamline probe_kernel_* and friends", v4: maccess: unexport probe_kernel_write() maccess: remove various unused weak aliases maccess: remove duplicate kerneldoc comments maccess: clarify kerneldoc comments maccess: update the top of file comment maccess: rename strncpy_from_unsafe_user to strncpy_from_user_nofault maccess: rename strncpy_from_unsafe_strict to strncpy_from_kernel_nofault maccess: rename strnlen_unsafe_user to strnlen_user_nofault maccess: remove probe_read_common and probe_write_common maccess: unify the probe kernel arch hooks bpf: factor out a bpf_trace_copy_string helper bpf: handle the compat string in bpf_trace_copy_string better Andrew Morton <akpm@linux-foundation.org>: bpf:bpf_seq_printf(): handle potentially unsafe format string better Christoph Hellwig <hch@lst.de>: bpf: rework the compat kernel probe handling tracing/kprobes: handle mixed kernel/userspace probes better maccess: remove strncpy_from_unsafe maccess: always use strict semantics for probe_kernel_read maccess: move user access routines together maccess: allow architectures to provide kernel probing directly x86: use non-set_fs based maccess routines maccess: return -ERANGE when probe_kernel_read() fails Subsystem: mm/documentation Luis Chamberlain <mcgrof@kernel.org>: include/linux/cache.h: expand documentation over __read_mostly Documentation/admin-guide/mm/numa_memory_policy.rst | 10 Documentation/admin-guide/mm/userfaultfd.rst | 2 Documentation/filesystems/locking.rst | 2 Documentation/vm/hmm.rst | 6 Documentation/vm/transhuge.rst | 4 arch/alpha/boot/bootp.c | 1 arch/alpha/boot/bootpz.c | 1 arch/alpha/boot/main.c | 1 arch/alpha/include/asm/io.h | 1 arch/alpha/include/asm/pgtable.h | 16 arch/alpha/kernel/process.c | 1 arch/alpha/kernel/proto.h | 4 arch/alpha/kernel/ptrace.c | 1 arch/alpha/kernel/setup.c | 1 arch/alpha/kernel/smp.c | 1 arch/alpha/kernel/sys_alcor.c | 1 arch/alpha/kernel/sys_cabriolet.c | 1 arch/alpha/kernel/sys_dp264.c | 1 arch/alpha/kernel/sys_eb64p.c | 1 arch/alpha/kernel/sys_eiger.c | 1 arch/alpha/kernel/sys_jensen.c | 1 arch/alpha/kernel/sys_marvel.c | 1 arch/alpha/kernel/sys_miata.c | 1 arch/alpha/kernel/sys_mikasa.c | 1 arch/alpha/kernel/sys_nautilus.c | 1 arch/alpha/kernel/sys_noritake.c | 1 arch/alpha/kernel/sys_rawhide.c | 1 arch/alpha/kernel/sys_ruffian.c | 1 arch/alpha/kernel/sys_rx164.c | 1 arch/alpha/kernel/sys_sable.c | 1 arch/alpha/kernel/sys_sio.c | 1 arch/alpha/kernel/sys_sx164.c | 1 arch/alpha/kernel/sys_takara.c | 1 arch/alpha/kernel/sys_titan.c | 1 arch/alpha/kernel/sys_wildfire.c | 1 arch/alpha/kernel/traps.c | 40 arch/alpha/mm/fault.c | 12 arch/alpha/mm/init.c | 1 arch/arc/include/asm/bug.h | 3 arch/arc/include/asm/pgtable.h | 24 arch/arc/kernel/process.c | 4 arch/arc/kernel/stacktrace.c | 29 arch/arc/kernel/troubleshoot.c | 6 arch/arc/mm/fault.c | 6 arch/arc/mm/highmem.c | 14 arch/arc/mm/tlbex.S | 4 arch/arm/include/asm/bug.h | 3 arch/arm/include/asm/efi.h | 3 arch/arm/include/asm/fixmap.h | 4 arch/arm/include/asm/idmap.h | 2 arch/arm/include/asm/pgtable-2level.h | 1 arch/arm/include/asm/pgtable-3level.h | 7 arch/arm/include/asm/pgtable-nommu.h | 3 arch/arm/include/asm/pgtable.h | 25 arch/arm/include/asm/traps.h | 3 arch/arm/include/asm/unwind.h | 3 arch/arm/kernel/head.S | 4 arch/arm/kernel/machine_kexec.c | 1 arch/arm/kernel/module.c | 1 arch/arm/kernel/process.c | 4 arch/arm/kernel/ptrace.c | 1 arch/arm/kernel/smp.c | 1 arch/arm/kernel/suspend.c | 4 arch/arm/kernel/swp_emulate.c | 4 arch/arm/kernel/traps.c | 61 arch/arm/kernel/unwind.c | 7 arch/arm/kernel/vdso.c | 2 arch/arm/kernel/vmlinux.lds.S | 4 arch/arm/lib/backtrace-clang.S | 9 arch/arm/lib/backtrace.S | 14 arch/arm/lib/uaccess_with_memcpy.c | 16 arch/arm/mach-ebsa110/core.c | 1 arch/arm/mach-footbridge/common.c | 1 arch/arm/mach-imx/mm-imx21.c | 1 arch/arm/mach-imx/mm-imx27.c | 1 arch/arm/mach-imx/mm-imx3.c | 1 arch/arm/mach-integrator/core.c | 4 arch/arm/mach-iop32x/i2c.c | 1 arch/arm/mach-iop32x/iq31244.c | 1 arch/arm/mach-iop32x/iq80321.c | 1 arch/arm/mach-iop32x/n2100.c | 1 arch/arm/mach-ixp4xx/common.c | 1 arch/arm/mach-keystone/platsmp.c | 4 arch/arm/mach-sa1100/assabet.c | 3 arch/arm/mach-sa1100/hackkit.c | 4 arch/arm/mach-tegra/iomap.h | 2 arch/arm/mach-zynq/common.c | 4 arch/arm/mm/copypage-v4mc.c | 1 arch/arm/mm/copypage-v6.c | 1 arch/arm/mm/copypage-xscale.c | 1 arch/arm/mm/dump.c | 1 arch/arm/mm/fault-armv.c | 1 arch/arm/mm/fault.c | 9 arch/arm/mm/highmem.c | 4 arch/arm/mm/idmap.c | 4 arch/arm/mm/ioremap.c | 31 arch/arm/mm/mm.h | 8 arch/arm/mm/mmu.c | 7 arch/arm/mm/pageattr.c | 1 arch/arm/mm/proc-arm1020.S | 4 arch/arm/mm/proc-arm1020e.S | 4 arch/arm/mm/proc-arm1022.S | 4 arch/arm/mm/proc-arm1026.S | 4 arch/arm/mm/proc-arm720.S | 4 arch/arm/mm/proc-arm740.S | 4 arch/arm/mm/proc-arm7tdmi.S | 4 arch/arm/mm/proc-arm920.S | 4 arch/arm/mm/proc-arm922.S | 4 arch/arm/mm/proc-arm925.S | 4 arch/arm/mm/proc-arm926.S | 4 arch/arm/mm/proc-arm940.S | 4 arch/arm/mm/proc-arm946.S | 4 arch/arm/mm/proc-arm9tdmi.S | 4 arch/arm/mm/proc-fa526.S | 4 arch/arm/mm/proc-feroceon.S | 4 arch/arm/mm/proc-mohawk.S | 4 arch/arm/mm/proc-sa110.S | 4 arch/arm/mm/proc-sa1100.S | 4 arch/arm/mm/proc-v6.S | 4 arch/arm/mm/proc-v7.S | 4 arch/arm/mm/proc-xsc3.S | 4 arch/arm/mm/proc-xscale.S | 4 arch/arm/mm/pv-fixup-asm.S | 4 arch/arm64/include/asm/io.h | 4 arch/arm64/include/asm/kernel-pgtable.h | 2 arch/arm64/include/asm/kvm_mmu.h | 4 arch/arm64/include/asm/mmu_context.h | 4 arch/arm64/include/asm/pgtable.h | 40 arch/arm64/include/asm/stacktrace.h | 3 arch/arm64/include/asm/stage2_pgtable.h | 2 arch/arm64/include/asm/vmap_stack.h | 4 arch/arm64/kernel/acpi.c | 4 arch/arm64/kernel/head.S | 4 arch/arm64/kernel/hibernate.c | 5 arch/arm64/kernel/kaslr.c | 4 arch/arm64/kernel/process.c | 2 arch/arm64/kernel/ptrace.c | 1 arch/arm64/kernel/smp.c | 1 arch/arm64/kernel/suspend.c | 4 arch/arm64/kernel/traps.c | 37 arch/arm64/kernel/vdso.c | 8 arch/arm64/kernel/vmlinux.lds.S | 3 arch/arm64/kvm/mmu.c | 14 arch/arm64/mm/dump.c | 1 arch/arm64/mm/fault.c | 9 arch/arm64/mm/kasan_init.c | 3 arch/arm64/mm/mmu.c | 8 arch/arm64/mm/pageattr.c | 1 arch/arm64/mm/proc.S | 4 arch/c6x/include/asm/pgtable.h | 3 arch/c6x/kernel/traps.c | 28 arch/csky/include/asm/io.h | 2 arch/csky/include/asm/pgtable.h | 37 arch/csky/kernel/module.c | 1 arch/csky/kernel/ptrace.c | 5 arch/csky/kernel/stacktrace.c | 20 arch/csky/kernel/vdso.c | 4 arch/csky/mm/fault.c | 10 arch/csky/mm/highmem.c | 2 arch/csky/mm/init.c | 7 arch/csky/mm/tlb.c | 1 arch/h8300/include/asm/pgtable.h | 1 arch/h8300/kernel/process.c | 1 arch/h8300/kernel/setup.c | 1 arch/h8300/kernel/signal.c | 1 arch/h8300/kernel/traps.c | 26 arch/h8300/mm/fault.c | 1 arch/h8300/mm/init.c | 1 arch/h8300/mm/memory.c | 1 arch/hexagon/include/asm/fixmap.h | 4 arch/hexagon/include/asm/pgtable.h | 55 arch/hexagon/kernel/traps.c | 39 arch/hexagon/kernel/vdso.c | 4 arch/hexagon/mm/uaccess.c | 2 arch/hexagon/mm/vm_fault.c | 9 arch/ia64/include/asm/pgtable.h | 34 arch/ia64/include/asm/ptrace.h | 1 arch/ia64/include/asm/uaccess.h | 2 arch/ia64/kernel/efi.c | 1 arch/ia64/kernel/entry.S | 4 arch/ia64/kernel/head.S | 5 arch/ia64/kernel/irq_ia64.c | 4 arch/ia64/kernel/ivt.S | 4 arch/ia64/kernel/kprobes.c | 4 arch/ia64/kernel/mca.c | 2 arch/ia64/kernel/mca_asm.S | 4 arch/ia64/kernel/perfmon.c | 8 arch/ia64/kernel/process.c | 37 arch/ia64/kernel/ptrace.c | 1 arch/ia64/kernel/relocate_kernel.S | 6 arch/ia64/kernel/setup.c | 4 arch/ia64/kernel/smp.c | 1 arch/ia64/kernel/smpboot.c | 1 arch/ia64/kernel/uncached.c | 4 arch/ia64/kernel/vmlinux.lds.S | 4 arch/ia64/mm/contig.c | 1 arch/ia64/mm/fault.c | 17 arch/ia64/mm/init.c | 12 arch/m68k/68000/m68EZ328.c | 2 arch/m68k/68000/m68VZ328.c | 4 arch/m68k/68000/timers.c | 1 arch/m68k/amiga/config.c | 1 arch/m68k/apollo/config.c | 1 arch/m68k/atari/atasound.c | 1 arch/m68k/atari/stram.c | 1 arch/m68k/bvme6000/config.c | 1 arch/m68k/include/asm/mcf_pgtable.h | 63 arch/m68k/include/asm/motorola_pgalloc.h | 8 arch/m68k/include/asm/motorola_pgtable.h | 84 - arch/m68k/include/asm/pgtable_mm.h | 1 arch/m68k/include/asm/pgtable_no.h | 2 arch/m68k/include/asm/sun3_pgtable.h | 24 arch/m68k/include/asm/sun3xflop.h | 4 arch/m68k/kernel/head.S | 4 arch/m68k/kernel/process.c | 1 arch/m68k/kernel/ptrace.c | 1 arch/m68k/kernel/setup_no.c | 1 arch/m68k/kernel/signal.c | 1 arch/m68k/kernel/sys_m68k.c | 14 arch/m68k/kernel/traps.c | 27 arch/m68k/kernel/uboot.c | 1 arch/m68k/mac/config.c | 1 arch/m68k/mm/fault.c | 10 arch/m68k/mm/init.c | 2 arch/m68k/mm/mcfmmu.c | 1 arch/m68k/mm/motorola.c | 65 arch/m68k/mm/sun3kmap.c | 1 arch/m68k/mm/sun3mmu.c | 1 arch/m68k/mvme147/config.c | 1 arch/m68k/mvme16x/config.c | 1 arch/m68k/q40/config.c | 1 arch/m68k/sun3/config.c | 1 arch/m68k/sun3/dvma.c | 1 arch/m68k/sun3/mmu_emu.c | 1 arch/m68k/sun3/sun3dvma.c | 1 arch/m68k/sun3x/dvma.c | 1 arch/m68k/sun3x/prom.c | 1 arch/microblaze/include/asm/pgalloc.h | 4 arch/microblaze/include/asm/pgtable.h | 23 arch/microblaze/include/asm/uaccess.h | 2 arch/microblaze/include/asm/unwind.h | 3 arch/microblaze/kernel/hw_exception_handler.S | 4 arch/microblaze/kernel/module.c | 4 arch/microblaze/kernel/setup.c | 4 arch/microblaze/kernel/signal.c | 9 arch/microblaze/kernel/stacktrace.c | 4 arch/microblaze/kernel/traps.c | 28 arch/microblaze/kernel/unwind.c | 46 arch/microblaze/mm/fault.c | 17 arch/microblaze/mm/init.c | 9 arch/microblaze/mm/pgtable.c | 4 arch/mips/fw/arc/memory.c | 1 arch/mips/include/asm/fixmap.h | 3 arch/mips/include/asm/mach-generic/floppy.h | 1 arch/mips/include/asm/mach-jazz/floppy.h | 1 arch/mips/include/asm/pgtable-32.h | 22 arch/mips/include/asm/pgtable-64.h | 32 arch/mips/include/asm/pgtable.h | 2 arch/mips/jazz/irq.c | 4 arch/mips/jazz/jazzdma.c | 1 arch/mips/jazz/setup.c | 4 arch/mips/kernel/module.c | 1 arch/mips/kernel/process.c | 1 arch/mips/kernel/ptrace.c | 1 arch/mips/kernel/ptrace32.c | 1 arch/mips/kernel/smp-bmips.c | 1 arch/mips/kernel/traps.c | 58 arch/mips/kernel/vdso.c | 4 arch/mips/kvm/mips.c | 4 arch/mips/kvm/mmu.c | 20 arch/mips/kvm/tlb.c | 1 arch/mips/kvm/trap_emul.c | 2 arch/mips/lib/dump_tlb.c | 1 arch/mips/lib/r3k_dump_tlb.c | 1 arch/mips/mm/c-octeon.c | 1 arch/mips/mm/c-r3k.c | 11 arch/mips/mm/c-r4k.c | 11 arch/mips/mm/c-tx39.c | 11 arch/mips/mm/fault.c | 12 arch/mips/mm/highmem.c | 2 arch/mips/mm/init.c | 1 arch/mips/mm/page.c | 1 arch/mips/mm/pgtable-32.c | 1 arch/mips/mm/pgtable-64.c | 1 arch/mips/mm/sc-ip22.c | 1 arch/mips/mm/sc-mips.c | 1 arch/mips/mm/sc-r5k.c | 1 arch/mips/mm/tlb-r3k.c | 1 arch/mips/mm/tlb-r4k.c | 1 arch/mips/mm/tlbex.c | 4 arch/mips/sgi-ip27/ip27-init.c | 1 arch/mips/sgi-ip27/ip27-timer.c | 1 arch/mips/sgi-ip32/ip32-memory.c | 1 arch/nds32/include/asm/highmem.h | 3 arch/nds32/include/asm/pgtable.h | 22 arch/nds32/kernel/head.S | 4 arch/nds32/kernel/module.c | 2 arch/nds32/kernel/traps.c | 33 arch/nds32/kernel/vdso.c | 6 arch/nds32/mm/fault.c | 17 arch/nds32/mm/init.c | 13 arch/nds32/mm/proc.c | 7 arch/nios2/include/asm/pgtable.h | 24 arch/nios2/kernel/module.c | 1 arch/nios2/kernel/nios2_ksyms.c | 4 arch/nios2/kernel/traps.c | 35 arch/nios2/mm/fault.c | 14 arch/nios2/mm/init.c | 5 arch/nios2/mm/pgtable.c | 1 arch/nios2/mm/tlb.c | 1 arch/openrisc/include/asm/io.h | 3 arch/openrisc/include/asm/pgtable.h | 33 arch/openrisc/include/asm/tlbflush.h | 1 arch/openrisc/kernel/asm-offsets.c | 1 arch/openrisc/kernel/entry.S | 4 arch/openrisc/kernel/head.S | 4 arch/openrisc/kernel/or32_ksyms.c | 4 arch/openrisc/kernel/process.c | 1 arch/openrisc/kernel/ptrace.c | 1 arch/openrisc/kernel/setup.c | 1 arch/openrisc/kernel/traps.c | 27 arch/openrisc/mm/fault.c | 12 arch/openrisc/mm/init.c | 1 arch/openrisc/mm/ioremap.c | 4 arch/openrisc/mm/tlb.c | 1 arch/parisc/include/asm/io.h | 2 arch/parisc/include/asm/mmu_context.h | 1 arch/parisc/include/asm/pgtable.h | 33 arch/parisc/kernel/asm-offsets.c | 4 arch/parisc/kernel/entry.S | 4 arch/parisc/kernel/head.S | 4 arch/parisc/kernel/module.c | 1 arch/parisc/kernel/pacache.S | 4 arch/parisc/kernel/pci-dma.c | 2 arch/parisc/kernel/pdt.c | 4 arch/parisc/kernel/ptrace.c | 1 arch/parisc/kernel/smp.c | 1 arch/parisc/kernel/traps.c | 42 arch/parisc/lib/memcpy.c | 14 arch/parisc/mm/fault.c | 10 arch/parisc/mm/fixmap.c | 6 arch/parisc/mm/init.c | 1 arch/powerpc/include/asm/book3s/32/pgtable.h | 20 arch/powerpc/include/asm/book3s/64/pgtable.h | 43 arch/powerpc/include/asm/fixmap.h | 4 arch/powerpc/include/asm/io.h | 1 arch/powerpc/include/asm/kup.h | 2 arch/powerpc/include/asm/nohash/32/pgtable.h | 17 arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 4 arch/powerpc/include/asm/nohash/64/pgtable.h | 22 arch/powerpc/include/asm/nohash/pgtable.h | 2 arch/powerpc/include/asm/pgtable.h | 28 arch/powerpc/include/asm/pkeys.h | 2 arch/powerpc/include/asm/tlb.h | 2 arch/powerpc/kernel/asm-offsets.c | 1 arch/powerpc/kernel/btext.c | 4 arch/powerpc/kernel/fpu.S | 3 arch/powerpc/kernel/head_32.S | 4 arch/powerpc/kernel/head_40x.S | 4 arch/powerpc/kernel/head_44x.S | 4 arch/powerpc/kernel/head_8xx.S | 4 arch/powerpc/kernel/head_fsl_booke.S | 4 arch/powerpc/kernel/io-workarounds.c | 4 arch/powerpc/kernel/irq.c | 4 arch/powerpc/kernel/mce_power.c | 4 arch/powerpc/kernel/paca.c | 4 arch/powerpc/kernel/process.c | 30 arch/powerpc/kernel/prom.c | 4 arch/powerpc/kernel/prom_init.c | 4 arch/powerpc/kernel/rtas_pci.c | 4 arch/powerpc/kernel/setup-common.c | 4 arch/powerpc/kernel/setup_32.c | 4 arch/powerpc/kernel/setup_64.c | 4 arch/powerpc/kernel/signal_32.c | 1 arch/powerpc/kernel/signal_64.c | 1 arch/powerpc/kernel/smp.c | 4 arch/powerpc/kernel/stacktrace.c | 2 arch/powerpc/kernel/traps.c | 1 arch/powerpc/kernel/vdso.c | 7 arch/powerpc/kvm/book3s_64_mmu_radix.c | 4 arch/powerpc/kvm/book3s_hv.c | 6 arch/powerpc/kvm/book3s_hv_nested.c | 4 arch/powerpc/kvm/book3s_hv_rm_xics.c | 4 arch/powerpc/kvm/book3s_hv_rm_xive.c | 4 arch/powerpc/kvm/book3s_hv_uvmem.c | 18 arch/powerpc/kvm/e500_mmu_host.c | 4 arch/powerpc/kvm/fpu.S | 4 arch/powerpc/lib/code-patching.c | 1 arch/powerpc/mm/book3s32/hash_low.S | 4 arch/powerpc/mm/book3s32/mmu.c | 2 arch/powerpc/mm/book3s32/tlb.c | 6 arch/powerpc/mm/book3s64/hash_hugetlbpage.c | 1 arch/powerpc/mm/book3s64/hash_native.c | 4 arch/powerpc/mm/book3s64/hash_pgtable.c | 5 arch/powerpc/mm/book3s64/hash_utils.c | 4 arch/powerpc/mm/book3s64/iommu_api.c | 4 arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 1 arch/powerpc/mm/book3s64/radix_pgtable.c | 1 arch/powerpc/mm/book3s64/slb.c | 4 arch/powerpc/mm/book3s64/subpage_prot.c | 16 arch/powerpc/mm/copro_fault.c | 4 arch/powerpc/mm/fault.c | 23 arch/powerpc/mm/hugetlbpage.c | 1 arch/powerpc/mm/init-common.c | 4 arch/powerpc/mm/init_32.c | 1 arch/powerpc/mm/init_64.c | 1 arch/powerpc/mm/kasan/8xx.c | 4 arch/powerpc/mm/kasan/book3s_32.c | 2 arch/powerpc/mm/kasan/kasan_init_32.c | 8 arch/powerpc/mm/mem.c | 1 arch/powerpc/mm/nohash/40x.c | 5 arch/powerpc/mm/nohash/8xx.c | 2 arch/powerpc/mm/nohash/fsl_booke.c | 1 arch/powerpc/mm/nohash/tlb_low_64e.S | 4 arch/powerpc/mm/pgtable.c | 2 arch/powerpc/mm/pgtable_32.c | 5 arch/powerpc/mm/pgtable_64.c | 1 arch/powerpc/mm/ptdump/8xx.c | 2 arch/powerpc/mm/ptdump/bats.c | 4 arch/powerpc/mm/ptdump/book3s64.c | 2 arch/powerpc/mm/ptdump/hashpagetable.c | 1 arch/powerpc/mm/ptdump/ptdump.c | 1 arch/powerpc/mm/ptdump/shared.c | 2 arch/powerpc/oprofile/cell/spu_task_sync.c | 6 arch/powerpc/perf/callchain.c | 1 arch/powerpc/perf/callchain_32.c | 1 arch/powerpc/perf/callchain_64.c | 1 arch/powerpc/platforms/85xx/corenet_generic.c | 4 arch/powerpc/platforms/85xx/mpc85xx_cds.c | 4 arch/powerpc/platforms/85xx/qemu_e500.c | 4 arch/powerpc/platforms/85xx/sbc8548.c | 4 arch/powerpc/platforms/85xx/smp.c | 4 arch/powerpc/platforms/86xx/mpc86xx_smp.c | 4 arch/powerpc/platforms/8xx/cpm1.c | 1 arch/powerpc/platforms/8xx/micropatch.c | 1 arch/powerpc/platforms/cell/cbe_regs.c | 4 arch/powerpc/platforms/cell/interrupt.c | 4 arch/powerpc/platforms/cell/pervasive.c | 4 arch/powerpc/platforms/cell/setup.c | 1 arch/powerpc/platforms/cell/smp.c | 4 arch/powerpc/platforms/cell/spider-pic.c | 4 arch/powerpc/platforms/cell/spufs/file.c | 10 arch/powerpc/platforms/chrp/pci.c | 4 arch/powerpc/platforms/chrp/setup.c | 1 arch/powerpc/platforms/chrp/smp.c | 4 arch/powerpc/platforms/maple/setup.c | 1 arch/powerpc/platforms/maple/time.c | 1 arch/powerpc/platforms/powermac/setup.c | 1 arch/powerpc/platforms/powermac/smp.c | 4 arch/powerpc/platforms/powermac/time.c | 1 arch/powerpc/platforms/pseries/lpar.c | 4 arch/powerpc/platforms/pseries/setup.c | 1 arch/powerpc/platforms/pseries/smp.c | 4 arch/powerpc/sysdev/cpm2.c | 1 arch/powerpc/sysdev/fsl_85xx_cache_sram.c | 2 arch/powerpc/sysdev/mpic.c | 4 arch/powerpc/xmon/xmon.c | 1 arch/riscv/include/asm/fixmap.h | 4 arch/riscv/include/asm/io.h | 4 arch/riscv/include/asm/kasan.h | 4 arch/riscv/include/asm/pgtable-64.h | 7 arch/riscv/include/asm/pgtable.h | 22 arch/riscv/kernel/module.c | 2 arch/riscv/kernel/setup.c | 1 arch/riscv/kernel/soc.c | 2 arch/riscv/kernel/stacktrace.c | 23 arch/riscv/kernel/vdso.c | 4 arch/riscv/mm/cacheflush.c | 3 arch/riscv/mm/fault.c | 14 arch/riscv/mm/init.c | 31 arch/riscv/mm/kasan_init.c | 4 arch/riscv/mm/pageattr.c | 6 arch/riscv/mm/ptdump.c | 2 arch/s390/boot/ipl_parm.c | 4 arch/s390/boot/kaslr.c | 4 arch/s390/include/asm/hugetlb.h | 4 arch/s390/include/asm/kasan.h | 4 arch/s390/include/asm/pgtable.h | 15 arch/s390/include/asm/tlbflush.h | 1 arch/s390/kernel/asm-offsets.c | 4 arch/s390/kernel/dumpstack.c | 25 arch/s390/kernel/machine_kexec.c | 1 arch/s390/kernel/ptrace.c | 1 arch/s390/kernel/uv.c | 4 arch/s390/kernel/vdso.c | 5 arch/s390/kvm/gaccess.c | 8 arch/s390/kvm/interrupt.c | 4 arch/s390/kvm/kvm-s390.c | 32 arch/s390/kvm/priv.c | 38 arch/s390/mm/dump_pagetables.c | 1 arch/s390/mm/extmem.c | 4 arch/s390/mm/fault.c | 17 arch/s390/mm/gmap.c | 80 arch/s390/mm/init.c | 1 arch/s390/mm/kasan_init.c | 4 arch/s390/mm/pageattr.c | 13 arch/s390/mm/pgalloc.c | 2 arch/s390/mm/pgtable.c | 1 arch/s390/mm/vmem.c | 1 arch/s390/pci/pci_mmio.c | 4 arch/sh/include/asm/io.h | 2 arch/sh/include/asm/kdebug.h | 6 arch/sh/include/asm/pgtable-3level.h | 7 arch/sh/include/asm/pgtable.h | 2 arch/sh/include/asm/pgtable_32.h | 25 arch/sh/include/asm/processor_32.h | 2 arch/sh/kernel/dumpstack.c | 54 arch/sh/kernel/machine_kexec.c | 1 arch/sh/kernel/process_32.c | 2 arch/sh/kernel/ptrace_32.c | 1 arch/sh/kernel/signal_32.c | 1 arch/sh/kernel/sys_sh.c | 6 arch/sh/kernel/traps.c | 4 arch/sh/kernel/vsyscall/vsyscall.c | 4 arch/sh/mm/cache-sh3.c | 1 arch/sh/mm/cache-sh4.c | 11 arch/sh/mm/cache-sh7705.c | 1 arch/sh/mm/fault.c | 16 arch/sh/mm/kmap.c | 5 arch/sh/mm/nommu.c | 1 arch/sh/mm/pmb.c | 4 arch/sparc/include/asm/floppy_32.h | 4 arch/sparc/include/asm/highmem.h | 4 arch/sparc/include/asm/ide.h | 2 arch/sparc/include/asm/io-unit.h | 4 arch/sparc/include/asm/pgalloc_32.h | 4 arch/sparc/include/asm/pgalloc_64.h | 2 arch/sparc/include/asm/pgtable_32.h | 34 arch/sparc/include/asm/pgtable_64.h | 32 arch/sparc/kernel/cpu.c | 4 arch/sparc/kernel/entry.S | 4 arch/sparc/kernel/head_64.S | 4 arch/sparc/kernel/ktlb.S | 4 arch/sparc/kernel/leon_smp.c | 1 arch/sparc/kernel/pci.c | 4 arch/sparc/kernel/process_32.c | 29 arch/sparc/kernel/process_64.c | 3 arch/sparc/kernel/ptrace_32.c | 1 arch/sparc/kernel/ptrace_64.c | 1 arch/sparc/kernel/setup_32.c | 1 arch/sparc/kernel/setup_64.c | 1 arch/sparc/kernel/signal32.c | 1 arch/sparc/kernel/signal_32.c | 1 arch/sparc/kernel/signal_64.c | 1 arch/sparc/kernel/smp_32.c | 1 arch/sparc/kernel/smp_64.c | 1 arch/sparc/kernel/sun4m_irq.c | 4 arch/sparc/kernel/trampoline_64.S | 4 arch/sparc/kernel/traps_32.c | 4 arch/sparc/kernel/traps_64.c | 24 arch/sparc/lib/clear_page.S | 4 arch/sparc/lib/copy_page.S | 2 arch/sparc/mm/fault_32.c | 21 arch/sparc/mm/fault_64.c | 17 arch/sparc/mm/highmem.c | 12 arch/sparc/mm/hugetlbpage.c | 1 arch/sparc/mm/init_32.c | 1 arch/sparc/mm/init_64.c | 7 arch/sparc/mm/io-unit.c | 11 arch/sparc/mm/iommu.c | 9 arch/sparc/mm/tlb.c | 1 arch/sparc/mm/tsb.c | 4 arch/sparc/mm/ultra.S | 4 arch/sparc/vdso/vma.c | 4 arch/um/drivers/mconsole_kern.c | 2 arch/um/include/asm/mmu_context.h | 5 arch/um/include/asm/pgtable-3level.h | 4 arch/um/include/asm/pgtable.h | 69 arch/um/kernel/maccess.c | 12 arch/um/kernel/mem.c | 10 arch/um/kernel/process.c | 1 arch/um/kernel/skas/mmu.c | 3 arch/um/kernel/skas/uaccess.c | 1 arch/um/kernel/sysrq.c | 35 arch/um/kernel/tlb.c | 5 arch/um/kernel/trap.c | 15 arch/um/kernel/um_arch.c | 1 arch/unicore32/include/asm/pgtable.h | 19 arch/unicore32/kernel/hibernate.c | 4 arch/unicore32/kernel/hibernate_asm.S | 4 arch/unicore32/kernel/module.c | 1 arch/unicore32/kernel/setup.h | 4 arch/unicore32/kernel/traps.c | 50 arch/unicore32/lib/backtrace.S | 24 arch/unicore32/mm/alignment.c | 4 arch/unicore32/mm/fault.c | 9 arch/unicore32/mm/mm.h | 10 arch/unicore32/mm/proc-ucv2.S | 4 arch/x86/boot/compressed/kaslr_64.c | 4 arch/x86/entry/vdso/vma.c | 14 arch/x86/events/core.c | 4 arch/x86/include/asm/agp.h | 2 arch/x86/include/asm/asm-prototypes.h | 4 arch/x86/include/asm/efi.h | 4 arch/x86/include/asm/iomap.h | 1 arch/x86/include/asm/kaslr.h | 2 arch/x86/include/asm/mmu.h | 2 arch/x86/include/asm/pgtable-3level.h | 8 arch/x86/include/asm/pgtable.h | 89 - arch/x86/include/asm/pgtable_32.h | 11 arch/x86/include/asm/pgtable_64.h | 4 arch/x86/include/asm/setup.h | 12 arch/x86/include/asm/stacktrace.h | 2 arch/x86/include/asm/uaccess.h | 16 arch/x86/include/asm/xen/hypercall.h | 4 arch/x86/include/asm/xen/page.h | 1 arch/x86/kernel/acpi/boot.c | 4 arch/x86/kernel/acpi/sleep.c | 4 arch/x86/kernel/alternative.c | 1 arch/x86/kernel/amd_gart_64.c | 5 arch/x86/kernel/apic/apic_numachip.c | 4 arch/x86/kernel/cpu/bugs.c | 4 arch/x86/kernel/cpu/common.c | 4 arch/x86/kernel/cpu/intel.c | 4 arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 6 arch/x86/kernel/cpu/resctrl/rdtgroup.c | 6 arch/x86/kernel/crash_core_32.c | 4 arch/x86/kernel/crash_core_64.c | 4 arch/x86/kernel/doublefault_32.c | 1 arch/x86/kernel/dumpstack.c | 21 arch/x86/kernel/early_printk.c | 4 arch/x86/kernel/espfix_64.c | 2 arch/x86/kernel/head64.c | 4 arch/x86/kernel/head_64.S | 4 arch/x86/kernel/i8259.c | 4 arch/x86/kernel/irqinit.c | 4 arch/x86/kernel/kprobes/core.c | 4 arch/x86/kernel/kprobes/opt.c | 4 arch/x86/kernel/ldt.c | 2 arch/x86/kernel/machine_kexec_32.c | 1 arch/x86/kernel/machine_kexec_64.c | 1 arch/x86/kernel/module.c | 1 arch/x86/kernel/paravirt.c | 4 arch/x86/kernel/process_32.c | 1 arch/x86/kernel/process_64.c | 1 arch/x86/kernel/ptrace.c | 1 arch/x86/kernel/reboot.c | 4 arch/x86/kernel/smpboot.c | 4 arch/x86/kernel/tboot.c | 3 arch/x86/kernel/vm86_32.c | 4 arch/x86/kvm/mmu/paging_tmpl.h | 8 arch/x86/mm/cpu_entry_area.c | 4 arch/x86/mm/debug_pagetables.c | 2 arch/x86/mm/dump_pagetables.c | 1 arch/x86/mm/fault.c | 22 arch/x86/mm/init.c | 22 arch/x86/mm/init_32.c | 27 arch/x86/mm/init_64.c | 1 arch/x86/mm/ioremap.c | 4 arch/x86/mm/kasan_init_64.c | 1 arch/x86/mm/kaslr.c | 37 arch/x86/mm/maccess.c | 44 arch/x86/mm/mem_encrypt_boot.S | 2 arch/x86/mm/mmio-mod.c | 4 arch/x86/mm/pat/cpa-test.c | 1 arch/x86/mm/pat/memtype.c | 1 arch/x86/mm/pat/memtype_interval.c | 4 arch/x86/mm/pgtable.c | 1 arch/x86/mm/pgtable_32.c | 1 arch/x86/mm/pti.c | 1 arch/x86/mm/setup_nx.c | 4 arch/x86/platform/efi/efi_32.c | 4 arch/x86/platform/efi/efi_64.c | 1 arch/x86/platform/olpc/olpc_ofw.c | 4 arch/x86/power/cpu.c | 4 arch/x86/power/hibernate.c | 4 arch/x86/power/hibernate_32.c | 4 arch/x86/power/hibernate_64.c | 4 arch/x86/realmode/init.c | 4 arch/x86/um/vdso/vma.c | 4 arch/x86/xen/enlighten_pv.c | 1 arch/x86/xen/grant-table.c | 1 arch/x86/xen/mmu_pv.c | 4 arch/x86/xen/smp_pv.c | 2 arch/xtensa/include/asm/fixmap.h | 12 arch/xtensa/include/asm/highmem.h | 4 arch/xtensa/include/asm/initialize_mmu.h | 2 arch/xtensa/include/asm/mmu_context.h | 4 arch/xtensa/include/asm/pgtable.h | 20 arch/xtensa/kernel/entry.S | 4 arch/xtensa/kernel/process.c | 1 arch/xtensa/kernel/ptrace.c | 1 arch/xtensa/kernel/setup.c | 1 arch/xtensa/kernel/traps.c | 42 arch/xtensa/kernel/vectors.S | 4 arch/xtensa/mm/cache.c | 4 arch/xtensa/mm/fault.c | 12 arch/xtensa/mm/highmem.c | 2 arch/xtensa/mm/ioremap.c | 4 arch/xtensa/mm/kasan_init.c | 10 arch/xtensa/mm/misc.S | 4 arch/xtensa/mm/mmu.c | 5 drivers/acpi/scan.c | 3 drivers/android/binder_alloc.c | 14 drivers/atm/fore200e.c | 4 drivers/base/power/main.c | 4 drivers/block/z2ram.c | 4 drivers/char/agp/frontend.c | 1 drivers/char/agp/generic.c | 1 drivers/char/bsr.c | 1 drivers/char/mspec.c | 3 drivers/dma-buf/dma-resv.c | 5 drivers/firmware/efi/arm-runtime.c | 4 drivers/firmware/efi/efi.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gpuvm.c | 4 drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c | 10 drivers/gpu/drm/amd/amdkfd/kfd_events.c | 4 drivers/gpu/drm/drm_vm.c | 4 drivers/gpu/drm/etnaviv/etnaviv_gem.c | 2 drivers/gpu/drm/i915/gem/i915_gem_mman.c | 4 drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 14 drivers/gpu/drm/i915/i915_mm.c | 1 drivers/gpu/drm/i915/i915_perf.c | 2 drivers/gpu/drm/nouveau/nouveau_svm.c | 22 drivers/gpu/drm/radeon/radeon_cs.c | 4 drivers/gpu/drm/radeon/radeon_gem.c | 6 drivers/gpu/drm/ttm/ttm_bo_vm.c | 10 drivers/infiniband/core/umem_odp.c | 4 drivers/infiniband/core/uverbs_main.c | 6 drivers/infiniband/hw/hfi1/mmu_rb.c | 2 drivers/infiniband/hw/mlx4/mr.c | 4 drivers/infiniband/hw/qib/qib_file_ops.c | 4 drivers/infiniband/hw/qib/qib_user_pages.c | 6 drivers/infiniband/hw/usnic/usnic_uiom.c | 4 drivers/infiniband/sw/rdmavt/mmap.c | 1 drivers/infiniband/sw/rxe/rxe_mmap.c | 1 drivers/infiniband/sw/siw/siw_mem.c | 4 drivers/iommu/amd_iommu_v2.c | 4 drivers/iommu/intel-svm.c | 4 drivers/macintosh/macio-adb.c | 4 drivers/macintosh/mediabay.c | 4 drivers/macintosh/via-pmu.c | 4 drivers/media/pci/bt8xx/bt878.c | 4 drivers/media/pci/bt8xx/btcx-risc.c | 4 drivers/media/pci/bt8xx/bttv-risc.c | 4 drivers/media/platform/davinci/vpbe_display.c | 1 drivers/media/v4l2-core/v4l2-common.c | 1 drivers/media/v4l2-core/videobuf-core.c | 4 drivers/media/v4l2-core/videobuf-dma-contig.c | 4 drivers/media/v4l2-core/videobuf-dma-sg.c | 10 drivers/media/v4l2-core/videobuf-vmalloc.c | 4 drivers/misc/cxl/cxllib.c | 9 drivers/misc/cxl/fault.c | 4 drivers/misc/genwqe/card_utils.c | 2 drivers/misc/sgi-gru/grufault.c | 25 drivers/misc/sgi-gru/grufile.c | 4 drivers/mtd/ubi/ubi.h | 2 drivers/net/ethernet/amd/7990.c | 4 drivers/net/ethernet/amd/hplance.c | 4 drivers/net/ethernet/amd/mvme147.c | 4 drivers/net/ethernet/amd/sun3lance.c | 4 drivers/net/ethernet/amd/sunlance.c | 4 drivers/net/ethernet/apple/bmac.c | 4 drivers/net/ethernet/apple/mace.c | 4 drivers/net/ethernet/freescale/fs_enet/fs_enet-main.c | 4 drivers/net/ethernet/freescale/fs_enet/mac-fcc.c | 4 drivers/net/ethernet/freescale/fs_enet/mii-fec.c | 4 drivers/net/ethernet/i825xx/82596.c | 4 drivers/net/ethernet/korina.c | 4 drivers/net/ethernet/marvell/pxa168_eth.c | 4 drivers/net/ethernet/natsemi/jazzsonic.c | 4 drivers/net/ethernet/natsemi/macsonic.c | 4 drivers/net/ethernet/natsemi/xtsonic.c | 4 drivers/net/ethernet/sun/sunbmac.c | 4 drivers/net/ethernet/sun/sunhme.c | 1 drivers/net/ethernet/sun/sunqe.c | 4 drivers/oprofile/buffer_sync.c | 12 drivers/sbus/char/flash.c | 1 drivers/sbus/char/uctrl.c | 1 drivers/scsi/53c700.c | 4 drivers/scsi/a2091.c | 1 drivers/scsi/a3000.c | 1 drivers/scsi/arm/cumana_2.c | 4 drivers/scsi/arm/eesox.c | 4 drivers/scsi/arm/powertec.c | 4 drivers/scsi/dpt_i2o.c | 4 drivers/scsi/gvp11.c | 1 drivers/scsi/lasi700.c | 1 drivers/scsi/mac53c94.c | 4 drivers/scsi/mesh.c | 4 drivers/scsi/mvme147.c | 1 drivers/scsi/qlogicpti.c | 4 drivers/scsi/sni_53c710.c | 1 drivers/scsi/zorro_esp.c | 4 drivers/staging/android/ashmem.c | 4 drivers/staging/comedi/comedi_fops.c | 2 drivers/staging/kpc2000/kpc_dma/fileops.c | 4 drivers/staging/media/atomisp/pci/hmm/hmm_bo.c | 4 drivers/tee/optee/call.c | 4 drivers/tty/sysrq.c | 4 drivers/tty/vt/consolemap.c | 2 drivers/vfio/pci/vfio_pci.c | 22 drivers/vfio/vfio_iommu_type1.c | 8 drivers/vhost/vdpa.c | 4 drivers/video/console/newport_con.c | 1 drivers/video/fbdev/acornfb.c | 1 drivers/video/fbdev/atafb.c | 1 drivers/video/fbdev/cirrusfb.c | 1 drivers/video/fbdev/cyber2000fb.c | 1 drivers/video/fbdev/fb-puv3.c | 1 drivers/video/fbdev/hitfb.c | 1 drivers/video/fbdev/neofb.c | 1 drivers/video/fbdev/q40fb.c | 1 drivers/video/fbdev/savage/savagefb_driver.c | 1 drivers/xen/balloon.c | 1 drivers/xen/gntdev.c | 6 drivers/xen/grant-table.c | 1 drivers/xen/privcmd.c | 15 drivers/xen/xenbus/xenbus_probe.c | 1 drivers/xen/xenbus/xenbus_probe_backend.c | 1 drivers/xen/xenbus/xenbus_probe_frontend.c | 1 fs/aio.c | 4 fs/coredump.c | 8 fs/exec.c | 18 fs/ext2/file.c | 2 fs/ext4/super.c | 6 fs/hugetlbfs/inode.c | 2 fs/io_uring.c | 4 fs/kernfs/file.c | 4 fs/proc/array.c | 1 fs/proc/base.c | 24 fs/proc/meminfo.c | 1 fs/proc/nommu.c | 1 fs/proc/task_mmu.c | 34 fs/proc/task_nommu.c | 18 fs/proc/vmcore.c | 1 fs/userfaultfd.c | 46 fs/xfs/xfs_file.c | 2 fs/xfs/xfs_inode.c | 14 fs/xfs/xfs_iops.c | 4 include/asm-generic/io.h | 2 include/asm-generic/pgtable-nopmd.h | 1 include/asm-generic/pgtable-nopud.h | 1 include/asm-generic/pgtable.h | 1322 ---------------- include/linux/cache.h | 10 include/linux/crash_dump.h | 3 include/linux/dax.h | 1 include/linux/dma-noncoherent.h | 2 include/linux/fs.h | 4 include/linux/hmm.h | 2 include/linux/huge_mm.h | 2 include/linux/hugetlb.h | 2 include/linux/io-mapping.h | 4 include/linux/kallsyms.h | 4 include/linux/kasan.h | 4 include/linux/mempolicy.h | 2 include/linux/mm.h | 15 include/linux/mm_types.h | 4 include/linux/mmap_lock.h | 128 + include/linux/mmu_notifier.h | 13 include/linux/pagemap.h | 2 include/linux/pgtable.h | 1444 +++++++++++++++++- include/linux/rmap.h | 2 include/linux/sched/debug.h | 7 include/linux/sched/mm.h | 10 include/linux/uaccess.h | 62 include/xen/arm/page.h | 4 init/init_task.c | 1 ipc/shm.c | 8 kernel/acct.c | 6 kernel/bpf/stackmap.c | 21 kernel/bpf/syscall.c | 2 kernel/cgroup/cpuset.c | 4 kernel/debug/kdb/kdb_bt.c | 17 kernel/events/core.c | 10 kernel/events/uprobes.c | 20 kernel/exit.c | 11 kernel/fork.c | 15 kernel/futex.c | 4 kernel/locking/lockdep.c | 4 kernel/locking/rtmutex-debug.c | 4 kernel/power/snapshot.c | 1 kernel/relay.c | 2 kernel/sched/core.c | 10 kernel/sched/fair.c | 4 kernel/sys.c | 22 kernel/trace/bpf_trace.c | 176 +- kernel/trace/ftrace.c | 8 kernel/trace/trace_kprobe.c | 80 kernel/trace/trace_output.c | 4 lib/dump_stack.c | 4 lib/ioremap.c | 1 lib/test_hmm.c | 14 lib/test_lockup.c | 16 mm/debug.c | 10 mm/debug_vm_pgtable.c | 1 mm/filemap.c | 46 mm/frame_vector.c | 6 mm/gup.c | 73 mm/hmm.c | 2 mm/huge_memory.c | 8 mm/hugetlb.c | 3 mm/init-mm.c | 6 mm/internal.h | 6 mm/khugepaged.c | 72 mm/ksm.c | 48 mm/maccess.c | 496 +++--- mm/madvise.c | 40 mm/memcontrol.c | 10 mm/memory.c | 61 mm/mempolicy.c | 36 mm/migrate.c | 16 mm/mincore.c | 8 mm/mlock.c | 22 mm/mmap.c | 74 mm/mmu_gather.c | 2 mm/mmu_notifier.c | 22 mm/mprotect.c | 22 mm/mremap.c | 14 mm/msync.c | 8 mm/nommu.c | 22 mm/oom_kill.c | 14 mm/page_io.c | 1 mm/page_reporting.h | 2 mm/pagewalk.c | 12 mm/pgtable-generic.c | 6 mm/process_vm_access.c | 4 mm/ptdump.c | 4 mm/rmap.c | 12 mm/shmem.c | 5 mm/sparse-vmemmap.c | 1 mm/sparse.c | 1 mm/swap_state.c | 5 mm/swapfile.c | 5 mm/userfaultfd.c | 26 mm/util.c | 12 mm/vmacache.c | 1 mm/zsmalloc.c | 4 net/ipv4/tcp.c | 8 net/xdp/xdp_umem.c | 4 security/keys/keyctl.c | 2 sound/core/oss/pcm_oss.c | 2 sound/core/sgbuf.c | 1 sound/pci/hda/hda_intel.c | 4 sound/soc/intel/common/sst-firmware.c | 4 sound/soc/intel/haswell/sst-haswell-pcm.c | 4 tools/include/linux/kallsyms.h | 2 virt/kvm/async_pf.c | 4 virt/kvm/kvm_main.c | 9 942 files changed, 4580 insertions(+), 5662 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-06-09 4:29 incoming Andrew Morton @ 2020-06-09 16:58 ` Linus Torvalds 0 siblings, 0 replies; 322+ messages in thread From: Linus Torvalds @ 2020-06-09 16:58 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Mon, Jun 8, 2020 at 9:29 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 942 files changed, 4580 insertions(+), 5662 deletions(-) If you use proper tools, add a "-M" to your diff script, so that you see 941 files changed, 2614 insertions(+), 3696 deletions(-) because a big portion of the lines were due to a rename: rename include/{asm-generic => linux}/pgtable.h (91%) but at some earlier point you mentioned "diffstat", so I guess "proper tools" isn't an option ;( Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-06-08 4:35 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-06-08 4:35 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm Various trees. Mainly those parts of MM whose linux-next dependents are now merged. I'm still sitting on ~160 patches which await merges from -next. 54 patches, based on 9aa900c8094dba7a60dc805ecec1e9f720744ba1. Subsystems affected by this patch series: mm/proc ipc dynamic-debug panic lib sysctl mm/gup mm/pagemap Subsystem: mm/proc SeongJae Park <sjpark@amazon.de>: mm/page_idle.c: skip offline pages Subsystem: ipc Jules Irenge <jbi.octave@gmail.com>: ipc/msg: add missing annotation for freeque() Giuseppe Scrivano <gscrivan@redhat.com>: ipc/namespace.c: use a work queue to free_ipc Subsystem: dynamic-debug Orson Zhai <orson.zhai@unisoc.com>: dynamic_debug: add an option to enable dynamic debug for modules only Subsystem: panic Rafael Aquini <aquini@redhat.com>: kernel: add panic_on_taint Subsystem: lib Manfred Spraul <manfred@colorfullife.com>: xarray.h: correct return code documentation for xa_store_{bh,irq}() Subsystem: sysctl Vlastimil Babka <vbabka@suse.cz>: Patch series "support setting sysctl parameters from kernel command line", v3: kernel/sysctl: support setting sysctl parameters from kernel command line kernel/sysctl: support handling command line aliases kernel/hung_task convert hung_task_panic boot parameter to sysctl tools/testing/selftests/sysctl/sysctl.sh: support CONFIG_TEST_SYSCTL=y lib/test_sysctl: support testing of sysctl. boot parameter "Guilherme G. Piccoli" <gpiccoli@canonical.com>: kernel/watchdog.c: convert {soft/hard}lockup boot parameters to sysctl aliases kernel/hung_task.c: introduce sysctl to print all traces when a hung task is detected panic: add sysctl to dump all CPUs backtraces on oops event Rafael Aquini <aquini@redhat.com>: kernel/sysctl.c: ignore out-of-range taint bits introduced via kernel.tainted Subsystem: mm/gup Souptick Joarder <jrdr.linux@gmail.com>: mm/gup.c: convert to use get_user_{page|pages}_fast_only() John Hubbard <jhubbard@nvidia.com>: mm/gup: update pin_user_pages.rst for "case 3" (mmu notifiers) Patch series "mm/gup: introduce pin_user_pages_locked(), use it in frame_vector.c", v2: mm/gup: introduce pin_user_pages_locked() mm/gup: frame_vector: convert get_user_pages() --> pin_user_pages() mm/gup: documentation fix for pin_user_pages*() APIs Patch series "vhost, docs: convert to pin_user_pages(), new "case 5"": docs: mm/gup: pin_user_pages.rst: add a "case 5" vhost: convert get_user_pages() --> pin_user_pages() Subsystem: mm/pagemap Alexander Gordeev <agordeev@linux.ibm.com>: mm/mmap.c: add more sanity checks to get_unmapped_area() mm/mmap.c: do not allow mappings outside of allowed limits Christoph Hellwig <hch@lst.de>: Patch series "sort out the flush_icache_range mess", v2: arm: fix the flush_icache_range arguments in set_fiq_handler nds32: unexport flush_icache_page powerpc: unexport flush_icache_user_range unicore32: remove flush_cache_user_range asm-generic: fix the inclusion guards for cacheflush.h asm-generic: don't include <linux/mm.h> in cacheflush.h asm-generic: improve the flush_dcache_page stub alpha: use asm-generic/cacheflush.h arm64: use asm-generic/cacheflush.h c6x: use asm-generic/cacheflush.h hexagon: use asm-generic/cacheflush.h ia64: use asm-generic/cacheflush.h microblaze: use asm-generic/cacheflush.h m68knommu: use asm-generic/cacheflush.h openrisc: use asm-generic/cacheflush.h powerpc: use asm-generic/cacheflush.h riscv: use asm-generic/cacheflush.h arm,sparc,unicore32: remove flush_icache_user_range mm: rename flush_icache_user_range to flush_icache_user_page asm-generic: add a flush_icache_user_range stub sh: implement flush_icache_user_range xtensa: implement flush_icache_user_range arm: rename flush_cache_user_range to flush_icache_user_range m68k: implement flush_icache_user_range exec: only build read_code when needed exec: use flush_icache_user_range in read_code binfmt_flat: use flush_icache_user_range nommu: use flush_icache_user_range in brk and mmap module: move the set_fs hack for flush_icache_range to m68k Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: doc: cgroup: update note about conditions when oom killer is invoked Documentation/admin-guide/cgroup-v2.rst | 17 +- Documentation/admin-guide/dynamic-debug-howto.rst | 5 Documentation/admin-guide/kdump/kdump.rst | 8 + Documentation/admin-guide/kernel-parameters.txt | 34 +++- Documentation/admin-guide/sysctl/kernel.rst | 37 ++++ Documentation/core-api/pin_user_pages.rst | 47 ++++-- arch/alpha/include/asm/cacheflush.h | 38 +---- arch/alpha/kernel/smp.c | 2 arch/arm/include/asm/cacheflush.h | 7 arch/arm/kernel/fiq.c | 4 arch/arm/kernel/traps.c | 2 arch/arm64/include/asm/cacheflush.h | 46 ------ arch/c6x/include/asm/cacheflush.h | 19 -- arch/hexagon/include/asm/cacheflush.h | 19 -- arch/ia64/include/asm/cacheflush.h | 30 ---- arch/m68k/include/asm/cacheflush_mm.h | 6 arch/m68k/include/asm/cacheflush_no.h | 19 -- arch/m68k/mm/cache.c | 13 + arch/microblaze/include/asm/cacheflush.h | 29 --- arch/nds32/include/asm/cacheflush.h | 4 arch/nds32/mm/cacheflush.c | 3 arch/openrisc/include/asm/cacheflush.h | 33 ---- arch/powerpc/include/asm/cacheflush.h | 46 +----- arch/powerpc/kvm/book3s_64_mmu_hv.c | 2 arch/powerpc/kvm/book3s_64_mmu_radix.c | 2 arch/powerpc/mm/mem.c | 3 arch/powerpc/perf/callchain_64.c | 4 arch/riscv/include/asm/cacheflush.h | 65 -------- arch/sh/include/asm/cacheflush.h | 1 arch/sparc/include/asm/cacheflush_32.h | 2 arch/sparc/include/asm/cacheflush_64.h | 1 arch/um/include/asm/tlb.h | 2 arch/unicore32/include/asm/cacheflush.h | 11 - arch/x86/include/asm/cacheflush.h | 2 arch/xtensa/include/asm/cacheflush.h | 2 drivers/media/platform/omap3isp/ispvideo.c | 2 drivers/nvdimm/pmem.c | 3 drivers/vhost/vhost.c | 5 fs/binfmt_flat.c | 2 fs/exec.c | 5 fs/proc/proc_sysctl.c | 163 ++++++++++++++++++++-- include/asm-generic/cacheflush.h | 25 +-- include/linux/dev_printk.h | 6 include/linux/dynamic_debug.h | 2 include/linux/ipc_namespace.h | 2 include/linux/kernel.h | 9 + include/linux/mm.h | 12 + include/linux/net.h | 3 include/linux/netdevice.h | 6 include/linux/printk.h | 9 - include/linux/sched/sysctl.h | 7 include/linux/sysctl.h | 4 include/linux/xarray.h | 4 include/rdma/ib_verbs.h | 6 init/main.c | 2 ipc/msg.c | 2 ipc/namespace.c | 24 ++- kernel/events/core.c | 4 kernel/events/uprobes.c | 2 kernel/hung_task.c | 30 ++-- kernel/module.c | 8 - kernel/panic.c | 45 ++++++ kernel/sysctl.c | 38 ++++- kernel/watchdog.c | 37 +--- lib/Kconfig.debug | 12 + lib/Makefile | 2 lib/dynamic_debug.c | 9 - lib/test_sysctl.c | 13 + mm/frame_vector.c | 7 mm/gup.c | 74 +++++++-- mm/mmap.c | 28 ++- mm/nommu.c | 4 mm/page_alloc.c | 9 - mm/page_idle.c | 7 tools/testing/selftests/sysctl/sysctl.sh | 44 +++++ virt/kvm/kvm_main.c | 8 - 76 files changed, 732 insertions(+), 517 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-06-04 23:45 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-06-04 23:45 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits - More MM work. 100ish more to go. Mike's "mm: remove __ARCH_HAS_5LEVEL_HACK" series should fix the current ppc issue. - Various other little subsystems 127 patches, based on 6929f71e46bdddbf1c4d67c2728648176c67c555. Subsystems affected by this patch series: kcov mm/pagemap mm/vmalloc mm/kmap mm/util mm/memory-hotplug mm/cleanups mm/zram procfs core-kernel get_maintainer lib bitops checkpatch binfmt init fat seq_file exec rapidio relay selftests ubsan Subsystem: kcov Andrey Konovalov <andreyknvl@google.com>: Patch series "kcov: collect coverage from usb soft interrupts", v4: kcov: cleanup debug messages kcov: fix potential use-after-free in kcov_remote_start kcov: move t->kcov assignments into kcov_start/stop kcov: move t->kcov_sequence assignment kcov: use t->kcov_mode as enabled indicator kcov: collect coverage from interrupts usb: core: kcov: collect coverage from usb complete callback Subsystem: mm/pagemap Feng Tang <feng.tang@intel.com>: mm/util.c: remove the VM_WARN_ONCE for vm_committed_as underflow check Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: remove __ARCH_HAS_5LEVEL_HACK", v4: h8300: remove usage of __ARCH_USE_5LEVEL_HACK arm: add support for folded p4d page tables arm64: add support for folded p4d page tables hexagon: remove __ARCH_USE_5LEVEL_HACK ia64: add support for folded p4d page tables nios2: add support for folded p4d page tables openrisc: add support for folded p4d page tables powerpc: add support for folded p4d page tables Geert Uytterhoeven <geert+renesas@glider.be>: sh: fault: modernize printing of kernel messages Mike Rapoport <rppt@linux.ibm.com>: sh: drop __pXd_offset() macros that duplicate pXd_index() ones sh: add support for folded p4d page tables unicore32: remove __ARCH_USE_5LEVEL_HACK asm-generic: remove pgtable-nop4d-hack.h mm: remove __ARCH_HAS_5LEVEL_HACK and include/asm-generic/5level-fixup.h Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/debug: Add tests validating architecture page table: x86/mm: define mm_p4d_folded() mm/debug: add tests validating architecture page table helpers Subsystem: mm/vmalloc Jeongtae Park <jtp.park@samsung.com>: mm/vmalloc: fix a typo in comment Subsystem: mm/kmap Ira Weiny <ira.weiny@intel.com>: Patch series "Remove duplicated kmap code", v3: arch/kmap: remove BUG_ON() arch/xtensa: move kmap build bug out of the way arch/kmap: remove redundant arch specific kmaps arch/kunmap: remove duplicate kunmap implementations {x86,powerpc,microblaze}/kmap: move preempt disable arch/kmap_atomic: consolidate duplicate code arch/kunmap_atomic: consolidate duplicate code arch/kmap: ensure kmap_prot visibility arch/kmap: don't hard code kmap_prot values arch/kmap: define kmap_atomic_prot() for all arch's drm: remove drm specific kmap_atomic code kmap: remove kmap_atomic_to_page() parisc/kmap: remove duplicate kmap code sparc: remove unnecessary includes kmap: consolidate kmap_prot definitions Subsystem: mm/util Waiman Long <longman@redhat.com>: mm: add kvfree_sensitive() for freeing sensitive data objects Subsystem: mm/memory-hotplug Vishal Verma <vishal.l.verma@intel.com>: mm/memory_hotplug: refrain from adding memory into an impossible node David Hildenbrand <david@redhat.com>: powerpc/pseries/hotplug-memory: stop checking is_mem_section_removable() mm/memory_hotplug: remove is_mem_section_removable() Patch series "mm/memory_hotplug: handle memblocks only with: mm/memory_hotplug: set node_start_pfn of hotadded pgdat to 0 mm/memory_hotplug: handle memblocks only with CONFIG_ARCH_KEEP_MEMBLOCK Patch series "mm/memory_hotplug: Interface to add driver-managed system: mm/memory_hotplug: introduce add_memory_driver_managed() kexec_file: don't place kexec images on IORESOURCE_MEM_DRIVER_MANAGED device-dax: add memory via add_memory_driver_managed() Michal Hocko <mhocko@kernel.org>: mm/memory_hotplug: disable the functionality for 32b Subsystem: mm/cleanups chenqiwu <chenqiwu@xiaomi.com>: mm: replace zero-length array with flexible-array member Ethon Paul <ethp@qq.com>: mm/memory_hotplug: fix a typo in comment "recoreded"->"recorded" mm: ksm: fix a typo in comment "alreaady"->"already" mm: mmap: fix a typo in comment "compatbility"->"compatibility" mm/hugetlb: fix a typos in comments mm/vmsan: fix some typos in comment mm/compaction: fix a typo in comment "pessemistic"->"pessimistic" mm/memblock: fix a typo in comment "implict"->"implicit" mm/list_lru: fix a typo in comment "numbesr"->"numbers" mm/filemap: fix a typo in comment "unneccssary"->"unnecessary" mm/frontswap: fix some typos in frontswap.c mm, memcg: fix some typos in memcontrol.c mm: fix a typo in comment "strucure"->"structure" mm/slub: fix a typo in comment "disambiguiation"->"disambiguation" mm/sparse: fix a typo in comment "convienence"->"convenience" mm/page-writeback: fix a typo in comment "effictive"->"effective" mm/memory: fix a typo in comment "attampt"->"attempt" Zou Wei <zou_wei@huawei.com>: mm: use false for bool variable Jason Yan <yanaijie@huawei.com>: include/linux/mm.h: return true in cpupid_pid_unset() Subsystem: mm/zram Andy Shevchenko <andriy.shevchenko@linux.intel.com>: zcomp: Use ARRAY_SIZE() for backends list Subsystem: procfs Alexey Dobriyan <adobriyan@gmail.com>: proc: rename "catch" function argument Subsystem: core-kernel Jason Yan <yanaijie@huawei.com>: user.c: make uidhash_table static Subsystem: get_maintainer Joe Perches <joe@perches.com>: get_maintainer: add email addresses from .yaml files get_maintainer: fix unexpected behavior for path/to//file (double slashes) Subsystem: lib Christophe JAILLET <christophe.jaillet@wanadoo.fr>: lib/math: avoid trailing newline hidden in pr_fmt() KP Singh <kpsingh@chromium.org>: lib: Add might_fault() to strncpy_from_user. Jason Yan <yanaijie@huawei.com>: lib/test_lockup.c: make test_inode static Jann Horn <jannh@google.com>: lib/zlib: remove outdated and incorrect pre-increment optimization Joe Perches <joe@perches.com>: lib/percpu-refcount.c: use a more common logging style Tan Hu <tan.hu@zte.com.cn>: lib/flex_proportions.c: cleanup __fprop_inc_percpu_max Jesse Brandeburg <jesse.brandeburg@intel.com>: lib: make a test module with set/clear bit Subsystem: bitops Arnd Bergmann <arnd@arndb.de>: include/linux/bitops.h: avoid clang shift-count-overflow warnings Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: additional MAINTAINER section entry ordering checks checkpatch: look for c99 comments in ctx_locate_comment checkpatch: disallow --git and --file/--fix Geert Uytterhoeven <geert+renesas@glider.be>: checkpatch: use patch subject when reading from stdin Subsystem: binfmt Anthony Iliopoulos <ailiop@suse.com>: fs/binfmt_elf: remove redundant elf_map ifndef Nick Desaulniers <ndesaulniers@google.com>: elfnote: mark all .note sections SHF_ALLOC Subsystem: init Chris Down <chris@chrisdown.name>: init: allow distribution configuration of default init Subsystem: fat OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>: fat: don't allow to mount if the FAT length == 0 fat: improve the readahead for FAT entries Subsystem: seq_file Joe Perches <joe@perches.com>: fs/seq_file.c: seq_read: Update pr_info_ratelimited Kefeng Wang <wangkefeng.wang@huawei.com>: Patch series "seq_file: Introduce DEFINE_SEQ_ATTRIBUTE() helper macro": include/linux/seq_file.h: introduce DEFINE_SEQ_ATTRIBUTE() helper macro mm/vmstat.c: convert to use DEFINE_SEQ_ATTRIBUTE macro kernel/kprobes.c: convert to use DEFINE_SEQ_ATTRIBUTE macro Subsystem: exec Christoph Hellwig <hch@lst.de>: exec: simplify the copy_strings_kernel calling convention exec: open code copy_string_kernel Subsystem: rapidio Madhuparna Bhowmik <madhuparnabhowmik10@gmail.com>: rapidio: avoid data race between file operation callbacks and mport_cdev_add(). John Hubbard <jhubbard@nvidia.com>: rapidio: convert get_user_pages() --> pin_user_pages() Subsystem: relay Daniel Axtens <dja@axtens.net>: kernel/relay.c: handle alloc_percpu returning NULL in relay_open Pengcheng Yang <yangpc@wangsu.com>: kernel/relay.c: fix read_pos error when multiple readers Subsystem: selftests Ram Pai <linuxram@us.ibm.com>: Patch series "selftests, powerpc, x86: Memory Protection Keys", v19: selftests/x86/pkeys: move selftests to arch-neutral directory selftests/vm/pkeys: rename all references to pkru to a generic name selftests/vm/pkeys: move generic definitions to header file Thiago Jung Bauermann <bauerman@linux.ibm.com>: selftests/vm/pkeys: move some definitions to arch-specific header selftests/vm/pkeys: make gcc check arguments of sigsafe_printf() Sandipan Das <sandipan@linux.ibm.com>: selftests: vm: pkeys: Use sane types for pkey register selftests: vm: pkeys: add helpers for pkey bits Ram Pai <linuxram@us.ibm.com>: selftests/vm/pkeys: fix pkey_disable_clear() selftests/vm/pkeys: fix assertion in pkey_disable_set/clear() selftests/vm/pkeys: fix alloc_random_pkey() to make it really random Sandipan Das <sandipan@linux.ibm.com>: selftests: vm: pkeys: use the correct huge page size Ram Pai <linuxram@us.ibm.com>: selftests/vm/pkeys: introduce generic pkey abstractions selftests/vm/pkeys: introduce powerpc support "Desnes A. Nunes do Rosario" <desnesn@linux.vnet.ibm.com>: selftests/vm/pkeys: fix number of reserved powerpc pkeys Ram Pai <linuxram@us.ibm.com>: selftests/vm/pkeys: fix assertion in test_pkey_alloc_exhaust() selftests/vm/pkeys: improve checks to determine pkey support selftests/vm/pkeys: associate key on a mapped page and detect access violation selftests/vm/pkeys: associate key on a mapped page and detect write violation selftests/vm/pkeys: detect write violation on a mapped access-denied-key page selftests/vm/pkeys: introduce a sub-page allocator selftests/vm/pkeys: test correct behaviour of pkey-0 selftests/vm/pkeys: override access right definitions on powerpc Sandipan Das <sandipan@linux.ibm.com>: selftests: vm: pkeys: use the correct page size on powerpc selftests: vm: pkeys: fix multilib builds for x86 Jagadeesh Pagadala <jagdsh.linux@gmail.com>: tools/testing/selftests/vm: remove duplicate headers Subsystem: ubsan Arnd Bergmann <arnd@arndb.de>: lib/ubsan.c: fix gcc-10 warnings Documentation/dev-tools/kcov.rst | 17 Documentation/features/debug/debug-vm-pgtable/arch-support.txt | 34 arch/arc/Kconfig | 1 arch/arc/include/asm/highmem.h | 20 arch/arc/mm/highmem.c | 34 arch/arm/include/asm/highmem.h | 9 arch/arm/include/asm/pgtable.h | 1 arch/arm/lib/uaccess_with_memcpy.c | 7 arch/arm/mach-sa1100/assabet.c | 2 arch/arm/mm/dump.c | 29 arch/arm/mm/fault-armv.c | 7 arch/arm/mm/fault.c | 22 arch/arm/mm/highmem.c | 41 arch/arm/mm/idmap.c | 3 arch/arm/mm/init.c | 2 arch/arm/mm/ioremap.c | 12 arch/arm/mm/mm.h | 2 arch/arm/mm/mmu.c | 35 arch/arm/mm/pgd.c | 40 arch/arm64/Kconfig | 1 arch/arm64/include/asm/kvm_mmu.h | 10 arch/arm64/include/asm/pgalloc.h | 10 arch/arm64/include/asm/pgtable-types.h | 5 arch/arm64/include/asm/pgtable.h | 37 arch/arm64/include/asm/stage2_pgtable.h | 48 arch/arm64/kernel/hibernate.c | 44 arch/arm64/kvm/mmu.c | 209 arch/arm64/mm/fault.c | 9 arch/arm64/mm/hugetlbpage.c | 15 arch/arm64/mm/kasan_init.c | 26 arch/arm64/mm/mmu.c | 52 arch/arm64/mm/pageattr.c | 7 arch/csky/include/asm/highmem.h | 12 arch/csky/mm/highmem.c | 64 arch/h8300/include/asm/pgtable.h | 1 arch/hexagon/include/asm/fixmap.h | 4 arch/hexagon/include/asm/pgtable.h | 1 arch/ia64/include/asm/pgalloc.h | 4 arch/ia64/include/asm/pgtable.h | 17 arch/ia64/mm/fault.c | 7 arch/ia64/mm/hugetlbpage.c | 18 arch/ia64/mm/init.c | 28 arch/microblaze/include/asm/highmem.h | 55 arch/microblaze/mm/highmem.c | 21 arch/microblaze/mm/init.c | 3 arch/mips/include/asm/highmem.h | 11 arch/mips/mm/cache.c | 6 arch/mips/mm/highmem.c | 62 arch/nds32/include/asm/highmem.h | 9 arch/nds32/mm/highmem.c | 49 arch/nios2/include/asm/pgtable.h | 3 arch/nios2/mm/fault.c | 9 arch/nios2/mm/ioremap.c | 6 arch/openrisc/include/asm/pgtable.h | 1 arch/openrisc/mm/fault.c | 10 arch/openrisc/mm/init.c | 4 arch/parisc/include/asm/cacheflush.h | 32 arch/powerpc/Kconfig | 1 arch/powerpc/include/asm/book3s/32/pgtable.h | 1 arch/powerpc/include/asm/book3s/64/hash.h | 4 arch/powerpc/include/asm/book3s/64/pgalloc.h | 4 arch/powerpc/include/asm/book3s/64/pgtable.h | 60 arch/powerpc/include/asm/book3s/64/radix.h | 6 arch/powerpc/include/asm/highmem.h | 56 arch/powerpc/include/asm/nohash/32/pgtable.h | 1 arch/powerpc/include/asm/nohash/64/pgalloc.h | 2 arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 32 arch/powerpc/include/asm/nohash/64/pgtable.h | 6 arch/powerpc/include/asm/pgtable.h | 10 arch/powerpc/kvm/book3s_64_mmu_radix.c | 32 arch/powerpc/lib/code-patching.c | 7 arch/powerpc/mm/book3s64/hash_pgtable.c | 4 arch/powerpc/mm/book3s64/radix_pgtable.c | 26 arch/powerpc/mm/book3s64/subpage_prot.c | 6 arch/powerpc/mm/highmem.c | 26 arch/powerpc/mm/hugetlbpage.c | 28 arch/powerpc/mm/kasan/kasan_init_32.c | 2 arch/powerpc/mm/mem.c | 3 arch/powerpc/mm/nohash/book3e_pgtable.c | 15 arch/powerpc/mm/pgtable.c | 30 arch/powerpc/mm/pgtable_64.c | 10 arch/powerpc/mm/ptdump/hashpagetable.c | 20 arch/powerpc/mm/ptdump/ptdump.c | 12 arch/powerpc/platforms/pseries/hotplug-memory.c | 26 arch/powerpc/xmon/xmon.c | 27 arch/s390/Kconfig | 1 arch/sh/include/asm/pgtable-2level.h | 1 arch/sh/include/asm/pgtable-3level.h | 1 arch/sh/include/asm/pgtable_32.h | 5 arch/sh/include/asm/pgtable_64.h | 5 arch/sh/kernel/io_trapped.c | 7 arch/sh/mm/cache-sh4.c | 4 arch/sh/mm/cache-sh5.c | 7 arch/sh/mm/fault.c | 64 arch/sh/mm/hugetlbpage.c | 28 arch/sh/mm/init.c | 15 arch/sh/mm/kmap.c | 2 arch/sh/mm/tlbex_32.c | 6 arch/sh/mm/tlbex_64.c | 7 arch/sparc/include/asm/highmem.h | 29 arch/sparc/mm/highmem.c | 31 arch/sparc/mm/io-unit.c | 1 arch/sparc/mm/iommu.c | 1 arch/unicore32/include/asm/pgtable.h | 1 arch/unicore32/kernel/hibernate.c | 4 arch/x86/Kconfig | 1 arch/x86/include/asm/fixmap.h | 1 arch/x86/include/asm/highmem.h | 37 arch/x86/include/asm/pgtable_64.h | 6 arch/x86/mm/highmem_32.c | 52 arch/xtensa/include/asm/highmem.h | 31 arch/xtensa/mm/highmem.c | 28 drivers/block/zram/zcomp.c | 7 drivers/dax/dax-private.h | 1 drivers/dax/kmem.c | 28 drivers/gpu/drm/ttm/ttm_bo_util.c | 56 drivers/gpu/drm/vmwgfx/vmwgfx_blit.c | 17 drivers/rapidio/devices/rio_mport_cdev.c | 27 drivers/usb/core/hcd.c | 3 fs/binfmt_elf.c | 4 fs/binfmt_em86.c | 6 fs/binfmt_misc.c | 4 fs/binfmt_script.c | 6 fs/exec.c | 58 fs/fat/fatent.c | 103 fs/fat/inode.c | 6 fs/proc/array.c | 8 fs/seq_file.c | 7 include/asm-generic/5level-fixup.h | 59 include/asm-generic/pgtable-nop4d-hack.h | 64 include/asm-generic/pgtable-nopud.h | 4 include/drm/ttm/ttm_bo_api.h | 4 include/linux/binfmts.h | 3 include/linux/bitops.h | 2 include/linux/elfnote.h | 2 include/linux/highmem.h | 89 include/linux/ioport.h | 1 include/linux/memory_hotplug.h | 9 include/linux/mm.h | 12 include/linux/sched.h | 3 include/linux/seq_file.h | 19 init/Kconfig | 10 init/main.c | 10 kernel/kcov.c | 282 - kernel/kexec_file.c | 5 kernel/kprobes.c | 34 kernel/relay.c | 22 kernel/user.c | 2 lib/Kconfig.debug | 44 lib/Makefile | 2 lib/flex_proportions.c | 7 lib/math/prime_numbers.c | 10 lib/percpu-refcount.c | 6 lib/strncpy_from_user.c | 1 lib/test_bitops.c | 60 lib/test_lockup.c | 2 lib/ubsan.c | 33 lib/zlib_inflate/inffast.c | 91 mm/Kconfig | 4 mm/Makefile | 1 mm/compaction.c | 2 mm/debug_vm_pgtable.c | 382 + mm/filemap.c | 2 mm/frontswap.c | 6 mm/huge_memory.c | 2 mm/hugetlb.c | 16 mm/internal.h | 2 mm/kasan/init.c | 11 mm/ksm.c | 10 mm/list_lru.c | 2 mm/memblock.c | 2 mm/memcontrol.c | 4 mm/memory.c | 10 mm/memory_hotplug.c | 179 mm/mmap.c | 2 mm/mremap.c | 2 mm/page-writeback.c | 2 mm/slub.c | 2 mm/sparse.c | 2 mm/util.c | 22 mm/vmalloc.c | 2 mm/vmscan.c | 6 mm/vmstat.c | 32 mm/zbud.c | 2 scripts/checkpatch.pl | 62 scripts/get_maintainer.pl | 46 security/keys/internal.h | 11 security/keys/keyctl.c | 16 tools/testing/selftests/lib/config | 1 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 75 tools/testing/selftests/vm/mremap_dontunmap.c | 1 tools/testing/selftests/vm/pkey-helpers.h | 557 +- tools/testing/selftests/vm/pkey-powerpc.h | 153 tools/testing/selftests/vm/pkey-x86.h | 191 tools/testing/selftests/vm/protection_keys.c | 2370 ++++++++-- tools/testing/selftests/x86/.gitignore | 1 tools/testing/selftests/x86/Makefile | 2 tools/testing/selftests/x86/pkey-helpers.h | 219 tools/testing/selftests/x86/protection_keys.c | 1506 ------ 200 files changed, 5182 insertions(+), 4033 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-06-03 22:55 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-06-03 22:55 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm More mm/ work, plenty more to come. 131 patches, based on d6f9469a03d832dcd17041ed67774ffb5f3e73b3. Subsystems affected by this patch series: mm/slub mm/memcg mm/gup mm/kasan mm/pagealloc mm/hugetlb mm/vmscan mm/tools mm/mempolicy mm/memblock mm/hugetlbfs mm/thp mm/mmap mm/kconfig Subsystem: mm/slub Wang Hai <wanghai38@huawei.com>: mm/slub: fix a memory leak in sysfs_slab_add() Subsystem: mm/memcg Shakeel Butt <shakeelb@google.com>: mm/memcg: optimize memory.numa_stat like memory.stat Subsystem: mm/gup John Hubbard <jhubbard@nvidia.com>: Patch series "mm/gup, drm/i915: refactor gup_fast, convert to pin_user_pages()", v2: mm/gup: move __get_user_pages_fast() down a few lines in gup.c mm/gup: refactor and de-duplicate gup_fast() code mm/gup: introduce pin_user_pages_fast_only() drm/i915: convert get_user_pages() --> pin_user_pages() mm/gup: might_lock_read(mmap_sem) in get_user_pages_fast() Subsystem: mm/kasan Daniel Axtens <dja@axtens.net>: Patch series "Fix some incompatibilites between KASAN and FORTIFY_SOURCE", v4: kasan: stop tests being eliminated as dead code with FORTIFY_SOURCE string.h: fix incompatibility between FORTIFY_SOURCE and KASAN Subsystem: mm/pagealloc Michal Hocko <mhocko@suse.com>: mm: clarify __GFP_MEMALLOC usage Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: rework free_area_init*() funcitons": mm: memblock: replace dereferences of memblock_region.nid with API calls mm: make early_pfn_to_nid() and related defintions close to each other mm: remove CONFIG_HAVE_MEMBLOCK_NODE_MAP option mm: free_area_init: use maximal zone PFNs rather than zone sizes mm: use free_area_init() instead of free_area_init_nodes() alpha: simplify detection of memory zone boundaries arm: simplify detection of memory zone boundaries arm64: simplify detection of memory zone boundaries for UMA configs csky: simplify detection of memory zone boundaries m68k: mm: simplify detection of memory zone boundaries parisc: simplify detection of memory zone boundaries sparc32: simplify detection of memory zone boundaries unicore32: simplify detection of memory zone boundaries xtensa: simplify detection of memory zone boundaries Baoquan He <bhe@redhat.com>: mm: memmap_init: iterate over memblock regions rather that check each PFN Mike Rapoport <rppt@linux.ibm.com>: mm: remove early_pfn_in_nid() and CONFIG_NODES_SPAN_OTHER_NODES mm: free_area_init: allow defining max_zone_pfn in descending order mm: rename free_area_init_node() to free_area_init_memoryless_node() mm: clean up free_area_init_node() and its helpers mm: simplify find_min_pfn_with_active_regions() docs/vm: update memory-models documentation Wei Yang <richard.weiyang@gmail.com>: Patch series "mm/page_alloc.c: cleanup on check page", v3: mm/page_alloc.c: bad_[reason|flags] is not necessary when PageHWPoison mm/page_alloc.c: bad_flags is not necessary for bad_page() mm/page_alloc.c: rename free_pages_check_bad() to check_free_page_bad() mm/page_alloc.c: rename free_pages_check() to check_free_page() mm/page_alloc.c: extract check_[new|free]_page_bad() common part to page_bad_reason() Roman Gushchin <guro@fb.com>: mm,page_alloc,cma: conditionally prefer cma pageblocks for movable allocations Baoquan He <bhe@redhat.com>: mm/page_alloc.c: remove unused free_bootmem_with_active_regions Patch series "improvements about lowmem_reserve and /proc/zoneinfo", v2: mm/page_alloc.c: only tune sysctl_lowmem_reserve_ratio value once when changing it mm/page_alloc.c: clear out zone->lowmem_reserve[] if the zone is empty mm/vmstat.c: do not show lowmem reserve protection information of empty zone Joonsoo Kim <iamjoonsoo.kim@lge.com>: Patch series "integrate classzone_idx and high_zoneidx", v5: mm/page_alloc: use ac->high_zoneidx for classzone_idx mm/page_alloc: integrate classzone_idx and high_zoneidx Wei Yang <richard.weiyang@gmail.com>: mm/page_alloc.c: use NODE_MASK_NONE in build_zonelists() mm: rename gfpflags_to_migratetype to gfp_migratetype for same convention Sandipan Das <sandipan@linux.ibm.com>: mm/page_alloc.c: reset numa stats for boot pagesets Charan Teja Reddy <charante@codeaurora.org>: mm, page_alloc: reset the zone->watermark_boost early Anshuman Khandual <anshuman.khandual@arm.com>: mm/page_alloc: restrict and formalize compound_page_dtors[] Daniel Jordan <daniel.m.jordan@oracle.com>: Patch series "initialize deferred pages with interrupts enabled", v4: mm/pagealloc.c: call touch_nmi_watchdog() on max order boundaries in deferred init Pavel Tatashin <pasha.tatashin@soleen.com>: mm: initialize deferred pages with interrupts enabled mm: call cond_resched() from deferred_init_memmap() Daniel Jordan <daniel.m.jordan@oracle.com>: Patch series "padata: parallelize deferred page init", v3: padata: remove exit routine padata: initialize earlier padata: allocate work structures for parallel jobs from a pool padata: add basic support for multithreaded jobs mm: don't track number of pages during deferred initialization mm: parallelize deferred_init_memmap() mm: make deferred init's max threads arch-specific padata: document multithreaded jobs Chen Tao <chentao107@huawei.com>: mm/page_alloc.c: add missing newline Subsystem: mm/hugetlb "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: Patch series "thp/khugepaged improvements and CoW semantics", v4: khugepaged: add self test khugepaged: do not stop collapse if less than half PTEs are referenced khugepaged: drain all LRU caches before scanning pages khugepaged: drain LRU add pagevec after swapin khugepaged: allow to collapse a page shared across fork khugepaged: allow to collapse PTE-mapped compound pages thp: change CoW semantics for anon-THP khugepaged: introduce 'max_ptes_shared' tunable Mike Kravetz <mike.kravetz@oracle.com>: Patch series "Clean up hugetlb boot command line processing", v4: hugetlbfs: add arch_hugetlb_valid_size hugetlbfs: move hugepagesz= parsing to arch independent code hugetlbfs: remove hugetlb_add_hstate() warning for existing hstate hugetlbfs: clean up command line processing hugetlbfs: fix changes to command line processing Li Xinhai <lixinhai.lxh@gmail.com>: mm/hugetlb: avoid unnecessary check on pud and pmd entry in huge_pte_offset Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/hugetlb: Add some new generic fallbacks", v3: arm64/mm: drop __HAVE_ARCH_HUGE_PTEP_GET mm/hugetlb: define a generic fallback for is_hugepage_only_range() mm/hugetlb: define a generic fallback for arch_clear_hugepage_flags() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: simplify calling a compound page destructor Subsystem: mm/vmscan Wei Yang <richard.weiyang@gmail.com>: mm/vmscan.c: use update_lru_size() in update_lru_sizes() Jaewon Kim <jaewon31.kim@samsung.com>: mm/vmscan: count layzfree pages and fix nr_isolated_* mismatch Maninder Singh <maninder1.s@samsung.com>: mm/vmscan.c: change prototype for shrink_page_list Qiwu Chen <qiwuchen55@gmail.com>: mm/vmscan: update the comment of should_continue_reclaim() Johannes Weiner <hannes@cmpxchg.org>: Patch series "mm: memcontrol: charge swapin pages on instantiation", v2: mm: fix NUMA node file count error in replace_page_cache() mm: memcontrol: fix stat-corrupting race in charge moving mm: memcontrol: drop @compound parameter from memcg charging API mm: shmem: remove rare optimization when swapin races with hole punching mm: memcontrol: move out cgroup swaprate throttling mm: memcontrol: convert page cache to a new mem_cgroup_charge() API mm: memcontrol: prepare uncharging for removal of private page type counters mm: memcontrol: prepare move_account for removal of private page type counters mm: memcontrol: prepare cgroup vmstat infrastructure for native anon counters mm: memcontrol: switch to native NR_FILE_PAGES and NR_SHMEM counters mm: memcontrol: switch to native NR_ANON_MAPPED counter mm: memcontrol: switch to native NR_ANON_THPS counter mm: memcontrol: convert anon and file-thp to new mem_cgroup_charge() API mm: memcontrol: drop unused try/commit/cancel charge API mm: memcontrol: prepare swap controller setup for integration mm: memcontrol: make swap tracking an integral part of memory control mm: memcontrol: charge swapin pages on instantiation Alex Shi <alex.shi@linux.alibaba.com>: mm: memcontrol: document the new swap control behavior Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: delete unused lrucare handling mm: memcontrol: update page->mem_cgroup stability rules mm: fix LRU balancing effect of new transparent huge pages mm: keep separate anon and file statistics on page reclaim activity mm: allow swappiness that prefers reclaiming anon over the file workingset mm: fold and remove lru_cache_add_anon() and lru_cache_add_file() mm: workingset: let cache workingset challenge anon mm: remove use-once cache bias from LRU balancing mm: vmscan: drop unnecessary div0 avoidance rounding in get_scan_count() mm: base LRU balancing on an explicit cost model mm: deactivations shouldn't bias the LRU balance mm: only count actual rotations as LRU reclaim cost mm: balance LRU lists based on relative thrashing mm: vmscan: determine anon/file pressure balance at the reclaim root mm: vmscan: reclaim writepage is IO cost mm: vmscan: limit the range of LRU type balancing Shakeel Butt <shakeelb@google.com>: mm: swap: fix vmstats for huge pages mm: swap: memcg: fix memcg stats for huge pages Subsystem: mm/tools Changhee Han <ch0.han@lge.com>: tools/vm/page_owner_sort.c: filter out unneeded line Subsystem: mm/mempolicy Michal Hocko <mhocko@suse.com>: mm, mempolicy: fix up gup usage in lookup_node Subsystem: mm/memblock chenqiwu <chenqiwu@xiaomi.com>: include/linux/memblock.h: fix minor typo and unclear comment Mike Rapoport <rppt@linux.ibm.com>: sparc32: register memory occupied by kernel as memblock.memory Subsystem: mm/hugetlbfs Shijie Hu <hushijie3@huawei.com>: hugetlbfs: get unmapped area below TASK_UNMAPPED_BASE for hugetlbfs Subsystem: mm/thp Yang Shi <yang.shi@linux.alibaba.com>: mm: thp: don't need to drain lru cache when splitting and mlocking THP Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/thp: Rename pmd_mknotpresent() as pmd_mknotvalid()", v2: powerpc/mm: drop platform defined pmd_mknotpresent() mm/thp: rename pmd_mknotpresent() as pmd_mkinvalid() Subsystem: mm/mmap Scott Cheloha <cheloha@linux.vnet.ibm.com>: drivers/base/memory.c: cache memory blocks in xarray to accelerate lookup Subsystem: mm/kconfig Zong Li <zong.li@sifive.com>: Patch series "Extract DEBUG_WX to shared use": mm: add DEBUG_WX support riscv: support DEBUG_WX x86: mm: use ARCH_HAS_DEBUG_WX instead of arch defined arm64: mm: use ARCH_HAS_DEBUG_WX instead of arch defined Documentation/admin-guide/cgroup-v1/memory.rst | 19 Documentation/admin-guide/kernel-parameters.txt | 40 Documentation/admin-guide/mm/hugetlbpage.rst | 35 Documentation/admin-guide/mm/transhuge.rst | 7 Documentation/admin-guide/sysctl/vm.rst | 23 Documentation/core-api/padata.rst | 41 Documentation/features/vm/numa-memblock/arch-support.txt | 34 Documentation/vm/memory-model.rst | 9 Documentation/vm/page_owner.rst | 3 arch/alpha/mm/init.c | 16 arch/alpha/mm/numa.c | 22 arch/arc/include/asm/hugepage.h | 2 arch/arc/mm/init.c | 41 arch/arm/include/asm/hugetlb.h | 7 arch/arm/include/asm/pgtable-3level.h | 2 arch/arm/mm/init.c | 66 arch/arm64/Kconfig | 2 arch/arm64/Kconfig.debug | 29 arch/arm64/include/asm/hugetlb.h | 13 arch/arm64/include/asm/pgtable.h | 2 arch/arm64/mm/hugetlbpage.c | 48 arch/arm64/mm/init.c | 56 arch/arm64/mm/numa.c | 9 arch/c6x/mm/init.c | 8 arch/csky/kernel/setup.c | 26 arch/h8300/mm/init.c | 6 arch/hexagon/mm/init.c | 6 arch/ia64/Kconfig | 1 arch/ia64/include/asm/hugetlb.h | 5 arch/ia64/mm/contig.c | 2 arch/ia64/mm/discontig.c | 2 arch/m68k/mm/init.c | 6 arch/m68k/mm/mcfmmu.c | 9 arch/m68k/mm/motorola.c | 15 arch/m68k/mm/sun3mmu.c | 10 arch/microblaze/Kconfig | 1 arch/microblaze/mm/init.c | 2 arch/mips/Kconfig | 1 arch/mips/include/asm/hugetlb.h | 11 arch/mips/include/asm/pgtable.h | 2 arch/mips/loongson64/numa.c | 2 arch/mips/mm/init.c | 2 arch/mips/sgi-ip27/ip27-memory.c | 2 arch/nds32/mm/init.c | 11 arch/nios2/mm/init.c | 8 arch/openrisc/mm/init.c | 9 arch/parisc/include/asm/hugetlb.h | 10 arch/parisc/mm/init.c | 22 arch/powerpc/Kconfig | 10 arch/powerpc/include/asm/book3s/64/pgtable.h | 4 arch/powerpc/include/asm/hugetlb.h | 5 arch/powerpc/mm/hugetlbpage.c | 38 arch/powerpc/mm/mem.c | 2 arch/riscv/Kconfig | 2 arch/riscv/include/asm/hugetlb.h | 10 arch/riscv/include/asm/ptdump.h | 11 arch/riscv/mm/hugetlbpage.c | 44 arch/riscv/mm/init.c | 5 arch/s390/Kconfig | 1 arch/s390/include/asm/hugetlb.h | 8 arch/s390/mm/hugetlbpage.c | 34 arch/s390/mm/init.c | 2 arch/sh/Kconfig | 1 arch/sh/include/asm/hugetlb.h | 7 arch/sh/mm/init.c | 2 arch/sparc/Kconfig | 10 arch/sparc/include/asm/hugetlb.h | 10 arch/sparc/mm/init_32.c | 1 arch/sparc/mm/init_64.c | 67 arch/sparc/mm/srmmu.c | 21 arch/um/kernel/mem.c | 12 arch/unicore32/include/asm/memory.h | 2 arch/unicore32/include/mach/memory.h | 6 arch/unicore32/kernel/pci.c | 14 arch/unicore32/mm/init.c | 43 arch/x86/Kconfig | 11 arch/x86/Kconfig.debug | 27 arch/x86/include/asm/hugetlb.h | 10 arch/x86/include/asm/pgtable.h | 2 arch/x86/mm/hugetlbpage.c | 35 arch/x86/mm/init.c | 2 arch/x86/mm/init_64.c | 12 arch/x86/mm/kmmio.c | 2 arch/x86/mm/numa.c | 11 arch/xtensa/mm/init.c | 8 drivers/base/memory.c | 44 drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 22 fs/cifs/file.c | 10 fs/fuse/dev.c | 2 fs/hugetlbfs/inode.c | 67 include/asm-generic/hugetlb.h | 2 include/linux/compaction.h | 9 include/linux/gfp.h | 7 include/linux/hugetlb.h | 16 include/linux/memblock.h | 15 include/linux/memcontrol.h | 102 - include/linux/mm.h | 52 include/linux/mmzone.h | 46 include/linux/padata.h | 43 include/linux/string.h | 60 include/linux/swap.h | 17 include/linux/vm_event_item.h | 4 include/linux/vmstat.h | 2 include/trace/events/compaction.h | 22 include/trace/events/huge_memory.h | 3 include/trace/events/vmscan.h | 14 init/Kconfig | 17 init/main.c | 2 kernel/events/uprobes.c | 22 kernel/padata.c | 293 +++- kernel/sysctl.c | 3 lib/test_kasan.c | 29 mm/Kconfig | 9 mm/Kconfig.debug | 32 mm/compaction.c | 70 - mm/filemap.c | 55 mm/gup.c | 237 ++- mm/huge_memory.c | 282 ---- mm/hugetlb.c | 260 ++- mm/internal.h | 25 mm/khugepaged.c | 316 ++-- mm/memblock.c | 19 mm/memcontrol.c | 642 +++------ mm/memory.c | 103 - mm/memory_hotplug.c | 10 mm/mempolicy.c | 5 mm/migrate.c | 30 mm/oom_kill.c | 4 mm/page_alloc.c | 735 ++++------ mm/page_owner.c | 7 mm/pgtable-generic.c | 2 mm/rmap.c | 53 mm/shmem.c | 156 -- mm/slab.c | 4 mm/slub.c | 8 mm/swap.c | 199 +- mm/swap_cgroup.c | 10 mm/swap_state.c | 110 - mm/swapfile.c | 39 mm/userfaultfd.c | 15 mm/vmscan.c | 344 ++-- mm/vmstat.c | 16 mm/workingset.c | 23 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 1 tools/testing/selftests/vm/khugepaged.c | 1035 +++++++++++++++ tools/vm/page_owner_sort.c | 5 147 files changed, 3876 insertions(+), 3108 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-06-02 20:09 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-06-02 20:09 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm A few little subsystems and a start of a lot of MM patches. 128 patches, based on f359287765c04711ff54fbd11645271d8e5ff763: Subsystems affected by this patch series: squashfs ocfs2 parisc vfs mm/slab-generic mm/slub mm/debug mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/memory-failure mm/vmalloc mm/kasan Subsystem: squashfs Philippe Liard <pliard@google.com>: squashfs: migrate from ll_rw_block usage to BIO Subsystem: ocfs2 Jules Irenge <jbi.octave@gmail.com>: ocfs2: add missing annotation for dlm_empty_lockres() Gang He <ghe@suse.com>: ocfs2: mount shared volume without ha stack Subsystem: parisc Andrew Morton <akpm@linux-foundation.org>: arch/parisc/include/asm/pgtable.h: remove unused `old_pte' Subsystem: vfs Jeff Layton <jlayton@redhat.com>: Patch series "vfs: have syncfs() return error when there are writeback: vfs: track per-sb writeback errors and report them to syncfs fs/buffer.c: record blockdev write errors in super_block that it backs Subsystem: mm/slab-generic Vlastimil Babka <vbabka@suse.cz>: usercopy: mark dma-kmalloc caches as usercopy caches Subsystem: mm/slub Dongli Zhang <dongli.zhang@oracle.com>: mm/slub.c: fix corrupted freechain in deactivate_slab() Christoph Lameter <cl@linux.com>: slub: Remove userspace notifier for cache add/remove Christopher Lameter <cl@linux.com>: slub: remove kmalloc under list_lock from list_slab_objects() V2 Qian Cai <cai@lca.pw>: mm/slub: fix stack overruns with SLUB_STATS Andrew Morton <akpm@linux-foundation.org>: Documentation/vm/slub.rst: s/Toggle/Enable/ Subsystem: mm/debug Vlastimil Babka <vbabka@suse.cz>: mm, dump_page(): do not crash with invalid mapping pointer Subsystem: mm/pagecache "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Change readahead API", v11: mm: move readahead prototypes from mm.h mm: return void from various readahead functions mm: ignore return value of ->readpages mm: move readahead nr_pages check into read_pages mm: add new readahead_control API mm: use readahead_control to pass arguments mm: rename various 'offset' parameters to 'index' mm: rename readahead loop variable to 'i' mm: remove 'page_offset' from readahead loop mm: put readahead pages in cache earlier mm: add readahead address space operation mm: move end_index check out of readahead loop mm: add page_cache_readahead_unbounded mm: document why we don't set PageReadahead mm: use memalloc_nofs_save in readahead path fs: convert mpage_readpages to mpage_readahead btrfs: convert from readpages to readahead erofs: convert uncompressed files from readpages to readahead erofs: convert compressed files from readpages to readahead ext4: convert from readpages to readahead ext4: pass the inode to ext4_mpage_readpages f2fs: convert from readpages to readahead f2fs: pass the inode to f2fs_mpage_readpages fuse: convert from readpages to readahead iomap: convert from readpages to readahead Guoqing Jiang <guoqing.jiang@cloud.ionos.com>: Patch series "Introduce attach/detach_page_private to cleanup code": include/linux/pagemap.h: introduce attach/detach_page_private md: remove __clear_page_buffers and use attach/detach_page_private btrfs: use attach/detach_page_private fs/buffer.c: use attach/detach_page_private f2fs: use attach/detach_page_private iomap: use attach/detach_page_private ntfs: replace attach_page_buffers with attach_page_private orangefs: use attach/detach_page_private buffer_head.h: remove attach_page_buffers mm/migrate.c: call detach_page_private to cleanup code mm_types.h: change set_page_private to inline function "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap.c: remove misleading comment Chao Yu <yuchao0@huawei.com>: mm/page-writeback.c: remove unused variable NeilBrown <neilb@suse.de>: mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead Subsystem: mm/gup Souptick Joarder <jrdr.linux@gmail.com>: mm/gup.c: update the documentation John Hubbard <jhubbard@nvidia.com>: mm/gup: introduce pin_user_pages_unlocked ivtv: convert get_user_pages() --> pin_user_pages() Miles Chen <miles.chen@mediatek.com>: mm/gup.c: further document vma_permits_fault() Subsystem: mm/swap chenqiwu <chenqiwu@xiaomi.com>: mm/swapfile: use list_{prev,next}_entry() instead of open-coding Qian Cai <cai@lca.pw>: mm/swap_state: fix a data race in swapin_nr_pages Andrea Righi <andrea.righi@canonical.com>: mm: swap: properly update readahead statistics in unuse_pte_range() Wei Yang <richard.weiyang@gmail.com>: mm/swapfile.c: offset is only used when there is more slots mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive mm/swapfile.c: remove the unnecessary goto for SSD case mm/swapfile.c: simplify the calculation of n_goal mm/swapfile.c: remove the extra check in scan_swap_map_slots() mm/swapfile.c: found_free could be represented by (tmp < max) mm/swapfile.c: tmp is always smaller than max mm/swapfile.c: omit a duplicate code by compare tmp and max first Huang Ying <ying.huang@intel.com>: swap: try to scan more free slots even when fragmented Wei Yang <richard.weiyang@gmail.com>: mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable mm/swapfile.c: __swap_entry_free() always free 1 entry Huang Ying <ying.huang@intel.com>: mm/swapfile.c: use prandom_u32_max() swap: reduce lock contention on swap cache from swap slots allocation Randy Dunlap <rdunlap@infradead.org>: mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment Miaohe Lin <linmiaohe@huawei.com>: include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration Subsystem: mm/memcg Yafang Shao <laoar.shao@gmail.com>: mm, memcg: add workingset_restore in memory.stat Kaixu Xia <kaixuxia@tencent.com>: mm: memcontrol: simplify value comparison between count and limit Shakeel Butt <shakeelb@google.com>: memcg: expose root cgroup's memory.stat Jakub Kicinski <kuba@kernel.org>: Patch series "memcg: Slow down swap allocation as the available space gets: mm/memcg: prepare for swap over-high accounting and penalty calculation mm/memcg: move penalty delay clamping out of calculate_high_delay() mm/memcg: move cgroup high memory limit setting into struct page_counter mm/memcg: automatically penalize tasks with high swap use Zefan Li <lizefan@huawei.com>: memcg: fix memcg_kmem_bypass() for remote memcg charging Subsystem: mm/pagemap Steven Price <steven.price@arm.com>: Patch series "Fix W+X debug feature on x86": x86: mm: ptdump: calculate effective permissions correctly mm: ptdump: expand type of 'val' in note_page() Huang Ying <ying.huang@intel.com>: /proc/PID/smaps: Add PMD migration entry parsing chenqiwu <chenqiwu@xiaomi.com>: mm/memory: remove unnecessary pte_devmap case in copy_one_pte() Subsystem: mm/memory-failure Wetp Zhang <wetp.zy@linux.alibaba.com>: mm, memory_failure: don't send BUS_MCEERR_AO for action required error Subsystem: mm/vmalloc Christoph Hellwig <hch@lst.de>: Patch series "decruft the vmalloc API", v2: x86/hyperv: use vmalloc_exec for the hypercall page x86: fix vmap arguments in map_irq_stack staging: android: ion: use vmap instead of vm_map_ram staging: media: ipu3: use vmap instead of reimplementing it dma-mapping: use vmap insted of reimplementing it powerpc: add an ioremap_phb helper powerpc: remove __ioremap_at and __iounmap_at mm: remove __get_vm_area mm: unexport unmap_kernel_range_noflush mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING mm: only allow page table mappings for built-in zsmalloc mm: pass addr as unsigned long to vb_free mm: remove vmap_page_range_noflush and vunmap_page_range mm: rename vmap_page_range to map_kernel_range mm: don't return the number of pages from map_kernel_range{,_noflush} mm: remove map_vm_range mm: remove unmap_vmap_area mm: remove the prot argument from vm_map_ram mm: enforce that vmap can't map pages executable gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc mm: remove the pgprot argument to __vmalloc mm: remove the prot argument to __vmalloc_node mm: remove both instances of __vmalloc_node_flags mm: remove __vmalloc_node_flags_caller mm: switch the test_vmalloc module to use __vmalloc_node mm: remove vmalloc_user_node_flags arm64: use __vmalloc_node in arch_alloc_vmap_stack powerpc: use __vmalloc_node in alloc_vm_stack s390: use __vmalloc_node in stack_alloc Joerg Roedel <jroedel@suse.de>: Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3: mm: add functions to track page directory modifications mm/vmalloc: track which page-table levels were modified mm/ioremap: track which page-table levels were modified x86/mm/64: implement arch_sync_kernel_mappings() x86/mm/32: implement arch_sync_kernel_mappings() mm: remove vmalloc_sync_(un)mappings() x86/mm: remove vmalloc faulting Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: fix clang compilation warning due to stack protector Kees Cook <keescook@chromium.org>: ubsan: entirely disable alignment checks under UBSAN_TRAP Jing Xia <jing.xia@unisoc.com>: mm/mm_init.c: report kasan-tag information stored in page->flags Andrey Konovalov <andreyknvl@google.com>: kasan: move kasan_report() into report.c Documentation/admin-guide/cgroup-v2.rst | 24 + Documentation/core-api/cachetlb.rst | 2 Documentation/filesystems/locking.rst | 6 Documentation/filesystems/proc.rst | 4 Documentation/filesystems/vfs.rst | 15 Documentation/vm/slub.rst | 2 arch/arm/configs/omap2plus_defconfig | 2 arch/arm64/include/asm/pgtable.h | 3 arch/arm64/include/asm/vmap_stack.h | 6 arch/arm64/mm/dump.c | 2 arch/parisc/include/asm/pgtable.h | 2 arch/powerpc/include/asm/io.h | 10 arch/powerpc/include/asm/pci-bridge.h | 2 arch/powerpc/kernel/irq.c | 5 arch/powerpc/kernel/isa-bridge.c | 28 + arch/powerpc/kernel/pci_64.c | 56 +- arch/powerpc/mm/ioremap_64.c | 50 -- arch/riscv/include/asm/pgtable.h | 4 arch/riscv/mm/ptdump.c | 2 arch/s390/kernel/setup.c | 9 arch/sh/kernel/cpu/sh4/sq.c | 3 arch/x86/hyperv/hv_init.c | 5 arch/x86/include/asm/kvm_host.h | 3 arch/x86/include/asm/pgtable-2level_types.h | 2 arch/x86/include/asm/pgtable-3level_types.h | 2 arch/x86/include/asm/pgtable_64_types.h | 2 arch/x86/include/asm/pgtable_types.h | 8 arch/x86/include/asm/switch_to.h | 23 - arch/x86/kernel/irq_64.c | 2 arch/x86/kernel/setup_percpu.c | 6 arch/x86/kvm/svm/sev.c | 3 arch/x86/mm/dump_pagetables.c | 35 + arch/x86/mm/fault.c | 196 ---------- arch/x86/mm/init_64.c | 5 arch/x86/mm/pti.c | 8 arch/x86/mm/tlb.c | 37 - block/blk-core.c | 1 drivers/acpi/apei/ghes.c | 6 drivers/base/node.c | 2 drivers/block/drbd/drbd_bitmap.c | 4 drivers/block/loop.c | 2 drivers/dax/device.c | 1 drivers/gpu/drm/drm_scatter.c | 11 drivers/gpu/drm/etnaviv/etnaviv_dump.c | 4 drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c | 2 drivers/lightnvm/pblk-init.c | 5 drivers/md/dm-bufio.c | 4 drivers/md/md-bitmap.c | 12 drivers/media/common/videobuf2/videobuf2-dma-sg.c | 3 drivers/media/common/videobuf2/videobuf2-vmalloc.c | 3 drivers/media/pci/ivtv/ivtv-udma.c | 19 - drivers/media/pci/ivtv/ivtv-yuv.c | 17 drivers/media/pci/ivtv/ivtvfb.c | 4 drivers/mtd/ubi/io.c | 4 drivers/pcmcia/electra_cf.c | 45 -- drivers/scsi/sd_zbc.c | 3 drivers/staging/android/ion/ion_heap.c | 4 drivers/staging/media/ipu3/ipu3-css-pool.h | 4 drivers/staging/media/ipu3/ipu3-dmamap.c | 30 - fs/block_dev.c | 7 fs/btrfs/disk-io.c | 4 fs/btrfs/extent_io.c | 64 --- fs/btrfs/extent_io.h | 3 fs/btrfs/inode.c | 39 -- fs/buffer.c | 23 - fs/erofs/data.c | 41 -- fs/erofs/decompressor.c | 2 fs/erofs/zdata.c | 31 - fs/exfat/inode.c | 7 fs/ext2/inode.c | 10 fs/ext4/ext4.h | 5 fs/ext4/inode.c | 25 - fs/ext4/readpage.c | 25 - fs/ext4/verity.c | 35 - fs/f2fs/data.c | 56 +- fs/f2fs/f2fs.h | 14 fs/f2fs/verity.c | 35 - fs/fat/inode.c | 7 fs/file_table.c | 1 fs/fs-writeback.c | 1 fs/fuse/file.c | 100 +---- fs/gfs2/aops.c | 23 - fs/gfs2/dir.c | 9 fs/gfs2/quota.c | 2 fs/hpfs/file.c | 7 fs/iomap/buffered-io.c | 113 +---- fs/iomap/trace.h | 2 fs/isofs/inode.c | 7 fs/jfs/inode.c | 7 fs/mpage.c | 38 -- fs/nfs/blocklayout/extent_tree.c | 2 fs/nfs/internal.h | 10 fs/nfs/write.c | 4 fs/nfsd/vfs.c | 9 fs/nilfs2/inode.c | 15 fs/ntfs/aops.c | 2 fs/ntfs/malloc.h | 2 fs/ntfs/mft.c | 2 fs/ocfs2/aops.c | 34 - fs/ocfs2/dlm/dlmmaster.c | 1 fs/ocfs2/ocfs2.h | 4 fs/ocfs2/slot_map.c | 46 +- fs/ocfs2/super.c | 21 + fs/omfs/file.c | 7 fs/open.c | 3 fs/orangefs/inode.c | 32 - fs/proc/meminfo.c | 3 fs/proc/task_mmu.c | 16 fs/qnx6/inode.c | 7 fs/reiserfs/inode.c | 8 fs/squashfs/block.c | 273 +++++++------- fs/squashfs/decompressor.h | 5 fs/squashfs/decompressor_multi.c | 9 fs/squashfs/decompressor_multi_percpu.c | 17 fs/squashfs/decompressor_single.c | 9 fs/squashfs/lz4_wrapper.c | 17 fs/squashfs/lzo_wrapper.c | 17 fs/squashfs/squashfs.h | 4 fs/squashfs/xz_wrapper.c | 51 +- fs/squashfs/zlib_wrapper.c | 63 +-- fs/squashfs/zstd_wrapper.c | 62 +-- fs/sync.c | 6 fs/ubifs/debug.c | 2 fs/ubifs/lprops.c | 2 fs/ubifs/lpt_commit.c | 4 fs/ubifs/orphan.c | 2 fs/udf/inode.c | 7 fs/xfs/kmem.c | 2 fs/xfs/xfs_aops.c | 13 fs/xfs/xfs_buf.c | 2 fs/zonefs/super.c | 7 include/asm-generic/5level-fixup.h | 5 include/asm-generic/pgtable.h | 27 + include/linux/buffer_head.h | 8 include/linux/fs.h | 18 include/linux/iomap.h | 3 include/linux/memcontrol.h | 4 include/linux/mm.h | 67 ++- include/linux/mm_types.h | 6 include/linux/mmzone.h | 1 include/linux/mpage.h | 4 include/linux/page_counter.h | 8 include/linux/pagemap.h | 193 ++++++++++ include/linux/ptdump.h | 3 include/linux/sched.h | 3 include/linux/swap.h | 17 include/linux/vmalloc.h | 49 +- include/linux/zsmalloc.h | 2 include/trace/events/erofs.h | 6 include/trace/events/f2fs.h | 6 include/trace/events/writeback.h | 5 kernel/bpf/core.c | 6 kernel/bpf/syscall.c | 29 - kernel/dma/remap.c | 48 -- kernel/groups.c | 2 kernel/module.c | 3 kernel/notifier.c | 1 kernel/sys.c | 2 kernel/trace/trace.c | 12 lib/Kconfig.ubsan | 2 lib/ioremap.c | 46 +- lib/test_vmalloc.c | 26 - mm/Kconfig | 4 mm/debug.c | 56 ++ mm/fadvise.c | 6 mm/filemap.c | 1 mm/gup.c | 77 +++- mm/internal.h | 14 mm/kasan/Makefile | 21 - mm/kasan/common.c | 19 - mm/kasan/report.c | 22 + mm/memcontrol.c | 198 +++++++--- mm/memory-failure.c | 15 mm/memory.c | 2 mm/migrate.c | 9 mm/mm_init.c | 16 mm/nommu.c | 52 +- mm/page-writeback.c | 62 ++- mm/page_alloc.c | 7 mm/percpu.c | 2 mm/ptdump.c | 17 mm/readahead.c | 349 ++++++++++-------- mm/slab_common.c | 3 mm/slub.c | 67 ++- mm/swap_state.c | 5 mm/swapfile.c | 194 ++++++---- mm/util.c | 2 mm/vmalloc.c | 399 ++++++++------------- mm/vmscan.c | 4 mm/vmstat.c | 11 mm/zsmalloc.c | 12 net/bridge/netfilter/ebtables.c | 6 net/ceph/ceph_common.c | 3 sound/core/memalloc.c | 2 sound/core/pcm_memory.c | 2 195 files changed, 2292 insertions(+), 2288 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-06-02 4:44 Andrew Morton 2020-06-02 20:08 ` incoming Andrew Morton 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2020-06-02 4:44 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm A few little subsystems and a start of a lot of MM patches. 128 patches, based on 9bf9511e3d9f328c03f6f79bfb741c3d18f2f2c0: Subsystems affected by this patch series: squashfs ocfs2 parisc vfs mm/slab-generic mm/slub mm/debug mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/memory-failure mm/vmalloc mm/kasan Subsystem: squashfs Philippe Liard <pliard@google.com>: squashfs: migrate from ll_rw_block usage to BIO Subsystem: ocfs2 Jules Irenge <jbi.octave@gmail.com>: ocfs2: add missing annotation for dlm_empty_lockres() Gang He <ghe@suse.com>: ocfs2: mount shared volume without ha stack Subsystem: parisc Andrew Morton <akpm@linux-foundation.org>: arch/parisc/include/asm/pgtable.h: remove unused `old_pte' Subsystem: vfs Jeff Layton <jlayton@redhat.com>: Patch series "vfs: have syncfs() return error when there are writeback: vfs: track per-sb writeback errors and report them to syncfs fs/buffer.c: record blockdev write errors in super_block that it backs Subsystem: mm/slab-generic Vlastimil Babka <vbabka@suse.cz>: usercopy: mark dma-kmalloc caches as usercopy caches Subsystem: mm/slub Dongli Zhang <dongli.zhang@oracle.com>: mm/slub.c: fix corrupted freechain in deactivate_slab() Christoph Lameter <cl@linux.com>: slub: Remove userspace notifier for cache add/remove Christopher Lameter <cl@linux.com>: slub: remove kmalloc under list_lock from list_slab_objects() V2 Qian Cai <cai@lca.pw>: mm/slub: fix stack overruns with SLUB_STATS Andrew Morton <akpm@linux-foundation.org>: Documentation/vm/slub.rst: s/Toggle/Enable/ Subsystem: mm/debug Vlastimil Babka <vbabka@suse.cz>: mm, dump_page(): do not crash with invalid mapping pointer Subsystem: mm/pagecache "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Change readahead API", v11: mm: move readahead prototypes from mm.h mm: return void from various readahead functions mm: ignore return value of ->readpages mm: move readahead nr_pages check into read_pages mm: add new readahead_control API mm: use readahead_control to pass arguments mm: rename various 'offset' parameters to 'index' mm: rename readahead loop variable to 'i' mm: remove 'page_offset' from readahead loop mm: put readahead pages in cache earlier mm: add readahead address space operation mm: move end_index check out of readahead loop mm: add page_cache_readahead_unbounded mm: document why we don't set PageReadahead mm: use memalloc_nofs_save in readahead path fs: convert mpage_readpages to mpage_readahead btrfs: convert from readpages to readahead erofs: convert uncompressed files from readpages to readahead erofs: convert compressed files from readpages to readahead ext4: convert from readpages to readahead ext4: pass the inode to ext4_mpage_readpages f2fs: convert from readpages to readahead f2fs: pass the inode to f2fs_mpage_readpages fuse: convert from readpages to readahead iomap: convert from readpages to readahead Guoqing Jiang <guoqing.jiang@cloud.ionos.com>: Patch series "Introduce attach/detach_page_private to cleanup code": include/linux/pagemap.h: introduce attach/detach_page_private md: remove __clear_page_buffers and use attach/detach_page_private btrfs: use attach/detach_page_private fs/buffer.c: use attach/detach_page_private f2fs: use attach/detach_page_private iomap: use attach/detach_page_private ntfs: replace attach_page_buffers with attach_page_private orangefs: use attach/detach_page_private buffer_head.h: remove attach_page_buffers mm/migrate.c: call detach_page_private to cleanup code mm_types.h: change set_page_private to inline function "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap.c: remove misleading comment Chao Yu <yuchao0@huawei.com>: mm/page-writeback.c: remove unused variable NeilBrown <neilb@suse.de>: mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead Subsystem: mm/gup Souptick Joarder <jrdr.linux@gmail.com>: mm/gup.c: update the documentation John Hubbard <jhubbard@nvidia.com>: mm/gup: introduce pin_user_pages_unlocked ivtv: convert get_user_pages() --> pin_user_pages() Miles Chen <miles.chen@mediatek.com>: mm/gup.c: further document vma_permits_fault() Subsystem: mm/swap chenqiwu <chenqiwu@xiaomi.com>: mm/swapfile: use list_{prev,next}_entry() instead of open-coding Qian Cai <cai@lca.pw>: mm/swap_state: fix a data race in swapin_nr_pages Andrea Righi <andrea.righi@canonical.com>: mm: swap: properly update readahead statistics in unuse_pte_range() Wei Yang <richard.weiyang@gmail.com>: mm/swapfile.c: offset is only used when there is more slots mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive mm/swapfile.c: remove the unnecessary goto for SSD case mm/swapfile.c: simplify the calculation of n_goal mm/swapfile.c: remove the extra check in scan_swap_map_slots() mm/swapfile.c: found_free could be represented by (tmp < max) mm/swapfile.c: tmp is always smaller than max mm/swapfile.c: omit a duplicate code by compare tmp and max first Huang Ying <ying.huang@intel.com>: swap: try to scan more free slots even when fragmented Wei Yang <richard.weiyang@gmail.com>: mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable mm/swapfile.c: __swap_entry_free() always free 1 entry Huang Ying <ying.huang@intel.com>: mm/swapfile.c: use prandom_u32_max() swap: reduce lock contention on swap cache from swap slots allocation Randy Dunlap <rdunlap@infradead.org>: mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment Miaohe Lin <linmiaohe@huawei.com>: include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration Subsystem: mm/memcg Yafang Shao <laoar.shao@gmail.com>: mm, memcg: add workingset_restore in memory.stat Kaixu Xia <kaixuxia@tencent.com>: mm: memcontrol: simplify value comparison between count and limit Shakeel Butt <shakeelb@google.com>: memcg: expose root cgroup's memory.stat Jakub Kicinski <kuba@kernel.org>: Patch series "memcg: Slow down swap allocation as the available space gets: mm/memcg: prepare for swap over-high accounting and penalty calculation mm/memcg: move penalty delay clamping out of calculate_high_delay() mm/memcg: move cgroup high memory limit setting into struct page_counter mm/memcg: automatically penalize tasks with high swap use Zefan Li <lizefan@huawei.com>: memcg: fix memcg_kmem_bypass() for remote memcg charging Subsystem: mm/pagemap Steven Price <steven.price@arm.com>: Patch series "Fix W+X debug feature on x86": x86: mm: ptdump: calculate effective permissions correctly mm: ptdump: expand type of 'val' in note_page() Huang Ying <ying.huang@intel.com>: /proc/PID/smaps: Add PMD migration entry parsing chenqiwu <chenqiwu@xiaomi.com>: mm/memory: remove unnecessary pte_devmap case in copy_one_pte() Subsystem: mm/memory-failure Wetp Zhang <wetp.zy@linux.alibaba.com>: mm, memory_failure: don't send BUS_MCEERR_AO for action required error Subsystem: mm/vmalloc Christoph Hellwig <hch@lst.de>: Patch series "decruft the vmalloc API", v2: x86/hyperv: use vmalloc_exec for the hypercall page x86: fix vmap arguments in map_irq_stack staging: android: ion: use vmap instead of vm_map_ram staging: media: ipu3: use vmap instead of reimplementing it dma-mapping: use vmap insted of reimplementing it powerpc: add an ioremap_phb helper powerpc: remove __ioremap_at and __iounmap_at mm: remove __get_vm_area mm: unexport unmap_kernel_range_noflush mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING mm: only allow page table mappings for built-in zsmalloc mm: pass addr as unsigned long to vb_free mm: remove vmap_page_range_noflush and vunmap_page_range mm: rename vmap_page_range to map_kernel_range mm: don't return the number of pages from map_kernel_range{,_noflush} mm: remove map_vm_range mm: remove unmap_vmap_area mm: remove the prot argument from vm_map_ram mm: enforce that vmap can't map pages executable gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc mm: remove the pgprot argument to __vmalloc mm: remove the prot argument to __vmalloc_node mm: remove both instances of __vmalloc_node_flags mm: remove __vmalloc_node_flags_caller mm: switch the test_vmalloc module to use __vmalloc_node mm: remove vmalloc_user_node_flags arm64: use __vmalloc_node in arch_alloc_vmap_stack powerpc: use __vmalloc_node in alloc_vm_stack s390: use __vmalloc_node in stack_alloc Joerg Roedel <jroedel@suse.de>: Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3: mm: add functions to track page directory modifications mm/vmalloc: track which page-table levels were modified mm/ioremap: track which page-table levels were modified x86/mm/64: implement arch_sync_kernel_mappings() x86/mm/32: implement arch_sync_kernel_mappings() mm: remove vmalloc_sync_(un)mappings() x86/mm: remove vmalloc faulting Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: fix clang compilation warning due to stack protector Kees Cook <keescook@chromium.org>: ubsan: entirely disable alignment checks under UBSAN_TRAP Jing Xia <jing.xia@unisoc.com>: mm/mm_init.c: report kasan-tag information stored in page->flags Andrey Konovalov <andreyknvl@google.com>: kasan: move kasan_report() into report.c Documentation/admin-guide/cgroup-v2.rst | 24 + Documentation/core-api/cachetlb.rst | 2 Documentation/filesystems/locking.rst | 6 Documentation/filesystems/proc.rst | 4 Documentation/filesystems/vfs.rst | 15 Documentation/vm/slub.rst | 2 arch/arm/configs/omap2plus_defconfig | 2 arch/arm64/include/asm/pgtable.h | 3 arch/arm64/include/asm/vmap_stack.h | 6 arch/arm64/mm/dump.c | 2 arch/parisc/include/asm/pgtable.h | 2 arch/powerpc/include/asm/io.h | 10 arch/powerpc/include/asm/pci-bridge.h | 2 arch/powerpc/kernel/irq.c | 5 arch/powerpc/kernel/isa-bridge.c | 28 + arch/powerpc/kernel/pci_64.c | 56 +- arch/powerpc/mm/ioremap_64.c | 50 -- arch/riscv/include/asm/pgtable.h | 4 arch/riscv/mm/ptdump.c | 2 arch/s390/kernel/setup.c | 9 arch/sh/kernel/cpu/sh4/sq.c | 3 arch/x86/hyperv/hv_init.c | 5 arch/x86/include/asm/kvm_host.h | 3 arch/x86/include/asm/pgtable-2level_types.h | 2 arch/x86/include/asm/pgtable-3level_types.h | 2 arch/x86/include/asm/pgtable_64_types.h | 2 arch/x86/include/asm/pgtable_types.h | 8 arch/x86/include/asm/switch_to.h | 23 - arch/x86/kernel/irq_64.c | 2 arch/x86/kernel/setup_percpu.c | 6 arch/x86/kvm/svm/sev.c | 3 arch/x86/mm/dump_pagetables.c | 35 + arch/x86/mm/fault.c | 196 ---------- arch/x86/mm/init_64.c | 5 arch/x86/mm/pti.c | 8 arch/x86/mm/tlb.c | 37 - block/blk-core.c | 1 drivers/acpi/apei/ghes.c | 6 drivers/base/node.c | 2 drivers/block/drbd/drbd_bitmap.c | 4 drivers/block/loop.c | 2 drivers/dax/device.c | 1 drivers/gpu/drm/drm_scatter.c | 11 drivers/gpu/drm/etnaviv/etnaviv_dump.c | 4 drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c | 2 drivers/lightnvm/pblk-init.c | 5 drivers/md/dm-bufio.c | 4 drivers/md/md-bitmap.c | 12 drivers/media/common/videobuf2/videobuf2-dma-sg.c | 3 drivers/media/common/videobuf2/videobuf2-vmalloc.c | 3 drivers/media/pci/ivtv/ivtv-udma.c | 19 - drivers/media/pci/ivtv/ivtv-yuv.c | 17 drivers/media/pci/ivtv/ivtvfb.c | 4 drivers/mtd/ubi/io.c | 4 drivers/pcmcia/electra_cf.c | 45 -- drivers/scsi/sd_zbc.c | 3 drivers/staging/android/ion/ion_heap.c | 4 drivers/staging/media/ipu3/ipu3-css-pool.h | 4 drivers/staging/media/ipu3/ipu3-dmamap.c | 30 - fs/block_dev.c | 7 fs/btrfs/disk-io.c | 4 fs/btrfs/extent_io.c | 64 --- fs/btrfs/extent_io.h | 3 fs/btrfs/inode.c | 39 -- fs/buffer.c | 23 - fs/erofs/data.c | 41 -- fs/erofs/decompressor.c | 2 fs/erofs/zdata.c | 31 - fs/exfat/inode.c | 7 fs/ext2/inode.c | 10 fs/ext4/ext4.h | 5 fs/ext4/inode.c | 25 - fs/ext4/readpage.c | 25 - fs/ext4/verity.c | 35 - fs/f2fs/data.c | 56 +- fs/f2fs/f2fs.h | 14 fs/f2fs/verity.c | 35 - fs/fat/inode.c | 7 fs/file_table.c | 1 fs/fs-writeback.c | 1 fs/fuse/file.c | 100 +---- fs/gfs2/aops.c | 23 - fs/gfs2/dir.c | 9 fs/gfs2/quota.c | 2 fs/hpfs/file.c | 7 fs/iomap/buffered-io.c | 113 +---- fs/iomap/trace.h | 2 fs/isofs/inode.c | 7 fs/jfs/inode.c | 7 fs/mpage.c | 38 -- fs/nfs/blocklayout/extent_tree.c | 2 fs/nfs/internal.h | 10 fs/nfs/write.c | 4 fs/nfsd/vfs.c | 9 fs/nilfs2/inode.c | 15 fs/ntfs/aops.c | 2 fs/ntfs/malloc.h | 2 fs/ntfs/mft.c | 2 fs/ocfs2/aops.c | 34 - fs/ocfs2/dlm/dlmmaster.c | 1 fs/ocfs2/ocfs2.h | 4 fs/ocfs2/slot_map.c | 46 +- fs/ocfs2/super.c | 21 + fs/omfs/file.c | 7 fs/open.c | 3 fs/orangefs/inode.c | 32 - fs/proc/meminfo.c | 3 fs/proc/task_mmu.c | 16 fs/qnx6/inode.c | 7 fs/reiserfs/inode.c | 8 fs/squashfs/block.c | 273 +++++++------- fs/squashfs/decompressor.h | 5 fs/squashfs/decompressor_multi.c | 9 fs/squashfs/decompressor_multi_percpu.c | 17 fs/squashfs/decompressor_single.c | 9 fs/squashfs/lz4_wrapper.c | 17 fs/squashfs/lzo_wrapper.c | 17 fs/squashfs/squashfs.h | 4 fs/squashfs/xz_wrapper.c | 51 +- fs/squashfs/zlib_wrapper.c | 63 +-- fs/squashfs/zstd_wrapper.c | 62 +-- fs/sync.c | 6 fs/ubifs/debug.c | 2 fs/ubifs/lprops.c | 2 fs/ubifs/lpt_commit.c | 4 fs/ubifs/orphan.c | 2 fs/udf/inode.c | 7 fs/xfs/kmem.c | 2 fs/xfs/xfs_aops.c | 13 fs/xfs/xfs_buf.c | 2 fs/zonefs/super.c | 7 include/asm-generic/5level-fixup.h | 5 include/asm-generic/pgtable.h | 27 + include/linux/buffer_head.h | 8 include/linux/fs.h | 18 include/linux/iomap.h | 3 include/linux/memcontrol.h | 4 include/linux/mm.h | 67 ++- include/linux/mm_types.h | 6 include/linux/mmzone.h | 1 include/linux/mpage.h | 4 include/linux/page_counter.h | 8 include/linux/pagemap.h | 193 ++++++++++ include/linux/ptdump.h | 3 include/linux/sched.h | 3 include/linux/swap.h | 17 include/linux/vmalloc.h | 49 +- include/linux/zsmalloc.h | 2 include/trace/events/erofs.h | 6 include/trace/events/f2fs.h | 6 include/trace/events/writeback.h | 5 kernel/bpf/core.c | 6 kernel/bpf/syscall.c | 29 - kernel/dma/remap.c | 48 -- kernel/groups.c | 2 kernel/module.c | 3 kernel/notifier.c | 1 kernel/sys.c | 2 kernel/trace/trace.c | 12 lib/Kconfig.ubsan | 2 lib/ioremap.c | 46 +- lib/test_vmalloc.c | 26 - mm/Kconfig | 4 mm/debug.c | 56 ++ mm/fadvise.c | 6 mm/filemap.c | 1 mm/gup.c | 77 +++- mm/internal.h | 14 mm/kasan/Makefile | 21 - mm/kasan/common.c | 19 - mm/kasan/report.c | 22 + mm/memcontrol.c | 198 +++++++--- mm/memory-failure.c | 15 mm/memory.c | 2 mm/migrate.c | 9 mm/mm_init.c | 16 mm/nommu.c | 52 +- mm/page-writeback.c | 62 ++- mm/page_alloc.c | 7 mm/percpu.c | 2 mm/ptdump.c | 17 mm/readahead.c | 349 ++++++++++-------- mm/slab_common.c | 3 mm/slub.c | 67 ++- mm/swap_state.c | 5 mm/swapfile.c | 194 ++++++---- mm/util.c | 2 mm/vmalloc.c | 399 ++++++++------------- mm/vmscan.c | 4 mm/vmstat.c | 11 mm/zsmalloc.c | 12 net/bridge/netfilter/ebtables.c | 6 net/ceph/ceph_common.c | 3 sound/core/memalloc.c | 2 sound/core/pcm_memory.c | 2 195 files changed, 2292 insertions(+), 2288 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-06-02 4:44 incoming Andrew Morton @ 2020-06-02 20:08 ` Andrew Morton 2020-06-02 20:45 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2020-06-02 20:08 UTC (permalink / raw) To: Linus Torvalds, mm-commits, linux-mm The local_lock merge made rather a mess of all of this. I'm cooking up a full resend of the same material. ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-06-02 20:08 ` incoming Andrew Morton @ 2020-06-02 20:45 ` Linus Torvalds 2020-06-02 21:38 ` incoming Andrew Morton 0 siblings, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2020-06-02 20:45 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Tue, Jun 2, 2020 at 1:08 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > The local_lock merge made rather a mess of all of this. I'm > cooking up a full resend of the same material. Hmm. I have no issues with conflicts, and already took your previous series. I've pushed it out now - does my tree match what you expect? Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-06-02 20:45 ` incoming Linus Torvalds @ 2020-06-02 21:38 ` Andrew Morton 2020-06-02 22:18 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2020-06-02 21:38 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, Linux-MM On Tue, 2 Jun 2020 13:45:49 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Tue, Jun 2, 2020 at 1:08 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > The local_lock merge made rather a mess of all of this. I'm > > cooking up a full resend of the same material. > > Hmm. I have no issues with conflicts, and already took your previous series. Well that's odd. > I've pushed it out now - does my tree match what you expect? Yup, thanks. ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-06-02 21:38 ` incoming Andrew Morton @ 2020-06-02 22:18 ` Linus Torvalds 0 siblings, 0 replies; 322+ messages in thread From: Linus Torvalds @ 2020-06-02 22:18 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Tue, Jun 2, 2020 at 2:38 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > On Tue, 2 Jun 2020 13:45:49 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > > > > Hmm. I have no issues with conflicts, and already took your previous series. > > Well that's odd. I meant "I saw the conflicts and had no issue with them". Nothing odd. And I actually much prefer seeing conflicts from your series (against other pulls I've done) over having you delay your patch bombs because of any fear for them. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-05-28 5:20 Andrew Morton 2020-05-28 20:10 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2020-05-28 5:20 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 5 fixes, based on 444fc5cde64330661bf59944c43844e7d4c2ccd8: Qian Cai <cai@lca.pw>: mm/z3fold: silence kmemleak false positives of slots Hugh Dickins <hughd@google.com>: mm,thp: stop leaking unreleased file pages Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm: remove VM_BUG_ON(PageSlab()) from page_mapcount() Alexander Potapenko <glider@google.com>: fs/binfmt_elf.c: allocate initialized memory in fill_thread_core_info() Arnd Bergmann <arnd@arndb.de>: include/asm-generic/topology.h: guard cpumask_of_node() macro argument fs/binfmt_elf.c | 2 +- include/asm-generic/topology.h | 2 +- include/linux/mm.h | 19 +++++++++++++++---- mm/khugepaged.c | 1 + mm/z3fold.c | 3 +++ 5 files changed, 21 insertions(+), 6 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-05-28 5:20 incoming Andrew Morton @ 2020-05-28 20:10 ` Linus Torvalds 2020-05-29 20:31 ` incoming Andrew Morton 0 siblings, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2020-05-28 20:10 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM Hmm.. On Wed, May 27, 2020 at 10:20 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > fs/binfmt_elf.c | 2 +- > include/asm-generic/topology.h | 2 +- > include/linux/mm.h | 19 +++++++++++++++---- > mm/khugepaged.c | 1 + > mm/z3fold.c | 3 +++ > 5 files changed, 21 insertions(+), 6 deletions(-) I wonder how you generate that diffstat. The change to <linux/mm.h> simply doesn't match what you sent me. The patch you sent me that changed mm.h had this: include/linux/mm.h | 15 +++++++++++++-- 1 file changed, 13 insertions(+), 2 deletions(-) (note 15 lines changed: it's +13 and -2) but now suddenly in your overall diffstat you have that include/linux/mm.h | 19 +++++++++++++++---- with +15/-4. So your diffstat simply doesn't match what you are sending. What's going on? Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-05-28 20:10 ` incoming Linus Torvalds @ 2020-05-29 20:31 ` Andrew Morton 2020-05-29 20:38 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2020-05-29 20:31 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, Linux-MM On Thu, 28 May 2020 13:10:18 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > Hmm.. > > On Wed, May 27, 2020 at 10:20 PM Andrew Morton > <akpm@linux-foundation.org> wrote: > > > > fs/binfmt_elf.c | 2 +- > > include/asm-generic/topology.h | 2 +- > > include/linux/mm.h | 19 +++++++++++++++---- > > mm/khugepaged.c | 1 + > > mm/z3fold.c | 3 +++ > > 5 files changed, 21 insertions(+), 6 deletions(-) > > I wonder how you generate that diffstat. > > The change to <linux/mm.h> simply doesn't match what you sent me. The > patch you sent me that changed mm.h had this: > > include/linux/mm.h | 15 +++++++++++++-- > 1 file changed, 13 insertions(+), 2 deletions(-) > > (note 15 lines changed: it's +13 and -2) but now suddenly in your > overall diffstat you have that > > include/linux/mm.h | 19 +++++++++++++++---- > > with +15/-4. > > So your diffstat simply doesn't match what you are sending. What's going on? > Bah. I got lazy (didn't want to interrupt an ongoing build) so I generated the diffstat prior to folding two patches into a single one. Evidently diffstat isn't as smart as I had assumed! ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-05-29 20:31 ` incoming Andrew Morton @ 2020-05-29 20:38 ` Linus Torvalds 2020-05-29 21:12 ` incoming Andrew Morton 0 siblings, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2020-05-29 20:38 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Fri, May 29, 2020 at 1:31 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > Bah. I got lazy (didn't want to interrupt an ongoing build) so I > generated the diffstat prior to folding two patches into a single one. > Evidently diffstat isn't as smart as I had assumed! Ahh. Yes - given two patches, diffstat just adds up the line number counts for the individual diffs, it doesn't count some kind of "combined diff result" line counts. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-05-29 20:38 ` incoming Linus Torvalds @ 2020-05-29 21:12 ` Andrew Morton 2020-05-29 21:20 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2020-05-29 21:12 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, Linux-MM On Fri, 29 May 2020 13:38:35 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Fri, May 29, 2020 at 1:31 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > Bah. I got lazy (didn't want to interrupt an ongoing build) so I > > generated the diffstat prior to folding two patches into a single one. > > Evidently diffstat isn't as smart as I had assumed! > > Ahh. Yes - given two patches, diffstat just adds up the line number > counts for the individual diffs, it doesn't count some kind of > "combined diff result" line counts. Stupid diffstat. Means that basically all my diffstats are very wrong. Thanks for spotting it. I can fix that... ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-05-29 21:12 ` incoming Andrew Morton @ 2020-05-29 21:20 ` Linus Torvalds 0 siblings, 0 replies; 322+ messages in thread From: Linus Torvalds @ 2020-05-29 21:20 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Fri, May 29, 2020 at 2:12 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > Stupid diffstat. Means that basically all my diffstats are very wrong. I'm actually used to diffstats not matching 100%/ Usually it's not due to this issue - a "git diff --stat" *will* give the stat from the actual combined diff result - but with git diffstats the issue is that I might have gotten a patch from another source. So the diffstat I see after-the-merge is possibly different from the pre-merge diffstat simply due to merge issues. So then I usually take a look at "ok, why did that diffstat differ" and go "Ahh". In your case, when I looked at the diffstat, I couldn't for the life of me see how you would have gotten the diffstat you did, since I only saw a single patch with no merge issues. > Thanks for spotting it. > > I can fix that... I can also just live with it, knowing what your workflow is. The diffstat matching exactly just isn't that important - in fact, different versions of "diff" can give slightly different output anyway depending on diff algorithms even when they are looking at the exact same before/after state. There's not necessarily always only one way to generate a valid diff. So to me, the diffstat is more of a guide than a hard thing, and I want to see the rough outline, In fact, one reason I want to see it in pull requests is actually just that I want to get a feel for what changes even before I do the pull or merge, so it's not just a "match against what I get" thing. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-05-23 5:22 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-05-23 5:22 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 11 fixes, based on 444565650a5fe9c63ddf153e6198e31705dedeb2: David Hildenbrand <david@redhat.com>: device-dax: don't leak kernel memory to user space after unloading kmem Nick Desaulniers <ndesaulniers@google.com>: x86: bitops: fix build regression John Hubbard <jhubbard@nvidia.com>: rapidio: fix an error in get_user_pages_fast() error handling selftests/vm/.gitignore: add mremap_dontunmap selftests/vm/write_to_hugetlbfs.c: fix unused variable warning Marco Elver <elver@google.com>: kasan: disable branch tracing for core runtime Arnd Bergmann <arnd@arndb.de>: sh: include linux/time_types.h for sockios Naoya Horiguchi <n-horiguchi@ah.jp.nec.com>: MAINTAINERS: update email address for Naoya Horiguchi Mike Rapoport <rppt@linux.ibm.com>: sparc32: use PUD rather than PGD to get PMD in srmmu_nocache_init() Uladzislau Rezki <uladzislau.rezki@sony.com>: z3fold: fix use-after-free when freeing handles Baoquan He <bhe@redhat.com>: MAINTAINERS: add files related to kdump MAINTAINERS | 7 ++++++- arch/sh/include/uapi/asm/sockios.h | 2 ++ arch/sparc/mm/srmmu.c | 2 +- arch/x86/include/asm/bitops.h | 12 ++++++------ drivers/dax/kmem.c | 14 +++++++++++--- drivers/rapidio/devices/rio_mport_cdev.c | 5 +++++ mm/kasan/Makefile | 16 ++++++++-------- mm/kasan/generic.c | 1 - mm/kasan/tags.c | 1 - mm/z3fold.c | 11 ++++++----- tools/testing/selftests/vm/.gitignore | 1 + tools/testing/selftests/vm/write_to_hugetlbfs.c | 2 -- 12 files changed, 46 insertions(+), 28 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-05-14 0:50 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-05-14 0:50 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 7 fixes, based on 24085f70a6e1b0cb647ec92623284641d8270637: Yafang Shao <laoar.shao@gmail.com>: mm, memcg: fix inconsistent oom event behavior Roman Penyaev <rpenyaev@suse.de>: epoll: call final ep_events_available() check under the lock Peter Xu <peterx@redhat.com>: mm/gup: fix fixup_user_fault() on multiple retries Brian Geffon <bgeffon@google.com>: userfaultfd: fix remap event with MREMAP_DONTUNMAP Vasily Averin <vvs@virtuozzo.com>: ipc/util.c: sysvipc_find_ipc() incorrectly updates position index Andrey Konovalov <andreyknvl@google.com>: kasan: consistently disable debugging features kasan: add missing functions declarations to kasan.h fs/eventpoll.c | 48 ++++++++++++++++++++++++++------------------- include/linux/memcontrol.h | 2 + ipc/util.c | 12 +++++------ mm/gup.c | 12 ++++++----- mm/kasan/Makefile | 15 +++++++++----- mm/kasan/kasan.h | 34 ++++++++++++++++++++++++++++++- mm/mremap.c | 2 - 7 files changed, 86 insertions(+), 39 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-05-08 1:35 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-05-08 1:35 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 14 fixes and one selftest to verify the ipc fixes herein. 15 patches, based on a811c1fa0a02c062555b54651065899437bacdbe: Oleg Nesterov <oleg@redhat.com>: ipc/mqueue.c: change __do_notify() to bypass check_kill_permission() Yafang Shao <laoar.shao@gmail.com>: mm, memcg: fix error return value of mem_cgroup_css_alloc() David Hildenbrand <david@redhat.com>: mm/page_alloc: fix watchdog soft lockups during set_zone_contiguous() Maciej Grochowski <maciej.grochowski@pm.me>: kernel/kcov.c: fix typos in kcov_remote_start documentation Ivan Delalande <colona@arista.com>: scripts/decodecode: fix trapping instruction formatting Janakarajan Natarajan <Janakarajan.Natarajan@amd.com>: arch/x86/kvm/svm/sev.c: change flag passed to GUP fast in sev_pin_memory() Khazhismel Kumykov <khazhy@google.com>: eventpoll: fix missing wakeup for ovflist in ep_poll_callback Aymeric Agon-Rambosson <aymeric.agon@yandex.com>: scripts/gdb: repair rb_first() and rb_last() Waiman Long <longman@redhat.com>: mm/slub: fix incorrect interpretation of s->offset Filipe Manana <fdmanana@suse.com>: percpu: make pcpu_alloc() aware of current gfp context Roman Penyaev <rpenyaev@suse.de>: kselftests: introduce new epoll60 testcase for catching lost wakeups epoll: atomically remove wait entry on wake up Qiwu Chen <qiwuchen55@gmail.com>: mm/vmscan: remove unnecessary argument description of isolate_lru_pages() Kees Cook <keescook@chromium.org>: ubsan: disable UBSAN_ALIGNMENT under COMPILE_TEST Henry Willard <henry.willard@oracle.com>: mm: limit boost_watermark on small zones arch/x86/kvm/svm/sev.c | 2 fs/eventpoll.c | 61 ++-- ipc/mqueue.c | 34 +- kernel/kcov.c | 4 lib/Kconfig.ubsan | 15 - mm/memcontrol.c | 15 - mm/page_alloc.c | 9 mm/percpu.c | 14 mm/slub.c | 45 ++- mm/vmscan.c | 1 scripts/decodecode | 2 scripts/gdb/linux/rbtree.py | 4 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 146 ++++++++++ tools/testing/selftests/wireguard/qemu/debug.config | 1 14 files changed, 275 insertions(+), 78 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-04-21 1:13 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-04-21 1:13 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 15 fixes, based on ae83d0b416db002fe95601e7f97f64b59514d936: Masahiro Yamada <masahiroy@kernel.org>: sh: fix build error in mm/init.c Kees Cook <keescook@chromium.org>: slub: avoid redzone when choosing freepointer location Peter Xu <peterx@redhat.com>: mm/userfaultfd: disable userfaultfd-wp on x86_32 Bartosz Golaszewski <bgolaszewski@baylibre.com>: MAINTAINERS: add an entry for kfifo Longpeng <longpeng2@huawei.com>: mm/hugetlb: fix a addressing exception caused by huge_pte_offset Michal Hocko <mhocko@suse.com>: mm, gup: return EINTR when gup is interrupted by fatal signals Christophe JAILLET <christophe.jaillet@wanadoo.fr>: checkpatch: fix a typo in the regex for $allocFunctions George Burgess IV <gbiv@google.com>: tools/build: tweak unused value workaround Muchun Song <songmuchun@bytedance.com>: mm/ksm: fix NULL pointer dereference when KSM zero page is enabled Hugh Dickins <hughd@google.com>: mm/shmem: fix build without THP Jann Horn <jannh@google.com>: vmalloc: fix remap_vmalloc_range() bounds checks Hugh Dickins <hughd@google.com>: shmem: fix possible deadlocks on shmlock_user_lock Yang Shi <yang.shi@linux.alibaba.com>: mm: shmem: disable interrupt when acquiring info->lock in userfaultfd_copy path Sudip Mukherjee <sudipm.mukherjee@gmail.com>: coredump: fix null pointer dereference on coredump Lucas Stach <l.stach@pengutronix.de>: tools/vm: fix cross-compile build MAINTAINERS | 7 +++++++ arch/sh/mm/init.c | 2 +- arch/x86/Kconfig | 2 +- fs/coredump.c | 2 ++ fs/proc/vmcore.c | 5 +++-- include/linux/vmalloc.h | 2 +- mm/gup.c | 2 +- mm/hugetlb.c | 14 ++++++++------ mm/ksm.c | 12 ++++++++++-- mm/shmem.c | 13 ++++++++----- mm/slub.c | 12 ++++++++++-- mm/vmalloc.c | 16 +++++++++++++--- samples/vfio-mdev/mdpy.c | 2 +- scripts/checkpatch.pl | 2 +- tools/build/feature/test-sync-compare-and-swap.c | 2 +- tools/vm/Makefile | 2 ++ 16 files changed, 70 insertions(+), 27 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-04-12 7:41 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-04-12 7:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm A straggler. This patch caused a lot of build errors on a lot of architectures for a long time, but Anshuman believes it's all fixed up now. 1 patch, based on GIT b032227c62939b5481bcd45442b36dfa263f4a7c. Anshuman Khandual <anshuman.khandual@arm.com>: mm/debug: add tests validating architecture page table helpers Documentation/features/debug/debug-vm-pgtable/arch-support.txt | 34 arch/arc/Kconfig | 1 arch/arm64/Kconfig | 1 arch/powerpc/Kconfig | 1 arch/s390/Kconfig | 1 arch/x86/Kconfig | 1 arch/x86/include/asm/pgtable_64.h | 6 include/linux/mmdebug.h | 5 init/main.c | 2 lib/Kconfig.debug | 26 mm/Makefile | 1 mm/debug_vm_pgtable.c | 392 ++++++++++ 12 files changed, 471 insertions(+) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-04-10 21:30 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-04-10 21:30 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm Almost all of the rest of MM. Various other things. 35 patches, based on c0cc271173b2e1c2d8d0ceaef14e4dfa79eefc0d. Subsystems affected by this patch series: hfs mm/memcg mm/slab-generic mm/slab mm/pagealloc mm/gup ocfs2 mm/hugetlb mm/pagemap mm/memremap kmod misc seqfile Subsystem: hfs Simon Gander <simon@tuxera.com>: hfsplus: fix crash and filesystem corruption when deleting files Subsystem: mm/memcg Jakub Kicinski <kuba@kernel.org>: mm, memcg: do not high throttle allocators based on wraparound Subsystem: mm/slab-generic Qiujun Huang <hqjagain@gmail.com>: mm, slab_common: fix a typo in comment "eariler"->"earlier" Subsystem: mm/slab Mauro Carvalho Chehab <mchehab+huawei@kernel.org>: docs: mm: slab.h: fix a broken cross-reference Subsystem: mm/pagealloc Randy Dunlap <rdunlap@infradead.org>: mm/page_alloc.c: fix kernel-doc warning Jason Yan <yanaijie@huawei.com>: mm/page_alloc: make pcpu_drain_mutex and pcpu_drain static Subsystem: mm/gup Miles Chen <miles.chen@mediatek.com>: mm/gup: fix null pointer dereference detected by coverity Subsystem: ocfs2 Changwei Ge <chge@linux.alibaba.com>: ocfs2: no need try to truncate file beyond i_size Subsystem: mm/hugetlb Aslan Bakirov <aslan@fb.com>: mm: cma: NUMA node interface Roman Gushchin <guro@fb.com>: mm: hugetlb: optionally allocate gigantic hugepages using cma Subsystem: mm/pagemap Jaewon Kim <jaewon31.kim@samsung.com>: mm/mmap.c: initialize align_offset explicitly for vm_unmapped_area Arjun Roy <arjunroy@google.com>: mm/memory.c: refactor insert_page to prepare for batched-lock insert mm: bring sparc pte_index() semantics inline with other platforms mm: define pte_index as macro for x86 mm/memory.c: add vm_insert_pages() Anshuman Khandual <anshuman.khandual@arm.com>: mm/vma: define a default value for VM_DATA_DEFAULT_FLAGS mm/vma: introduce VM_ACCESS_FLAGS mm/special: create generic fallbacks for pte_special() and pte_mkspecial() Subsystem: mm/memremap Logan Gunthorpe <logang@deltatee.com>: Patch series "Allow setting caching mode in arch_add_memory() for P2PDMA", v4: mm/memory_hotplug: drop the flags field from struct mhp_restrictions mm/memory_hotplug: rename mhp_restrictions to mhp_params x86/mm: thread pgprot_t through init_memory_mapping() x86/mm: introduce __set_memory_prot() powerpc/mm: thread pgprot_t through create_section_mapping() mm/memory_hotplug: add pgprot_t to mhp_params mm/memremap: set caching mode for PCI P2PDMA memory to WC Subsystem: kmod Eric Biggers <ebiggers@google.com>: Patch series "module autoloading fixes and cleanups", v5: kmod: make request_module() return an error when autoloading is disabled fs/filesystems.c: downgrade user-reachable WARN_ONCE() to pr_warn_once() docs: admin-guide: document the kernel.modprobe sysctl selftests: kmod: fix handling test numbers above 9 selftests: kmod: test disabling module autoloading Subsystem: misc Pali Rohár <pali@kernel.org>: change email address for Pali Rohár kbuild test robot <lkp@intel.com>: drivers/dma/tegra20-apb-dma.c: fix platform_get_irq.cocci warnings Subsystem: seqfile Vasily Averin <vvs@virtuozzo.com>: Patch series "seq_file .next functions should increase position index": fs/seq_file.c: seq_read(): add info message about buggy .next functions kernel/gcov/fs.c: gcov_seq_next() should increase position index ipc/util.c: sysvipc_find_ipc() should increase position index Documentation/ABI/testing/sysfs-platform-dell-laptop | 8 Documentation/admin-guide/kernel-parameters.txt | 8 Documentation/admin-guide/sysctl/kernel.rst | 21 ++ MAINTAINERS | 16 - arch/alpha/include/asm/page.h | 3 arch/alpha/include/asm/pgtable.h | 2 arch/arc/include/asm/page.h | 2 arch/arm/include/asm/page.h | 4 arch/arm/include/asm/pgtable-2level.h | 2 arch/arm/include/asm/pgtable.h | 15 - arch/arm/mach-omap2/omap-secure.c | 2 arch/arm/mach-omap2/omap-secure.h | 2 arch/arm/mach-omap2/omap-smc.S | 2 arch/arm/mm/fault.c | 2 arch/arm/mm/mmu.c | 14 + arch/arm64/include/asm/page.h | 4 arch/arm64/mm/fault.c | 2 arch/arm64/mm/init.c | 6 arch/arm64/mm/mmu.c | 7 arch/c6x/include/asm/page.h | 5 arch/csky/include/asm/page.h | 3 arch/csky/include/asm/pgtable.h | 3 arch/h8300/include/asm/page.h | 2 arch/hexagon/include/asm/page.h | 3 arch/hexagon/include/asm/pgtable.h | 2 arch/ia64/include/asm/page.h | 5 arch/ia64/include/asm/pgtable.h | 2 arch/ia64/mm/init.c | 7 arch/m68k/include/asm/mcf_pgtable.h | 10 - arch/m68k/include/asm/motorola_pgtable.h | 2 arch/m68k/include/asm/page.h | 3 arch/m68k/include/asm/sun3_pgtable.h | 2 arch/microblaze/include/asm/page.h | 2 arch/microblaze/include/asm/pgtable.h | 4 arch/mips/include/asm/page.h | 5 arch/mips/include/asm/pgtable.h | 44 +++- arch/nds32/include/asm/page.h | 3 arch/nds32/include/asm/pgtable.h | 9 - arch/nds32/mm/fault.c | 2 arch/nios2/include/asm/page.h | 3 arch/nios2/include/asm/pgtable.h | 3 arch/openrisc/include/asm/page.h | 5 arch/openrisc/include/asm/pgtable.h | 2 arch/parisc/include/asm/page.h | 3 arch/parisc/include/asm/pgtable.h | 2 arch/powerpc/include/asm/book3s/64/hash.h | 3 arch/powerpc/include/asm/book3s/64/radix.h | 3 arch/powerpc/include/asm/page.h | 9 - arch/powerpc/include/asm/page_64.h | 7 arch/powerpc/include/asm/sparsemem.h | 3 arch/powerpc/mm/book3s64/hash_utils.c | 5 arch/powerpc/mm/book3s64/pgtable.c | 7 arch/powerpc/mm/book3s64/pkeys.c | 2 arch/powerpc/mm/book3s64/radix_pgtable.c | 18 +- arch/powerpc/mm/mem.c | 12 - arch/riscv/include/asm/page.h | 3 arch/s390/include/asm/page.h | 3 arch/s390/mm/fault.c | 2 arch/s390/mm/init.c | 9 - arch/sh/include/asm/page.h | 3 arch/sh/mm/init.c | 7 arch/sparc/include/asm/page_32.h | 3 arch/sparc/include/asm/page_64.h | 3 arch/sparc/include/asm/pgtable_32.h | 7 arch/sparc/include/asm/pgtable_64.h | 10 - arch/um/include/asm/pgtable.h | 10 - arch/unicore32/include/asm/page.h | 3 arch/unicore32/include/asm/pgtable.h | 3 arch/unicore32/mm/fault.c | 2 arch/x86/include/asm/page_types.h | 7 arch/x86/include/asm/pgtable.h | 6 arch/x86/include/asm/set_memory.h | 1 arch/x86/kernel/amd_gart_64.c | 3 arch/x86/kernel/setup.c | 4 arch/x86/mm/init.c | 9 - arch/x86/mm/init_32.c | 19 +- arch/x86/mm/init_64.c | 42 ++-- arch/x86/mm/mm_internal.h | 3 arch/x86/mm/pat/set_memory.c | 13 + arch/x86/mm/pkeys.c | 2 arch/x86/platform/uv/bios_uv.c | 3 arch/x86/um/asm/vm-flags.h | 10 - arch/xtensa/include/asm/page.h | 3 arch/xtensa/include/asm/pgtable.h | 3 drivers/char/hw_random/omap3-rom-rng.c | 4 drivers/dma/tegra20-apb-dma.c | 1 drivers/hwmon/dell-smm-hwmon.c | 4 drivers/platform/x86/dell-laptop.c | 4 drivers/platform/x86/dell-rbtn.c | 4 drivers/platform/x86/dell-rbtn.h | 2 drivers/platform/x86/dell-smbios-base.c | 4 drivers/platform/x86/dell-smbios-smm.c | 2 drivers/platform/x86/dell-smbios.h | 2 drivers/platform/x86/dell-smo8800.c | 2 drivers/platform/x86/dell-wmi.c | 4 drivers/power/supply/bq2415x_charger.c | 4 drivers/power/supply/bq27xxx_battery.c | 2 drivers/power/supply/isp1704_charger.c | 2 drivers/power/supply/rx51_battery.c | 4 drivers/staging/gasket/gasket_core.c | 2 fs/filesystems.c | 4 fs/hfsplus/attributes.c | 4 fs/ocfs2/alloc.c | 4 fs/seq_file.c | 7 fs/udf/ecma_167.h | 2 fs/udf/osta_udf.h | 2 include/linux/cma.h | 14 + include/linux/hugetlb.h | 12 + include/linux/memblock.h | 3 include/linux/memory_hotplug.h | 21 +- include/linux/mm.h | 34 +++ include/linux/power/bq2415x_charger.h | 2 include/linux/slab.h | 2 ipc/util.c | 2 kernel/gcov/fs.c | 2 kernel/kmod.c | 4 mm/cma.c | 16 + mm/gup.c | 3 mm/hugetlb.c | 109 ++++++++++++ mm/memblock.c | 2 mm/memcontrol.c | 3 mm/memory.c | 168 +++++++++++++++++-- mm/memory_hotplug.c | 13 - mm/memremap.c | 17 + mm/mmap.c | 4 mm/mprotect.c | 4 mm/page_alloc.c | 5 mm/slab_common.c | 2 tools/laptop/freefall/freefall.c | 2 tools/testing/selftests/kmod/kmod.sh | 43 ++++ 130 files changed, 710 insertions(+), 370 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-04-07 3:02 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-04-07 3:02 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits - a lot more of MM, quite a bit more yet to come. - various other subsystems 166 patches based on 7e63420847ae5f1036e4f7c42f0b3282e73efbc2. Subsystems affected by this patch series: mm/memcg mm/pagemap mm/vmalloc mm/pagealloc mm/migration mm/thp mm/ksm mm/madvise mm/virtio mm/userfaultfd mm/memory-hotplug mm/shmem mm/rmap mm/zswap mm/zsmalloc mm/cleanups procfs misc MAINTAINERS bitops lib checkpatch epoll binfmt kallsyms reiserfs kmod gcov kconfig kcov ubsan fault-injection ipc Subsystem: mm/memcg Chris Down <chris@chrisdown.name>: mm, memcg: bypass high reclaim iteration for cgroup hierarchy root Subsystem: mm/pagemap Li Xinhai <lixinhai.lxh@gmail.com>: Patch series "mm: Fix misuse of parent anon_vma in dup_mmap path": mm: don't prepare anon_vma if vma has VM_WIPEONFORK Revert "mm/rmap.c: reuse mergeable anon_vma as parent when fork" mm: set vm_next and vm_prev to NULL in vm_area_dup() Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/vma: Use all available wrappers when possible", v2: mm/vma: add missing VMA flag readable name for VM_SYNC mm/vma: make vma_is_accessible() available for general use mm/vma: replace all remaining open encodings with is_vm_hugetlb_page() mm/vma: replace all remaining open encodings with vma_is_anonymous() mm/vma: append unlikely() while testing VMA access permissions Subsystem: mm/vmalloc Qiujun Huang <hqjagain@gmail.com>: mm/vmalloc: fix a typo in comment Subsystem: mm/pagealloc Michal Hocko <mhocko@suse.com>: mm: make it clear that gfp reclaim modifiers are valid only for sleepable allocations Subsystem: mm/migration Wei Yang <richardw.yang@linux.intel.com>: Patch series "cleanup on do_pages_move()", v5: mm/migrate.c: no need to check for i > start in do_pages_move() mm/migrate.c: wrap do_move_pages_to_node() and store_status() mm/migrate.c: check pagelist in move_pages_and_store_status() mm/migrate.c: unify "not queued for migration" handling in do_pages_move() Yang Shi <yang.shi@linux.alibaba.com>: mm/migrate.c: migrate PG_readahead flag Subsystem: mm/thp David Rientjes <rientjes@google.com>: mm, shmem: add vmstat for hugepage fallback mm, thp: track fallbacks due to failed memcg charges separately "Matthew Wilcox (Oracle)" <willy@infradead.org>: include/linux/pagemap.h: optimise find_subpage for !THP mm: remove CONFIG_TRANSPARENT_HUGE_PAGECACHE Subsystem: mm/ksm Li Chen <chenli@uniontech.com>: mm/ksm.c: update get_user_pages() argument in comment Subsystem: mm/madvise Huang Ying <ying.huang@intel.com>: mm: code cleanup for MADV_FREE Subsystem: mm/virtio Alexander Duyck <alexander.h.duyck@linux.intel.com>: Patch series "mm / virtio: Provide support for free page reporting", v17: mm: adjust shuffle code to allow for future coalescing mm: use zone and order instead of free area in free_list manipulators mm: add function __putback_isolated_page mm: introduce Reported pages virtio-balloon: pull page poisoning config out of free page hinting virtio-balloon: add support for providing free page reports to host mm/page_reporting: rotate reported pages to the tail of the list mm/page_reporting: add budget limit on how many pages can be reported per pass mm/page_reporting: add free page reporting documentation David Hildenbrand <david@redhat.com>: virtio-balloon: switch back to OOM handler for VIRTIO_BALLOON_F_DEFLATE_ON_OOM Subsystem: mm/userfaultfd Shaohua Li <shli@fb.com>: Patch series "userfaultfd: write protection support", v6: userfaultfd: wp: add helper for writeprotect check Andrea Arcangeli <aarcange@redhat.com>: userfaultfd: wp: hook userfault handler to write protection fault userfaultfd: wp: add WP pagetable tracking to x86 userfaultfd: wp: userfaultfd_pte/huge_pmd_wp() helpers userfaultfd: wp: add UFFDIO_COPY_MODE_WP Peter Xu <peterx@redhat.com>: mm: merge parameters for change_protection() userfaultfd: wp: apply _PAGE_UFFD_WP bit userfaultfd: wp: drop _PAGE_UFFD_WP properly when fork userfaultfd: wp: add pmd_swp_*uffd_wp() helpers userfaultfd: wp: support swap and page migration khugepaged: skip collapse if uffd-wp detected Shaohua Li <shli@fb.com>: userfaultfd: wp: support write protection for userfault vma range Andrea Arcangeli <aarcange@redhat.com>: userfaultfd: wp: add the writeprotect API to userfaultfd ioctl Shaohua Li <shli@fb.com>: userfaultfd: wp: enabled write protection in userfaultfd API Peter Xu <peterx@redhat.com>: userfaultfd: wp: don't wake up when doing write protect Martin Cracauer <cracauer@cons.org>: userfaultfd: wp: UFFDIO_REGISTER_MODE_WP documentation update Peter Xu <peterx@redhat.com>: userfaultfd: wp: declare _UFFDIO_WRITEPROTECT conditionally userfaultfd: selftests: refactor statistics userfaultfd: selftests: add write-protect test Subsystem: mm/memory-hotplug David Hildenbrand <david@redhat.com>: Patch series "mm: drop superfluous section checks when onlining/offlining": drivers/base/memory.c: drop section_count drivers/base/memory.c: drop pages_correctly_probed() mm/page_ext.c: drop pfn_present() check when onlining Baoquan He <bhe@redhat.com>: mm/memory_hotplug.c: only respect mem= parameter during boot stage David Hildenbrand <david@redhat.com>: mm/memory_hotplug.c: simplify calculation of number of pages in __remove_pages() mm/memory_hotplug.c: cleanup __add_pages() Baoquan He <bhe@redhat.com>: Patch series "mm/hotplug: Only use subsection map for VMEMMAP", v4: mm/sparse.c: introduce new function fill_subsection_map() mm/sparse.c: introduce a new function clear_subsection_map() mm/sparse.c: only use subsection map in VMEMMAP case mm/sparse.c: add note about only VMEMMAP supporting sub-section hotplug mm/sparse.c: move subsection_map related functions together David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: allow to specify a default online_type", v3: drivers/base/memory: rename MMOP_ONLINE_KEEP to MMOP_ONLINE drivers/base/memory: map MMOP_OFFLINE to 0 drivers/base/memory: store mapping between MMOP_* and string in an array powernv/memtrace: always online added memory blocks hv_balloon: don't check for memhp_auto_online manually mm/memory_hotplug: unexport memhp_auto_online mm/memory_hotplug: convert memhp_auto_online to store an online_type mm/memory_hotplug: allow to specify a default online_type chenqiwu <chenqiwu@xiaomi.com>: mm/memory_hotplug.c: use __pfn_to_section() instead of open-coding Subsystem: mm/shmem Kees Cook <keescook@chromium.org>: mm/shmem.c: distribute switch variables for initialization Mateusz Nosek <mateusznosek0@gmail.com>: mm/shmem.c: clean code by removing unnecessary assignment Hugh Dickins <hughd@google.com>: mm: huge tmpfs: try to split_huge_page() when punching hole Subsystem: mm/rmap Palmer Dabbelt <palmerdabbelt@google.com>: mm: prevent a warning when casting void* -> enum Subsystem: mm/zswap "Maciej S. Szmigiero" <mail@maciej.szmigiero.name>: mm/zswap: allow setting default status, compressor and allocator in Kconfig Subsystem: mm/zsmalloc Subsystem: mm/cleanups Jules Irenge <jbi.octave@gmail.com>: mm/compaction: add missing annotation for compact_lock_irqsave mm/hugetlb: add missing annotation for gather_surplus_pages() mm/mempolicy: add missing annotation for queue_pages_pmd() mm/slub: add missing annotation for get_map() mm/slub: add missing annotation for put_map() mm/zsmalloc: add missing annotation for migrate_read_lock() mm/zsmalloc: add missing annotation for migrate_read_unlock() mm/zsmalloc: add missing annotation for pin_tag() mm/zsmalloc: add missing annotation for unpin_tag() chenqiwu <chenqiwu@xiaomi.com>: mm: fix ambiguous comments for better code readability Mateusz Nosek <mateusznosek0@gmail.com>: mm/mm_init.c: clean code. Use BUILD_BUG_ON when comparing compile time constant Joe Perches <joe@perches.com>: mm: use fallthrough; Steven Price <steven.price@arm.com>: include/linux/swapops.h: correct guards for non_swap_entry() Ira Weiny <ira.weiny@intel.com>: include/linux/memremap.h: remove stale comments Mateusz Nosek <mateusznosek0@gmail.com>: mm/dmapool.c: micro-optimisation remove unnecessary branch Waiman Long <longman@redhat.com>: mm: remove dummy struct bootmem_data/bootmem_data_t Subsystem: procfs Jules Irenge <jbi.octave@gmail.com>: fs/proc/inode.c: annotate close_pdeo() for sparse Alexey Dobriyan <adobriyan@gmail.com>: proc: faster open/read/close with "permanent" files proc: speed up /proc/*/statm "Matthew Wilcox (Oracle)" <willy@infradead.org>: proc: inline vma_stop into m_stop proc: remove m_cache_vma proc: use ppos instead of m->version seq_file: remove m->version proc: inline m_next_vma into m_next Subsystem: misc Michal Simek <michal.simek@xilinx.com>: asm-generic: fix unistd_32.h generation format Nathan Chancellor <natechancellor@gmail.com>: kernel/extable.c: use address-of operator on section symbols Masahiro Yamada <masahiroy@kernel.org>: sparc,x86: vdso: remove meaningless undefining CONFIG_OPTIMIZE_INLINING compiler: remove CONFIG_OPTIMIZE_INLINING entirely Vegard Nossum <vegard.nossum@oracle.com>: compiler.h: fix error in BUILD_BUG_ON() reporting Subsystem: MAINTAINERS Joe Perches <joe@perches.com>: MAINTAINERS: list the section entries in the preferred order Subsystem: bitops Josh Poimboeuf <jpoimboe@redhat.com>: bitops: always inline sign extension helpers Subsystem: lib Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: lib/test_lockup: test module to generate lockups Colin Ian King <colin.king@canonical.com>: lib/test_lockup.c: fix spelling mistake "iteraions" -> "iterations" Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: lib/test_lockup.c: add parameters for locking generic vfs locks "Gustavo A. R. Silva" <gustavo@embeddedor.com>: lib/bch.c: replace zero-length array with flexible-array member lib/ts_bm.c: replace zero-length array with flexible-array member lib/ts_fsm.c: replace zero-length array with flexible-array member lib/ts_kmp.c: replace zero-length array with flexible-array member Geert Uytterhoeven <geert+renesas@glider.be>: lib/scatterlist: fix sg_copy_buffer() kerneldoc Kees Cook <keescook@chromium.org>: lib: test_stackinit.c: XFAIL switch variable init tests Alexander Potapenko <glider@google.com>: lib/stackdepot.c: check depot_index before accessing the stack slab lib/stackdepot.c: fix a condition in stack_depot_fetch() lib/stackdepot.c: build with -fno-builtin kasan: stackdepot: move filter_irq_stacks() to stackdepot.c Qian Cai <cai@lca.pw>: percpu_counter: fix a data race at vm_committed_as Andy Shevchenko <andriy.shevchenko@linux.intel.com>: lib/test_bitmap.c: make use of EXP2_IN_BITS chenqiwu <chenqiwu@xiaomi.com>: lib/rbtree: fix coding style of assignments Dan Carpenter <dan.carpenter@oracle.com>: lib/test_kmod.c: remove a NULL test Rikard Falkeborn <rikard.falkeborn@gmail.com>: linux/bits.h: add compile time sanity check of GENMASK inputs Chris Wilson <chris@chris-wilson.co.uk>: lib/list: prevent compiler reloads inside 'safe' list iteration Nathan Chancellor <natechancellor@gmail.com>: lib/dynamic_debug.c: use address-of operator on section symbols Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: remove email address comment from email address comparisons Lubomir Rintel <lkundrak@v3.sk>: checkpatch: check SPDX tags in YAML files John Hubbard <jhubbard@nvidia.com>: checkpatch: support "base-commit:" format Joe Perches <joe@perches.com>: checkpatch: prefer fallthrough; over fallthrough comments Antonio Borneo <borneo.antonio@gmail.com>: checkpatch: fix minor typo and mixed space+tab in indentation checkpatch: fix multiple const * types checkpatch: add command-line option for TAB size Joe Perches <joe@perches.com>: checkpatch: improve Gerrit Change-Id: test Lubomir Rintel <lkundrak@v3.sk>: checkpatch: check proper licensing of Devicetree bindings Joe Perches <joe@perches.com>: checkpatch: avoid warning about uninitialized_var() Subsystem: epoll Roman Penyaev <rpenyaev@suse.de>: kselftest: introduce new epoll test case Jason Baron <jbaron@akamai.com>: fs/epoll: make nesting accounting safe for -rt kernel Subsystem: binfmt Alexey Dobriyan <adobriyan@gmail.com>: fs/binfmt_elf.c: delete "loc" variable fs/binfmt_elf.c: allocate less for static executable fs/binfmt_elf.c: don't free interpreter's ELF pheaders on common path Subsystem: kallsyms Will Deacon <will@kernel.org>: Patch series "Unexport kallsyms_lookup_name() and kallsyms_on_each_symbol()": samples/hw_breakpoint: drop HW_BREAKPOINT_R when reporting writes samples/hw_breakpoint: drop use of kallsyms_lookup_name() kallsyms: unexport kallsyms_lookup_name() and kallsyms_on_each_symbol() Subsystem: reiserfs Colin Ian King <colin.king@canonical.com>: reiserfs: clean up several indentation issues Subsystem: kmod Qiujun Huang <hqjagain@gmail.com>: kernel/kmod.c: fix a typo "assuems" -> "assumes" Subsystem: gcov "Gustavo A. R. Silva" <gustavo@embeddedor.com>: gcov: gcc_4_7: replace zero-length array with flexible-array member gcov: gcc_3_4: replace zero-length array with flexible-array member kernel/gcov/fs.c: replace zero-length array with flexible-array member Subsystem: kconfig Krzysztof Kozlowski <krzk@kernel.org>: init/Kconfig: clean up ANON_INODES and old IO schedulers options Subsystem: kcov Andrey Konovalov <andreyknvl@google.com>: Patch series "kcov: collect coverage from usb soft interrupts", v4: kcov: cleanup debug messages kcov: fix potential use-after-free in kcov_remote_start kcov: move t->kcov assignments into kcov_start/stop kcov: move t->kcov_sequence assignment kcov: use t->kcov_mode as enabled indicator kcov: collect coverage from interrupts usb: core: kcov: collect coverage from usb complete callback Subsystem: ubsan Kees Cook <keescook@chromium.org>: Patch series "ubsan: Split out bounds checker", v5: ubsan: add trap instrumentation option ubsan: split "bounds" checker from other options drivers/misc/lkdtm/bugs.c: add arithmetic overflow and array bounds checks ubsan: check panic_on_warn kasan: unset panic_on_warn before calling panic() ubsan: include bug type in report header Subsystem: fault-injection Qiujun Huang <hqjagain@gmail.com>: lib/Kconfig.debug: fix a typo "capabilitiy" -> "capability" Subsystem: ipc Somala Swaraj <somalaswaraj@gmail.com>: ipc/mqueue.c: fix a brace coding style issue Jason Yan <yanaijie@huawei.com>: ipc/shm.c: make compat_ksys_shmctl() static Documentation/admin-guide/kernel-parameters.txt | 13 Documentation/admin-guide/mm/transhuge.rst | 14 Documentation/admin-guide/mm/userfaultfd.rst | 51 Documentation/dev-tools/kcov.rst | 17 Documentation/vm/free_page_reporting.rst | 41 Documentation/vm/zswap.rst | 20 MAINTAINERS | 35 arch/alpha/include/asm/mmzone.h | 2 arch/alpha/kernel/syscalls/syscallhdr.sh | 2 arch/csky/mm/fault.c | 4 arch/ia64/kernel/syscalls/syscallhdr.sh | 2 arch/ia64/kernel/vmlinux.lds.S | 2 arch/m68k/mm/fault.c | 4 arch/microblaze/kernel/syscalls/syscallhdr.sh | 2 arch/mips/kernel/syscalls/syscallhdr.sh | 3 arch/mips/mm/fault.c | 4 arch/nds32/kernel/vmlinux.lds.S | 1 arch/parisc/kernel/syscalls/syscallhdr.sh | 2 arch/powerpc/kernel/syscalls/syscallhdr.sh | 3 arch/powerpc/kvm/e500_mmu_host.c | 2 arch/powerpc/mm/fault.c | 2 arch/powerpc/platforms/powernv/memtrace.c | 14 arch/sh/kernel/syscalls/syscallhdr.sh | 2 arch/sh/mm/fault.c | 2 arch/sparc/kernel/syscalls/syscallhdr.sh | 2 arch/sparc/vdso/vdso32/vclock_gettime.c | 4 arch/x86/Kconfig | 1 arch/x86/configs/i386_defconfig | 1 arch/x86/configs/x86_64_defconfig | 1 arch/x86/entry/vdso/vdso32/vclock_gettime.c | 4 arch/x86/include/asm/pgtable.h | 67 + arch/x86/include/asm/pgtable_64.h | 8 arch/x86/include/asm/pgtable_types.h | 12 arch/x86/mm/fault.c | 2 arch/xtensa/kernel/syscalls/syscallhdr.sh | 2 drivers/base/memory.c | 138 -- drivers/hv/hv_balloon.c | 25 drivers/misc/lkdtm/bugs.c | 75 + drivers/misc/lkdtm/core.c | 3 drivers/misc/lkdtm/lkdtm.h | 3 drivers/usb/core/hcd.c | 3 drivers/virtio/Kconfig | 1 drivers/virtio/virtio_balloon.c | 190 ++- fs/binfmt_elf.c | 56 fs/eventpoll.c | 64 - fs/proc/array.c | 39 fs/proc/cpuinfo.c | 1 fs/proc/generic.c | 31 fs/proc/inode.c | 188 ++- fs/proc/internal.h | 6 fs/proc/kmsg.c | 1 fs/proc/stat.c | 1 fs/proc/task_mmu.c | 97 - fs/reiserfs/do_balan.c | 2 fs/reiserfs/ioctl.c | 11 fs/reiserfs/namei.c | 10 fs/seq_file.c | 28 fs/userfaultfd.c | 116 + include/asm-generic/pgtable.h | 1 include/asm-generic/pgtable_uffd.h | 66 + include/asm-generic/tlb.h | 3 include/linux/bitops.h | 4 include/linux/bits.h | 22 include/linux/compiler.h | 2 include/linux/compiler_types.h | 11 include/linux/gfp.h | 2 include/linux/huge_mm.h | 2 include/linux/list.h | 50 include/linux/memory.h | 1 include/linux/memory_hotplug.h | 13 include/linux/memremap.h | 2 include/linux/mm.h | 25 include/linux/mm_inline.h | 15 include/linux/mm_types.h | 4 include/linux/mmzone.h | 47 include/linux/page-flags.h | 16 include/linux/page_reporting.h | 26 include/linux/pagemap.h | 4 include/linux/percpu_counter.h | 4 include/linux/proc_fs.h | 17 include/linux/sched.h | 3 include/linux/seq_file.h | 1 include/linux/shmem_fs.h | 10 include/linux/stackdepot.h | 2 include/linux/swapops.h | 5 include/linux/userfaultfd_k.h | 42 include/linux/vm_event_item.h | 5 include/trace/events/huge_memory.h | 1 include/trace/events/mmflags.h | 1 include/trace/events/vmscan.h | 2 include/uapi/linux/userfaultfd.h | 40 include/uapi/linux/virtio_balloon.h | 1 init/Kconfig | 8 ipc/mqueue.c | 5 ipc/shm.c | 2 ipc/util.c | 1 kernel/configs/tiny.config | 1 kernel/events/core.c | 3 kernel/extable.c | 3 kernel/fork.c | 10 kernel/gcov/fs.c | 2 kernel/gcov/gcc_3_4.c | 6 kernel/gcov/gcc_4_7.c | 2 kernel/kallsyms.c | 2 kernel/kcov.c | 282 +++- kernel/kmod.c | 2 kernel/module.c | 1 kernel/sched/fair.c | 2 lib/Kconfig.debug | 35 lib/Kconfig.ubsan | 51 lib/Makefile | 8 lib/bch.c | 2 lib/dynamic_debug.c | 2 lib/rbtree.c | 4 lib/scatterlist.c | 2 lib/stackdepot.c | 39 lib/test_bitmap.c | 2 lib/test_kmod.c | 2 lib/test_lockup.c | 601 +++++++++- lib/test_stackinit.c | 28 lib/ts_bm.c | 2 lib/ts_fsm.c | 2 lib/ts_kmp.c | 2 lib/ubsan.c | 47 mm/Kconfig | 135 ++ mm/Makefile | 1 mm/compaction.c | 3 mm/dmapool.c | 4 mm/filemap.c | 14 mm/gup.c | 9 mm/huge_memory.c | 36 mm/hugetlb.c | 1 mm/hugetlb_cgroup.c | 6 mm/internal.h | 2 mm/kasan/common.c | 23 mm/kasan/report.c | 10 mm/khugepaged.c | 39 mm/ksm.c | 5 mm/list_lru.c | 2 mm/memcontrol.c | 5 mm/memory-failure.c | 2 mm/memory.c | 42 mm/memory_hotplug.c | 53 mm/mempolicy.c | 11 mm/migrate.c | 122 +- mm/mm_init.c | 2 mm/mmap.c | 10 mm/mprotect.c | 76 - mm/page_alloc.c | 174 ++ mm/page_ext.c | 5 mm/page_isolation.c | 6 mm/page_reporting.c | 384 ++++++ mm/page_reporting.h | 54 mm/rmap.c | 23 mm/shmem.c | 168 +- mm/shuffle.c | 12 mm/shuffle.h | 6 mm/slab_common.c | 1 mm/slub.c | 3 mm/sparse.c | 236 ++- mm/swap.c | 20 mm/swapfile.c | 1 mm/userfaultfd.c | 98 + mm/vmalloc.c | 2 mm/vmscan.c | 12 mm/vmstat.c | 3 mm/zsmalloc.c | 10 mm/zswap.c | 24 samples/hw_breakpoint/data_breakpoint.c | 11 scripts/Makefile.ubsan | 16 scripts/checkpatch.pl | 155 +- tools/lib/rbtree.c | 4 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 67 + tools/testing/selftests/vm/userfaultfd.c | 233 +++ 174 files changed, 3990 insertions(+), 1399 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-04-02 4:01 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-04-02 4:01 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits A large amount of MM, plenty more to come. 155 patches, based on GIT 1a323ea5356edbb3073dc59d51b9e6b86908857d Subsystems affected by this patch series: tools kthread kbuild scripts ocfs2 vfs mm/slub mm/kmemleak mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/mremap mm/sparsemem mm/kasan mm/pagealloc mm/vmscan mm/compaction mm/mempolicy mm/hugetlbfs mm/hugetlb Subsystem: tools David Ahern <dsahern@kernel.org>: tools/accounting/getdelays.c: fix netlink attribute length Subsystem: kthread Petr Mladek <pmladek@suse.com>: kthread: mark timer used by delayed kthread works as IRQ safe Subsystem: kbuild Masahiro Yamada <masahiroy@kernel.org>: asm-generic: make more kernel-space headers mandatory Subsystem: scripts Jonathan Neuschäfer <j.neuschaefer@gmx.net>: scripts/spelling.txt: add syfs/sysfs pattern Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ocfs2 Alex Shi <alex.shi@linux.alibaba.com>: ocfs2: remove FS_OCFS2_NM ocfs2: remove unused macros ocfs2: use OCFS2_SEC_BITS in macro ocfs2: remove dlm_lock_is_remote wangyan <wangyan122@huawei.com>: ocfs2: there is no need to log twice in several functions ocfs2: correct annotation from "l_next_rec" to "l_next_free_rec" Alex Shi <alex.shi@linux.alibaba.com>: ocfs2: remove useless err Jules Irenge <jbi.octave@gmail.com>: ocfs2: Add missing annotations for ocfs2_refcount_cache_lock() and ocfs2_refcount_cache_unlock() "Gustavo A. R. Silva" <gustavo@embeddedor.com>: ocfs2: replace zero-length array with flexible-array member ocfs2: cluster: replace zero-length array with flexible-array member ocfs2: dlm: replace zero-length array with flexible-array member ocfs2: ocfs2_fs.h: replace zero-length array with flexible-array member wangjian <wangjian161@huawei.com>: ocfs2: roll back the reference count modification of the parent directory if an error occurs Takashi Iwai <tiwai@suse.de>: ocfs2: use scnprintf() for avoiding potential buffer overflow "Matthew Wilcox (Oracle)" <willy@infradead.org>: ocfs2: use memalloc_nofs_save instead of memalloc_noio_save Subsystem: vfs Kees Cook <keescook@chromium.org>: fs_parse: Remove pr_notice() about each validation Subsystem: mm/slub chenqiwu <chenqiwu@xiaomi.com>: mm/slub.c: replace cpu_slab->partial with wrapped APIs mm/slub.c: replace kmem_cache->cpu_partial with wrapped APIs Kees Cook <keescook@chromium.org>: slub: improve bit diffusion for freelist ptr obfuscation slub: relocate freelist pointer to middle of object Vlastimil Babka <vbabka@suse.cz>: Revert "topology: add support for node_to_mem_node() to determine the fallback node" Subsystem: mm/kmemleak Nathan Chancellor <natechancellor@gmail.com>: mm/kmemleak.c: use address-of operator on section symbols Qian Cai <cai@lca.pw>: mm/Makefile: disable KCSAN for kmemleak Subsystem: mm/pagecache Jan Kara <jack@suse.cz>: mm/filemap.c: don't bother dropping mmap_sem for zero size readahead Mauricio Faria de Oliveira <mfo@canonical.com>: mm/page-writeback.c: write_cache_pages(): deduplicate identical checks Xianting Tian <xianting_tian@126.com>: mm/filemap.c: clear page error before actual read Souptick Joarder <jrdr.linux@gmail.com>: mm/filemap.c: remove unused argument from shrink_readahead_size_eio() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap.c: use vm_fault error code directly include/linux/pagemap.h: rename arguments to find_subpage mm/page-writeback.c: use VM_BUG_ON_PAGE in clear_page_dirty_for_io mm/filemap.c: unexport find_get_entry mm/filemap.c: rewrite pagecache_get_page documentation Subsystem: mm/gup John Hubbard <jhubbard@nvidia.com>: Patch series "mm/gup: track FOLL_PIN pages", v6: mm/gup: split get_user_pages_remote() into two routines mm/gup: pass a flags arg to __gup_device_* functions mm: introduce page_ref_sub_return() mm/gup: pass gup flags to two more routines mm/gup: require FOLL_GET for get_user_pages_fast() mm/gup: track FOLL_PIN pages mm/gup: page->hpage_pinned_refcount: exact pin counts for huge pages mm/gup: /proc/vmstat: pin_user_pages (FOLL_PIN) reporting mm/gup_benchmark: support pin_user_pages() and related calls selftests/vm: run_vmtests: invoke gup_benchmark with basic FOLL_PIN coverage "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: improve dump_page() for compound pages John Hubbard <jhubbard@nvidia.com>: mm: dump_page(): additional diagnostics for huge pinned pages Claudio Imbrenda <imbrenda@linux.ibm.com>: mm/gup/writeback: add callbacks for inaccessible pages Pingfan Liu <kernelfans@gmail.com>: mm/gup: rename nr as nr_pinned in get_user_pages_fast() mm/gup: fix omission of check on FOLL_LONGTERM in gup fast path Subsystem: mm/swap Chen Wandun <chenwandun@huawei.com>: mm/swapfile.c: fix comments for swapcache_prepare Wei Yang <richardw.yang@linux.intel.com>: mm/swap.c: not necessary to export __pagevec_lru_add() Qian Cai <cai@lca.pw>: mm/swapfile: fix data races in try_to_unuse() Wei Yang <richard.weiyang@linux.alibaba.com>: mm/swap_slots.c: assign|reset cache slot by value directly Yang Shi <yang.shi@linux.alibaba.com>: mm: swap: make page_evictable() inline mm: swap: use smp_mb__after_atomic() to order LRU bit set Wei Yang <richard.weiyang@gmail.com>: mm/swap_state.c: use the same way to count page in [add_to|delete_from]_swap_cache Subsystem: mm/memcg Yafang Shao <laoar.shao@gmail.com>: mm, memcg: fix build error around the usage of kmem_caches Kirill Tkhai <ktkhai@virtuozzo.com>: mm/memcontrol.c: allocate shrinker_map on appropriate NUMA node Roman Gushchin <guro@fb.com>: mm: memcg/slab: use mem_cgroup_from_obj() Patch series "mm: memcg: kmem API cleanup", v2: mm: kmem: cleanup (__)memcg_kmem_charge_memcg() arguments mm: kmem: cleanup memcg_kmem_uncharge_memcg() arguments mm: kmem: rename memcg_kmem_(un)charge() into memcg_kmem_(un)charge_page() mm: kmem: switch to nr_pages in (__)memcg_kmem_charge_memcg() mm: memcg/slab: cache page number in memcg_(un)charge_slab() mm: kmem: rename (__)memcg_kmem_(un)charge_memcg() to __memcg_kmem_(un)charge() Johannes Weiner <hannes@cmpxchg.org>: Patch series "mm: memcontrol: recursive memory.low protection", v3: mm: memcontrol: fix memory.low proportional distribution mm: memcontrol: clean up and document effective low/min calculations mm: memcontrol: recursive memory.low protection Shakeel Butt <shakeelb@google.com>: memcg: css_tryget_online cleanups Vincenzo Frascino <vincenzo.frascino@arm.com>: mm/memcontrol.c: make mem_cgroup_id_get_many() __maybe_unused Chris Down <chris@chrisdown.name>: mm, memcg: prevent memory.high load/store tearing mm, memcg: prevent memory.max load tearing mm, memcg: prevent memory.low load/store tearing mm, memcg: prevent memory.min load/store tearing mm, memcg: prevent memory.swap.max load tearing mm, memcg: prevent mem_cgroup_protected store tearing Roman Gushchin <guro@fb.com>: mm: memcg: make memory.oom.group tolerable to task migration Subsystem: mm/pagemap Thomas Hellstrom <thellstrom@vmware.com>: mm/mapping_dirty_helpers: Update huge page-table entry callbacks Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/vma: some more minor changes", v2: mm/vma: move VM_NO_KHUGEPAGED into generic header mm/vma: make vma_is_foreign() available for general use mm/vma: make is_vma_temporary_stack() available for general use "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: add pagemap.h to the fine documentation Peter Xu <peterx@redhat.com>: Patch series "mm: Page fault enhancements", v6: mm/gup: rename "nonblocking" to "locked" where proper mm/gup: fix __get_user_pages() on fault retry of hugetlb mm: introduce fault_signal_pending() x86/mm: use helper fault_signal_pending() arc/mm: use helper fault_signal_pending() arm64/mm: use helper fault_signal_pending() powerpc/mm: use helper fault_signal_pending() sh/mm: use helper fault_signal_pending() mm: return faster for non-fatal signals in user mode faults userfaultfd: don't retake mmap_sem to emulate NOPAGE mm: introduce FAULT_FLAG_DEFAULT mm: introduce FAULT_FLAG_INTERRUPTIBLE mm: allow VM_FAULT_RETRY for multiple times mm/gup: allow VM_FAULT_RETRY for multiple times mm/gup: allow to react to fatal signals mm/userfaultfd: honor FAULT_FLAG_KILLABLE in fault path WANG Wenhu <wenhu.wang@vivo.com>: mm: clarify a confusing comment for remap_pfn_range() Wang Wenhu <wenhu.wang@vivo.com>: mm/memory.c: clarify a confusing comment for vm_iomap_memory Jaewon Kim <jaewon31.kim@samsung.com>: Patch series "mm: mmap: add mmap trace point", v3: mmap: remove inline of vm_unmapped_area mm: mmap: add trace point of vm_unmapped_area Subsystem: mm/mremap Brian Geffon <bgeffon@google.com>: mm/mremap: add MREMAP_DONTUNMAP to mremap() selftests: add MREMAP_DONTUNMAP selftest Subsystem: mm/sparsemem Wei Yang <richardw.yang@linux.intel.com>: mm/sparsemem: get address to page struct instead of address to pfn Pingfan Liu <kernelfans@gmail.com>: mm/sparse: rename pfn_present() to pfn_in_present_section() Baoquan He <bhe@redhat.com>: mm/sparse.c: use kvmalloc/kvfree to alloc/free memmap for the classic sparse mm/sparse.c: allocate memmap preferring the given node Subsystem: mm/kasan Walter Wu <walter-zh.wu@mediatek.com>: Patch series "fix the missing underflow in memory operation function", v4: kasan: detect negative size in memory operation function kasan: add test for invalid size in memmove Subsystem: mm/pagealloc Joel Savitz <jsavitz@redhat.com>: mm/page_alloc: increase default min_free_kbytes bound Mateusz Nosek <mateusznosek0@gmail.com>: mm, pagealloc: micro-optimisation: save two branches on hot page allocation path chenqiwu <chenqiwu@xiaomi.com>: mm/page_alloc.c: use free_area_empty() instead of open-coding Mateusz Nosek <mateusznosek0@gmail.com>: mm/page_alloc.c: micro-optimisation Remove unnecessary branch chenqiwu <chenqiwu@xiaomi.com>: mm/page_alloc: simplify page_is_buddy() for better code readability Subsystem: mm/vmscan Yang Shi <yang.shi@linux.alibaba.com>: mm: vmpressure: don't need call kfree if kstrndup fails mm: vmpressure: use mem_cgroup_is_root API mm: vmscan: replace open codings to NUMA_NO_NODE Wei Yang <richardw.yang@linux.intel.com>: mm/vmscan.c: remove cpu online notification for now Qian Cai <cai@lca.pw>: mm/vmscan.c: fix data races using kswapd_classzone_idx Mateusz Nosek <mateusznosek0@gmail.com>: mm/vmscan.c: Clean code by removing unnecessary assignment Kirill Tkhai <ktkhai@virtuozzo.com>: mm/vmscan.c: make may_enter_fs bool in shrink_page_list() Mateusz Nosek <mateusznosek0@gmail.com>: mm/vmscan.c: do_try_to_free_pages(): clean code by removing unnecessary assignment Michal Hocko <mhocko@suse.com>: selftests: vm: drop dependencies on page flags from mlock2 tests Subsystem: mm/compaction Rik van Riel <riel@surriel.com>: Patch series "fix THP migration for CMA allocations", v2: mm,compaction,cma: add alloc_contig flag to compact_control mm,thp,compaction,cma: allow THP migration for CMA allocations Vlastimil Babka <vbabka@suse.cz>: mm, compaction: fully assume capture is not NULL in compact_zone_order() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/compaction: really limit compact_unevictable_allowed to 0 and 1 mm/compaction: Disable compact_unevictable_allowed on RT Mateusz Nosek <mateusznosek0@gmail.com>: mm/compaction.c: clean code by removing unnecessary assignment Subsystem: mm/mempolicy Li Xinhai <lixinhai.lxh@gmail.com>: mm/mempolicy: support MPOL_MF_STRICT for huge page mapping mm/mempolicy: check hugepage migration is supported by arch in vma_migratable() Yang Shi <yang.shi@linux.alibaba.com>: mm: mempolicy: use VM_BUG_ON_VMA in queue_pages_test_walk() Randy Dunlap <rdunlap@infradead.org>: mm: mempolicy: require at least one nodeid for MPOL_PREFERRED Colin Ian King <colin.king@canonical.com>: mm/memblock.c: remove redundant assignment to variable max_addr Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: Patch series "hugetlbfs: use i_mmap_rwsem for more synchronization", v2: hugetlbfs: use i_mmap_rwsem for more pmd sharing synchronization hugetlbfs: Use i_mmap_rwsem to address page fault/truncate race Subsystem: mm/hugetlb Mina Almasry <almasrymina@google.com>: hugetlb_cgroup: add hugetlb_cgroup reservation counter hugetlb_cgroup: add interface for charge/uncharge hugetlb reservations mm/hugetlb_cgroup: fix hugetlb_cgroup migration hugetlb_cgroup: add reservation accounting for private mappings hugetlb: disable region_add file_region coalescing hugetlb_cgroup: add accounting for shared mappings hugetlb_cgroup: support noreserve mappings hugetlb: support file_region coalescing again hugetlb_cgroup: add hugetlb_cgroup reservation tests hugetlb_cgroup: add hugetlb_cgroup reservation docs Mateusz Nosek <mateusznosek0@gmail.com>: mm/hugetlb.c: clean code by removing unnecessary initialization Vlastimil Babka <vbabka@suse.cz>: mm/hugetlb: remove unnecessary memory fetch in PageHeadHuge() Christophe Leroy <christophe.leroy@c-s.fr>: selftests/vm: fix map_hugetlb length used for testing read and write mm/hugetlb: fix build failure with HUGETLB_PAGE but not HUGEBTLBFS "Matthew Wilcox (Oracle)" <willy@infradead.org>: include/linux/huge_mm.h: check PageTail in hpage_nr_pages even when !THP Documentation/admin-guide/cgroup-v1/hugetlb.rst | 103 +- Documentation/admin-guide/cgroup-v2.rst | 11 Documentation/admin-guide/sysctl/vm.rst | 3 Documentation/core-api/mm-api.rst | 3 Documentation/core-api/pin_user_pages.rst | 86 + arch/alpha/include/asm/Kbuild | 11 arch/alpha/mm/fault.c | 6 arch/arc/include/asm/Kbuild | 21 arch/arc/mm/fault.c | 37 arch/arm/include/asm/Kbuild | 12 arch/arm/mm/fault.c | 7 arch/arm64/include/asm/Kbuild | 18 arch/arm64/mm/fault.c | 26 arch/c6x/include/asm/Kbuild | 37 arch/csky/include/asm/Kbuild | 36 arch/h8300/include/asm/Kbuild | 46 arch/hexagon/include/asm/Kbuild | 33 arch/hexagon/mm/vm_fault.c | 5 arch/ia64/include/asm/Kbuild | 7 arch/ia64/mm/fault.c | 5 arch/m68k/include/asm/Kbuild | 24 arch/m68k/mm/fault.c | 7 arch/microblaze/include/asm/Kbuild | 29 arch/microblaze/mm/fault.c | 5 arch/mips/include/asm/Kbuild | 13 arch/mips/mm/fault.c | 5 arch/nds32/include/asm/Kbuild | 37 arch/nds32/mm/fault.c | 5 arch/nios2/include/asm/Kbuild | 38 arch/nios2/mm/fault.c | 7 arch/openrisc/include/asm/Kbuild | 36 arch/openrisc/mm/fault.c | 5 arch/parisc/include/asm/Kbuild | 18 arch/parisc/mm/fault.c | 8 arch/powerpc/include/asm/Kbuild | 4 arch/powerpc/mm/book3s64/pkeys.c | 12 arch/powerpc/mm/fault.c | 20 arch/powerpc/platforms/pseries/hotplug-memory.c | 2 arch/riscv/include/asm/Kbuild | 28 arch/riscv/mm/fault.c | 9 arch/s390/include/asm/Kbuild | 15 arch/s390/mm/fault.c | 10 arch/sh/include/asm/Kbuild | 16 arch/sh/mm/fault.c | 13 arch/sparc/include/asm/Kbuild | 14 arch/sparc/mm/fault_32.c | 5 arch/sparc/mm/fault_64.c | 5 arch/um/kernel/trap.c | 3 arch/unicore32/include/asm/Kbuild | 34 arch/unicore32/mm/fault.c | 8 arch/x86/include/asm/Kbuild | 2 arch/x86/include/asm/mmu_context.h | 15 arch/x86/mm/fault.c | 32 arch/xtensa/include/asm/Kbuild | 26 arch/xtensa/mm/fault.c | 5 drivers/base/node.c | 2 drivers/gpu/drm/ttm/ttm_bo_vm.c | 12 fs/fs_parser.c | 2 fs/hugetlbfs/inode.c | 30 fs/ocfs2/alloc.c | 3 fs/ocfs2/cluster/heartbeat.c | 12 fs/ocfs2/cluster/netdebug.c | 4 fs/ocfs2/cluster/tcp.c | 27 fs/ocfs2/cluster/tcp.h | 2 fs/ocfs2/dir.c | 4 fs/ocfs2/dlm/dlmcommon.h | 8 fs/ocfs2/dlm/dlmdebug.c | 100 - fs/ocfs2/dlm/dlmmaster.c | 2 fs/ocfs2/dlm/dlmthread.c | 3 fs/ocfs2/dlmglue.c | 2 fs/ocfs2/journal.c | 2 fs/ocfs2/namei.c | 15 fs/ocfs2/ocfs2_fs.h | 18 fs/ocfs2/refcounttree.c | 2 fs/ocfs2/reservations.c | 3 fs/ocfs2/stackglue.c | 2 fs/ocfs2/suballoc.c | 5 fs/ocfs2/super.c | 46 fs/pipe.c | 2 fs/userfaultfd.c | 64 - include/asm-generic/Kbuild | 52 + include/linux/cgroup-defs.h | 5 include/linux/fs.h | 5 include/linux/gfp.h | 6 include/linux/huge_mm.h | 10 include/linux/hugetlb.h | 76 + include/linux/hugetlb_cgroup.h | 175 +++ include/linux/kasan.h | 2 include/linux/kthread.h | 3 include/linux/memcontrol.h | 66 - include/linux/mempolicy.h | 29 include/linux/mm.h | 243 +++- include/linux/mm_types.h | 7 include/linux/mmzone.h | 6 include/linux/page_ref.h | 9 include/linux/pagemap.h | 29 include/linux/sched/signal.h | 18 include/linux/swap.h | 1 include/linux/topology.h | 17 include/trace/events/mmap.h | 48 include/uapi/linux/mman.h | 5 kernel/cgroup/cgroup.c | 17 kernel/fork.c | 9 kernel/sysctl.c | 31 lib/test_kasan.c | 19 mm/Makefile | 1 mm/compaction.c | 31 mm/debug.c | 54 - mm/filemap.c | 77 - mm/gup.c | 682 ++++++++++--- mm/gup_benchmark.c | 71 + mm/huge_memory.c | 29 mm/hugetlb.c | 866 ++++++++++++----- mm/hugetlb_cgroup.c | 347 +++++- mm/internal.h | 32 mm/kasan/common.c | 26 mm/kasan/generic.c | 9 mm/kasan/generic_report.c | 11 mm/kasan/kasan.h | 2 mm/kasan/report.c | 5 mm/kasan/tags.c | 9 mm/kasan/tags_report.c | 11 mm/khugepaged.c | 4 mm/kmemleak.c | 2 mm/list_lru.c | 12 mm/mapping_dirty_helpers.c | 42 mm/memblock.c | 2 mm/memcontrol.c | 378 ++++--- mm/memory-failure.c | 29 mm/memory.c | 4 mm/mempolicy.c | 73 + mm/migrate.c | 25 mm/mmap.c | 32 mm/mremap.c | 92 + mm/page-writeback.c | 19 mm/page_alloc.c | 82 - mm/page_counter.c | 29 mm/page_ext.c | 2 mm/rmap.c | 39 mm/shuffle.c | 2 mm/slab.h | 32 mm/slab_common.c | 2 mm/slub.c | 27 mm/sparse.c | 33 mm/swap.c | 5 mm/swap_slots.c | 12 mm/swap_state.c | 2 mm/swapfile.c | 10 mm/userfaultfd.c | 11 mm/vmpressure.c | 8 mm/vmscan.c | 111 -- mm/vmstat.c | 2 scripts/spelling.txt | 21 tools/accounting/getdelays.c | 2 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 2 tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 575 +++++++++++ tools/testing/selftests/vm/gup_benchmark.c | 15 tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 244 ++++ tools/testing/selftests/vm/map_hugetlb.c | 14 tools/testing/selftests/vm/mlock2-tests.c | 233 ---- tools/testing/selftests/vm/mremap_dontunmap.c | 313 ++++++ tools/testing/selftests/vm/run_vmtests | 37 tools/testing/selftests/vm/write_hugetlb_memory.sh | 23 tools/testing/selftests/vm/write_to_hugetlbfs.c | 242 ++++ 165 files changed, 5020 insertions(+), 2376 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-03-29 2:14 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-03-29 2:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 5 fixes, based on 83fd69c93340177dcd66fd26ce6441fb581c1dbf: Naohiro Aota <naohiro.aota@wdc.com>: mm/swapfile.c: move inode_lock out of claim_swapfile David Hildenbrand <david@redhat.com>: drivers/base/memory.c: indicate all memory blocks as removable Mina Almasry <almasrymina@google.com>: hugetlb_cgroup: fix illegal access to memory Roman Gushchin <guro@fb.com>: mm: fork: fix kernel_stack memcg stats for various stack implementations "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/sparse: fix kernel crash with pfn_section_valid check drivers/base/memory.c | 23 +++-------------------- include/linux/memcontrol.h | 12 ++++++++++++ kernel/fork.c | 4 ++-- mm/hugetlb_cgroup.c | 3 +-- mm/memcontrol.c | 38 ++++++++++++++++++++++++++++++++++++++ mm/sparse.c | 6 ++++++ mm/swapfile.c | 41 ++++++++++++++++++++--------------------- 7 files changed, 82 insertions(+), 45 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-03-22 1:19 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-03-22 1:19 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 10 fixes, based on c63c50fc2ec9afc4de21ef9ead2eac64b178cce1: Chunguang Xu <brookxu@tencent.com>: memcg: fix NULL pointer dereference in __mem_cgroup_usage_unregister_event Baoquan He <bhe@redhat.com>: mm/hotplug: fix hot remove failure in SPARSEMEM|!VMEMMAP case Qian Cai <cai@lca.pw>: page-flags: fix a crash at SetPageError(THP_SWAP) Chris Down <chris@chrisdown.name>: mm, memcg: fix corruption on 64-bit divisor in memory.high throttling mm, memcg: throttle allocators based on ancestral memory.high Michal Hocko <mhocko@suse.com>: mm: do not allow MADV_PAGEOUT for CoW pages Roman Penyaev <rpenyaev@suse.de>: epoll: fix possible lost wakeup on epoll_ctl() path Qian Cai <cai@lca.pw>: mm/mmu_notifier: silence PROVE_RCU_LIST warnings Vlastimil Babka <vbabka@suse.cz>: mm, slub: prevent kmalloc_node crashes and memory leaks Joerg Roedel <jroedel@suse.de>: x86/mm: split vmalloc_sync_all() arch/x86/mm/fault.c | 26 ++++++++++- drivers/acpi/apei/ghes.c | 2 fs/eventpoll.c | 8 +-- include/linux/page-flags.h | 2 include/linux/vmalloc.h | 5 +- kernel/notifier.c | 2 mm/madvise.c | 12 +++-- mm/memcontrol.c | 105 ++++++++++++++++++++++++++++----------------- mm/mmu_notifier.c | 27 +++++++---- mm/nommu.c | 10 +++- mm/slub.c | 26 +++++++---- mm/sparse.c | 8 ++- mm/vmalloc.c | 11 +++- 13 files changed, 165 insertions(+), 79 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-03-06 6:27 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-03-06 6:27 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 7 fixes, based on 9f65ed5fe41ce08ed1cb1f6a950f9ec694c142ad: Mel Gorman <mgorman@techsingularity.net>: mm, numa: fix bad pmd by atomically check for pmd_trans_huge when marking page tables prot_numa Huang Ying <ying.huang@intel.com>: mm: fix possible PMD dirty bit lost in set_pmd_migration_entry() "Kirill A. Shutemov" <kirill@shutemov.name>: mm: avoid data corruption on CoW fault into PFN-mapped VMA OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>: fat: fix uninit-memory access for partial initialized inode Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/z3fold.c: do not include rwlock.h directly Vlastimil Babka <vbabka@suse.cz>: mm, hotplug: fix page online with DEBUG_PAGEALLOC compiled but not enabled Miroslav Benes <mbenes@suse.cz>: arch/Kconfig: update HAVE_RELIABLE_STACKTRACE description arch/Kconfig | 5 +++-- fs/fat/inode.c | 19 +++++++------------ include/linux/mm.h | 4 ++++ mm/huge_memory.c | 3 +-- mm/memory.c | 35 +++++++++++++++++++++++++++-------- mm/memory_hotplug.c | 8 +++++++- mm/mprotect.c | 38 ++++++++++++++++++++++++++++++++++++-- mm/z3fold.c | 1 - 8 files changed, 85 insertions(+), 28 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-02-21 4:00 Andrew Morton 2020-02-21 4:03 ` incoming Andrew Morton 2020-02-21 18:21 ` incoming Linus Torvalds 0 siblings, 2 replies; 322+ messages in thread From: Andrew Morton @ 2020-02-21 4:00 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits - A few y2038 fixes which missed the merge window whiole dependencies in NFS were being sorted out. - A bunch of fixes. Some minor, some not. Subsystems affected by this patch series: Arnd Bergmann <arnd@arndb.de>: y2038: remove ktime to/from timespec/timeval conversion y2038: remove unused time32 interfaces y2038: hide timeval/timespec/itimerval/itimerspec types Ioanna Alifieraki <ioanna-maria.alifieraki@canonical.com>: Revert "ipc,sem: remove uneeded sem_undo_list lock usage in exit_sem()" Christian Borntraeger <borntraeger@de.ibm.com>: include/uapi/linux/swab.h: fix userspace breakage, use __BITS_PER_LONG for swap SeongJae Park <sjpark@amazon.de>: selftests/vm: add missed tests in run_vmtests Joe Perches <joe@perches.com>: get_maintainer: remove uses of P: for maintainer name Douglas Anderson <dianders@chromium.org>: scripts/get_maintainer.pl: deprioritize old Fixes: addresses Christoph Hellwig <hch@lst.de>: mm/swapfile.c: fix a comment in sys_swapon() Vasily Averin <vvs@virtuozzo.com>: mm/memcontrol.c: lost css_put in memcg_expand_shrinker_maps() Alexandru Ardelean <alexandru.ardelean@analog.com>: lib/string.c: update match_string() doc-strings with correct behavior Gavin Shan <gshan@redhat.com>: mm/vmscan.c: don't round up scan size for online memory cgroup Wei Yang <richardw.yang@linux.intel.com>: mm/sparsemem: pfn_to_page is not valid yet on SPARSEMEM Alexander Potapenko <glider@google.com>: lib/stackdepot.c: fix global out-of-bounds in stack_slabs Randy Dunlap <rdunlap@infradead.org>: MAINTAINERS: use tabs for SAFESETID MAINTAINERS | 8 - include/linux/compat.h | 29 ------ include/linux/ktime.h | 37 ------- include/linux/time32.h | 154 --------------------------------- include/linux/timekeeping32.h | 32 ------ include/linux/types.h | 5 - include/uapi/asm-generic/posix_types.h | 2 include/uapi/linux/swab.h | 4 include/uapi/linux/time.h | 22 ++-- ipc/sem.c | 6 - kernel/compat.c | 64 ------------- kernel/time/time.c | 43 --------- lib/stackdepot.c | 8 + lib/string.c | 16 +++ mm/memcontrol.c | 4 mm/sparse.c | 2 mm/swapfile.c | 2 mm/vmscan.c | 9 + scripts/get_maintainer.pl | 32 ------ tools/testing/selftests/vm/run_vmtests | 33 +++++++ 20 files changed, 93 insertions(+), 419 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-02-21 4:00 incoming Andrew Morton @ 2020-02-21 4:03 ` Andrew Morton 2020-02-21 18:21 ` incoming Linus Torvalds 1 sibling, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-02-21 4:03 UTC (permalink / raw) To: Linus Torvalds, linux-mm, mm-commits On Thu, 20 Feb 2020 20:00:30 -0800 Andrew Morton <akpm@linux-foundation.org> wrote: > - A few y2038 fixes which missed the merge window whiole dependencies > in NFS were being sorted out. > > - A bunch of fixes. Some minor, some not. 15 patches, based on ca7e1fd1026c5af6a533b4b5447e1d2f153e28f2 ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-02-21 4:00 incoming Andrew Morton 2020-02-21 4:03 ` incoming Andrew Morton @ 2020-02-21 18:21 ` Linus Torvalds 2020-02-21 18:32 ` incoming Konstantin Ryabitsev 2020-02-21 19:33 ` incoming Linus Torvalds 1 sibling, 2 replies; 322+ messages in thread From: Linus Torvalds @ 2020-02-21 18:21 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits On Thu, Feb 20, 2020 at 8:00 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > - A few y2038 fixes which missed the merge window whiole dependencies > in NFS were being sorted out. > > - A bunch of fixes. Some minor, some not. Hmm. Konstantin's nice lore script _used_ to pick up your patches, but now they don't. I'm not sure what changed. It worked with your big series of 118 patches. It doesn't work with this smaller series of fixes. I think the difference is that you've done something bad to your patch sending. That big series was properly threaded with each of the patches being a reply to the 'incoming' message. This series is not. Please, Andrew, can you make your email flow more consistent so that I can actually use the nice new tool to download a patch series? Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-02-21 18:21 ` incoming Linus Torvalds @ 2020-02-21 18:32 ` Konstantin Ryabitsev 2020-02-27 9:59 ` incoming Vlastimil Babka 2020-02-21 19:33 ` incoming Linus Torvalds 1 sibling, 1 reply; 322+ messages in thread From: Konstantin Ryabitsev @ 2020-02-21 18:32 UTC (permalink / raw) To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits On Fri, Feb 21, 2020 at 10:21:19AM -0800, Linus Torvalds wrote: > On Thu, Feb 20, 2020 at 8:00 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > - A few y2038 fixes which missed the merge window whiole dependencies > > in NFS were being sorted out. > > > > - A bunch of fixes. Some minor, some not. > > Hmm. Konstantin's nice lore script _used_ to pick up your patches, but > now they don't. > > I'm not sure what changed. It worked with your big series of 118 patches. > > It doesn't work with this smaller series of fixes. > > I think the difference is that you've done something bad to your patch > sending. That big series was properly threaded with each of the > patches being a reply to the 'incoming' message. > > This series is not. This is correct -- each patch is posted without an in-reply-to, so public-inbox doesn't group them into a thread. E.g.: https://lore.kernel.org/linux-mm/20200221040350.84HaG%25akpm@linux-foundation.org/ > > Please, Andrew, can you make your email flow more consistent so that I > can actually use the nice new tool to download a patch series? Andrew, I'll be happy to provide you with a helper tool if you can describe me your workflow. E.g. if you have a quilt directory of patches plus a series file, it could easily be a tiny wrapper like: send-patches --base-commit 1234abcd --cover cover.txt patchdir/series -K ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-02-21 18:32 ` incoming Konstantin Ryabitsev @ 2020-02-27 9:59 ` Vlastimil Babka 0 siblings, 0 replies; 322+ messages in thread From: Vlastimil Babka @ 2020-02-27 9:59 UTC (permalink / raw) To: Konstantin Ryabitsev, Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits On 2/21/20 7:32 PM, Konstantin Ryabitsev wrote: > On Fri, Feb 21, 2020 at 10:21:19AM -0800, Linus Torvalds wrote: >> On Thu, Feb 20, 2020 at 8:00 PM Andrew Morton <akpm@linux-foundation.org> wrote: >> > >> > - A few y2038 fixes which missed the merge window whiole dependencies >> > in NFS were being sorted out. >> > >> > - A bunch of fixes. Some minor, some not. >> >> Hmm. Konstantin's nice lore script _used_ to pick up your patches, but >> now they don't. >> >> I'm not sure what changed. It worked with your big series of 118 patches. >> >> It doesn't work with this smaller series of fixes. >> >> I think the difference is that you've done something bad to your patch >> sending. That big series was properly threaded with each of the >> patches being a reply to the 'incoming' message. >> >> This series is not. > > This is correct -- each patch is posted without an in-reply-to, so > public-inbox doesn't group them into a thread. > > E.g.: > https://lore.kernel.org/linux-mm/20200221040350.84HaG%25akpm@linux-foundation.org/ > >> >> Please, Andrew, can you make your email flow more consistent so that I >> can actually use the nice new tool to download a patch series? > > Andrew, I'll be happy to provide you with a helper tool if you can > describe me your workflow. E.g. if you have a quilt directory of patches > plus a series file, it could easily be a tiny wrapper like: > > send-patches --base-commit 1234abcd --cover cover.txt patchdir/series Once/if there is such tool, could it perhaps instead of mass e-mailing create git commits, push them to korg repo and send a pull request? Thanks, Vlastimil > -K > ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-02-21 18:21 ` incoming Linus Torvalds 2020-02-21 18:32 ` incoming Konstantin Ryabitsev @ 2020-02-21 19:33 ` Linus Torvalds 1 sibling, 0 replies; 322+ messages in thread From: Linus Torvalds @ 2020-02-21 19:33 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits Side note: I've obviously picked it up the old-fashioned way, but I had been looking forward to seeing if I could just automate this more. Linus On Fri, Feb 21, 2020 at 10:21 AM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > Please, Andrew, can you make your email flow more consistent so that I > can actually use the nice new tool to download a patch series? > > Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-02-04 1:33 Andrew Morton 2020-02-04 2:27 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2020-02-04 1:33 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm The rest of MM and the rest of everything else. Subsystems affected by this patch series: hotfixes mm/pagealloc mm/memory-hotplug ipc misc mm/cleanups mm/pagemap procfs lib cleanups arm Subsystem: hotfixes Gang He <GHe@suse.com>: ocfs2: fix oops when writing cloned file David Hildenbrand <david@redhat.com>: Patch series "mm: fix max_pfn not falling on section boundary", v2: mm/page_alloc.c: fix uninitialized memmaps on a partially populated last section fs/proc/page.c: allow inspection of last section and fix end detection mm/page_alloc.c: initialize memmap of unavailable memory directly Subsystem: mm/pagealloc David Hildenbrand <david@redhat.com>: mm/page_alloc: fix and rework pfn handling in memmap_init_zone() mm: factor out next_present_section_nr() Subsystem: mm/memory-hotplug "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "mm/memory_hotplug: Shrink zones before removing memory", v6: mm/memmap_init: update variable name in memmap_init_zone David Hildenbrand <david@redhat.com>: mm/memory_hotplug: poison memmap in remove_pfn_range_from_zone() mm/memory_hotplug: we always have a zone in find_(smallest|biggest)_section_pfn mm/memory_hotplug: don't check for "all holes" in shrink_zone_span() mm/memory_hotplug: drop local variables in shrink_zone_span() mm/memory_hotplug: cleanup __remove_pages() mm/memory_hotplug: drop valid_start/valid_end from test_pages_in_a_zone() Subsystem: ipc Manfred Spraul <manfred@colorfullife.com>: smp_mb__{before,after}_atomic(): update Documentation Davidlohr Bueso <dave@stgolabs.net>: ipc/mqueue.c: remove duplicated code Manfred Spraul <manfred@colorfullife.com>: ipc/mqueue.c: update/document memory barriers ipc/msg.c: update and document memory barriers ipc/sem.c: document and update memory barriers Lu Shuaibing <shuaibinglu@126.com>: ipc/msg.c: consolidate all xxxctl_down() functions drivers/block/null_blk_main.c: fix layout Subsystem: misc Andrew Morton <akpm@linux-foundation.org>: drivers/block/null_blk_main.c: fix layout drivers/block/null_blk_main.c: fix uninitialized var warnings Randy Dunlap <rdunlap@infradead.org>: pinctrl: fix pxa2xx.c build warnings Subsystem: mm/cleanups Florian Westphal <fw@strlen.de>: mm: remove __krealloc Subsystem: mm/pagemap Steven Price <steven.price@arm.com>: Patch series "Generic page walk and ptdump", v17: mm: add generic p?d_leaf() macros arc: mm: add p?d_leaf() definitions arm: mm: add p?d_leaf() definitions arm64: mm: add p?d_leaf() definitions mips: mm: add p?d_leaf() definitions powerpc: mm: add p?d_leaf() definitions riscv: mm: add p?d_leaf() definitions s390: mm: add p?d_leaf() definitions sparc: mm: add p?d_leaf() definitions x86: mm: add p?d_leaf() definitions mm: pagewalk: add p4d_entry() and pgd_entry() mm: pagewalk: allow walking without vma mm: pagewalk: don't lock PTEs for walk_page_range_novma() mm: pagewalk: fix termination condition in walk_pte_range() mm: pagewalk: add 'depth' parameter to pte_hole x86: mm: point to struct seq_file from struct pg_state x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct mm: add generic ptdump x86: mm: convert dump_pagetables to use walk_page_range arm64: mm: convert mm/dump.c to use walk_page_range() arm64: mm: display non-present entries in ptdump mm: ptdump: reduce level numbers by 1 in note_page() x86: mm: avoid allocating struct mm_struct on the stack "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "Fixup page directory freeing", v4: powerpc/mmu_gather: enable RCU_TABLE_FREE even for !SMP case Peter Zijlstra <peterz@infradead.org>: mm/mmu_gather: invalidate TLB correctly on batch allocation failure and flush asm-generic/tlb: avoid potential double flush asm-gemeric/tlb: remove stray function declarations asm-generic/tlb: add missing CONFIG symbol asm-generic/tlb: rename HAVE_RCU_TABLE_FREE asm-generic/tlb: rename HAVE_MMU_GATHER_PAGE_SIZE asm-generic/tlb: rename HAVE_MMU_GATHER_NO_GATHER asm-generic/tlb: provide MMU_GATHER_TABLE_FREE Subsystem: procfs Alexey Dobriyan <adobriyan@gmail.com>: proc: decouple proc from VFS with "struct proc_ops" proc: convert everything to "struct proc_ops" Subsystem: lib Yury Norov <yury.norov@gmail.com>: Patch series "lib: rework bitmap_parse", v5: lib/string: add strnchrnul() bitops: more BITS_TO_* macros lib: add test for bitmap_parse() lib: make bitmap_parse_user a wrapper on bitmap_parse lib: rework bitmap_parse() lib: new testcases for bitmap_parse{_user} include/linux/cpumask.h: don't calculate length of the input string Subsystem: cleanups Masahiro Yamada <masahiroy@kernel.org>: treewide: remove redundant IS_ERR() before error code check Subsystem: arm Chen-Yu Tsai <wens@csie.org>: ARM: dma-api: fix max_pfn off-by-one error in __dma_supported() Documentation/memory-barriers.txt | 14 arch/Kconfig | 17 arch/alpha/kernel/srm_env.c | 17 arch/arc/include/asm/pgtable.h | 1 arch/arm/Kconfig | 2 arch/arm/include/asm/pgtable-2level.h | 1 arch/arm/include/asm/pgtable-3level.h | 1 arch/arm/include/asm/tlb.h | 6 arch/arm/kernel/atags_proc.c | 8 arch/arm/mm/alignment.c | 14 arch/arm/mm/dma-mapping.c | 2 arch/arm64/Kconfig | 3 arch/arm64/Kconfig.debug | 19 arch/arm64/include/asm/pgtable.h | 2 arch/arm64/include/asm/ptdump.h | 8 arch/arm64/mm/Makefile | 4 arch/arm64/mm/dump.c | 152 ++---- arch/arm64/mm/mmu.c | 4 arch/arm64/mm/ptdump_debugfs.c | 2 arch/ia64/kernel/salinfo.c | 24 - arch/m68k/kernel/bootinfo_proc.c | 8 arch/mips/include/asm/pgtable.h | 5 arch/mips/lasat/picvue_proc.c | 31 - arch/powerpc/Kconfig | 7 arch/powerpc/include/asm/book3s/32/pgalloc.h | 8 arch/powerpc/include/asm/book3s/64/pgalloc.h | 2 arch/powerpc/include/asm/book3s/64/pgtable.h | 3 arch/powerpc/include/asm/nohash/pgalloc.h | 8 arch/powerpc/include/asm/tlb.h | 11 arch/powerpc/kernel/proc_powerpc.c | 10 arch/powerpc/kernel/rtas-proc.c | 70 +-- arch/powerpc/kernel/rtas_flash.c | 34 - arch/powerpc/kernel/rtasd.c | 14 arch/powerpc/mm/book3s64/pgtable.c | 7 arch/powerpc/mm/numa.c | 12 arch/powerpc/platforms/pseries/lpar.c | 24 - arch/powerpc/platforms/pseries/lparcfg.c | 14 arch/powerpc/platforms/pseries/reconfig.c | 8 arch/powerpc/platforms/pseries/scanlog.c | 15 arch/riscv/include/asm/pgtable-64.h | 7 arch/riscv/include/asm/pgtable.h | 7 arch/s390/Kconfig | 4 arch/s390/include/asm/pgtable.h | 2 arch/sh/mm/alignment.c | 17 arch/sparc/Kconfig | 3 arch/sparc/include/asm/pgtable_64.h | 2 arch/sparc/include/asm/tlb_64.h | 11 arch/sparc/kernel/led.c | 15 arch/um/drivers/mconsole_kern.c | 9 arch/um/kernel/exitcode.c | 15 arch/um/kernel/process.c | 15 arch/x86/Kconfig | 3 arch/x86/Kconfig.debug | 20 arch/x86/include/asm/pgtable.h | 10 arch/x86/include/asm/tlb.h | 4 arch/x86/kernel/cpu/mtrr/if.c | 21 arch/x86/mm/Makefile | 4 arch/x86/mm/debug_pagetables.c | 18 arch/x86/mm/dump_pagetables.c | 418 +++++------------- arch/x86/platform/efi/efi_32.c | 2 arch/x86/platform/efi/efi_64.c | 4 arch/x86/platform/uv/tlb_uv.c | 14 arch/xtensa/platforms/iss/simdisk.c | 10 crypto/af_alg.c | 2 drivers/acpi/battery.c | 15 drivers/acpi/proc.c | 15 drivers/acpi/scan.c | 2 drivers/base/memory.c | 9 drivers/block/null_blk_main.c | 58 +- drivers/char/hw_random/bcm2835-rng.c | 2 drivers/char/hw_random/omap-rng.c | 4 drivers/clk/clk.c | 2 drivers/dma/mv_xor_v2.c | 2 drivers/firmware/efi/arm-runtime.c | 2 drivers/gpio/gpiolib-devres.c | 2 drivers/gpio/gpiolib-of.c | 8 drivers/gpio/gpiolib.c | 2 drivers/hwmon/dell-smm-hwmon.c | 15 drivers/i2c/busses/i2c-mv64xxx.c | 5 drivers/i2c/busses/i2c-synquacer.c | 2 drivers/ide/ide-proc.c | 19 drivers/input/input.c | 28 - drivers/isdn/capi/kcapi_proc.c | 6 drivers/macintosh/via-pmu.c | 17 drivers/md/md.c | 15 drivers/misc/sgi-gru/gruprocfs.c | 42 - drivers/mtd/ubi/build.c | 2 drivers/net/wireless/cisco/airo.c | 126 ++--- drivers/net/wireless/intel/ipw2x00/libipw_module.c | 15 drivers/net/wireless/intersil/hostap/hostap_hw.c | 4 drivers/net/wireless/intersil/hostap/hostap_proc.c | 14 drivers/net/wireless/intersil/hostap/hostap_wlan.h | 2 drivers/net/wireless/ray_cs.c | 20 drivers/of/device.c | 2 drivers/parisc/led.c | 17 drivers/pci/controller/pci-tegra.c | 2 drivers/pci/proc.c | 25 - drivers/phy/phy-core.c | 4 drivers/pinctrl/pxa/pinctrl-pxa2xx.c | 1 drivers/platform/x86/thinkpad_acpi.c | 15 drivers/platform/x86/toshiba_acpi.c | 60 +- drivers/pnp/isapnp/proc.c | 9 drivers/pnp/pnpbios/proc.c | 17 drivers/s390/block/dasd_proc.c | 15 drivers/s390/cio/blacklist.c | 14 drivers/s390/cio/css.c | 11 drivers/scsi/esas2r/esas2r_main.c | 9 drivers/scsi/scsi_devinfo.c | 15 drivers/scsi/scsi_proc.c | 29 - drivers/scsi/sg.c | 30 - drivers/spi/spi-orion.c | 3 drivers/staging/rtl8192u/ieee80211/ieee80211_module.c | 14 drivers/tty/sysrq.c | 8 drivers/usb/gadget/function/rndis.c | 17 drivers/video/fbdev/imxfb.c | 2 drivers/video/fbdev/via/viafbdev.c | 105 ++-- drivers/zorro/proc.c | 9 fs/cifs/cifs_debug.c | 108 ++-- fs/cifs/dfs_cache.c | 13 fs/cifs/dfs_cache.h | 2 fs/ext4/super.c | 2 fs/f2fs/node.c | 2 fs/fscache/internal.h | 2 fs/fscache/object-list.c | 11 fs/fscache/proc.c | 2 fs/jbd2/journal.c | 13 fs/jfs/jfs_debug.c | 14 fs/lockd/procfs.c | 12 fs/nfsd/nfsctl.c | 13 fs/nfsd/stats.c | 12 fs/ocfs2/file.c | 14 fs/ocfs2/suballoc.c | 2 fs/proc/cpuinfo.c | 12 fs/proc/generic.c | 38 - fs/proc/inode.c | 76 +-- fs/proc/internal.h | 5 fs/proc/kcore.c | 13 fs/proc/kmsg.c | 14 fs/proc/page.c | 54 +- fs/proc/proc_net.c | 32 - fs/proc/proc_sysctl.c | 2 fs/proc/root.c | 2 fs/proc/stat.c | 12 fs/proc/task_mmu.c | 4 fs/proc/vmcore.c | 10 fs/sysfs/group.c | 2 include/asm-generic/pgtable.h | 20 include/asm-generic/tlb.h | 138 +++-- include/linux/bitmap.h | 8 include/linux/bitops.h | 4 include/linux/cpumask.h | 4 include/linux/memory_hotplug.h | 4 include/linux/mm.h | 6 include/linux/mmzone.h | 10 include/linux/pagewalk.h | 49 +- include/linux/proc_fs.h | 23 include/linux/ptdump.h | 24 - include/linux/seq_file.h | 13 include/linux/slab.h | 1 include/linux/string.h | 1 include/linux/sunrpc/stats.h | 4 ipc/mqueue.c | 123 ++++- ipc/msg.c | 62 +- ipc/sem.c | 66 +- ipc/util.c | 14 kernel/configs.c | 9 kernel/irq/proc.c | 42 - kernel/kallsyms.c | 12 kernel/latencytop.c | 14 kernel/locking/lockdep_proc.c | 15 kernel/module.c | 12 kernel/profile.c | 24 - kernel/sched/psi.c | 48 +- lib/bitmap.c | 195 ++++---- lib/string.c | 17 lib/test_bitmap.c | 105 ++++ mm/Kconfig.debug | 21 mm/Makefile | 1 mm/gup.c | 2 mm/hmm.c | 66 +- mm/memory_hotplug.c | 104 +--- mm/memremap.c | 2 mm/migrate.c | 5 mm/mincore.c | 1 mm/mmu_gather.c | 158 ++++-- mm/page_alloc.c | 75 +-- mm/pagewalk.c | 167 +++++-- mm/ptdump.c | 159 ++++++ mm/slab_common.c | 37 - mm/sparse.c | 10 mm/swapfile.c | 14 net/atm/mpoa_proc.c | 17 net/atm/proc.c | 8 net/core/dev.c | 2 net/core/filter.c | 2 net/core/pktgen.c | 44 - net/ipv4/ipconfig.c | 10 net/ipv4/netfilter/ipt_CLUSTERIP.c | 16 net/ipv4/route.c | 24 - net/netfilter/xt_recent.c | 17 net/sunrpc/auth_gss/svcauth_gss.c | 10 net/sunrpc/cache.c | 45 - net/sunrpc/stats.c | 21 net/xfrm/xfrm_policy.c | 2 samples/kfifo/bytestream-example.c | 11 samples/kfifo/inttype-example.c | 11 samples/kfifo/record-example.c | 11 scripts/coccinelle/free/devm_free.cocci | 4 sound/core/info.c | 34 - sound/soc/codecs/ak4104.c | 3 sound/soc/codecs/cs4270.c | 3 sound/soc/codecs/tlv320aic32x4.c | 6 sound/soc/sunxi/sun4i-spdif.c | 2 tools/include/linux/bitops.h | 9 214 files changed, 2589 insertions(+), 2227 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-02-04 1:33 incoming Andrew Morton @ 2020-02-04 2:27 ` Linus Torvalds 2020-02-04 2:46 ` incoming Andrew Morton 0 siblings, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2020-02-04 2:27 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Tue, Feb 4, 2020 at 1:33 AM Andrew Morton <akpm@linux-foundation.org> wrote: > > The rest of MM and the rest of everything else. What's the base? You've changed your scripts or something, and that information is no longer in your cover letter.. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-02-04 2:27 ` incoming Linus Torvalds @ 2020-02-04 2:46 ` Andrew Morton 2020-02-04 3:11 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2020-02-04 2:46 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, Linux-MM On Tue, 4 Feb 2020 02:27:48 +0000 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Tue, Feb 4, 2020 at 1:33 AM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > The rest of MM and the rest of everything else. > > What's the base? You've changed your scripts or something, and that > information is no longer in your cover letter.. > Crap, sorry, geriatric. d4e9056daedca3891414fe3c91de3449a5dad0f2 ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2020-02-04 2:46 ` incoming Andrew Morton @ 2020-02-04 3:11 ` Linus Torvalds 0 siblings, 0 replies; 322+ messages in thread From: Linus Torvalds @ 2020-02-04 3:11 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Tue, Feb 4, 2020 at 2:46 AM Andrew Morton <akpm@linux-foundation.org> wrote: > > On Tue, 4 Feb 2020 02:27:48 +0000 Linus Torvalds <torvalds@linux-foundation.org> wrote: > > > What's the base? You've changed your scripts or something, and that > > information is no longer in your cover letter.. > > Crap, sorry, geriatric. > > d4e9056daedca3891414fe3c91de3449a5dad0f2 Ok, I've tentatively applied it with the MIME decoding fixes I found, and I'll guess I'll let it build and sit for a while before merging it into my tree. I didn't find anything else odd in there. But... Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-01-31 6:10 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-01-31 6:10 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits Most of -mm and quite a number of other subsystems. MM is fairly quiet this time. Holidays, I assume. 119 patches, based on 39bed42de2e7d74686a2d5a45638d6a5d7e7d473: Subsystems affected by this patch series: hotfixes scripts ocfs2 mm/slub mm/kmemleak mm/debug mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/tracing mm/kasan mm/initialization mm/pagealloc mm/vmscan mm/tools mm/memblock mm/oom-kill mm/hugetlb mm/migration mm/mmap mm/memory-hotplug mm/zswap mm/cleanups mm/zram misc lib binfmt init reiserfs exec dma-mapping kcov Subsystem: hotfixes Andy Shevchenko <andriy.shevchenko@linux.intel.com>: lib/test_bitmap: correct test data offsets for 32-bit "Theodore Ts'o" <tytso@mit.edu>: memcg: fix a crash in wb_workfn when a device disappears Dan Carpenter <dan.carpenter@oracle.com>: mm/mempolicy.c: fix out of bounds write in mpol_parse_str() Pingfan Liu <kernelfans@gmail.com>: mm/sparse.c: reset section's mem_map when fully deactivated Wei Yang <richardw.yang@linux.intel.com>: mm/migrate.c: also overwrite error when it is bigger than zero Dan Williams <dan.j.williams@intel.com>: mm/memory_hotplug: fix remove_memory() lockdep splat Wei Yang <richardw.yang@linux.intel.com>: mm: thp: don't need care deferred split queue in memcg charge move path Yang Shi <yang.shi@linux.alibaba.com>: mm: move_pages: report the number of non-attempted pages Subsystem: scripts Xiong <xndchn@gmail.com>: scripts/spelling.txt: add more spellings to spelling.txt Luca Ceresoli <luca@lucaceresoli.net>: scripts/spelling.txt: add "issus" typo Subsystem: ocfs2 Aditya Pakki <pakki001@umn.edu>: fs: ocfs: remove unnecessary assertion in dlm_migrate_lockres zhengbin <zhengbin13@huawei.com>: ocfs2: remove unneeded semicolons Masahiro Yamada <masahiroy@kernel.org>: ocfs2: make local header paths relative to C files Colin Ian King <colin.king@canonical.com>: ocfs2/dlm: remove redundant assignment to ret Andy Shevchenko <andriy.shevchenko@linux.intel.com>: ocfs2/dlm: move BITS_TO_BYTES() to bitops.h for wider use wangyan <wangyan122@huawei.com>: ocfs2: fix a NULL pointer dereference when call ocfs2_update_inode_fsync_trans() ocfs2: use ocfs2_update_inode_fsync_trans() to access t_tid in handle->h_transaction Subsystem: mm/slub Yu Zhao <yuzhao@google.com>: mm/slub.c: avoid slub allocation while holding list_lock Subsystem: mm/kmemleak He Zhe <zhe.he@windriver.com>: mm/kmemleak: turn kmemleak_lock and object->lock to raw_spinlock_t Subsystem: mm/debug Vlastimil Babka <vbabka@suse.cz>: mm/debug.c: always print flags in dump_page() Subsystem: mm/pagecache Ira Weiny <ira.weiny@intel.com>: mm/filemap.c: clean up filemap_write_and_wait() Subsystem: mm/gup Qiujun Huang <hqjagain@gmail.com>: mm: fix gup_pud_range Wei Yang <richardw.yang@linux.intel.com>: mm/gup.c: use is_vm_hugetlb_page() to check whether to follow huge John Hubbard <jhubbard@nvidia.com>: Patch series "mm/gup: prereqs to track dma-pinned pages: FOLL_PIN", v12: mm/gup: factor out duplicate code from four routines mm/gup: move try_get_compound_head() to top, fix minor issues Dan Williams <dan.j.williams@intel.com>: mm: Cleanup __put_devmap_managed_page() vs ->page_free() John Hubbard <jhubbard@nvidia.com>: mm: devmap: refactor 1-based refcounting for ZONE_DEVICE pages goldish_pipe: rename local pin_user_pages() routine mm: fix get_user_pages_remote()'s handling of FOLL_LONGTERM vfio: fix FOLL_LONGTERM use, simplify get_user_pages_remote() call mm/gup: allow FOLL_FORCE for get_user_pages_fast() IB/umem: use get_user_pages_fast() to pin DMA pages media/v4l2-core: set pages dirty upon releasing DMA buffers mm/gup: introduce pin_user_pages*() and FOLL_PIN goldish_pipe: convert to pin_user_pages() and put_user_page() IB/{core,hw,umem}: set FOLL_PIN via pin_user_pages*(), fix up ODP mm/process_vm_access: set FOLL_PIN via pin_user_pages_remote() drm/via: set FOLL_PIN via pin_user_pages_fast() fs/io_uring: set FOLL_PIN via pin_user_pages() net/xdp: set FOLL_PIN via pin_user_pages() media/v4l2-core: pin_user_pages (FOLL_PIN) and put_user_page() conversion vfio, mm: pin_user_pages (FOLL_PIN) and put_user_page() conversion powerpc: book3s64: convert to pin_user_pages() and put_user_page() mm/gup_benchmark: use proper FOLL_WRITE flags instead of hard-coding "1" mm, tree-wide: rename put_user_page*() to unpin_user_page*() Subsystem: mm/swap Vasily Averin <vvs@virtuozzo.com>: mm/swapfile.c: swap_next should increase position index Subsystem: mm/memcg Kaitao Cheng <pilgrimtao@gmail.com>: mm/memcontrol.c: cleanup some useless code Subsystem: mm/pagemap Li Xinhai <lixinhai.lxh@gmail.com>: mm/page_vma_mapped.c: explicitly compare pfn for normal, hugetlbfs and THP page Subsystem: mm/tracing Junyong Sun <sunjy516@gmail.com>: mm, tracing: print symbol name for kmem_alloc_node call_site events Subsystem: mm/kasan "Gustavo A. R. Silva" <gustavo@embeddedor.com>: lib/test_kasan.c: fix memory leak in kmalloc_oob_krealloc_more() Subsystem: mm/initialization Andy Shevchenko <andriy.shevchenko@linux.intel.com>: mm/early_ioremap.c: use %pa to print resource_size_t variables Subsystem: mm/pagealloc "Kirill A. Shutemov" <kirill@shutemov.name>: mm/page_alloc: skip non present sections on zone initialization David Hildenbrand <david@redhat.com>: mm: remove the memory isolate notifier mm: remove "count" parameter from has_unmovable_pages() Subsystem: mm/vmscan Liu Song <liu.song11@zte.com.cn>: mm/vmscan.c: remove unused return value of shrink_node Alex Shi <alex.shi@linux.alibaba.com>: mm/vmscan: remove prefetch_prev_lru_page mm/vmscan: remove unused RECLAIM_OFF/RECLAIM_ZONE Subsystem: mm/tools Daniel Wagner <dwagner@suse.de>: tools/vm/slabinfo: fix sanity checks enabling Subsystem: mm/memblock Anshuman Khandual <anshuman.khandual@arm.com>: mm/memblock: define memblock_physmem_add() memblock: Use __func__ in remaining memblock_dbg() call sites Subsystem: mm/oom-kill David Rientjes <rientjes@google.com>: mm, oom: dump stack of victim when reaping failed Subsystem: mm/hugetlb Wei Yang <richardw.yang@linux.intel.com>: mm/huge_memory.c: use head to check huge zero page mm/huge_memory.c: use head to emphasize the purpose of page mm/huge_memory.c: reduce critical section protected by split_queue_lock Subsystem: mm/migration Ralph Campbell <rcampbell@nvidia.com>: mm/migrate: remove useless mask of start address mm/migrate: clean up some minor coding style mm/migrate: add stable check in migrate_vma_insert_page() David Rientjes <rientjes@google.com>: mm, thp: fix defrag setting if newline is not used Subsystem: mm/mmap Miaohe Lin <linmiaohe@huawei.com>: mm/mmap.c: get rid of odd jump labels in find_mergeable_anon_vma() Subsystem: mm/memory-hotplug David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: pass in nid to online_pages()": mm/memory_hotplug: pass in nid to online_pages() Qian Cai <cai@lca.pw>: mm/hotplug: silence a lockdep splat with printk() mm/page_isolation: fix potential warning from user Subsystem: mm/zswap Vitaly Wool <vitaly.wool@konsulko.com>: mm/zswap.c: add allocation hysteresis if pool limit is hit Dan Carpenter <dan.carpenter@oracle.com>: zswap: potential NULL dereference on error in init_zswap() Subsystem: mm/cleanups Yu Zhao <yuzhao@google.com>: include/linux/mm.h: clean up obsolete check on space in page->flags Wei Yang <richardw.yang@linux.intel.com>: include/linux/mm.h: remove dead code totalram_pages_set() Anshuman Khandual <anshuman.khandual@arm.com>: include/linux/memory.h: drop fields 'hw' and 'phys_callback' from struct memory_block Hao Lee <haolee.swjtu@gmail.com>: mm: fix comments related to node reclaim Subsystem: mm/zram Taejoon Song <taejoon.song@lge.com>: zram: try to avoid worst-case scenario on same element pages Colin Ian King <colin.king@canonical.com>: drivers/block/zram/zram_drv.c: fix error return codes not being returned in writeback_store Subsystem: misc Akinobu Mita <akinobu.mita@gmail.com>: Patch series "add header file for kelvin to/from Celsius conversion: include/linux/units.h: add helpers for kelvin to/from Celsius conversion ACPI: thermal: switch to use <linux/units.h> helpers platform/x86: asus-wmi: switch to use <linux/units.h> helpers platform/x86: intel_menlow: switch to use <linux/units.h> helpers thermal: int340x: switch to use <linux/units.h> helpers thermal: intel_pch: switch to use <linux/units.h> helpers nvme: hwmon: switch to use <linux/units.h> helpers thermal: remove kelvin to/from Celsius conversion helpers from <linux/thermal.h> iwlegacy: use <linux/units.h> helpers iwlwifi: use <linux/units.h> helpers thermal: armada: remove unused TO_MCELSIUS macro iio: adc: qcom-vadc-common: use <linux/units.h> helpers Subsystem: lib Mikhail Zaslonko <zaslonko@linux.ibm.com>: Patch series "S390 hardware support for kernel zlib", v3: lib/zlib: add s390 hardware support for kernel zlib_deflate s390/boot: rename HEAP_SIZE due to name collision lib/zlib: add s390 hardware support for kernel zlib_inflate s390/boot: add dfltcc= kernel command line parameter lib/zlib: add zlib_deflate_dfltcc_enabled() function btrfs: use larger zlib buffer for s390 hardware compression Nathan Chancellor <natechancellor@gmail.com>: lib/scatterlist.c: adjust indentation in __sg_alloc_table Yury Norov <yury.norov@gmail.com>: uapi: rename ext2_swab() to swab() and share globally in swab.h lib/find_bit.c: join _find_next_bit{_le} lib/find_bit.c: uninline helper _find_next_bit() Subsystem: binfmt Alexey Dobriyan <adobriyan@gmail.com>: fs/binfmt_elf.c: smaller code generation around auxv vector fill fs/binfmt_elf.c: fix ->start_code calculation fs/binfmt_elf.c: don't copy ELF header around fs/binfmt_elf.c: better codegen around current->mm fs/binfmt_elf.c: make BAD_ADDR() unlikely fs/binfmt_elf.c: coredump: allocate core ELF header on stack fs/binfmt_elf.c: coredump: delete duplicated overflow check fs/binfmt_elf.c: coredump: allow process with empty address space to coredump Subsystem: init Arvind Sankar <nivedita@alum.mit.edu>: init/main.c: log arguments and environment passed to init init/main.c: remove unnecessary repair_env_string in do_initcall_level Patch series "init/main.c: minor cleanup/bugfix of envvar handling", v2: init/main.c: fix quoted value handling in unknown_bootoption Christophe Leroy <christophe.leroy@c-s.fr>: init/main.c: fix misleading "This architecture does not have kernel memory protection" message Subsystem: reiserfs Yunfeng Ye <yeyunfeng@huawei.com>: reiserfs: prevent NULL pointer dereference in reiserfs_insert_item() Subsystem: exec Alexey Dobriyan <adobriyan@gmail.com>: execve: warn if process starts with executable stack Subsystem: dma-mapping Andy Shevchenko <andriy.shevchenko@linux.intel.com>: include/linux/io-mapping.h-mapping: use PHYS_PFN() macro in io_mapping_map_atomic_wc() Subsystem: kcov Dmitry Vyukov <dvyukov@google.com>: kcov: ignore fault-inject and stacktrace Documentation/admin-guide/kernel-parameters.txt | 12 Documentation/core-api/index.rst | 1 Documentation/core-api/pin_user_pages.rst | 234 +++++ Documentation/vm/zswap.rst | 13 arch/powerpc/mm/book3s64/iommu_api.c | 14 arch/s390/boot/compressed/decompressor.c | 8 arch/s390/boot/ipl_parm.c | 14 arch/s390/include/asm/setup.h | 7 arch/s390/kernel/setup.c | 14 drivers/acpi/thermal.c | 34 drivers/base/memory.c | 25 drivers/block/zram/zram_drv.c | 10 drivers/gpu/drm/via/via_dmablit.c | 6 drivers/iio/adc/qcom-vadc-common.c | 6 drivers/iio/adc/qcom-vadc-common.h | 1 drivers/infiniband/core/umem.c | 21 drivers/infiniband/core/umem_odp.c | 13 drivers/infiniband/hw/hfi1/user_pages.c | 4 drivers/infiniband/hw/mthca/mthca_memfree.c | 8 drivers/infiniband/hw/qib/qib_user_pages.c | 4 drivers/infiniband/hw/qib/qib_user_sdma.c | 8 drivers/infiniband/hw/usnic/usnic_uiom.c | 4 drivers/infiniband/sw/siw/siw_mem.c | 4 drivers/media/v4l2-core/videobuf-dma-sg.c | 20 drivers/net/ethernet/broadcom/bnx2x/bnx2x_init.h | 1 drivers/net/wireless/intel/iwlegacy/4965-mac.c | 3 drivers/net/wireless/intel/iwlegacy/4965.c | 17 drivers/net/wireless/intel/iwlegacy/common.h | 3 drivers/net/wireless/intel/iwlwifi/dvm/dev.h | 5 drivers/net/wireless/intel/iwlwifi/dvm/devices.c | 6 drivers/nvdimm/pmem.c | 6 drivers/nvme/host/hwmon.c | 13 drivers/platform/goldfish/goldfish_pipe.c | 39 drivers/platform/x86/asus-wmi.c | 7 drivers/platform/x86/intel_menlow.c | 9 drivers/thermal/armada_thermal.c | 2 drivers/thermal/intel/int340x_thermal/int340x_thermal_zone.c | 7 drivers/thermal/intel/intel_pch_thermal.c | 3 drivers/vfio/vfio_iommu_type1.c | 39 fs/binfmt_elf.c | 154 +-- fs/btrfs/compression.c | 2 fs/btrfs/zlib.c | 135 ++ fs/exec.c | 5 fs/fs-writeback.c | 2 fs/io_uring.c | 6 fs/ocfs2/cluster/quorum.c | 2 fs/ocfs2/dlm/Makefile | 2 fs/ocfs2/dlm/dlmast.c | 8 fs/ocfs2/dlm/dlmcommon.h | 4 fs/ocfs2/dlm/dlmconvert.c | 8 fs/ocfs2/dlm/dlmdebug.c | 8 fs/ocfs2/dlm/dlmdomain.c | 8 fs/ocfs2/dlm/dlmlock.c | 8 fs/ocfs2/dlm/dlmmaster.c | 10 fs/ocfs2/dlm/dlmrecovery.c | 10 fs/ocfs2/dlm/dlmthread.c | 8 fs/ocfs2/dlm/dlmunlock.c | 8 fs/ocfs2/dlmfs/Makefile | 2 fs/ocfs2/dlmfs/dlmfs.c | 4 fs/ocfs2/dlmfs/userdlm.c | 6 fs/ocfs2/dlmglue.c | 2 fs/ocfs2/journal.h | 8 fs/ocfs2/namei.c | 3 fs/reiserfs/stree.c | 3 include/linux/backing-dev.h | 10 include/linux/bitops.h | 1 include/linux/fs.h | 6 include/linux/io-mapping.h | 5 include/linux/memblock.h | 7 include/linux/memory.h | 29 include/linux/memory_hotplug.h | 3 include/linux/mm.h | 116 +- include/linux/mmzone.h | 2 include/linux/page-isolation.h | 8 include/linux/swab.h | 1 include/linux/thermal.h | 11 include/linux/units.h | 84 + include/linux/zlib.h | 6 include/trace/events/kmem.h | 4 include/trace/events/writeback.h | 37 include/uapi/linux/swab.h | 10 include/uapi/linux/sysctl.h | 2 init/main.c | 36 kernel/Makefile | 1 lib/Kconfig | 7 lib/Makefile | 2 lib/decompress_inflate.c | 13 lib/find_bit.c | 82 - lib/scatterlist.c | 2 lib/test_bitmap.c | 9 lib/test_kasan.c | 1 lib/zlib_deflate/deflate.c | 85 + lib/zlib_deflate/deflate_syms.c | 1 lib/zlib_deflate/deftree.c | 54 - lib/zlib_deflate/defutil.h | 134 ++ lib/zlib_dfltcc/Makefile | 13 lib/zlib_dfltcc/dfltcc.c | 57 + lib/zlib_dfltcc/dfltcc.h | 155 +++ lib/zlib_dfltcc/dfltcc_deflate.c | 280 ++++++ lib/zlib_dfltcc/dfltcc_inflate.c | 149 +++ lib/zlib_dfltcc/dfltcc_syms.c | 17 lib/zlib_dfltcc/dfltcc_util.h | 123 ++ lib/zlib_inflate/inflate.c | 32 lib/zlib_inflate/inflate.h | 8 lib/zlib_inflate/infutil.h | 18 mm/Makefile | 1 mm/backing-dev.c | 1 mm/debug.c | 18 mm/early_ioremap.c | 8 mm/filemap.c | 34 mm/gup.c | 503 ++++++----- mm/gup_benchmark.c | 9 mm/huge_memory.c | 44 mm/kmemleak.c | 112 +- mm/memblock.c | 22 mm/memcontrol.c | 25 mm/memory_hotplug.c | 24 mm/mempolicy.c | 6 mm/memremap.c | 95 -- mm/migrate.c | 77 + mm/mmap.c | 30 mm/oom_kill.c | 2 mm/page_alloc.c | 83 + mm/page_isolation.c | 69 - mm/page_vma_mapped.c | 12 mm/process_vm_access.c | 32 mm/slub.c | 88 + mm/sparse.c | 2 mm/swap.c | 27 mm/swapfile.c | 2 mm/vmscan.c | 24 mm/zswap.c | 88 + net/xdp/xdp_umem.c | 4 scripts/spelling.txt | 14 tools/testing/selftests/vm/gup_benchmark.c | 6 tools/vm/slabinfo.c | 4 136 files changed, 2790 insertions(+), 1358 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-01-14 0:28 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-01-14 0:28 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 11 MM fixes, based on b3a987b0264d3ddbb24293ebff10eddfc472f653: Vlastimil Babka <vbabka@suse.cz>: mm, thp: tweak reclaim/compaction effort of local-only and all-node allocations David Hildenbrand <david@redhat.com>: mm/memory_hotplug: don't free usage map when removing a re-added early section "Kirill A. Shutemov" <kirill@shutemov.name>: Patch series "Fix two above-47bit hint address vs. THP bugs": mm/huge_memory.c: thp: fix conflict of above-47bit hint address and PMD alignment mm/shmem.c: thp, shmem: fix conflict of above-47bit hint address and PMD alignment Roman Gushchin <guro@fb.com>: mm: memcg/slab: fix percpu slab vmstats flushing Vlastimil Babka <vbabka@suse.cz>: mm, debug_pagealloc: don't rely on static keys too early Wen Yang <wenyang@linux.alibaba.com>: Patch series "use div64_ul() instead of div_u64() if the divisor is: mm/page-writeback.c: avoid potential division by zero in wb_min_max_ratio() mm/page-writeback.c: use div64_ul() for u64-by-unsigned-long divide mm/page-writeback.c: improve arithmetic divisions Adrian Huang <ahuang12@lenovo.com>: mm: memcg/slab: call flush_memcg_workqueue() only if memcg workqueue is valid Yang Shi <yang.shi@linux.alibaba.com>: mm: khugepaged: add trace status description for SCAN_PAGE_HAS_PRIVATE include/linux/mm.h | 18 +++++++++- include/linux/mmzone.h | 5 +-- include/trace/events/huge_memory.h | 3 + init/main.c | 1 mm/huge_memory.c | 38 ++++++++++++++--------- mm/memcontrol.c | 37 +++++----------------- mm/mempolicy.c | 10 ++++-- mm/page-writeback.c | 10 +++--- mm/page_alloc.c | 61 ++++++++++--------------------------- mm/shmem.c | 7 ++-- mm/slab.c | 4 +- mm/slab_common.c | 3 + mm/slub.c | 2 - mm/sparse.c | 9 ++++- mm/vmalloc.c | 4 +- 15 files changed, 102 insertions(+), 110 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2020-01-04 20:55 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2020-01-04 20:55 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 17 fixes, base on 5613970af3f5f8372c596b138bd64f3918513515: David Hildenbrand <david@redhat.com>: mm/memory_hotplug: shrink zones when offlining memory Chanho Min <chanho.min@lge.com>: mm/zsmalloc.c: fix the migrated zspage statistics. Andrey Konovalov <andreyknvl@google.com>: kcov: fix struct layout for kcov_remote_arg Shakeel Butt <shakeelb@google.com>: memcg: account security cred as well to kmemcg Yang Shi <yang.shi@linux.alibaba.com>: mm: move_pages: return valid node id in status if the page is already on the target node Eric Biggers <ebiggers@google.com>: fs/direct-io.c: include fs/internal.h for missing prototype fs/nsfs.c: include headers for missing declarations fs/namespace.c: make to_mnt_ns() static Nick Desaulniers <ndesaulniers@google.com>: hexagon: parenthesize registers in asm predicates hexagon: work around compiler crash Randy Dunlap <rdunlap@infradead.org>: fs/posix_acl.c: fix kernel-doc warnings Ilya Dryomov <idryomov@gmail.com>: mm/oom: fix pgtables units mismatch in Killed process message Navid Emamdoost <navid.emamdoost@gmail.com>: mm/gup: fix memory leak in __gup_benchmark_ioctl Waiman Long <longman@redhat.com>: mm/hugetlb: defer freeing of huge pages if in non-task context Kai Li <li.kai4@h3c.com>: ocfs2: call journal flush to mark journal as empty after journal recovery when mount Gang He <GHe@suse.com>: ocfs2: fix the crash due to call ocfs2_get_dlm_debug once less Nick Desaulniers <ndesaulniers@google.com>: hexagon: define ioremap_uc Documentation/dev-tools/kcov.rst | 10 +++---- arch/arm64/mm/mmu.c | 4 -- arch/hexagon/include/asm/atomic.h | 8 ++--- arch/hexagon/include/asm/bitops.h | 8 ++--- arch/hexagon/include/asm/cmpxchg.h | 2 - arch/hexagon/include/asm/futex.h | 6 ++-- arch/hexagon/include/asm/io.h | 1 arch/hexagon/include/asm/spinlock.h | 20 +++++++------- arch/hexagon/kernel/stacktrace.c | 4 -- arch/hexagon/kernel/vm_entry.S | 2 - arch/ia64/mm/init.c | 4 -- arch/powerpc/mm/mem.c | 3 -- arch/s390/mm/init.c | 4 -- arch/sh/mm/init.c | 4 -- arch/x86/mm/init_32.c | 4 -- arch/x86/mm/init_64.c | 4 -- fs/direct-io.c | 2 + fs/namespace.c | 2 - fs/nsfs.c | 3 ++ fs/ocfs2/dlmglue.c | 1 fs/ocfs2/journal.c | 8 +++++ fs/posix_acl.c | 7 +++- include/linux/memory_hotplug.h | 7 +++- include/uapi/linux/kcov.h | 10 +++---- kernel/cred.c | 6 ++-- mm/gup_benchmark.c | 8 ++++- mm/hugetlb.c | 51 +++++++++++++++++++++++++++++++++++- mm/memory_hotplug.c | 31 +++++++++++---------- mm/memremap.c | 2 - mm/migrate.c | 23 ++++++++++++---- mm/oom_kill.c | 2 - mm/zsmalloc.c | 5 +++ 32 files changed, 166 insertions(+), 90 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2019-12-18 4:50 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2019-12-18 4:50 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 6 fixes based on 2187f215ebaac73ddbd814696d7c7fa34f0c3de0: Andrey Ryabinin <aryabinin@virtuozzo.com>: kasan: fix crashes on access to memory mapped by vm_map_ram() Daniel Axtens <dja@axtens.net>: mm/memory.c: add apply_to_existing_page_range() helper kasan: use apply_to_existing_page_range() for releasing vmalloc shadow kasan: don't assume percpu shadow allocations will succeed Yang Shi <yang.shi@linux.alibaba.com>: mm: vmscan: protect shrinker idr replace with CONFIG_MEMCG Changbin Du <changbin.du@gmail.com>: lib/Kconfig.debug: fix some messed up configurations include/linux/kasan.h | 15 +++-- include/linux/mm.h | 3 + lib/Kconfig.debug | 100 ++++++++++++++++++------------------ mm/kasan/common.c | 36 ++++++++----- mm/memory.c | 136 ++++++++++++++++++++++++++++++++++---------------- mm/vmalloc.c | 133 ++++++++++++++++++++++++++++-------------------- mm/vmscan.c | 2 7 files changed, 260 insertions(+), 165 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2019-12-05 0:48 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2019-12-05 0:48 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm Most of the rest of MM and various other things. Some Kconfig rework still awaits merges of dependent trees from linux-next. 86 patches, based on 63de37476ebd1e9bab6a9e17186dc5aa1da9ea99. Subsystems affected by this patch series: mm/hotfixes mm/memcg mm/vmstat mm/thp procfs sysctl misc notifiers core-kernel bitops lib checkpatch epoll binfmt init rapidio uaccess kcov ubsan ipc bitmap mm/pagemap Subsystem: mm/hotfixes zhong jiang <zhongjiang@huawei.com>: mm/kasan/common.c: fix compile error Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: memcg/slab: wait for !root kmem_cache refcnt killing on root kmem_cache destruction Subsystem: mm/vmstat Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm/vmstat: add helpers to get vmstat item names for each enum type mm/memcontrol: use vmstat names for printing statistics Subsystem: mm/thp Yu Zhao <yuzhao@google.com>: mm/memory.c: replace is_zero_pfn with is_huge_zero_pmd for thp Subsystem: procfs Alexey Dobriyan <adobriyan@gmail.com>: proc: change ->nlink under proc_subdir_lock fs/proc/generic.c: delete useless "len" variable fs/proc/internal.h: shuffle "struct pde_opener" Miaohe Lin <linmiaohe@huawei.com>: include/linux/proc_fs.h: fix confusing macro arg name Krzysztof Kozlowski <krzk@kernel.org>: fs/proc/Kconfig: fix indentation Subsystem: sysctl Alessio Balsini <balsini@android.com>: include/linux/sysctl.h: inline braces for ctl_table and ctl_table_header Subsystem: misc Stephen Boyd <swboyd@chromium.org>: .gitattributes: use 'dts' diff driver for dts files Rikard Falkeborn <rikard.falkeborn@gmail.com>: linux/build_bug.h: change type to int Masahiro Yamada <yamada.masahiro@socionext.com>: linux/scc.h: make uapi linux/scc.h self-contained Krzysztof Kozlowski <krzk@kernel.org>: arch/Kconfig: fix indentation Joe Perches <joe@perches.com>: scripts/get_maintainer.pl: add signatures from Fixes: <badcommit> lines in commit message Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: update comment about simple_strto<foo>() functions auxdisplay: charlcd: deduplicate simple_strtoul() Subsystem: notifiers Xiaoming Ni <nixiaoming@huawei.com>: kernel/notifier.c: intercept duplicate registrations to avoid infinite loops kernel/notifier.c: remove notifier_chain_cond_register() kernel/notifier.c: remove blocking_notifier_chain_cond_register() Subsystem: core-kernel Nathan Chancellor <natechancellor@gmail.com>: kernel/profile.c: use cpumask_available to check for NULL cpumask Joe Perches <joe@perches.com>: kernel/sys.c: avoid copying possible padding bytes in copy_to_user Subsystem: bitops William Breathitt Gray <vilhelm.gray@gmail.com>: bitops: introduce the for_each_set_clump8 macro lib/test_bitmap.c: add for_each_set_clump8 test cases gpio: 104-dio-48e: utilize for_each_set_clump8 macro gpio: 104-idi-48: utilize for_each_set_clump8 macro gpio: gpio-mm: utilize for_each_set_clump8 macro gpio: ws16c48: utilize for_each_set_clump8 macro gpio: pci-idio-16: utilize for_each_set_clump8 macro gpio: pcie-idio-24: utilize for_each_set_clump8 macro gpio: uniphier: utilize for_each_set_clump8 macro gpio: 74x164: utilize the for_each_set_clump8 macro thermal: intel: intel_soc_dts_iosf: Utilize for_each_set_clump8 macro gpio: pisosr: utilize the for_each_set_clump8 macro gpio: max3191x: utilize the for_each_set_clump8 macro gpio: pca953x: utilize the for_each_set_clump8 macro Subsystem: lib Wei Yang <richardw.yang@linux.intel.com>: lib/rbtree: set successor's parent unconditionally lib/rbtree: get successor's color directly Laura Abbott <labbott@redhat.com>: lib/test_meminit.c: add bulk alloc/free tests Trent Piepho <tpiepho@gmail.com>: lib/math/rational.c: fix possible incorrect result from rational fractions helper Huang Shijie <sjhuang@iluvatar.ai>: lib/genalloc.c: export symbol addr_in_gen_pool lib/genalloc.c: rename addr_in_gen_pool to gen_pool_has_addr Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: improve ignoring CamelCase SI style variants like mA checkpatch: reduce is_maintained_obsolete lookup runtime Subsystem: epoll Jason Baron <jbaron@akamai.com>: epoll: simplify ep_poll_safewake() for CONFIG_DEBUG_LOCK_ALLOC Heiher <r@hev.cc>: fs/epoll: remove unnecessary wakeups of nested epoll selftests: add epoll selftests Subsystem: binfmt Alexey Dobriyan <adobriyan@gmail.com>: fs/binfmt_elf.c: delete unused "interp_map_addr" argument fs/binfmt_elf.c: extract elf_read() function Subsystem: init Krzysztof Kozlowski <krzk@kernel.org>: init/Kconfig: fix indentation Subsystem: rapidio "Ben Dooks (Codethink)" <ben.dooks@codethink.co.uk>: drivers/rapidio/rio-driver.c: fix missing include of <linux/rio_drv.h> drivers/rapidio/rio-access.c: fix missing include of <linux/rio_drv.h> Subsystem: uaccess Daniel Vetter <daniel.vetter@ffwll.ch>: drm: limit to INT_MAX in create_blob ioctl Kees Cook <keescook@chromium.org>: uaccess: disallow > INT_MAX copy sizes Subsystem: kcov Andrey Konovalov <andreyknvl@google.com>: Patch series " kcov: collect coverage from usb and vhost", v3: kcov: remote coverage support usb, kcov: collect coverage from hub_event vhost, kcov: collect coverage from vhost_worker Subsystem: ubsan Julien Grall <julien.grall@arm.com>: lib/ubsan: don't serialize UBSAN report Subsystem: ipc Masahiro Yamada <yamada.masahiro@socionext.com>: arch: ipcbuf.h: make uapi asm/ipcbuf.h self-contained arch: msgbuf.h: make uapi asm/msgbuf.h self-contained arch: sembuf.h: make uapi asm/sembuf.h self-contained Subsystem: bitmap Andy Shevchenko <andriy.shevchenko@linux.intel.com>: Patch series "gpio: pca953x: Convert to bitmap (extended) API", v2: lib/test_bitmap: force argument of bitmap_parselist_user() to proper address space lib/test_bitmap: undefine macros after use lib/test_bitmap: name EXP_BYTES properly lib/test_bitmap: rename exp to exp1 to avoid ambiguous name lib/test_bitmap: move exp1 and exp2 upper for others to use lib/test_bitmap: fix comment about this file lib/bitmap: introduce bitmap_replace() helper gpio: pca953x: remove redundant variable and check in IRQ handler gpio: pca953x: use input from regs structure in pca953x_irq_pending() gpio: pca953x: convert to use bitmap API gpio: pca953x: tighten up indentation Subsystem: mm/pagemap Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: remove __ARCH_HAS_4LEVEL_HACK", v13: alpha: use pgtable-nopud instead of 4level-fixup arm: nommu: use pgtable-nopud instead of 4level-fixup c6x: use pgtable-nopud instead of 4level-fixup m68k: nommu: use pgtable-nopud instead of 4level-fixup m68k: mm: use pgtable-nopXd instead of 4level-fixup microblaze: use pgtable-nopmd instead of 4level-fixup nds32: use pgtable-nopmd instead of 4level-fixup parisc: use pgtable-nopXd instead of 4level-fixup Helge Deller <deller@gmx.de>: parisc/hugetlb: use pgtable-nopXd instead of 4level-fixup Mike Rapoport <rppt@linux.ibm.com>: sparc32: use pgtable-nopud instead of 4level-fixup um: remove unused pxx_offset_proc() and addr_pte() functions um: add support for folded p4d page tables mm: remove __ARCH_HAS_4LEVEL_HACK and include/asm-generic/4level-fixup.h .gitattributes | 2 Documentation/core-api/genalloc.rst | 2 Documentation/dev-tools/kcov.rst | 129 arch/Kconfig | 22 arch/alpha/include/asm/mmzone.h | 1 arch/alpha/include/asm/pgalloc.h | 4 arch/alpha/include/asm/pgtable.h | 24 arch/alpha/mm/init.c | 12 arch/arm/include/asm/pgtable.h | 2 arch/arm/mm/dma-mapping.c | 2 arch/c6x/include/asm/pgtable.h | 2 arch/m68k/include/asm/mcf_pgalloc.h | 7 arch/m68k/include/asm/mcf_pgtable.h | 28 arch/m68k/include/asm/mmu_context.h | 12 arch/m68k/include/asm/motorola_pgalloc.h | 4 arch/m68k/include/asm/motorola_pgtable.h | 32 arch/m68k/include/asm/page.h | 9 arch/m68k/include/asm/pgtable_mm.h | 11 arch/m68k/include/asm/pgtable_no.h | 2 arch/m68k/include/asm/sun3_pgalloc.h | 5 arch/m68k/include/asm/sun3_pgtable.h | 18 arch/m68k/kernel/sys_m68k.c | 10 arch/m68k/mm/init.c | 6 arch/m68k/mm/kmap.c | 39 arch/m68k/mm/mcfmmu.c | 16 arch/m68k/mm/motorola.c | 17 arch/m68k/sun3x/dvma.c | 7 arch/microblaze/include/asm/page.h | 3 arch/microblaze/include/asm/pgalloc.h | 16 arch/microblaze/include/asm/pgtable.h | 32 arch/microblaze/kernel/signal.c | 10 arch/microblaze/mm/init.c | 7 arch/microblaze/mm/pgtable.c | 13 arch/mips/include/uapi/asm/msgbuf.h | 1 arch/mips/include/uapi/asm/sembuf.h | 2 arch/nds32/include/asm/page.h | 3 arch/nds32/include/asm/pgalloc.h | 3 arch/nds32/include/asm/pgtable.h | 12 arch/nds32/include/asm/tlb.h | 1 arch/nds32/kernel/pm.c | 4 arch/nds32/mm/fault.c | 16 arch/nds32/mm/init.c | 11 arch/nds32/mm/mm-nds32.c | 6 arch/nds32/mm/proc.c | 26 arch/parisc/include/asm/page.h | 30 arch/parisc/include/asm/pgalloc.h | 41 arch/parisc/include/asm/pgtable.h | 52 arch/parisc/include/asm/tlb.h | 2 arch/parisc/include/uapi/asm/msgbuf.h | 1 arch/parisc/include/uapi/asm/sembuf.h | 1 arch/parisc/kernel/cache.c | 13 arch/parisc/kernel/pci-dma.c | 9 arch/parisc/mm/fixmap.c | 10 arch/parisc/mm/hugetlbpage.c | 18 arch/powerpc/include/uapi/asm/msgbuf.h | 2 arch/powerpc/include/uapi/asm/sembuf.h | 2 arch/s390/include/uapi/asm/ipcbuf.h | 2 arch/sparc/include/asm/pgalloc_32.h | 6 arch/sparc/include/asm/pgtable_32.h | 28 arch/sparc/include/uapi/asm/ipcbuf.h | 2 arch/sparc/include/uapi/asm/msgbuf.h | 2 arch/sparc/include/uapi/asm/sembuf.h | 2 arch/sparc/mm/fault_32.c | 11 arch/sparc/mm/highmem.c | 6 arch/sparc/mm/io-unit.c | 6 arch/sparc/mm/iommu.c | 6 arch/sparc/mm/srmmu.c | 51 arch/um/include/asm/pgtable-2level.h | 1 arch/um/include/asm/pgtable-3level.h | 1 arch/um/include/asm/pgtable.h | 3 arch/um/kernel/mem.c | 8 arch/um/kernel/skas/mmu.c | 12 arch/um/kernel/skas/uaccess.c | 7 arch/um/kernel/tlb.c | 85 arch/um/kernel/trap.c | 4 arch/x86/include/uapi/asm/msgbuf.h | 3 arch/x86/include/uapi/asm/sembuf.h | 2 arch/xtensa/include/uapi/asm/ipcbuf.h | 2 arch/xtensa/include/uapi/asm/msgbuf.h | 2 arch/xtensa/include/uapi/asm/sembuf.h | 1 drivers/auxdisplay/charlcd.c | 34 drivers/base/node.c | 9 drivers/gpio/gpio-104-dio-48e.c | 75 drivers/gpio/gpio-104-idi-48.c | 36 drivers/gpio/gpio-74x164.c | 19 drivers/gpio/gpio-gpio-mm.c | 75 drivers/gpio/gpio-max3191x.c | 19 drivers/gpio/gpio-pca953x.c | 209 drivers/gpio/gpio-pci-idio-16.c | 75 drivers/gpio/gpio-pcie-idio-24.c | 111 drivers/gpio/gpio-pisosr.c | 12 drivers/gpio/gpio-uniphier.c | 13 drivers/gpio/gpio-ws16c48.c | 73 drivers/gpu/drm/drm_property.c | 2 drivers/misc/sram-exec.c | 2 drivers/rapidio/rio-access.c | 2 drivers/rapidio/rio-driver.c | 1 drivers/thermal/intel/intel_soc_dts_iosf.c | 31 drivers/thermal/intel/intel_soc_dts_iosf.h | 2 drivers/usb/core/hub.c | 5 drivers/vhost/vhost.c | 6 drivers/vhost/vhost.h | 1 fs/binfmt_elf.c | 56 fs/eventpoll.c | 52 fs/proc/Kconfig | 8 fs/proc/generic.c | 37 fs/proc/internal.h | 2 include/asm-generic/4level-fixup.h | 39 include/asm-generic/bitops/find.h | 17 include/linux/bitmap.h | 51 include/linux/bitops.h | 12 include/linux/build_bug.h | 4 include/linux/genalloc.h | 2 include/linux/kcov.h | 23 include/linux/kernel.h | 19 include/linux/mm.h | 10 include/linux/notifier.h | 4 include/linux/proc_fs.h | 4 include/linux/rbtree_augmented.h | 6 include/linux/sched.h | 8 include/linux/sysctl.h | 6 include/linux/thread_info.h | 2 include/linux/vmstat.h | 54 include/uapi/asm-generic/ipcbuf.h | 2 include/uapi/asm-generic/msgbuf.h | 2 include/uapi/asm-generic/sembuf.h | 1 include/uapi/linux/kcov.h | 28 include/uapi/linux/scc.h | 1 init/Kconfig | 78 kernel/dma/remap.c | 2 kernel/kcov.c | 547 + kernel/notifier.c | 45 kernel/profile.c | 6 kernel/sys.c | 4 lib/bitmap.c | 12 lib/find_bit.c | 14 lib/genalloc.c | 7 lib/math/rational.c | 63 lib/test_bitmap.c | 206 lib/test_meminit.c | 20 lib/ubsan.c | 64 mm/kasan/common.c | 1 mm/memcontrol.c | 52 mm/memory.c | 10 mm/slab_common.c | 12 mm/vmstat.c | 60 net/sunrpc/rpc_pipe.c | 2 scripts/checkpatch.pl | 13 scripts/get_maintainer.pl | 38 tools/testing/selftests/Makefile | 1 tools/testing/selftests/filesystems/epoll/.gitignore | 1 tools/testing/selftests/filesystems/epoll/Makefile | 7 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 3074 ++++++++++ usr/include/Makefile | 4 154 files changed, 5270 insertions(+), 1360 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2019-12-01 1:47 Andrew Morton 2019-12-01 5:17 ` incoming James Bottomley 2019-12-01 21:07 ` incoming Linus Torvalds 0 siblings, 2 replies; 322+ messages in thread From: Andrew Morton @ 2019-12-01 1:47 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - a small number of updates to scripts/, ocfs2 and fs/buffer.c - most of MM. I still have quite a lot of material (mostly not MM) staged after linux-next due to -next dependencies. I'll send thos across next week as the preprequisites get merged up. 158 patches, based on 32ef9553635ab1236c33951a8bd9b5af1c3b1646. Subsystems affected by this patch series: scripts ocfs2 vfs mm/slab mm/slub mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/memfd mm/memory-failure mm/memory-hotplug mm/sparsemem mm/vmalloc mm/kasan mm/pagealloc mm/vmscan mm/proc mm/z3fold mm/mempolicy mm/memblock mm/hugetlbfs mm/hugetlb mm/migration mm/thp mm/cma mm/autonuma mm/page-poison mm/mmap mm/madvise mm/userfaultfd mm/shmem mm/cleanups mm/support Subsystem: scripts Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ocfs2 Ding Xiang <dingxiang@cmss.chinamobile.com>: ocfs2: fix passing zero to 'PTR_ERR' warning Subsystem: vfs Saurav Girepunje <saurav.girepunje@gmail.com>: fs/buffer.c: fix use true/false for bool type Ben Dooks <ben.dooks@codethink.co.uk>: fs/buffer.c: include internal.h for missing declarations Subsystem: mm/slab Pengfei Li <lpf.vector@gmail.com>: Patch series "mm, slab: Make kmalloc_info[] contain all types of names", v6: mm, slab: make kmalloc_info[] contain all types of names mm, slab: remove unused kmalloc_size() mm, slab_common: use enum kmalloc_cache_type to iterate over kmalloc caches Subsystem: mm/slub Miles Chen <miles.chen@mediatek.com>: mm: slub: print the offset of fault addresses Yu Zhao <yuzhao@google.com>: mm/slub.c: update comments mm/slub.c: clean up validate_slab() Subsystem: mm/pagecache Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm/filemap.c: remove redundant cache invalidation after async direct-io write fs/direct-io.c: keep dio_warn_stale_pagecache() when CONFIG_BLOCK=n mm/filemap.c: warn if stale pagecache is left after direct write Subsystem: mm/gup zhong jiang <zhongjiang@huawei.com>: mm/gup.c: allow CMA migration to propagate errors back to caller Liu Xiang <liuxiang_1999@126.com>: mm/gup.c: fix comments of __get_user_pages() and get_user_pages_remote() Subsystem: mm/swap Naohiro Aota <naohiro.aota@wdc.com>: mm, swap: disallow swapon() on zoned block devices Fengguang Wu <fengguang.wu@intel.com>: mm/swap.c: trivial mark_page_accessed() cleanup Subsystem: mm/memcg Yafang Shao <laoar.shao@gmail.com>: mm, memcg: clean up reclaim iter array Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: remove dead code from memory_max_write() mm: memcontrol: try harder to set a new memory.high Hao Lee <haolee.swjtu@gmail.com>: include/linux/memcontrol.h: fix comments based on per-node memcg Shakeel Butt <shakeelb@google.com>: mm: vmscan: memcontrol: remove mem_cgroup_select_victim_node() Chris Down <chris@chrisdown.name>: Documentation/admin-guide/cgroup-v2.rst: document why inactive_X + active_X may not equal X Subsystem: mm/pagemap Johannes Weiner <hannes@cmpxchg.org>: mm: drop mmap_sem before calling balance_dirty_pages() in write fault "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: shmem: pin the file in shmem_fault() if mmap_sem is dropped "Joel Fernandes (Google)" <joel@joelfernandes.org>: mm: emit tracepoint when RSS changes rss_stat: add support to detect RSS updates of external mm Wei Yang <richardw.yang@linux.intel.com>: mm/mmap.c: remove a never-triggered warning in __vma_adjust() Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm/swap.c: piggyback lru_add_drain_all() calls Wei Yang <richardw.yang@linux.intel.com>: mm/mmap.c: prev could be retrieved from vma->vm_prev mm/mmap.c: __vma_unlink_prev() is not necessary now mm/mmap.c: extract __vma_unlink_list() as counterpart for __vma_link_list() mm/mmap.c: rb_parent is not necessary in __vma_link_list() mm/rmap.c: don't reuse anon_vma if we just want a copy mm/rmap.c: reuse mergeable anon_vma as parent when fork Gaowei Pu <pugaowei@gmail.com>: mm/mmap.c: use IS_ERR_VALUE to check return value of get_unmapped_area Vineet Gupta <Vineet.Gupta1@synopsys.com>: Patch series "elide extraneous generated code for folded p4d/pud/pmd", v3: ARC: mm: remove __ARCH_USE_5LEVEL_HACK asm-generic/tlb: stub out pud_free_tlb() if nopud ... asm-generic/tlb: stub out p4d_free_tlb() if nop4d ... asm-generic/tlb: stub out pmd_free_tlb() if nopmd asm-generic/mm: stub out p{4,u}d_clear_bad() if __PAGETABLE_P{4,U}D_FOLDED Miles Chen <miles.chen@mediatek.com>: mm/rmap.c: fix outdated comment in page_get_anon_vma() Yang Shi <yang.shi@linux.alibaba.com>: mm/rmap.c: use VM_BUG_ON_PAGE() in __page_check_anon_rmap() Thomas Hellstrom <thellstrom@vmware.com>: mm: move the backup x_devmap() functions to asm-generic/pgtable.h mm/memory.c: fix a huge pud insertion race during faulting Steven Price <steven.price@arm.com>: Patch series "Generic page walk and ptdump", v15: mm: add generic p?d_leaf() macros arc: mm: add p?d_leaf() definitions arm: mm: add p?d_leaf() definitions arm64: mm: add p?d_leaf() definitions mips: mm: add p?d_leaf() definitions powerpc: mm: add p?d_leaf() definitions riscv: mm: add p?d_leaf() definitions s390: mm: add p?d_leaf() definitions sparc: mm: add p?d_leaf() definitions x86: mm: add p?d_leaf() definitions mm: pagewalk: add p4d_entry() and pgd_entry() mm: pagewalk: allow walking without vma mm: pagewalk: add test_p?d callbacks mm: pagewalk: add 'depth' parameter to pte_hole x86: mm: point to struct seq_file from struct pg_state x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct x86: mm: convert ptdump_walk_pgd_level_core() to take an mm_struct mm: add generic ptdump x86: mm: convert dump_pagetables to use walk_page_range arm64: mm: convert mm/dump.c to use walk_page_range() arm64: mm: display non-present entries in ptdump mm: ptdump: reduce level numbers by 1 in note_page() Subsystem: mm/memfd Nicolas Geoffray <ngeoffray@google.com>: mm, memfd: fix COW issue on MAP_PRIVATE and F_SEAL_FUTURE_WRITE mappings "Joel Fernandes (Google)" <joel@joelfernandes.org>: memfd: add test for COW on MAP_PRIVATE and F_SEAL_FUTURE_WRITE mappings Subsystem: mm/memory-failure Jane Chu <jane.chu@oracle.com>: mm/memory-failure.c clean up around tk pre-allocation Naoya Horiguchi <nao.horiguchi@gmail.com>: mm, soft-offline: convert parameter to pfn Yunfeng Ye <yeyunfeng@huawei.com>: mm/memory-failure.c: use page_shift() in add_to_kill() Subsystem: mm/memory-hotplug Anshuman Khandual <anshuman.khandual@arm.com>: mm/hotplug: reorder memblock_[free|remove]() calls in try_remove_memory() Alastair D'Silva <alastair@d-silva.org>: mm/memory_hotplug.c: add a bounds check to __add_pages() David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: Export generic_online_page()": mm/memory_hotplug: export generic_online_page() hv_balloon: use generic_online_page() mm/memory_hotplug: remove __online_page_free() and __online_page_increment_counters() Patch series "mm: Memory offlining + page isolation cleanups", v2: mm/page_alloc.c: don't set pages PageReserved() when offlining mm/page_isolation.c: convert SKIP_HWPOISON to MEMORY_OFFLINE "Ben Dooks (Codethink)" <ben.dooks@codethink.co.uk>: include/linux/memory_hotplug.h: move definitions of {set,clear}_zone_contiguous David Hildenbrand <david@redhat.com>: drivers/base/memory.c: drop the mem_sysfs_mutex mm/memory_hotplug.c: don't allow to online/offline memory blocks with holes Subsystem: mm/sparsemem Vincent Whitchurch <vincent.whitchurch@axis.com>: mm/sparse: consistently do not zero memmap Ilya Leoshkevich <iii@linux.ibm.com>: mm/sparse.c: mark populate_section_memmap as __meminit Michal Hocko <mhocko@suse.com>: mm/sparse.c: do not waste pre allocated memmap space Subsystem: mm/vmalloc Liu Xiang <liuxiang_1999@126.com>: mm/vmalloc.c: remove unnecessary highmem_mask from parameter of gfpflags_allow_blocking() "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: remove preempt_disable/enable when doing preloading mm/vmalloc: respect passed gfp_mask when doing preloading mm/vmalloc: add more comments to the adjust_va_to_fit_type() Anders Roxell <anders.roxell@linaro.org>: selftests: vm: add fragment CONFIG_TEST_VMALLOC "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: rework vmap_area_lock Subsystem: mm/kasan Daniel Axtens <dja@axtens.net>: Patch series "kasan: support backing vmalloc space with real shadow: kasan: support backing vmalloc space with real shadow memory kasan: add test for vmalloc fork: support VMAP_STACK with KASAN_VMALLOC x86/kasan: support KASAN_VMALLOC Subsystem: mm/pagealloc Anshuman Khandual <anshuman.khandual@arm.com>: mm/page_alloc: add alloc_contig_pages() Mel Gorman <mgorman@techsingularity.net>: mm, pcp: share common code between memory hotplug and percpu sysctl handler mm, pcpu: make zone pcp updates and reset internal to the mm Hao Lee <haolee.swjtu@gmail.com>: include/linux/mmzone.h: fix comment for ISOLATE_UNMAPPED macro lijiazi <jqqlijiazi@gmail.com>: mm/page_alloc.c: print reserved_highatomic info Subsystem: mm/vmscan Andrey Ryabinin <aryabinin@virtuozzo.com>: mm/vmscan: remove unused lru_pages argument Yang Shi <yang.shi@linux.alibaba.com>: mm/vmscan.c: remove unused scan_control parameter from pageout() Johannes Weiner <hannes@cmpxchg.org>: Patch series "mm: vmscan: cgroup-related cleanups": mm: vmscan: simplify lruvec_lru_size() mm: clean up and clarify lruvec lookup procedure mm: vmscan: move inactive_list_is_low() swap check to the caller mm: vmscan: naming fixes: global_reclaim() and sane_reclaim() mm: vmscan: replace shrink_node() loop with a retry jump mm: vmscan: turn shrink_node_memcg() into shrink_lruvec() mm: vmscan: split shrink_node() into node part and memcgs part mm: vmscan: harmonize writeback congestion tracking for nodes & memcgs Patch series "mm: fix page aging across multiple cgroups": mm: vmscan: move file exhaustion detection to the node level mm: vmscan: detect file thrashing at the reclaim root mm: vmscan: enforce inactive:active ratio at the reclaim root Xianting Tian <xianting_tian@126.com>: mm/vmscan.c: fix typo in comment Subsystem: mm/proc Johannes Weiner <hannes@cmpxchg.org>: kernel: sysctl: make drop_caches write-only Subsystem: mm/z3fold Vitaly Wool <vitaly.wool@konsulko.com>: mm/z3fold.c: add inter-page compaction Subsystem: mm/mempolicy Li Xinhai <lixinhai.lxh@gmail.com>: Patch series "mm: Fix checking unmapped holes for mbind", v4: mm/mempolicy.c: check range first in queue_pages_test_walk mm/mempolicy.c: fix checking unmapped holes for mbind Subsystem: mm/memblock Cao jin <caoj.fnst@cn.fujitsu.com>: mm/memblock.c: cleanup doc mm/memblock: correct doc for function Yunfeng Ye <yeyunfeng@huawei.com>: mm: support memblock alloc on the exact node for sparse_buffer_init() Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: hugetlbfs: hugetlb_fault_mutex_hash() cleanup mm/hugetlbfs: fix error handling when setting up mounts Patch series "hugetlbfs: convert macros to static inline, fix sparse warning": powerpc/mm: remove pmd_huge/pud_huge stubs and include hugetlb.h hugetlbfs: convert macros to static inline, fix sparse warning Piotr Sarna <p.sarna@tlen.pl>: hugetlbfs: add O_TMPFILE support Waiman Long <longman@redhat.com>: hugetlbfs: take read_lock on i_mmap for PMD sharing Subsystem: mm/hugetlb Mina Almasry <almasrymina@google.com>: hugetlb: region_chg provides only cache entry hugetlb: remove duplicated code Wei Yang <richardw.yang@linux.intel.com>: hugetlb: remove unused hstate in hugetlb_fault_mutex_hash() Zhigang Lu <tonnylu@tencent.com>: mm/hugetlb: avoid looping to the same hugepage if !pages and !vmas zhong jiang <zhongjiang@huawei.com>: mm/huge_memory.c: split_huge_pages_fops should be defined with DEFINE_DEBUGFS_ATTRIBUTE Subsystem: mm/migration Yang Shi <yang.shi@linux.alibaba.com>: mm/migrate.c: handle freed page at the first place Subsystem: mm/thp "Kirill A. Shutemov" <kirill@shutemov.name>: mm, thp: do not queue fully unmapped pages for deferred split Song Liu <songliubraving@fb.com>: mm/thp: flush file for !is_shmem PageDirty() case in collapse_file() Subsystem: mm/cma Yunfeng Ye <yeyunfeng@huawei.com>: mm/cma.c: switch to bitmap_zalloc() for cma bitmap allocation zhong jiang <zhongjiang@huawei.com>: mm/cma_debug.c: use DEFINE_DEBUGFS_ATTRIBUTE to define debugfs fops Subsystem: mm/autonuma Huang Ying <ying.huang@intel.com>: autonuma: fix watermark checking in migrate_balanced_pgdat() autonuma: reduce cache footprint when scanning page tables Subsystem: mm/page-poison zhong jiang <zhongjiang@huawei.com>: mm/hwpoison-inject: use DEFINE_DEBUGFS_ATTRIBUTE to define debugfs fops Subsystem: mm/mmap Wei Yang <richardw.yang@linux.intel.com>: mm/mmap.c: make vma_merge() comment more easy to understand Subsystem: mm/madvise Yunfeng Ye <yeyunfeng@huawei.com>: mm/madvise.c: replace with page_size() in madvise_inject_error() Wei Yang <richardw.yang@linux.intel.com>: mm/madvise.c: use PAGE_ALIGN[ED] for range checking Subsystem: mm/userfaultfd Wei Yang <richardw.yang@linux.intel.com>: userfaultfd: use vma_pagesize for all huge page size calculation userfaultfd: remove unnecessary WARN_ON() in __mcopy_atomic_hugetlb() userfaultfd: wrap the common dst_vma check into an inlined function Andrea Arcangeli <aarcange@redhat.com>: fs/userfaultfd.c: wp: clear VM_UFFD_MISSING or VM_UFFD_WP during userfaultfd_register() Mike Rapoport <rppt@linux.ibm.com>: userfaultfd: require CAP_SYS_PTRACE for UFFD_FEATURE_EVENT_FORK Subsystem: mm/shmem Colin Ian King <colin.king@canonical.com>: mm/shmem.c: make array 'values' static const, makes object smaller Yang Shi <yang.shi@linux.alibaba.com>: mm: shmem: use proper gfp flags for shmem_writepage() Chen Jun <chenjun102@huawei.com>: mm/shmem.c: cast the type of unmap_start to u64 Subsystem: mm/cleanups Hao Lee <haolee.swjtu@gmail.com>: mm: fix struct member name in function comments Wei Yang <richardw.yang@linux.intel.com>: mm: fix typos in comments when calling __SetPageUptodate() Souptick Joarder <jrdr.linux@gmail.com>: mm/memory_hotplug.c: remove __online_page_set_limits() Krzysztof Kozlowski <krzk@kernel.org>: mm/Kconfig: fix indentation Randy Dunlap <rdunlap@infradead.org>: mm/Kconfig: fix trivial help text punctuation Subsystem: mm/support Minchan Kim <minchan@google.com>: mm/page_io.c: annotate refault stalls from swap_readpage Documentation/admin-guide/cgroup-v2.rst | 7 Documentation/dev-tools/kasan.rst | 63 + arch/Kconfig | 9 arch/arc/include/asm/pgtable.h | 2 arch/arc/mm/fault.c | 10 arch/arc/mm/highmem.c | 4 arch/arm/include/asm/pgtable-2level.h | 1 arch/arm/include/asm/pgtable-3level.h | 1 arch/arm64/Kconfig | 1 arch/arm64/Kconfig.debug | 19 arch/arm64/include/asm/pgtable.h | 2 arch/arm64/include/asm/ptdump.h | 8 arch/arm64/mm/Makefile | 4 arch/arm64/mm/dump.c | 148 +--- arch/arm64/mm/mmu.c | 4 arch/arm64/mm/ptdump_debugfs.c | 2 arch/mips/include/asm/pgtable.h | 5 arch/powerpc/include/asm/book3s/64/pgtable-4k.h | 3 arch/powerpc/include/asm/book3s/64/pgtable-64k.h | 3 arch/powerpc/include/asm/book3s/64/pgtable.h | 30 arch/powerpc/mm/book3s64/radix_pgtable.c | 1 arch/riscv/include/asm/pgtable-64.h | 7 arch/riscv/include/asm/pgtable.h | 7 arch/s390/include/asm/pgtable.h | 2 arch/sparc/include/asm/pgtable_64.h | 2 arch/x86/Kconfig | 2 arch/x86/Kconfig.debug | 20 arch/x86/include/asm/pgtable.h | 10 arch/x86/mm/Makefile | 4 arch/x86/mm/debug_pagetables.c | 8 arch/x86/mm/dump_pagetables.c | 431 +++--------- arch/x86/mm/kasan_init_64.c | 61 + arch/x86/platform/efi/efi_32.c | 2 arch/x86/platform/efi/efi_64.c | 4 drivers/base/memory.c | 40 - drivers/firmware/efi/arm-runtime.c | 2 drivers/hv/hv_balloon.c | 4 drivers/xen/balloon.c | 1 fs/buffer.c | 6 fs/direct-io.c | 21 fs/hugetlbfs/inode.c | 67 + fs/ocfs2/acl.c | 4 fs/proc/task_mmu.c | 4 fs/userfaultfd.c | 21 include/asm-generic/4level-fixup.h | 1 include/asm-generic/5level-fixup.h | 1 include/asm-generic/pgtable-nop4d.h | 2 include/asm-generic/pgtable-nopmd.h | 2 include/asm-generic/pgtable-nopud.h | 2 include/asm-generic/pgtable.h | 71 ++ include/asm-generic/tlb.h | 4 include/linux/fs.h | 6 include/linux/gfp.h | 2 include/linux/hugetlb.h | 142 +++- include/linux/kasan.h | 31 include/linux/memblock.h | 3 include/linux/memcontrol.h | 51 - include/linux/memory_hotplug.h | 11 include/linux/mm.h | 42 - include/linux/mmzone.h | 34 include/linux/moduleloader.h | 2 include/linux/page-isolation.h | 4 include/linux/pagewalk.h | 42 - include/linux/ptdump.h | 22 include/linux/slab.h | 20 include/linux/string.h | 2 include/linux/swap.h | 2 include/linux/vmalloc.h | 12 include/trace/events/kmem.h | 53 + kernel/events/uprobes.c | 2 kernel/fork.c | 4 kernel/sysctl.c | 2 lib/Kconfig.kasan | 16 lib/test_kasan.c | 26 lib/vsprintf.c | 40 - mm/Kconfig | 40 - mm/Kconfig.debug | 21 mm/Makefile | 1 mm/cma.c | 6 mm/cma_debug.c | 10 mm/filemap.c | 56 - mm/gup.c | 40 - mm/hmm.c | 8 mm/huge_memory.c | 2 mm/hugetlb.c | 298 ++------ mm/hwpoison-inject.c | 4 mm/internal.h | 27 mm/kasan/common.c | 233 ++++++ mm/kasan/generic_report.c | 3 mm/kasan/kasan.h | 1 mm/khugepaged.c | 18 mm/madvise.c | 14 mm/memblock.c | 113 ++- mm/memcontrol.c | 167 ---- mm/memory-failure.c | 61 - mm/memory.c | 56 + mm/memory_hotplug.c | 86 +- mm/mempolicy.c | 59 + mm/migrate.c | 21 mm/mincore.c | 1 mm/mmap.c | 75 -- mm/mprotect.c | 8 mm/mremap.c | 4 mm/nommu.c | 10 mm/page_alloc.c | 137 +++ mm/page_io.c | 15 mm/page_isolation.c | 12 mm/pagewalk.c | 126 ++- mm/pgtable-generic.c | 9 mm/ptdump.c | 167 ++++ mm/rmap.c | 65 + mm/shmem.c | 29 mm/slab.c | 7 mm/slab.h | 6 mm/slab_common.c | 101 +- mm/slub.c | 36 - mm/sparse.c | 22 mm/swap.c | 29 mm/swapfile.c | 7 mm/userfaultfd.c | 77 +- mm/util.c | 22 mm/vmalloc.c | 196 +++-- mm/vmscan.c | 798 +++++++++++------------ mm/workingset.c | 75 +- mm/z3fold.c | 375 ++++++++-- scripts/spelling.txt | 28 tools/testing/selftests/memfd/memfd_test.c | 36 + tools/testing/selftests/vm/config | 1 128 files changed, 3409 insertions(+), 2121 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2019-12-01 1:47 incoming Andrew Morton @ 2019-12-01 5:17 ` James Bottomley 2019-12-01 21:07 ` incoming Linus Torvalds 1 sibling, 0 replies; 322+ messages in thread From: James Bottomley @ 2019-12-01 5:17 UTC (permalink / raw) To: Andrew Morton, Linus Torvalds; +Cc: mm-commits, linux-mm On Sat, 2019-11-30 at 17:47 -0800, Andrew Morton wrote: > - a small number of updates to scripts/, ocfs2 and fs/buffer.c > > - most of MM. I still have quite a lot of material (mostly not MM) > staged after linux-next due to -next dependencies. I'll send thos > across next week as the preprequisites get merged up. > > 158 patches, based on 32ef9553635ab1236c33951a8bd9b5af1c3b1646. Hey, Andrew, would it be at all possible for you to thread these patches under something like this incoming message? The selfish reason I'm asking is so I can mark the thread as read instead of having to do it individually for 158 messages ... my thumb would thank you for this. Regards, James ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2019-12-01 1:47 incoming Andrew Morton 2019-12-01 5:17 ` incoming James Bottomley @ 2019-12-01 21:07 ` Linus Torvalds 2019-12-02 8:21 ` incoming Steven Price 1 sibling, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2019-12-01 21:07 UTC (permalink / raw) To: Andrew Morton, Steven Price; +Cc: mm-commits, Linux-MM On Sat, Nov 30, 2019 at 5:47 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > Steven Price <steven.price@arm.com>: > Patch series "Generic page walk and ptdump", v15: > mm: add generic p?d_leaf() macros > arc: mm: add p?d_leaf() definitions > arm: mm: add p?d_leaf() definitions > arm64: mm: add p?d_leaf() definitions > mips: mm: add p?d_leaf() definitions > powerpc: mm: add p?d_leaf() definitions > riscv: mm: add p?d_leaf() definitions > s390: mm: add p?d_leaf() definitions > sparc: mm: add p?d_leaf() definitions > x86: mm: add p?d_leaf() definitions > mm: pagewalk: add p4d_entry() and pgd_entry() > mm: pagewalk: allow walking without vma > mm: pagewalk: add test_p?d callbacks > mm: pagewalk: add 'depth' parameter to pte_hole > x86: mm: point to struct seq_file from struct pg_state > x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct > x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct > x86: mm: convert ptdump_walk_pgd_level_core() to take an mm_struct > mm: add generic ptdump > x86: mm: convert dump_pagetables to use walk_page_range > arm64: mm: convert mm/dump.c to use walk_page_range() > arm64: mm: display non-present entries in ptdump > mm: ptdump: reduce level numbers by 1 in note_page() I've dropped these, and since they clearly weren't ready I don't want to see them re-sent for 5.5. If somebody figures out the bug, trying again for 5.6 sounds fine. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2019-12-01 21:07 ` incoming Linus Torvalds @ 2019-12-02 8:21 ` Steven Price 0 siblings, 0 replies; 322+ messages in thread From: Steven Price @ 2019-12-02 8:21 UTC (permalink / raw) To: Linus Torvalds; +Cc: Andrew Morton, mm-commits@vger.kernel.org, Linux-MM On Sun, Dec 01, 2019 at 09:07:47PM +0000, Linus Torvalds wrote: > On Sat, Nov 30, 2019 at 5:47 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > Steven Price <steven.price@arm.com>: > > Patch series "Generic page walk and ptdump", v15: > > mm: add generic p?d_leaf() macros > > arc: mm: add p?d_leaf() definitions > > arm: mm: add p?d_leaf() definitions > > arm64: mm: add p?d_leaf() definitions > > mips: mm: add p?d_leaf() definitions > > powerpc: mm: add p?d_leaf() definitions > > riscv: mm: add p?d_leaf() definitions > > s390: mm: add p?d_leaf() definitions > > sparc: mm: add p?d_leaf() definitions > > x86: mm: add p?d_leaf() definitions > > mm: pagewalk: add p4d_entry() and pgd_entry() > > mm: pagewalk: allow walking without vma > > mm: pagewalk: add test_p?d callbacks > > mm: pagewalk: add 'depth' parameter to pte_hole > > x86: mm: point to struct seq_file from struct pg_state > > x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct > > x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct > > x86: mm: convert ptdump_walk_pgd_level_core() to take an mm_struct > > mm: add generic ptdump > > x86: mm: convert dump_pagetables to use walk_page_range > > arm64: mm: convert mm/dump.c to use walk_page_range() > > arm64: mm: display non-present entries in ptdump > > mm: ptdump: reduce level numbers by 1 in note_page() > > I've dropped these, and since they clearly weren't ready I don't want > to see them re-sent for 5.5. Sorry about this, I'll try to track down the cause of this and hopefully resubmit for 5.6. Thanks, Steve > If somebody figures out the bug, trying again for 5.6 sounds fine. > > Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2019-11-22 1:53 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2019-11-22 1:53 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 4 fixes, based on 81429eb8d9ca40b0c65bb739d29fa856c5d5e958: Vincent Whitchurch <vincent.whitchurch@axis.com>: mm/sparse: consistently do not zero memmap Joseph Qi <joseph.qi@linux.alibaba.com>: Revert "fs: ocfs2: fix possible null-pointer dereferences in ocfs2_xa_prepare_entry()" David Hildenbrand <david@redhat.com>: mm/memory_hotplug: don't access uninitialized memmaps in shrink_zone_span() Andrey Ryabinin <aryabinin@virtuozzo.com>: mm/ksm.c: don't WARN if page is still mapped in remove_stable_node() fs/ocfs2/xattr.c | 56 ++++++++++++++++++++++++++++++---------------------- mm/ksm.c | 14 ++++++------- mm/memory_hotplug.c | 16 ++++++++++++-- mm/sparse.c | 2 - 4 files changed, 54 insertions(+), 34 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2019-11-16 1:34 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2019-11-16 1:34 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 11 fixes, based on 875fef493f21e54d20d71a581687990aaa50268c: Yang Shi <yang.shi@linux.alibaba.com>: mm: mempolicy: fix the wrong return value and potential pages leak of mbind zhong jiang <zhongjiang@huawei.com>: mm: fix trying to reclaim unevictable lru page when calling madvise_pageout Lasse Collin <lasse.collin@tukaani.org>: lib/xz: fix XZ_DYNALLOC to avoid useless memory reallocations Roman Gushchin <guro@fb.com>: mm: memcg: switch to css_tryget() in get_mem_cgroup_from_mm() mm: hugetlb: switch to css_tryget() in hugetlb_cgroup_charge_cgroup() Laura Abbott <labbott@redhat.com>: mm: slub: really fix slab walking for init_on_free Song Liu <songliubraving@fb.com>: mm,thp: recheck each page before collapsing file THP David Hildenbrand <david@redhat.com>: mm/memory_hotplug: fix try_offline_node() Vinayak Menon <vinmenon@codeaurora.org>: mm/page_io.c: do not free shared swap slots Ralph Campbell <rcampbell@nvidia.com>: mm/debug.c: __dump_page() prints an extra line mm/debug.c: PageAnon() is true for PageKsm() pages drivers/base/memory.c | 36 ++++++++++++++++++++++++++++++++++++ include/linux/memory.h | 1 + lib/xz/xz_dec_lzma2.c | 1 + mm/debug.c | 33 ++++++++++++++++++--------------- mm/hugetlb_cgroup.c | 2 +- mm/khugepaged.c | 28 ++++++++++++++++------------ mm/madvise.c | 16 ++++++++++++---- mm/memcontrol.c | 2 +- mm/memory_hotplug.c | 47 +++++++++++++++++++++++++++++------------------ mm/mempolicy.c | 14 +++++++++----- mm/page_io.c | 6 +++--- mm/slub.c | 39 +++++++++------------------------------ 12 files changed, 136 insertions(+), 89 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2019-11-06 5:16 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2019-11-06 5:16 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 17 fixes, based on 26bc672134241a080a83b2ab9aa8abede8d30e1c: Shakeel Butt <shakeelb@google.com>: mm: memcontrol: fix NULL-ptr deref in percpu stats flush John Hubbard <jhubbard@nvidia.com>: mm/gup_benchmark: fix MAP_HUGETLB case Mel Gorman <mgorman@techsingularity.net>: mm, meminit: recalculate pcpu batch and high limits after init completes Yang Shi <yang.shi@linux.alibaba.com>: mm: thp: handle page cache THP correctly in PageTransCompoundMap Shuning Zhang <sunny.s.zhang@oracle.com>: ocfs2: protect extent tree in ocfs2_prepare_inode_for_write() Jason Gunthorpe <jgg@mellanox.com>: mm/mmu_notifiers: use the right return code for WARN_ON Michal Hocko <mhocko@suse.com>: mm, vmstat: hide /proc/pagetypeinfo from normal users mm, vmstat: reduce zone->lock holding time by /proc/pagetypeinfo Ville Syrjälä <ville.syrjala@linux.intel.com>: mm/khugepaged: fix might_sleep() warn with CONFIG_HIGHPTE=y Johannes Weiner <hannes@cmpxchg.org>: mm/page_alloc.c: ratelimit allocation failure warnings more aggressively Vitaly Wool <vitaly.wool@konsulko.com>: zswap: add Vitaly to the maintainers list Kevin Hao <haokexin@gmail.com>: dump_stack: avoid the livelock of the dump_lock Song Liu <songliubraving@fb.com>: MAINTAINERS: update information for "MEMORY MANAGEMENT" Roman Gushchin <guro@fb.com>: mm: slab: make page_cgroup_ino() to recognize non-compound slab pages properly Ilya Leoshkevich <iii@linux.ibm.com>: scripts/gdb: fix debugging modules compiled with hot/cold partitioning David Hildenbrand <david@redhat.com>: mm/memory_hotplug: fix updating the node span Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: fix network errors from failing __GFP_ATOMIC charges MAINTAINERS | 5 + fs/ocfs2/file.c | 125 ++++++++++++++++++++++------- include/linux/mm.h | 5 - include/linux/mm_types.h | 5 + include/linux/page-flags.h | 20 ++++ lib/dump_stack.c | 7 + mm/khugepaged.c | 7 - mm/memcontrol.c | 23 +++-- mm/memory_hotplug.c | 8 + mm/mmu_notifier.c | 2 mm/page_alloc.c | 17 ++- mm/slab.h | 4 mm/vmstat.c | 25 ++++- scripts/gdb/linux/symbols.py | 3 tools/testing/selftests/vm/gup_benchmark.c | 2 15 files changed, 197 insertions(+), 61 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2019-10-19 3:19 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2019-10-19 3:19 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm Rather a lot of fixes, almost all affecting mm/. 26 patches, based on b9959c7a347d6adbb558fba7e36e9fef3cba3b07: David Hildenbrand <david@redhat.com>: drivers/base/memory.c: don't access uninitialized memmaps in soft_offline_page_store() fs/proc/page.c: don't access uninitialized memmaps in fs/proc/page.c mm/memory-failure.c: don't access uninitialized memmaps in memory_failure() Joel Colledge <joel.colledge@linbit.com>: scripts/gdb: fix lx-dmesg when CONFIG_PRINTK_CALLER is set Qian Cai <cai@lca.pw>: mm/page_owner: don't access uninitialized memmaps when reading /proc/pagetypeinfo David Hildenbrand <david@redhat.com>: mm/memory_hotplug: don't access uninitialized memmaps in shrink_pgdat_span() "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "mm/memory_hotplug: Shrink zones before removing memory", v6: mm/memunmap: don't access uninitialized memmap in memunmap_pages() Roman Gushchin <guro@fb.com>: mm: memcg/slab: fix panic in __free_slab() caused by premature memcg pointer release Chengguang Xu <cgxu519@mykernel.net>: ocfs2: fix error handling in ocfs2_setattr() John Hubbard <jhubbard@nvidia.com>: mm/gup_benchmark: add a missing "w" to getopt string mm/gup: fix a misnamed "write" argument, and a related bug Honglei Wang <honglei.wang@oracle.com>: mm: memcg: get number of pages on the LRU list in memcgroup base on lru_zone_size Mike Rapoport <rppt@linux.ibm.com>: mm: memblock: do not enforce current limit for memblock_phys* family David Hildenbrand <david@redhat.com>: hugetlbfs: don't access uninitialized memmaps in pfn_range_valid_gigantic() Yi Li <yilikernel@gmail.com>: ocfs2: fix panic due to ocfs2_wq is null Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm/memcontrol: update lruvec counters in mem_cgroup_move_account Chenwandun <chenwandun@huawei.com>: zram: fix race between backing_dev_show and backing_dev_store Ben Dooks <ben.dooks@codethink.co.uk>: mm: include <linux/huge_mm.h> for is_vma_temporary_stack mm/filemap.c: include <linux/ramfs.h> for generic_file_vm_ops definition "Ben Dooks (Codethink)" <ben.dooks@codethink.co.uk>: mm/init-mm.c: include <linux/mman.h> for vm_committed_as_batch "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: Patch series "Fixes for THP in page cache", v2: proc/meminfo: fix output alignment mm/thp: fix node page state in split_huge_page_to_list() William Kucharski <william.kucharski@oracle.com>: mm/vmscan.c: support removing arbitrary sized pages from mapping "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: mm/thp: allow dropping THP from page cache Song Liu <songliubraving@fb.com>: kernel/events/uprobes.c: only do FOLL_SPLIT_PMD for uprobe register Ilya Leoshkevich <iii@linux.ibm.com>: scripts/gdb: fix debugging modules on s390 drivers/base/memory.c | 3 + drivers/block/zram/zram_drv.c | 5 + fs/ocfs2/file.c | 2 fs/ocfs2/journal.c | 3 - fs/ocfs2/localalloc.c | 3 - fs/proc/meminfo.c | 4 - fs/proc/page.c | 28 ++++++---- kernel/events/uprobes.c | 13 ++++- mm/filemap.c | 1 mm/gup.c | 14 +++-- mm/huge_memory.c | 9 ++- mm/hugetlb.c | 5 - mm/init-mm.c | 1 mm/memblock.c | 6 +- mm/memcontrol.c | 18 ++++--- mm/memory-failure.c | 14 +++-- mm/memory_hotplug.c | 74 ++++++----------------------- mm/memremap.c | 11 ++-- mm/page_owner.c | 5 + mm/rmap.c | 1 mm/slab_common.c | 9 +-- mm/truncate.c | 12 ++++ mm/vmscan.c | 14 ++--- scripts/gdb/linux/dmesg.py | 16 ++++-- scripts/gdb/linux/symbols.py | 8 ++- scripts/gdb/linux/utils.py | 25 +++++---- tools/testing/selftests/vm/gup_benchmark.c | 2 27 files changed, 166 insertions(+), 140 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2019-10-14 21:11 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2019-10-14 21:11 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm The usual shower of hotfixes and some followups to the recently merged page_owner enhancements. 16 patches, based on 2abd839aa7e615f2bbc50c8ba7deb9e40d186768. Subsystems affected by this patch series: Vlastimil Babka <vbabka@suse.cz>: Patch series "followups to debug_pagealloc improvements through page_owner", v3: mm, page_owner: fix off-by-one error in __set_page_owner_handle() mm, page_owner: decouple freeing stack trace from debug_pagealloc mm, page_owner: rename flag indicating that page is allocated Qian Cai <cai@lca.pw>: mm/slub: fix a deadlock in show_slab_objects() Eric Biggers <ebiggers@google.com>: lib/generic-radix-tree.c: add kmemleak annotations Alexander Potapenko <glider@google.com>: mm/slub.c: init_on_free=1 should wipe freelist ptr for bulk allocations lib/test_meminit: add a kmem_cache_alloc_bulk() test David Rientjes <rientjes@google.com>: mm, hugetlb: allow hugepage allocations to reclaim as needed Vlastimil Babka <vbabka@suse.cz>: mm, compaction: fix wrong pfn handling in __reset_isolation_pfn() Randy Dunlap <rdunlap@infradead.org>: fs/direct-io.c: fix kernel-doc warning fs/libfs.c: fix kernel-doc warning fs/fs-writeback.c: fix kernel-doc warning bitmap.h: fix kernel-doc warning and typo xarray.h: fix kernel-doc warning mm/slab.c: fix kernel-doc warning for __ksize() Jane Chu <jane.chu@oracle.com>: mm/memory-failure: poison read receives SIGKILL instead of SIGBUS if mmaped more than once Documentation/dev-tools/kasan.rst | 3 ++ fs/direct-io.c | 3 -- fs/fs-writeback.c | 2 - fs/libfs.c | 3 -- include/linux/bitmap.h | 3 +- include/linux/page_ext.h | 10 ++++++ include/linux/xarray.h | 4 +- lib/generic-radix-tree.c | 32 +++++++++++++++++----- lib/test_meminit.c | 27 ++++++++++++++++++ mm/compaction.c | 7 ++-- mm/memory-failure.c | 22 ++++++++------- mm/page_alloc.c | 6 ++-- mm/page_ext.c | 23 ++++++--------- mm/page_owner.c | 55 +++++++++++++------------------------- mm/slab.c | 3 ++ mm/slub.c | 35 ++++++++++++++++++------ 16 files changed, 152 insertions(+), 86 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2019-10-07 0:57 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2019-10-07 0:57 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm The usual shower of hotfixes. Chris's memcg patches aren't actually fixes - they're mature but a few niggling review issues were late to arrive. The ocfs2 fixes are quite old - those took some time to get reviewer attention. 18 patches, based on 4ea655343ce4180fe9b2c7ec8cb8ef9884a47901. Subsystems affected by this patch series: ocfs2 hotfixes mm/memcg mm/slab-generic Subsystem: ocfs2 Jia Guo <guojia12@huawei.com>: ocfs2: clear zero in unaligned direct IO Jia-Ju Bai <baijiaju1990@gmail.com>: fs: ocfs2: fix possible null-pointer dereferences in ocfs2_xa_prepare_entry() fs: ocfs2: fix a possible null-pointer dereference in ocfs2_write_end_nolock() fs: ocfs2: fix a possible null-pointer dereference in ocfs2_info_scan_inode_alloc() Subsystem: hotfixes Will Deacon <will@kernel.org>: panic: ensure preemption is disabled during panic() Anshuman Khandual <anshuman.khandual@arm.com>: mm/memremap: drop unused SECTION_SIZE and SECTION_MASK Tejun Heo <tj@kernel.org>: writeback: fix use-after-free in finish_writeback_work() Yi Wang <wang.yi59@zte.com.cn>: mm: fix -Wmissing-prototypes warnings Baoquan He <bhe@redhat.com>: memcg: only record foreign writebacks with dirty pages when memcg is not disabled Michal Hocko <mhocko@suse.com>: kernel/sysctl.c: do not override max_threads provided by userspace Vitaly Wool <vitalywool@gmail.com>: mm/z3fold.c: claim page in the beginning of free Qian Cai <cai@lca.pw>: mm/page_alloc.c: fix a crash in free_pages_prepare() Dan Carpenter <dan.carpenter@oracle.com>: mm/vmpressure.c: fix a signedness bug in vmpressure_register_event() Subsystem: mm/memcg Chris Down <chris@chrisdown.name>: mm, memcg: proportional memory.{low,min} reclaim mm, memcg: make memory.emin the baseline for utilisation determination mm, memcg: make scan aggression always exclude protection Subsystem: mm/slab-generic Vlastimil Babka <vbabka@suse.cz>: Patch series "guarantee natural alignment for kmalloc()", v2: mm, sl[ou]b: improve memory accounting mm, sl[aou]b: guarantee natural alignment for kmalloc(power-of-two) Documentation/admin-guide/cgroup-v2.rst | 20 +- Documentation/core-api/memory-allocation.rst | 4 fs/fs-writeback.c | 9 - fs/ocfs2/aops.c | 25 +++ fs/ocfs2/ioctl.c | 2 fs/ocfs2/xattr.c | 56 +++---- include/linux/memcontrol.h | 67 ++++++--- include/linux/slab.h | 4 kernel/fork.c | 4 kernel/panic.c | 1 mm/memcontrol.c | 5 mm/memremap.c | 2 mm/page_alloc.c | 8 - mm/shuffle.c | 2 mm/slab_common.c | 19 ++ mm/slob.c | 62 ++++++-- mm/slub.c | 14 + mm/sparse.c | 2 mm/vmpressure.c | 20 +- mm/vmscan.c | 198 +++++++++++++++++---------- mm/z3fold.c | 10 + 21 files changed, 363 insertions(+), 171 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2019-09-25 23:45 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2019-09-25 23:45 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - almost all of the rest of -mm - various other subsystems 76 patches, based on 351c8a09b00b5c51c8f58b016fffe51f87e2d820: Subsystems affected by this patch series: memcg misc core-kernel lib checkpatch reiserfs fat fork cpumask kexec uaccess kconfig kgdb bug ipc lzo kasan madvise cleanups pagemap Subsystem: memcg Michal Hocko <mhocko@suse.com>: memcg, kmem: do not fail __GFP_NOFAIL charges Subsystem: misc Masahiro Yamada <yamada.masahiro@socionext.com>: linux/coff.h: add include guard Subsystem: core-kernel Valdis Kletnieks <valdis.kletnieks@vt.edu>: kernel/elfcore.c: include proper prototypes Subsystem: lib Michel Lespinasse <walken@google.com>: rbtree: avoid generating code twice for the cached versions (tools copy) Patch series "make RB_DECLARE_CALLBACKS more generic", v3: augmented rbtree: add comments for RB_DECLARE_CALLBACKS macro augmented rbtree: add new RB_DECLARE_CALLBACKS_MAX macro augmented rbtree: rework the RB_DECLARE_CALLBACKS macro definition Joe Perches <joe@perches.com>: kernel-doc: core-api: include string.h into core-api Qian Cai <cai@lca.pw>: include/trace/events/writeback.h: fix -Wstringop-truncation warnings Kees Cook <keescook@chromium.org>: strscpy: reject buffer sizes larger than INT_MAX Valdis Kletnieks <valdis.kletnieks@vt.edu>: lib/generic-radix-tree.c: make 2 functions static inline lib/extable.c: add missing prototypes Stephen Boyd <swboyd@chromium.org>: lib/hexdump: make print_hex_dump_bytes() a nop on !DEBUG builds Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: don't interpret stack dumps as commit IDs checkpatch: improve SPDX license checking Matteo Croce <mcroce@redhat.com>: checkpatch.pl: warn on invalid commit id Brendan Jackman <brendan.jackman@bluwireless.co.uk>: checkpatch: exclude sizeof sub-expressions from MACRO_ARG_REUSE Joe Perches <joe@perches.com>: checkpatch: prefer __section over __attribute__((section(...))) checkpatch: allow consecutive close braces Sean Christopherson <sean.j.christopherson@intel.com>: checkpatch: remove obsolete period from "ambiguous SHA1" query Joe Perches <joe@perches.com>: checkpatch: make git output use LANGUAGE=en_US.utf8 Subsystem: reiserfs Jia-Ju Bai <baijiaju1990@gmail.com>: fs: reiserfs: remove unnecessary check of bh in remove_from_transaction() zhengbin <zhengbin13@huawei.com>: fs/reiserfs/journal.c: remove set but not used variables fs/reiserfs/stree.c: remove set but not used variables fs/reiserfs/lbalance.c: remove set but not used variables fs/reiserfs/objectid.c: remove set but not used variables fs/reiserfs/prints.c: remove set but not used variables fs/reiserfs/fix_node.c: remove set but not used variables fs/reiserfs/do_balan.c: remove set but not used variables Jason Yan <yanaijie@huawei.com>: fs/reiserfs/journal.c: remove set but not used variable fs/reiserfs/do_balan.c: remove set but not used variable Subsystem: fat Markus Elfring <elfring@users.sourceforge.net>: fat: delete an unnecessary check before brelse() Subsystem: fork Sai Praneeth Prakhya <sai.praneeth.prakhya@intel.com>: fork: improve error message for corrupted page tables Subsystem: cpumask Alexey Dobriyan <adobriyan@gmail.com>: cpumask: nicer for_each_cpumask_and() signature Subsystem: kexec Tetsuo Handa <penguin-kernel@I-love.SAKURA.ne.jp>: kexec: bail out upon SIGKILL when allocating memory. Vasily Gorbik <gor@linux.ibm.com>: kexec: restore arch_kexec_kernel_image_probe declaration Subsystem: uaccess Kees Cook <keescook@chromium.org>: uaccess: add missing __must_check attributes Subsystem: kconfig Masahiro Yamada <yamada.masahiro@socionext.com>: compiler: enable CONFIG_OPTIMIZE_INLINING forcibly Subsystem: kgdb Douglas Anderson <dianders@chromium.org>: kgdb: don't use a notifier to enter kgdb at panic; call directly scripts/gdb: handle split debug Subsystem: bug Kees Cook <keescook@chromium.org>: Patch series "Clean up WARN() "cut here" handling", v2: bug: refactor away warn_slowpath_fmt_taint() bug: rename __WARN_printf_taint() to __WARN_printf() bug: consolidate warn_slowpath_fmt() usage bug: lift "cut here" out of __warn() bug: clean up helper macros to remove __WARN_TAINT() bug: consolidate __WARN_FLAGS usage bug: move WARN_ON() "cut here" into exception handler Subsystem: ipc Markus Elfring <elfring@users.sourceforge.net>: ipc/mqueue.c: delete an unnecessary check before the macro call dev_kfree_skb() ipc/mqueue: improve exception handling in do_mq_notify() "Joel Fernandes (Google)" <joel@joelfernandes.org>: ipc/sem.c: convert to use built-in RCU list checking Subsystem: lzo Dave Rodgman <dave.rodgman@arm.com>: lib/lzo/lzo1x_compress.c: fix alignment bug in lzo-rle Subsystem: kasan Andrey Konovalov <andreyknvl@google.com>: Patch series "arm64: untag user pointers passed to the kernel", v19: lib: untag user pointers in strn*_user mm: untag user pointers passed to memory syscalls mm: untag user pointers in mm/gup.c mm: untag user pointers in get_vaddr_frames fs/namespace: untag user pointers in copy_mount_options userfaultfd: untag user pointers drm/amdgpu: untag user pointers drm/radeon: untag user pointers in radeon_gem_userptr_ioctl media/v4l2-core: untag user pointers in videobuf_dma_contig_user_get tee/shm: untag user pointers in tee_shm_register vfio/type1: untag user pointers in vaddr_get_pfn Catalin Marinas <catalin.marinas@arm.com>: mm: untag user pointers in mmap/munmap/mremap/brk Subsystem: madvise Minchan Kim <minchan@kernel.org>: Patch series "Introduce MADV_COLD and MADV_PAGEOUT", v7: mm: introduce MADV_COLD mm: change PAGEREF_RECLAIM_CLEAN with PAGE_REFRECLAIM mm: introduce MADV_PAGEOUT mm: factor out common parts between MADV_COLD and MADV_PAGEOUT Subsystem: cleanups Mike Rapoport <rppt@linux.ibm.com>: hexagon: drop empty and unused free_initrd_mem Denis Efremov <efremov@linux.com>: checkpatch: check for nested (un)?likely() calls xen/events: remove unlikely() from WARN() condition fs: remove unlikely() from WARN_ON() condition wimax/i2400m: remove unlikely() from WARN*() condition xfs: remove unlikely() from WARN_ON() condition IB/hfi1: remove unlikely() from IS_ERR*() condition ntfs: remove (un)?likely() from IS_ERR() conditions Subsystem: pagemap Mark Rutland <mark.rutland@arm.com>: mm: treewide: clarify pgtable_page_{ctor,dtor}() naming Documentation/core-api/kernel-api.rst | 3 Documentation/vm/split_page_table_lock.rst | 10 arch/alpha/include/uapi/asm/mman.h | 3 arch/arc/include/asm/pgalloc.h | 4 arch/arm/include/asm/tlb.h | 2 arch/arm/mm/mmu.c | 2 arch/arm64/include/asm/tlb.h | 2 arch/arm64/mm/mmu.c | 2 arch/csky/include/asm/pgalloc.h | 2 arch/hexagon/include/asm/pgalloc.h | 2 arch/hexagon/mm/init.c | 13 arch/m68k/include/asm/mcf_pgalloc.h | 6 arch/m68k/include/asm/motorola_pgalloc.h | 6 arch/m68k/include/asm/sun3_pgalloc.h | 2 arch/mips/include/asm/pgalloc.h | 2 arch/mips/include/uapi/asm/mman.h | 3 arch/nios2/include/asm/pgalloc.h | 2 arch/openrisc/include/asm/pgalloc.h | 6 arch/parisc/include/uapi/asm/mman.h | 3 arch/powerpc/mm/pgtable-frag.c | 6 arch/riscv/include/asm/pgalloc.h | 2 arch/s390/mm/pgalloc.c | 6 arch/sh/include/asm/pgalloc.h | 2 arch/sparc/include/asm/pgtable_64.h | 5 arch/sparc/mm/init_64.c | 4 arch/sparc/mm/srmmu.c | 4 arch/um/include/asm/pgalloc.h | 2 arch/unicore32/include/asm/tlb.h | 2 arch/x86/mm/pat_rbtree.c | 19 arch/x86/mm/pgtable.c | 2 arch/xtensa/include/asm/pgalloc.h | 4 arch/xtensa/include/uapi/asm/mman.h | 3 drivers/block/drbd/drbd_interval.c | 29 - drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gpuvm.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_gem.c | 2 drivers/gpu/drm/radeon/radeon_gem.c | 2 drivers/infiniband/hw/hfi1/verbs.c | 2 drivers/media/v4l2-core/videobuf-dma-contig.c | 9 drivers/net/wimax/i2400m/tx.c | 3 drivers/tee/tee_shm.c | 1 drivers/vfio/vfio_iommu_type1.c | 2 drivers/xen/events/events_base.c | 2 fs/fat/dir.c | 4 fs/namespace.c | 2 fs/ntfs/mft.c | 12 fs/ntfs/namei.c | 2 fs/ntfs/runlist.c | 2 fs/ntfs/super.c | 2 fs/open.c | 2 fs/reiserfs/do_balan.c | 15 fs/reiserfs/fix_node.c | 6 fs/reiserfs/journal.c | 22 fs/reiserfs/lbalance.c | 3 fs/reiserfs/objectid.c | 3 fs/reiserfs/prints.c | 3 fs/reiserfs/stree.c | 4 fs/userfaultfd.c | 22 fs/xfs/xfs_buf.c | 4 include/asm-generic/bug.h | 71 +- include/asm-generic/pgalloc.h | 8 include/linux/cpumask.h | 14 include/linux/interval_tree_generic.h | 22 include/linux/kexec.h | 2 include/linux/kgdb.h | 2 include/linux/mm.h | 4 include/linux/mm_types_task.h | 4 include/linux/printk.h | 22 include/linux/rbtree_augmented.h | 114 +++- include/linux/string.h | 5 include/linux/swap.h | 2 include/linux/thread_info.h | 2 include/linux/uaccess.h | 21 include/trace/events/writeback.h | 38 - include/uapi/asm-generic/mman-common.h | 3 include/uapi/linux/coff.h | 5 ipc/mqueue.c | 22 ipc/sem.c | 3 kernel/debug/debug_core.c | 31 - kernel/elfcore.c | 1 kernel/fork.c | 16 kernel/kexec_core.c | 2 kernel/panic.c | 48 - lib/Kconfig.debug | 4 lib/bug.c | 11 lib/extable.c | 1 lib/generic-radix-tree.c | 4 lib/hexdump.c | 21 lib/lzo/lzo1x_compress.c | 14 lib/rbtree_test.c | 37 - lib/string.c | 12 lib/strncpy_from_user.c | 3 lib/strnlen_user.c | 3 mm/frame_vector.c | 2 mm/gup.c | 4 mm/internal.h | 2 mm/madvise.c | 562 ++++++++++++++++------- mm/memcontrol.c | 10 mm/mempolicy.c | 3 mm/migrate.c | 2 mm/mincore.c | 2 mm/mlock.c | 4 mm/mmap.c | 34 - mm/mprotect.c | 2 mm/mremap.c | 13 mm/msync.c | 2 mm/oom_kill.c | 2 mm/swap.c | 42 + mm/vmalloc.c | 5 mm/vmscan.c | 62 ++ scripts/checkpatch.pl | 69 ++ scripts/gdb/linux/symbols.py | 4 tools/include/linux/rbtree.h | 71 +- tools/include/linux/rbtree_augmented.h | 145 +++-- tools/lib/rbtree.c | 37 - 114 files changed, 1195 insertions(+), 754 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2019-09-23 22:31 Andrew Morton 2019-09-24 0:55 ` incoming Linus Torvalds 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2019-09-23 22:31 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - a few hot fixes - ocfs2 updates - almost all of -mm, as below. 134 patches, based on 619e17cf75dd58905aa67ccd494a6ba5f19d6cc6: Subsystems affected by this patch series: hotfixes ocfs2 slab-generic slab slub kmemleak kasan cleanups debug pagecache memcg gup pagemap memory-hotplug sparsemem vmalloc initialization z3fold compaction mempolicy oom-kill hugetlb migration thp mmap madvise shmem zswap zsmalloc Subsystem: hotfixes OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>: fat: work around race with userspace's read via blockdev while mounting Vitaly Wool <vitalywool@gmail.com>: Revert "mm/z3fold.c: fix race between migration and destruction" Arnd Bergmann <arnd@arndb.de>: mm: add dummy can_do_mlock() helper Vitaly Wool <vitalywool@gmail.com>: z3fold: fix retry mechanism in page reclaim Greg Thelen <gthelen@google.com>: kbuild: clean compressed initramfs image Subsystem: ocfs2 Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: use jbd2_inode dirty range scoping jbd2: remove jbd2_journal_inode_add_[write|wait] Greg Kroah-Hartman <gregkh@linuxfoundation.org>: ocfs2: further debugfs cleanups Guozhonghua <guozhonghua@h3c.com>: ocfs2: remove unused ocfs2_calc_tree_trunc_credits() ocfs2: remove unused ocfs2_orphan_scan_exit() declaration zhengbin <zhengbin13@huawei.com>: fs/ocfs2/namei.c: remove set but not used variables fs/ocfs2/file.c: remove set but not used variables fs/ocfs2/dir.c: remove set but not used variables Markus Elfring <elfring@users.sourceforge.net>: ocfs2: delete unnecessary checks before brelse() Changwei Ge <gechangwei@live.cn>: ocfs2: wait for recovering done after direct unlock request ocfs2: checkpoint appending truncate log transaction before flushing Colin Ian King <colin.king@canonical.com>: ocfs2: fix spelling mistake "ambigous" -> "ambiguous" Subsystem: slab-generic Waiman Long <longman@redhat.com>: mm, slab: extend slab/shrink to shrink all memcg caches Subsystem: slab Waiman Long <longman@redhat.com>: mm, slab: move memcg_cache_params structure to mm/slab.h Subsystem: slub Qian Cai <cai@lca.pw>: mm/slub.c: fix -Wunused-function compiler warnings Subsystem: kmemleak Nicolas Boichat <drinkcat@chromium.org>: kmemleak: increase DEBUG_KMEMLEAK_EARLY_LOG_SIZE default to 16K Catalin Marinas <catalin.marinas@arm.com>: Patch series "mm: kmemleak: Use a memory pool for kmemleak object: mm: kmemleak: make the tool tolerant to struct scan_area allocation failures mm: kmemleak: simple memory allocation pool for kmemleak objects mm: kmemleak: use the memory pool for early allocations Qian Cai <cai@lca.pw>: mm/kmemleak.c: record the current memory pool size mm/kmemleak: increase the max mem pool to 1M Subsystem: kasan Walter Wu <walter-zh.wu@mediatek.com>: kasan: add memory corruption identification for software tag-based mode Mark Rutland <mark.rutland@arm.com>: lib/test_kasan.c: add roundtrip tests Subsystem: cleanups Christophe JAILLET <christophe.jaillet@wanadoo.fr>: mm/page_poison.c: fix a typo in a comment YueHaibing <yuehaibing@huawei.com>: mm/rmap.c: remove set but not used variable 'cstart' Matthew Wilcox (Oracle) <willy@infradead.org>: Patch series "Make working with compound pages easier", v2: mm: introduce page_size() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: introduce page_shift() Matthew Wilcox (Oracle) <willy@infradead.org>: mm: introduce compound_nr() Yu Zhao <yuzhao@google.com>: mm: replace list_move_tail() with add_page_to_lru_list_tail() Subsystem: debug Vlastimil Babka <vbabka@suse.cz>: Patch series "debug_pagealloc improvements through page_owner", v2: mm, page_owner: record page owner for each subpage mm, page_owner: keep owner info when freeing the page mm, page_owner, debug_pagealloc: save and dump freeing stack trace Subsystem: pagecache Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm/filemap.c: don't initiate writeback if mapping has no dirty pages mm/filemap.c: rewrite mapping_needs_writeback in less fancy manner "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: page cache: store only head pages in i_pages Subsystem: memcg Chris Down <chris@chrisdown.name>: mm, memcg: throttle allocators when failing reclaim over memory.high Roman Gushchin <guro@fb.com>: mm: memcontrol: switch to rcu protection in drain_all_stock() Johannes Weiner <hannes@cmpxchg.org>: mm: vmscan: do not share cgroup iteration between reclaimers Subsystem: gup [11~From: John Hubbard <jhubbard@nvidia.com>: Patch series "mm/gup: add make_dirty arg to put_user_pages_dirty_lock()",: mm/gup: add make_dirty arg to put_user_pages_dirty_lock() John Hubbard <jhubbard@nvidia.com>: drivers/gpu/drm/via: convert put_page() to put_user_page*() net/xdp: convert put_page() to put_user_page*() Subsystem: pagemap Wei Yang <richardw.yang@linux.intel.com>: mm: remove redundant assignment of entry Minchan Kim <minchan@kernel.org>: mm: release the spinlock on zap_pte_range Nicholas Piggin <npiggin@gmail.com>: Patch series "mm: remove quicklist page table caches": mm: remove quicklist page table caches Mike Rapoport <rppt@linux.ibm.com>: ia64: switch to generic version of pte allocation sh: switch to generic version of pte allocation microblaze: switch to generic version of pte allocation mm: consolidate pgtable_cache_init() and pgd_cache_init() Kefeng Wang <wangkefeng.wang@huawei.com>: mm: do not hash address in print_bad_pte() Subsystem: memory-hotplug David Hildenbrand <david@redhat.com>: mm/memory_hotplug: remove move_pfn_range() drivers/base/node.c: simplify unregister_memory_block_under_nodes() drivers/base/memory.c: fixup documentation of removable/phys_index/block_size_bytes driver/base/memory.c: validate memory block size early drivers/base/memory.c: don't store end_section_nr in memory blocks Wei Yang <richardw.yang@linux.intel.com>: mm/memory_hotplug.c: prevent memory leak when reusing pgdat David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: online_pages() cleanups", v2: mm/memory_hotplug.c: use PFN_UP / PFN_DOWN in walk_system_ram_range() mm/memory_hotplug: drop PageReserved() check in online_pages_range() mm/memory_hotplug: simplify online_pages_range() mm/memory_hotplug: make sure the pfn is aligned to the order when onlining mm/memory_hotplug: online_pages cannot be 0 in online_pages() Alastair D'Silva <alastair@d-silva.org>: Patch series "Add bounds check for Hotplugged memory", v3: mm/memory_hotplug.c: add a bounds check to check_hotplug_memory_range() mm/memremap.c: add a bounds check in devm_memremap_pages() Souptick Joarder <jrdr.linux@gmail.com>: mm/memory_hotplug.c: s/is/if Subsystem: sparsemem Lecopzer Chen <lecopzer.chen@mediatek.com>: mm/sparse.c: fix memory leak of sparsemap_buf in aligned memory mm/sparse.c: fix ALIGN() without power of 2 in sparse_buffer_alloc() Wei Yang <richardw.yang@linux.intel.com>: mm/sparse.c: use __nr_to_section(section_nr) to get mem_section Alastair D'Silva <alastair@d-silva.org>: mm/sparse.c: don't manually decrement num_poisoned_pages "Alastair D'Silva" <alastair@d-silva.org>: mm/sparse.c: remove NULL check in clear_hwpoisoned_pages() Subsystem: vmalloc "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: do not keep unpurged areas in the busy tree Pengfei Li <lpf.vector@gmail.com>: mm/vmalloc: modify struct vmap_area to reduce its size Austin Kim <austindh.kim@gmail.com>: mm/vmalloc.c: move 'area->pages' after if statement Subsystem: initialization Mike Rapoport <rppt@linux.ibm.com>: mm: use CPU_BITS_NONE to initialize init_mm.cpu_bitmask Qian Cai <cai@lca.pw>: mm: silence -Woverride-init/initializer-overrides Subsystem: z3fold Vitaly Wool <vitalywool@gmail.com>: z3fold: fix memory leak in kmem cache Subsystem: compaction Yafang Shao <laoar.shao@gmail.com>: mm/compaction.c: clear total_{migrate,free}_scanned before scanning a new zone Pengfei Li <lpf.vector@gmail.com>: mm/compaction.c: remove unnecessary zone parameter in isolate_migratepages() Subsystem: mempolicy Kefeng Wang <wangkefeng.wang@huawei.com>: mm/mempolicy.c: remove unnecessary nodemask check in kernel_migrate_pages() Subsystem: oom-kill Joel Savitz <jsavitz@redhat.com>: mm/oom_kill.c: add task UID to info message on an oom kill Tetsuo Handa <penguin-kernel@i-love.sakura.ne.jp>: memcg, oom: don't require __GFP_FS when invoking memcg OOM killer Edward Chron <echron@arista.com>: mm/oom: add oom_score_adj and pgtables to Killed process message Yi Wang <wang.yi59@zte.com.cn>: mm/oom_kill.c: fix oom_cpuset_eligible() comment Michal Hocko <mhocko@suse.com>: mm, oom: consider present pages for the node size Qian Cai <cai@lca.pw>: mm/memcontrol.c: fix a -Wunused-function warning Michal Hocko <mhocko@suse.com>: memcg, kmem: deprecate kmem.limit_in_bytes Subsystem: hugetlb Hillf Danton <hdanton@sina.com>: Patch series "address hugetlb page allocation stalls", v2: mm, reclaim: make should_continue_reclaim perform dryrun detection Vlastimil Babka <vbabka@suse.cz>: mm, reclaim: cleanup should_continue_reclaim() mm, compaction: raise compaction priority after it withdrawns Mike Kravetz <mike.kravetz@oracle.com>: hugetlbfs: don't retry when pool page allocations start to fail Subsystem: migration Pingfan Liu <kernelfans@gmail.com>: mm/migrate.c: clean up useless code in migrate_vma_collect_pmd() Subsystem: thp Kefeng Wang <wangkefeng.wang@huawei.com>: thp: update split_huge_page_pmd() comment Song Liu <songliubraving@fb.com>: Patch series "Enable THP for text section of non-shmem files", v10;: filemap: check compound_head(page)->mapping in filemap_fault() filemap: check compound_head(page)->mapping in pagecache_get_page() filemap: update offset check in filemap_fault() mm,thp: stats for file backed THP khugepaged: rename collapse_shmem() and khugepaged_scan_shmem() mm,thp: add read-only THP support for (non-shmem) FS mm,thp: avoid writes to file with THP in pagecache Yang Shi <yang.shi@linux.alibaba.com>: Patch series "Make deferred split shrinker memcg aware", v6: mm: thp: extract split_queue_* into a struct mm: move mem_cgroup_uncharge out of __page_cache_release() mm: shrinker: make shrinker not depend on memcg kmem mm: thp: make deferred split shrinker memcg aware Song Liu <songliubraving@fb.com>: Patch series "THP aware uprobe", v13: mm: move memcmp_pages() and pages_identical() uprobe: use original page when all uprobes are removed mm, thp: introduce FOLL_SPLIT_PMD uprobe: use FOLL_SPLIT_PMD instead of FOLL_SPLIT khugepaged: enable collapse pmd for pte-mapped THP uprobe: collapse THP pmd after removing all uprobes Subsystem: mmap Alexandre Ghiti <alex@ghiti.fr>: Patch series "Provide generic top-down mmap layout functions", v6: mm, fs: move randomize_stack_top from fs to mm arm64: make use of is_compat_task instead of hardcoding this test arm64: consider stack randomization for mmap base only when necessary arm64, mm: move generic mmap layout functions to mm arm64, mm: make randomization selected by generic topdown mmap layout arm: properly account for stack randomization and stack guard gap arm: use STACK_TOP when computing mmap base address arm: use generic mmap top-down layout and brk randomization mips: properly account for stack randomization and stack guard gap mips: use STACK_TOP when computing mmap base address mips: adjust brk randomization offset to fit generic version mips: replace arch specific way to determine 32bit task with generic version mips: use generic mmap top-down layout and brk randomization riscv: make mmap allocation top-down by default Wei Yang <richardw.yang@linux.intel.com>: mm/mmap.c: refine find_vma_prev() with rb_last() Ivan Khoronzhuk <ivan.khoronzhuk@linaro.org>: mm: mmap: increase sockets maximum memory size pgoff for 32bits Subsystem: madvise Mike Rapoport <rppt@linux.ibm.com>: mm/madvise: reduce code duplication in error handling paths Subsystem: shmem Miles Chen <miles.chen@mediatek.com>: shmem: fix obsolete comment in shmem_getpage_gfp() Subsystem: zswap Hui Zhu <teawaterz@linux.alibaba.com>: zpool: add malloc_support_movable to zpool_driver zswap: use movable memory if zpool support allocate movable memory Vitaly Wool <vitalywool@gmail.com>: zswap: do not map same object twice Subsystem: zsmalloc Qian Cai <cai@lca.pw>: mm/zsmalloc.c: fix a -Wunused-function warning Documentation/ABI/testing/sysfs-kernel-slab | 13 Documentation/admin-guide/cgroup-v1/memory.rst | 4 Documentation/admin-guide/kernel-parameters.txt | 2 arch/Kconfig | 11 arch/alpha/include/asm/pgalloc.h | 2 arch/alpha/include/asm/pgtable.h | 5 arch/arc/include/asm/pgalloc.h | 1 arch/arc/include/asm/pgtable.h | 5 arch/arm/Kconfig | 1 arch/arm/include/asm/pgalloc.h | 2 arch/arm/include/asm/pgtable-nommu.h | 5 arch/arm/include/asm/pgtable.h | 2 arch/arm/include/asm/processor.h | 2 arch/arm/kernel/process.c | 5 arch/arm/mm/flush.c | 7 arch/arm/mm/mmap.c | 80 ----- arch/arm64/Kconfig | 2 arch/arm64/include/asm/pgalloc.h | 2 arch/arm64/include/asm/pgtable.h | 2 arch/arm64/include/asm/processor.h | 2 arch/arm64/kernel/process.c | 8 arch/arm64/mm/flush.c | 3 arch/arm64/mm/mmap.c | 84 ----- arch/arm64/mm/pgd.c | 2 arch/c6x/include/asm/pgtable.h | 5 arch/csky/include/asm/pgalloc.h | 2 arch/csky/include/asm/pgtable.h | 5 arch/h8300/include/asm/pgtable.h | 6 arch/hexagon/include/asm/pgalloc.h | 2 arch/hexagon/include/asm/pgtable.h | 3 arch/hexagon/mm/Makefile | 2 arch/hexagon/mm/pgalloc.c | 10 arch/ia64/Kconfig | 4 arch/ia64/include/asm/pgalloc.h | 64 ---- arch/ia64/include/asm/pgtable.h | 5 arch/ia64/mm/init.c | 2 arch/m68k/include/asm/pgtable_mm.h | 7 arch/m68k/include/asm/pgtable_no.h | 7 arch/microblaze/include/asm/pgalloc.h | 128 -------- arch/microblaze/include/asm/pgtable.h | 7 arch/microblaze/mm/pgtable.c | 4 arch/mips/Kconfig | 2 arch/mips/include/asm/pgalloc.h | 2 arch/mips/include/asm/pgtable.h | 5 arch/mips/include/asm/processor.h | 5 arch/mips/mm/mmap.c | 124 +------- arch/nds32/include/asm/pgalloc.h | 2 arch/nds32/include/asm/pgtable.h | 2 arch/nios2/include/asm/pgalloc.h | 2 arch/nios2/include/asm/pgtable.h | 2 arch/openrisc/include/asm/pgalloc.h | 2 arch/openrisc/include/asm/pgtable.h | 5 arch/parisc/include/asm/pgalloc.h | 2 arch/parisc/include/asm/pgtable.h | 2 arch/powerpc/include/asm/pgalloc.h | 2 arch/powerpc/include/asm/pgtable.h | 1 arch/powerpc/mm/book3s64/hash_utils.c | 2 arch/powerpc/mm/book3s64/iommu_api.c | 7 arch/powerpc/mm/hugetlbpage.c | 2 arch/riscv/Kconfig | 12 arch/riscv/include/asm/pgalloc.h | 4 arch/riscv/include/asm/pgtable.h | 5 arch/s390/include/asm/pgtable.h | 6 arch/sh/include/asm/pgalloc.h | 56 --- arch/sh/include/asm/pgtable.h | 5 arch/sh/mm/Kconfig | 3 arch/sh/mm/nommu.c | 4 arch/sparc/include/asm/pgalloc_32.h | 2 arch/sparc/include/asm/pgalloc_64.h | 2 arch/sparc/include/asm/pgtable_32.h | 5 arch/sparc/include/asm/pgtable_64.h | 1 arch/sparc/mm/init_32.c | 1 arch/um/include/asm/pgalloc.h | 2 arch/um/include/asm/pgtable.h | 2 arch/unicore32/include/asm/pgalloc.h | 2 arch/unicore32/include/asm/pgtable.h | 2 arch/x86/include/asm/pgtable_32.h | 2 arch/x86/include/asm/pgtable_64.h | 3 arch/x86/mm/pgtable.c | 6 arch/xtensa/include/asm/pgtable.h | 1 arch/xtensa/include/asm/tlbflush.h | 3 drivers/base/memory.c | 44 +- drivers/base/node.c | 55 +-- drivers/crypto/chelsio/chtls/chtls_io.c | 5 drivers/gpu/drm/via/via_dmablit.c | 10 drivers/infiniband/core/umem.c | 5 drivers/infiniband/hw/hfi1/user_pages.c | 5 drivers/infiniband/hw/qib/qib_user_pages.c | 5 drivers/infiniband/hw/usnic/usnic_uiom.c | 5 drivers/infiniband/sw/siw/siw_mem.c | 10 drivers/staging/android/ion/ion_system_heap.c | 4 drivers/target/tcm_fc/tfc_io.c | 3 drivers/vfio/vfio_iommu_spapr_tce.c | 8 fs/binfmt_elf.c | 20 - fs/fat/dir.c | 13 fs/fat/fatent.c | 3 fs/inode.c | 3 fs/io_uring.c | 2 fs/jbd2/journal.c | 2 fs/jbd2/transaction.c | 12 fs/ocfs2/alloc.c | 20 + fs/ocfs2/aops.c | 13 fs/ocfs2/blockcheck.c | 26 - fs/ocfs2/cluster/heartbeat.c | 109 +------ fs/ocfs2/dir.c | 3 fs/ocfs2/dlm/dlmcommon.h | 1 fs/ocfs2/dlm/dlmdebug.c | 55 --- fs/ocfs2/dlm/dlmdebug.h | 16 - fs/ocfs2/dlm/dlmdomain.c | 7 fs/ocfs2/dlm/dlmunlock.c | 23 + fs/ocfs2/dlmglue.c | 29 - fs/ocfs2/extent_map.c | 3 fs/ocfs2/file.c | 13 fs/ocfs2/inode.c | 2 fs/ocfs2/journal.h | 42 -- fs/ocfs2/namei.c | 2 fs/ocfs2/ocfs2.h | 3 fs/ocfs2/super.c | 10 fs/open.c | 8 fs/proc/meminfo.c | 8 fs/proc/task_mmu.c | 6 include/asm-generic/pgalloc.h | 5 include/asm-generic/pgtable.h | 7 include/linux/compaction.h | 22 + include/linux/fs.h | 32 ++ include/linux/huge_mm.h | 9 include/linux/hugetlb.h | 2 include/linux/jbd2.h | 2 include/linux/khugepaged.h | 12 include/linux/memcontrol.h | 23 - include/linux/memory.h | 7 include/linux/memory_hotplug.h | 1 include/linux/mm.h | 37 ++ include/linux/mm_types.h | 1 include/linux/mmzone.h | 14 include/linux/page_ext.h | 1 include/linux/pagemap.h | 10 include/linux/quicklist.h | 94 ------ include/linux/shrinker.h | 7 include/linux/slab.h | 62 ---- include/linux/vmalloc.h | 20 - include/linux/zpool.h | 3 init/main.c | 6 kernel/events/uprobes.c | 81 ++++- kernel/resource.c | 4 kernel/sched/idle.c | 1 kernel/sysctl.c | 6 lib/Kconfig.debug | 15 lib/Kconfig.kasan | 8 lib/iov_iter.c | 2 lib/show_mem.c | 5 lib/test_kasan.c | 41 ++ mm/Kconfig | 16 - mm/Kconfig.debug | 4 mm/Makefile | 4 mm/compaction.c | 50 +-- mm/filemap.c | 168 ++++------ mm/gup.c | 125 +++----- mm/huge_memory.c | 129 ++++++-- mm/hugetlb.c | 89 +++++ mm/hugetlb_cgroup.c | 2 mm/init-mm.c | 2 mm/kasan/common.c | 32 +- mm/kasan/kasan.h | 14 mm/kasan/report.c | 44 ++ mm/kasan/tags_report.c | 24 + mm/khugepaged.c | 372 ++++++++++++++++++++---- mm/kmemleak.c | 338 +++++---------------- mm/ksm.c | 18 - mm/madvise.c | 52 +-- mm/memcontrol.c | 188 ++++++++++-- mm/memfd.c | 2 mm/memory.c | 21 + mm/memory_hotplug.c | 120 ++++--- mm/mempolicy.c | 4 mm/memremap.c | 5 mm/migrate.c | 13 mm/mmap.c | 12 mm/mmu_gather.c | 2 mm/nommu.c | 2 mm/oom_kill.c | 30 + mm/page_alloc.c | 27 + mm/page_owner.c | 127 +++++--- mm/page_poison.c | 2 mm/page_vma_mapped.c | 3 mm/quicklist.c | 103 ------ mm/rmap.c | 25 - mm/shmem.c | 12 mm/slab.h | 64 ++++ mm/slab_common.c | 37 ++ mm/slob.c | 2 mm/slub.c | 22 - mm/sparse.c | 25 + mm/swap.c | 16 - mm/swap_state.c | 6 mm/util.c | 126 +++++++- mm/vmalloc.c | 84 +++-- mm/vmscan.c | 163 ++++------ mm/vmstat.c | 2 mm/z3fold.c | 154 ++------- mm/zpool.c | 16 + mm/zsmalloc.c | 23 - mm/zswap.c | 15 net/xdp/xdp_umem.c | 9 net/xdp/xsk.c | 2 usr/Makefile | 3 206 files changed, 2385 insertions(+), 2533 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2019-09-23 22:31 incoming Andrew Morton @ 2019-09-24 0:55 ` Linus Torvalds 2019-09-24 4:31 ` incoming Andrew Morton 0 siblings, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2019-09-24 0:55 UTC (permalink / raw) To: Andrew Morton, David Rientjes, Vlastimil Babka, Michal Hocko, Andrea Arcangeli Cc: mm-commits, Linux-MM On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > - almost all of -mm, as below. I was hoping that we could at least test the THP locality thing? Is it in your queue at all, or am I supposed to just do it myself? Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2019-09-24 0:55 ` incoming Linus Torvalds @ 2019-09-24 4:31 ` Andrew Morton 2019-09-24 7:48 ` incoming Michal Hocko 0 siblings, 1 reply; 322+ messages in thread From: Andrew Morton @ 2019-09-24 4:31 UTC (permalink / raw) To: Linus Torvalds Cc: David Rientjes, Vlastimil Babka, Michal Hocko, Andrea Arcangeli, mm-commits, Linux-MM On Mon, 23 Sep 2019 17:55:24 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > - almost all of -mm, as below. > > I was hoping that we could at least test the THP locality thing? Is it > in your queue at all, or am I supposed to just do it myself? > Confused. I saw a privately emailed patch from David which nobody seems to have tested yet. I parked that for consideration after -rc1. Or are you referring to something else? This thing keeps stalling. It would be nice to push this along and get something nailed down which we can at least get into 5.4-rc, perhaps with a backport-this tag? ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2019-09-24 4:31 ` incoming Andrew Morton @ 2019-09-24 7:48 ` Michal Hocko 2019-09-24 15:34 ` incoming Linus Torvalds 2019-09-24 19:55 ` incoming Vlastimil Babka 0 siblings, 2 replies; 322+ messages in thread From: Michal Hocko @ 2019-09-24 7:48 UTC (permalink / raw) To: Andrew Morton Cc: Linus Torvalds, David Rientjes, Vlastimil Babka, Andrea Arcangeli, mm-commits, Linux-MM On Mon 23-09-19 21:31:53, Andrew Morton wrote: > On Mon, 23 Sep 2019 17:55:24 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > > > On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > > > - almost all of -mm, as below. > > > > I was hoping that we could at least test the THP locality thing? Is it > > in your queue at all, or am I supposed to just do it myself? > > > > Confused. I saw a privately emailed patch from David which nobody > seems to have tested yet. I parked that for consideration after -rc1. > Or are you referring to something else? > > This thing keeps stalling. It would be nice to push this along and get > something nailed down which we can at least get into 5.4-rc, perhaps > with a backport-this tag? The patch proposed by David is really non trivial wrt. potential side effects. I have provided my review feedback [1] and it didn't get any reaction. I really believe that we need to debug this properly. A reproducer would be useful for others to work on that. There is a more fundamental problem here and we need to address it rather than to duck tape it and whack a mole afterwards. [1] http://lkml.kernel.org/r/20190909193020.GD2063@dhcp22.suse.cz -- Michal Hocko SUSE Labs ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2019-09-24 7:48 ` incoming Michal Hocko @ 2019-09-24 15:34 ` Linus Torvalds 2019-09-25 6:36 ` incoming Michal Hocko 2019-09-24 19:55 ` incoming Vlastimil Babka 1 sibling, 1 reply; 322+ messages in thread From: Linus Torvalds @ 2019-09-24 15:34 UTC (permalink / raw) To: Michal Hocko Cc: Andrew Morton, David Rientjes, Vlastimil Babka, Andrea Arcangeli, mm-commits, Linux-MM On Tue, Sep 24, 2019 at 12:48 AM Michal Hocko <mhocko@kernel.org> wrote: > > The patch proposed by David is really non trivial wrt. potential side > effects. The thing is, that's not an argument when we know that the current state is garbage and has a lot of these non-trivial side effects that are bad. So the patch by David _fixes_ a non-trivial bad side effect. You can't then say "there may be other non-trivial side effects that I don't even know about" as an argument for saying it's bad. David at least has numbers and an argument for his patch. Linus ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2019-09-24 15:34 ` incoming Linus Torvalds @ 2019-09-25 6:36 ` Michal Hocko 0 siblings, 0 replies; 322+ messages in thread From: Michal Hocko @ 2019-09-25 6:36 UTC (permalink / raw) To: Linus Torvalds Cc: Andrew Morton, David Rientjes, Vlastimil Babka, Andrea Arcangeli, mm-commits, Linux-MM On Tue 24-09-19 08:34:20, Linus Torvalds wrote: > On Tue, Sep 24, 2019 at 12:48 AM Michal Hocko <mhocko@kernel.org> wrote: > > > > The patch proposed by David is really non trivial wrt. potential side > > effects. > > The thing is, that's not an argument when we know that the current > state is garbage and has a lot of these non-trivial side effects that > are bad. > > So the patch by David _fixes_ a non-trivial bad side effect. > > You can't then say "there may be other non-trivial side effects that I > don't even know about" as an argument for saying it's bad. David at > least has numbers and an argument for his patch. All I am saying is that I am not able to wrap my head around this patch to provide a competent Ack. I also believe that the fix is targetting a wrong layer of the problem as explained in my review feedback. Appart from reclaim/compaction interaction mentioned by Vlastimil, it seems that it is an overly eager fallback to a remote node in the fast path that is causing a large part of the problem as well. Kcompactd is not eager enough to keep high order allocations ready for the fast path. This is not specific to THP we have many other high order allocations which are going to follow the same pattern, likely not visible in any counters but still having performance implications. Let's discuss technical details in the respective email thread -- Michal Hocko SUSE Labs ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2019-09-24 7:48 ` incoming Michal Hocko 2019-09-24 15:34 ` incoming Linus Torvalds @ 2019-09-24 19:55 ` Vlastimil Babka 1 sibling, 0 replies; 322+ messages in thread From: Vlastimil Babka @ 2019-09-24 19:55 UTC (permalink / raw) To: Michal Hocko, Andrew Morton Cc: Linus Torvalds, David Rientjes, Andrea Arcangeli, mm-commits, Linux-MM On 9/24/19 9:48 AM, Michal Hocko wrote: > On Mon 23-09-19 21:31:53, Andrew Morton wrote: >> On Mon, 23 Sep 2019 17:55:24 -0700 Linus Torvalds >> <torvalds@linux-foundation.org> wrote: >> >>> On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton >>> <akpm@linux-foundation.org> wrote: >>>> >>>> - almost all of -mm, as below. >>> >>> I was hoping that we could at least test the THP locality thing? >>> Is it in your queue at all, or am I supposed to just do it >>> myself? >>> >> >> Confused. I saw a privately emailed patch from David which nobody >> seems to have tested yet. I parked that for consideration after >> -rc1. Or are you referring to something else? >> >> This thing keeps stalling. It would be nice to push this along and >> get something nailed down which we can at least get into 5.4-rc, >> perhaps with a backport-this tag? > > The patch proposed by David is really non trivial wrt. potential > side effects. I have provided my review feedback [1] and it didn't > get any reaction. I really believe that we need to debug this > properly. A reproducer would be useful for others to work on that. > > There is a more fundamental problem here and we need to address it > rather than to duck tape it and whack a mole afterwards. I believe we found a problem when investigating over-reclaim in this thread [1] where it seems madvised THP allocation attempt can result in 4MB reclaimed, if there is a small zone such as ZONE_DMA on the node. As it happens, the patch "[patch 090/134] mm, reclaim: make should_continue_reclaim perform dryrun detection" in Andrew's pile should change this 4MB to 32 pages reclaimed (as a side-effect), but that has to be tested. I'm also working on a patch to not reclaim even those few pages. Of course there might be more fundamental issues with reclaim/compaction interaction, but this one seems to become hopefully clear now. [1] https://lore.kernel.org/linux-mm/4b4ba042-3741-7b16-2292-198c569da2aa@profihost.ag/ > [1] http://lkml.kernel.org/r/20190909193020.GD2063@dhcp22.suse.cz > ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2019-08-30 23:04 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2019-08-30 23:04 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 7 fixes, based on 846d2db3e00048da3f650e0cfb0b8d67669cec3e: Roman Gushchin <guro@fb.com>: mm: memcontrol: flush percpu slab vmstats on kmem offlining Andrew Morton <akpm@linux-foundation.org>: mm/zsmalloc.c: fix build when CONFIG_COMPACTION=n Roman Gushchin <guro@fb.com>: mm, memcg: partially revert "mm/memcontrol.c: keep local VM counters in sync with the hierarchical ones" "Gustavo A. R. Silva" <gustavo@embeddedor.com>: mm/z3fold.c: fix lock/unlock imbalance in z3fold_page_isolate Dmitry Safonov <dima@arista.com>: mailmap: add aliases for Dmitry Safonov Michal Hocko <mhocko@suse.com>: mm, memcg: do not set reclaim_state on soft limit reclaim Shakeel Butt <shakeelb@google.com>: mm: memcontrol: fix percpu vmstats and vmevents flush .mailmap | 3 ++ include/linux/mmzone.h | 5 ++-- mm/memcontrol.c | 53 ++++++++++++++++++++++++++++++++----------------- mm/vmscan.c | 5 ++-- mm/z3fold.c | 1 mm/zsmalloc.c | 2 + 6 files changed, 47 insertions(+), 22 deletions(-) ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2019-08-25 0:54 Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2019-08-25 0:54 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 11 fixes, based on 361469211f876e67d7ca3d3d29e6d1c3e313d0f1: Henry Burns <henryburns@google.com>: mm/z3fold.c: fix race between migration and destruction David Rientjes <rientjes@google.com>: mm, page_alloc: move_freepages should not examine struct page of reserved memory Qian Cai <cai@lca.pw>: parisc: fix compilation errrors Roman Gushchin <guro@fb.com>: mm: memcontrol: flush percpu vmstats before releasing memcg mm: memcontrol: flush percpu vmevents before releasing memcg Jason Xing <kerneljasonxing@linux.alibaba.com>: psi: get poll_work to run when calling poll syscall next time Oleg Nesterov <oleg@redhat.com>: userfaultfd_release: always remove uffd flags and clear vm_userfaultfd_ctx Vlastimil Babka <vbabka@suse.cz>: mm, page_owner: handle THP splits correctly Henry Burns <henryburns@google.com>: mm/zsmalloc.c: migration can leave pages in ZS_EMPTY indefinitely mm/zsmalloc.c: fix race condition in zs_destroy_pool Andrey Ryabinin <aryabinin@virtuozzo.com>: mm/kasan: fix false positive invalid-free reports with CONFIG_KASAN_SW_TAGS=y ^ permalink raw reply [flat|nested] 322+ messages in thread
[parent not found: <20190716162536.bb52b8f34a8ecf5331a86a42@linux-foundation.org>]
* Re: incoming [not found] <20190716162536.bb52b8f34a8ecf5331a86a42@linux-foundation.org> @ 2019-07-17 8:47 ` Vlastimil Babka 2019-07-17 8:57 ` incoming Bhaskar Chowdhury 2019-07-17 16:13 ` incoming Linus Torvalds 0 siblings, 2 replies; 322+ messages in thread From: Vlastimil Babka @ 2019-07-17 8:47 UTC (permalink / raw) To: linux-kernel, Linus Torvalds Cc: linux-mm, Jonathan Corbet, Thorsten Leemhuis, LKML On 7/17/19 1:25 AM, Andrew Morton wrote: > > Most of the rest of MM and just about all of the rest of everything > else. Hi, as I've mentioned at LSF/MM [1], I think it would be nice if mm pull requests had summaries similar to other subsystems. I see they are now more structured (thanks!), but they are now probably hitting the limit of what scripting can do to produce a high-level summary for human readers (unless patch authors themselves provide a blurb that can be extracted later?). So I've tried now to provide an example what I had in mind, below. Maybe it's too concise - if there were "larger" features in this pull request, they would probably benefit from more details. I'm CCing the known (to me) consumers of these mails to judge :) Note I've only covered mm, and core stuff that I think will be interesting to wide audience (change in LIST_POISON2 value? I'm sure as hell glad to know about that one :) Feel free to include this in the merge commit, if you find it useful. Thanks, Vlastimil [1] https://lwn.net/Articles/787705/ ----- - z3fold fixes and enhancements by Henry Burns and Vitaly Wool - more accurate reclaimed slab caches calculations by Yafang Shao - fix MAP_UNINITIALIZED UAPI symbol to not depend on config, by Christoph Hellwig - !CONFIG_MMU fixes by Christoph Hellwig - new novmcoredd parameter to omit device dumps from vmcore, by Kairui Song - new test_meminit module for testing heap and pagealloc initialization, by Alexander Potapenko - ioremap improvements for huge mappings, by Anshuman Khandual - generalize kprobe page fault handling, by Anshuman Khandual - device-dax hotplug fixes and improvements, by Pavel Tatashin - enable synchronous DAX fault on powerpc, by Aneesh Kumar K.V - add pte_devmap() support for arm64, by Robin Murphy - unify locked_vm accounting with a helper, by Daniel Jordan - several misc fixes core/lib - new typeof_member() macro including some users, by Alexey Dobriyan - make BIT() and GENMASK() available in asm, by Masahiro Yamada - changed LIST_POISON2 on x86_64 to 0xdead000000000122 for better code generation, by Alexey Dobriyan - rbtree code size optimizations, by Michel Lespinasse - convert struct pid count to refcount_t, by Joel Fernandes get_maintainer.pl - add --no-moderated switch to skip moderated ML's, by Joe Perches ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2019-07-17 8:47 ` incoming Vlastimil Babka @ 2019-07-17 8:57 ` Bhaskar Chowdhury 2019-07-17 16:13 ` incoming Linus Torvalds 1 sibling, 0 replies; 322+ messages in thread From: Bhaskar Chowdhury @ 2019-07-17 8:57 UTC (permalink / raw) To: Vlastimil Babka Cc: linux-kernel, Linus Torvalds, linux-mm, Jonathan Corbet, Thorsten Leemhuis [-- Attachment #1: Type: text/plain, Size: 2496 bytes --] Cool !! On 10:47 Wed 17 Jul , Vlastimil Babka wrote: >On 7/17/19 1:25 AM, Andrew Morton wrote: >> >> Most of the rest of MM and just about all of the rest of everything >> else. > >Hi, > >as I've mentioned at LSF/MM [1], I think it would be nice if mm pull >requests had summaries similar to other subsystems. I see they are now >more structured (thanks!), but they are now probably hitting the limit >of what scripting can do to produce a high-level summary for human >readers (unless patch authors themselves provide a blurb that can be >extracted later?). > >So I've tried now to provide an example what I had in mind, below. Maybe >it's too concise - if there were "larger" features in this pull request, >they would probably benefit from more details. I'm CCing the known (to >me) consumers of these mails to judge :) Note I've only covered mm, and >core stuff that I think will be interesting to wide audience (change in >LIST_POISON2 value? I'm sure as hell glad to know about that one :) > >Feel free to include this in the merge commit, if you find it useful. > >Thanks, >Vlastimil > >[1] https://lwn.net/Articles/787705/ > >----- > >- z3fold fixes and enhancements by Henry Burns and Vitaly Wool >- more accurate reclaimed slab caches calculations by Yafang Shao >- fix MAP_UNINITIALIZED UAPI symbol to not depend on config, by >Christoph Hellwig >- !CONFIG_MMU fixes by Christoph Hellwig >- new novmcoredd parameter to omit device dumps from vmcore, by Kairui Song >- new test_meminit module for testing heap and pagealloc initialization, >by Alexander Potapenko >- ioremap improvements for huge mappings, by Anshuman Khandual >- generalize kprobe page fault handling, by Anshuman Khandual >- device-dax hotplug fixes and improvements, by Pavel Tatashin >- enable synchronous DAX fault on powerpc, by Aneesh Kumar K.V >- add pte_devmap() support for arm64, by Robin Murphy >- unify locked_vm accounting with a helper, by Daniel Jordan >- several misc fixes > >core/lib >- new typeof_member() macro including some users, by Alexey Dobriyan >- make BIT() and GENMASK() available in asm, by Masahiro Yamada >- changed LIST_POISON2 on x86_64 to 0xdead000000000122 for better code >generation, by Alexey Dobriyan >- rbtree code size optimizations, by Michel Lespinasse >- convert struct pid count to refcount_t, by Joel Fernandes > >get_maintainer.pl >- add --no-moderated switch to skip moderated ML's, by Joe Perches > > [-- Attachment #2: signature.asc --] [-- Type: application/pgp-signature, Size: 488 bytes --] ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2019-07-17 8:47 ` incoming Vlastimil Babka 2019-07-17 8:57 ` incoming Bhaskar Chowdhury @ 2019-07-17 16:13 ` Linus Torvalds 2019-07-17 17:09 ` incoming Christian Brauner 2019-07-17 18:13 ` incoming Vlastimil Babka 1 sibling, 2 replies; 322+ messages in thread From: Linus Torvalds @ 2019-07-17 16:13 UTC (permalink / raw) To: Vlastimil Babka Cc: Linux List Kernel Mailing, linux-mm, Jonathan Corbet, Thorsten Leemhuis On Wed, Jul 17, 2019 at 1:47 AM Vlastimil Babka <vbabka@suse.cz> wrote: > > So I've tried now to provide an example what I had in mind, below. I'll take it as a trial. I added one-line notes about coda and the PTRACE_GET_SYSCALL_INFO interface too. I do hope that eventually I'll just get pull requests, and they'll have more of a "theme" than this all (*) Linus (*) Although in many ways, the theme for Andrew is "falls through the cracks otherwise" so I'm not really complaining. This has been working for years and years. ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2019-07-17 16:13 ` incoming Linus Torvalds @ 2019-07-17 17:09 ` Christian Brauner 2019-07-17 18:13 ` incoming Vlastimil Babka 1 sibling, 0 replies; 322+ messages in thread From: Christian Brauner @ 2019-07-17 17:09 UTC (permalink / raw) To: Linus Torvalds Cc: Vlastimil Babka, Linux List Kernel Mailing, linux-mm, Jonathan Corbet, Thorsten Leemhuis On Wed, Jul 17, 2019 at 09:13:26AM -0700, Linus Torvalds wrote: > On Wed, Jul 17, 2019 at 1:47 AM Vlastimil Babka <vbabka@suse.cz> wrote: > > > > So I've tried now to provide an example what I had in mind, below. > > I'll take it as a trial. I added one-line notes about coda and the > PTRACE_GET_SYSCALL_INFO interface too. > > I do hope that eventually I'll just get pull requests, and they'll > have more of a "theme" than this all (*) > > Linus > > (*) Although in many ways, the theme for Andrew is "falls through the > cracks otherwise" so I'm not really complaining. This has been working I put all pid{fd}/clone{3} which is mostly related to pid.c, exit.c, fork.c into my tree and try to give it a consistent theme for the prs I sent. And that at least from my perspective that worked and was pretty easy to coordinate with Andrew. That should hopefully make it a little easier to theme the -mm tree overall going forward. ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2019-07-17 16:13 ` incoming Linus Torvalds 2019-07-17 17:09 ` incoming Christian Brauner @ 2019-07-17 18:13 ` Vlastimil Babka 1 sibling, 0 replies; 322+ messages in thread From: Vlastimil Babka @ 2019-07-17 18:13 UTC (permalink / raw) To: Linus Torvalds Cc: Linux List Kernel Mailing, linux-mm, Jonathan Corbet, Thorsten Leemhuis On 7/17/19 6:13 PM, Linus Torvalds wrote: > On Wed, Jul 17, 2019 at 1:47 AM Vlastimil Babka <vbabka@suse.cz> wrote: >> >> So I've tried now to provide an example what I had in mind, below. > > I'll take it as a trial. I added one-line notes about coda and the > PTRACE_GET_SYSCALL_INFO interface too. Thanks. > I do hope that eventually I'll just get pull requests, Very much agree, that was also discussed at length in the LSF/MM mm process session I've linked. > and they'll > have more of a "theme" than this all (*) I'll check if the first patch bomb would be more amenable to that, as I plan to fill in the mm part for 5.3 on LinuxChanges wiki, but for a merge commit it's too late. > Linus > > (*) Although in many ways, the theme for Andrew is "falls through the > cracks otherwise" so I'm not really complaining. This has been working > for years and years. Nevermind the misc stuff that much, but I think mm itself is more important and deserves what other subsystems have. ^ permalink raw reply [flat|nested] 322+ messages in thread
* incoming @ 2007-05-02 22:02 Andrew Morton 2007-05-02 22:31 ` incoming Benjamin Herrenschmidt ` (2 more replies) 0 siblings, 3 replies; 322+ messages in thread From: Andrew Morton @ 2007-05-02 22:02 UTC (permalink / raw) To: Linus Torvalds Cc: Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm So this is what I have lined up for the first mm->2.6.22 batch. I won't be sending it off for another 12-24 hours yet. To give people time for final comment and to give me time to see if it actually works. - A few serial bits. - A few pcmcia bits. - Some of the MM queue. Includes: - An enhancement to /proc/pid/smaps to permit monitoring of a running program's working set. There's another patchset which builds on this quite a lot from Matt Mackall, but it's not quite ready yet. - The SLUB allocator. It's pretty green but I do want to push ahead with this pretty aggressively with a view to replacing slab altogether. If it ends up not working out then we should remove slub altogether again, but I doubt if that will occur. If SLUB isn't in good shape by 2.6.22 we should hide it in Kconfig to prevent people from hitting known problems. It'll remain EXPERIMENTAL. - generic pagetable quicklist management. We have x86_64 and ia64 and sparc64 implementations, but I'll only include David's sparc64 implementation here. I'll send the x86_64 and ia64 implementations through maintainers. - Various random MM bits - Benh's teach-get_unmapped_area-about-MAP_FIXED changes - madvise(MADV_FREE) This means I'm holding back Mel's page allocator work, and Andy's lumpy-reclaim. A shame in a way - I have high hopes for lumpy reclaim against the moveable zone, but these things are not to be done lightly. A few MM things have been held back awaiting subsystem tree merges (probably x86 - I didn't check). - One little security patch - the blackfin architecture - small h8300 update - small alpha update - swsusp updates - m68k bits - cris udpates - Lots of UML updates - v850, xtensa slab-introduce-krealloc.patch at91_cf-minor-fix.patch add-new_id-to-pcmcia-drivers.patch ide-cs-recognize-2gb-compactflash-from-transcend.patch serial-driver-pmc-msp71xx.patch rm9000-serial-driver.patch serial-define-fixed_port-flag-for-serial_core.patch serial-use-resource_size_t-for-serial-port-io-addresses.patch mpsc-serial-driver-tx-locking.patch 8250_pci-fix-pci-must_checks.patch serial-serial_core-use-pr_debug.patch add-apply_to_page_range-which-applies-a-function-to-a-pte-range.patch safer-nr_node_ids-and-nr_node_ids-determination-and-initial.patch use-zvc-counters-to-establish-exact-size-of-dirtyable-pages.patch proper-prototype-for-hugetlb_get_unmapped_area.patch mm-remove-gcc-workaround.patch slab-ensure-cache_alloc_refill-terminates.patch mm-make-read_cache_page-synchronous.patch fs-buffer-dont-pageuptodate-without-page-locked.patch allow-oom_adj-of-saintly-processes.patch introduce-config_has_dma.patch mm-slabc-proper-prototypes.patch add-pfn_valid_within-helper-for-sub-max_order-hole-detection.patch mm-simplify-filemap_nopage.patch add-unitialized_var-macro-for-suppressing-gcc-warnings.patch i386-add-ptep_test_and_clear_dirtyyoung.patch i386-use-pte_update_defer-in-ptep_test_and_clear_dirtyyoung.patch smaps-extract-pmd-walker-from-smaps-code.patch smaps-add-pages-referenced-count-to-smaps.patch smaps-add-clear_refs-file-to-clear-reference.patch readahead-improve-heuristic-detecting-sequential-reads.patch readahead-code-cleanup.patch slab-use-num_possible_cpus-in-enable_cpucache.patch slab-dont-allocate-empty-shared-caches.patch slab-numa-kmem_cache-diet.patch do-not-disable-interrupts-when-reading-min_free_kbytes.patch slab-mark-set_up_list3s-__init.patch cpusets-allow-tif_memdie-threads-to-allocate-anywhere.patch i386-use-page-allocator-to-allocate-thread_info-structure.patch slub-core.patch make-page-private-usable-in-compound-pages-v1.patch optimize-compound_head-by-avoiding-a-shared-page.patch add-virt_to_head_page-and-consolidate-code-in-slab-and-slub.patch slub-fix-object-tracking.patch slub-enable-tracking-of-full-slabs.patch slub-validation-of-slabs-metadata-and-guard-zones.patch slub-add-min_partial.patch slub-add-ability-to-list-alloc--free-callers-per-slab.patch slub-free-slabs-and-sort-partial-slab-lists-in-kmem_cache_shrink.patch slub-remove-object-activities-out-of-checking-functions.patch slub-user-documentation.patch slub-add-slabinfo-tool.patch quicklists-for-page-table-pages.patch quicklist-support-for-sparc64.patch slob-handle-slab_panic-flag.patch include-kern_-constant-in-printk-calls-in-mm-slabc.patch mm-madvise-avoid-exclusive-mmap_sem.patch mm-remove-destroy_dirty_buffers-from-invalidate_bdev.patch mm-optimize-kill_bdev.patch mm-optimize-acorn-partition-truncate.patch slab-allocators-remove-obsolete-slab_must_hwcache_align.patch kmem_cache-simplify-slab-cache-creation.patch slab-allocators-remove-multiple-alignment-specifications.patch fault-injection-fix-failslab-with-config_numa.patch mm-fix-handling-of-panic_on_oom-when-cpusets-are-in-use.patch oom-fix-constraint-deadlock.patch get_unmapped_area-handles-map_fixed-on-powerpc.patch get_unmapped_area-handles-map_fixed-on-alpha.patch get_unmapped_area-handles-map_fixed-on-arm.patch get_unmapped_area-handles-map_fixed-on-frv.patch get_unmapped_area-handles-map_fixed-on-i386.patch get_unmapped_area-handles-map_fixed-on-ia64.patch get_unmapped_area-handles-map_fixed-on-parisc.patch get_unmapped_area-handles-map_fixed-on-sparc64.patch get_unmapped_area-handles-map_fixed-on-x86_64.patch get_unmapped_area-handles-map_fixed-in-hugetlbfs.patch get_unmapped_area-handles-map_fixed-in-generic-code.patch get_unmapped_area-doesnt-need-hugetlbfs-hacks-anymore.patch slab-allocators-remove-slab_debug_initial-flag.patch slab-allocators-remove-slab_ctor_atomic.patch slab-allocators-remove-useless-__gfp_no_grow-flag.patch lazy-freeing-of-memory-through-madv_free.patch restore-madv_dontneed-to-its-original-linux-behaviour.patch hugetlbfs-add-null-check-in-hugetlb_zero_setup.patch slob-fix-page-order-calculation-on-not-4kb-page.patch page-migration-only-migrate-pages-if-allocation-in-the-highest-zone-is-possible.patch return-eperm-not-echild-on-security_task_wait-failure.patch blackfin-arch.patch driver_bfin_serial_core.patch blackfin-on-chip-ethernet-mac-controller-driver.patch blackfin-patch-add-blackfin-support-in-smc91x.patch blackfin-on-chip-rtc-controller-driver.patch blackfin-blackfin-on-chip-spi-controller-driver.patch convert-h8-300-to-generic-timekeeping.patch h8300-generic-irq.patch h8300-add-zimage-support.patch round_up-macro-cleanup-in-arch-alpha-kernel-osf_sysc.patch alpha-fix-bootp-image-creation.patch alpha-prctl-macros.patch srmcons-fix-kmallocgfp_kernel-inside-spinlock.patch arm26-remove-useless-config-option-generic_bust_spinlock.patch fix-refrigerator-vs-thaw_process-race.patch swsusp-use-inline-functions-for-changing-page-flags.patch swsusp-do-not-use-page-flags.patch mm-remove-unused-page-flags.patch swsusp-fix-error-paths-in-snapshot_open.patch swsusp-use-gfp_kernel-for-creating-basic-data-structures.patch freezer-remove-pf_nofreeze-from-handle_initrd.patch swsusp-use-rbtree-for-tracking-allocated-swap.patch freezer-fix-racy-usage-of-try_to_freeze-in-kswapd.patch remove-software_suspend.patch power-management-change-sys-power-disk-display.patch kconfig-mentioneds-hibernation-not-just-swsusp.patch swsusp-fix-snapshot_release.patch swsusp-free-more-memory.patch remove-unused-header-file-arch-m68k-atari-atasoundh.patch spin_lock_unlocked-cleanup-in-arch-m68k.patch remove-unused-header-file-drivers-serial-crisv10h.patch cris-check-for-memory-allocation.patch cris-remove-code-related-to-pre-22-kernel.patch uml-delete-unused-code.patch uml-formatting-fixes.patch uml-host_info-tidying.patch uml-mark-tt-mode-code-for-future-removal.patch uml-print-coredump-limits.patch uml-handle-block-device-hotplug-errors.patch uml-driver-formatting-fixes.patch uml-driver-formatting-fixes-fix.patch uml-network-interface-hotplug-error-handling.patch array_size-check-for-type.patch uml-move-sigio-testing-to-sigioc.patch uml-create-archh.patch uml-create-as-layouth.patch uml-move-remaining-useful-contents-of-user_utilh.patch uml-remove-user_utilh.patch uml-add-missing-__init-declarations.patch remove-unused-header-file-arch-um-kernel-tt-include-mode_kern-tth.patch uml-improve-checking-and-diagnostics-of-ethernet-macs.patch uml-eliminate-temporary-buffer-in-eth_configure.patch uml-replace-one-element-array-with-zero-element-array.patch uml-fix-umid-in-xterm-titles.patch uml-speed-up-exec.patch uml-no-locking-needed-in-tlsc.patch uml-tidy-processc.patch uml-remove-page_size.patch uml-kernel_thread-shouldnt-panic.patch uml-tidy-fault-code.patch uml-kernel-segfaults-should-dump-proper-registers.patch uml-comment-early-boot-locking.patch uml-irq-locking-commentary.patch uml-delete-host_frame_size.patch uml-drivers-get-release-methods.patch uml-dump-registers-on-ptrace-or-wait-failure.patch uml-speed-up-page-table-walking.patch uml-remove-unused-x86_64-code.patch uml-start-fixing-os_read_file-and-os_write_file.patch uml-tidy-libc-code.patch uml-convert-libc-layer-to-call-read-and-write.patch uml-batch-i-o-requests.patch uml-send-pointers-instead-of-structures-to-i-o-thread.patch uml-send-pointers-instead-of-structures-to-i-o-thread-fix.patch uml-dump-core-on-panic.patch uml-dont-try-to-handle-signals-on-initial-process-stack.patch uml-change-remaining-callers-of-os_read_write_file.patch uml-formatting-fixes-around-os_read_write_file-callers.patch uml-remove-debugging-remnants.patch uml-rename-os_read_write_file_k-back-to-os_read_write_file.patch uml-aio-deadlock-avoidance.patch uml-speed-page-fault-path.patch uml-eliminate-a-piece-of-debugging-code.patch uml-more-page-fault-path-trimming.patch uml-only-flush-areas-covered-by-vma.patch uml-out-of-tmpfs-space-error-clarification.patch uml-virtualized-time-fix.patch uml-fix-prototypes.patch v850-generic-timekeeping-conversion.patch xtensa-strlcpy-is-smart-enough.patch -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2007-05-02 22:02 incoming Andrew Morton @ 2007-05-02 22:31 ` Benjamin Herrenschmidt 2007-05-03 7:55 ` incoming Russell King 2007-05-04 13:37 ` incoming Greg KH 2 siblings, 0 replies; 322+ messages in thread From: Benjamin Herrenschmidt @ 2007-05-02 22:31 UTC (permalink / raw) To: Andrew Morton Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, linux-kernel, linux-mm On Wed, 2007-05-02 at 15:02 -0700, Andrew Morton wrote: > So this is what I have lined up for the first mm->2.6.22 batch. I won't be > sending it off for another 12-24 hours yet. To give people time for final > comment and to give me time to see if it actually works. Thanks. I have some powerpc bits that depend on that stuff that will go through Paulus after these show up in git and I've rebased. Cheers, Ben. -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2007-05-02 22:02 incoming Andrew Morton 2007-05-02 22:31 ` incoming Benjamin Herrenschmidt @ 2007-05-03 7:55 ` Russell King 2007-05-03 8:05 ` incoming Andrew Morton 2007-05-04 13:37 ` incoming Greg KH 2 siblings, 1 reply; 322+ messages in thread From: Russell King @ 2007-05-03 7:55 UTC (permalink / raw) To: Andrew Morton Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote: > So this is what I have lined up for the first mm->2.6.22 batch. I won't be > sending it off for another 12-24 hours yet. To give people time for final > comment and to give me time to see if it actually works. I assume you're going to update this list with my comments I sent yesterday? -- Russell King Linux kernel 2.6 ARM Linux - http://www.arm.linux.org.uk/ maintainer of: -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2007-05-03 7:55 ` incoming Russell King @ 2007-05-03 8:05 ` Andrew Morton 0 siblings, 0 replies; 322+ messages in thread From: Andrew Morton @ 2007-05-03 8:05 UTC (permalink / raw) To: Russell King Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm On Thu, 3 May 2007 08:55:43 +0100 Russell King <rmk+lkml@arm.linux.org.uk> wrote: > On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote: > > So this is what I have lined up for the first mm->2.6.22 batch. I won't be > > sending it off for another 12-24 hours yet. To give people time for final > > comment and to give me time to see if it actually works. > > I assume you're going to update this list with my comments I sent > yesterday? > Serial drivers? Well you saw me drop a bunch of them. I now have: serial-driver-pmc-msp71xx.patch rm9000-serial-driver.patch serial-define-fixed_port-flag-for-serial_core.patch mpsc-serial-driver-tx-locking.patch serial-serial_core-use-pr_debug.patch I'll also be holding off on MADV_FREE - Nick has some performance things to share and I'm assuming they're not as good as he'd like. -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2007-05-02 22:02 incoming Andrew Morton 2007-05-02 22:31 ` incoming Benjamin Herrenschmidt 2007-05-03 7:55 ` incoming Russell King @ 2007-05-04 13:37 ` Greg KH 2007-05-04 16:14 ` incoming Andrew Morton 2 siblings, 1 reply; 322+ messages in thread From: Greg KH @ 2007-05-04 13:37 UTC (permalink / raw) To: Andrew Morton Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote: > - One little security patch Care to cc: linux-stable with it so we can do a new 2.6.21 release with it if needed? thanks, greg k-h -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2007-05-04 13:37 ` incoming Greg KH @ 2007-05-04 16:14 ` Andrew Morton 2007-05-04 17:02 ` incoming Greg KH 2007-05-04 18:57 ` incoming Roland McGrath 0 siblings, 2 replies; 322+ messages in thread From: Andrew Morton @ 2007-05-04 16:14 UTC (permalink / raw) To: Greg KH Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm, Roland McGrath, Stephen Smalley On Fri, 4 May 2007 06:37:28 -0700 Greg KH <greg@kroah.com> wrote: > On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote: > > - One little security patch > > Care to cc: linux-stable with it so we can do a new 2.6.21 release with > it if needed? > Ah. The patch affects security code, but it doesn't actually address any insecurity. I didn't think it was needed for -stable? From: Roland McGrath <roland@redhat.com> wait* syscalls return -ECHILD even when an individual PID of a live child was requested explicitly, when security_task_wait denies the operation. This means that something like a broken SELinux policy can produce an unexpected failure that looks just like a bug with wait or ptrace or something. This patch makes do_wait return -EACCES (or other appropriate error returned from security_task_wait() instead of -ECHILD if some children were ruled out solely because security_task_wait failed. [jmorris@namei.org: switch error code to EACCES] Signed-off-by: Roland McGrath <roland@redhat.com> Cc: Stephen Smalley <sds@tycho.nsa.gov> Cc: Chris Wright <chrisw@sous-sol.org> Cc: James Morris <jmorris@namei.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- kernel/exit.c | 17 +++++++++++++++-- 1 files changed, 15 insertions(+), 2 deletions(-) diff -puN kernel/exit.c~return-eperm-not-echild-on-security_task_wait-failure kernel/exit.c --- a/kernel/exit.c~return-eperm-not-echild-on-security_task_wait-failure +++ a/kernel/exit.c @@ -1033,6 +1033,8 @@ asmlinkage void sys_exit_group(int error static int eligible_child(pid_t pid, int options, struct task_struct *p) { + int err; + if (pid > 0) { if (p->pid != pid) return 0; @@ -1066,8 +1068,9 @@ static int eligible_child(pid_t pid, int if (delay_group_leader(p)) return 2; - if (security_task_wait(p)) - return 0; + err = security_task_wait(p); + if (err) + return err; return 1; } @@ -1449,6 +1452,7 @@ static long do_wait(pid_t pid, int optio DECLARE_WAITQUEUE(wait, current); struct task_struct *tsk; int flag, retval; + int allowed, denied; add_wait_queue(¤t->signal->wait_chldexit,&wait); repeat: @@ -1457,6 +1461,7 @@ repeat: * match our criteria, even if we are not able to reap it yet. */ flag = 0; + allowed = denied = 0; current->state = TASK_INTERRUPTIBLE; read_lock(&tasklist_lock); tsk = current; @@ -1472,6 +1477,12 @@ repeat: if (!ret) continue; + if (unlikely(ret < 0)) { + denied = ret; + continue; + } + allowed = 1; + switch (p->state) { case TASK_TRACED: /* @@ -1570,6 +1581,8 @@ check_continued: goto repeat; } retval = -ECHILD; + if (unlikely(denied) && !allowed) + retval = denied; end: current->state = TASK_RUNNING; remove_wait_queue(¤t->signal->wait_chldexit,&wait); _ -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2007-05-04 16:14 ` incoming Andrew Morton @ 2007-05-04 17:02 ` Greg KH 2007-05-04 18:57 ` incoming Roland McGrath 1 sibling, 0 replies; 322+ messages in thread From: Greg KH @ 2007-05-04 17:02 UTC (permalink / raw) To: Andrew Morton Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm, Roland McGrath, Stephen Smalley On Fri, May 04, 2007 at 09:14:34AM -0700, Andrew Morton wrote: > On Fri, 4 May 2007 06:37:28 -0700 Greg KH <greg@kroah.com> wrote: > > > On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote: > > > - One little security patch > > > > Care to cc: linux-stable with it so we can do a new 2.6.21 release with > > it if needed? > > > > Ah. The patch affects security code, but it doesn't actually address any > insecurity. I didn't think it was needed for -stable? Ah, ok, I read "security" as fixing a insecure problem, my mistake :) thanks, greg k-h -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2007-05-04 16:14 ` incoming Andrew Morton 2007-05-04 17:02 ` incoming Greg KH @ 2007-05-04 18:57 ` Roland McGrath 2007-05-04 19:24 ` incoming Greg KH 1 sibling, 1 reply; 322+ messages in thread From: Roland McGrath @ 2007-05-04 18:57 UTC (permalink / raw) To: Andrew Morton Cc: Greg KH, Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm, Stephen Smalley > Ah. The patch affects security code, but it doesn't actually address any > insecurity. I didn't think it was needed for -stable? I would not recommend it for -stable. It is an ABI change for the case of a security refusal. Thanks, Roland -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2007-05-04 18:57 ` incoming Roland McGrath @ 2007-05-04 19:24 ` Greg KH 2007-05-04 19:29 ` incoming Roland McGrath 0 siblings, 1 reply; 322+ messages in thread From: Greg KH @ 2007-05-04 19:24 UTC (permalink / raw) To: Roland McGrath Cc: Andrew Morton, Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm, Stephen Smalley On Fri, May 04, 2007 at 11:57:21AM -0700, Roland McGrath wrote: > > Ah. The patch affects security code, but it doesn't actually address any > > insecurity. I didn't think it was needed for -stable? > > I would not recommend it for -stable. > It is an ABI change for the case of a security refusal. ABI changes are not a problem for -stable, so don't let that stop anyone :) thanks, greg k-h -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 322+ messages in thread
* Re: incoming 2007-05-04 19:24 ` incoming Greg KH @ 2007-05-04 19:29 ` Roland McGrath 0 siblings, 0 replies; 322+ messages in thread From: Roland McGrath @ 2007-05-04 19:29 UTC (permalink / raw) To: Greg KH Cc: Andrew Morton, Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm, Stephen Smalley > ABI changes are not a problem for -stable, so don't let that stop anyone > :) In fact this is the harmless sort (changes only the error code of a failure case) that might actually go in if there were any important reason. But the smiley stands. Thanks, Roland -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 322+ messages in thread
end of thread, other threads:[~2022-04-27 19:41 UTC | newest] Thread overview: 322+ messages (download: mbox.gz follow: Atom feed -- links below jump to the message on this page -- 2022-03-25 1:07 incoming Andrew Morton 2022-03-25 1:08 ` [patch 001/114] tools/vm/page_owner_sort.c: sort by stacktrace before culling Andrew Morton 2022-03-25 1:08 ` [patch 002/114] tools/vm/page_owner_sort.c: support sorting by stack trace Andrew Morton 2022-03-25 1:08 ` [patch 003/114] tools/vm/page_owner_sort.c: add switch between culling by stacktrace and txt Andrew Morton 2022-03-25 1:08 ` [patch 004/114] tools/vm/page_owner_sort.c: support sorting pid and time Andrew Morton 2022-03-25 1:08 ` [patch 005/114] tools/vm/page_owner_sort.c: two trivial fixes Andrew Morton 2022-03-25 1:08 ` [patch 006/114] tools/vm/page_owner_sort.c: delete invalid duplicate code Andrew Morton 2022-03-25 1:08 ` [patch 007/114] Documentation/vm/page_owner.rst: update the documentation Andrew Morton 2022-03-25 1:08 ` [patch 008/114] Documentation/vm/page_owner.rst: fix unexpected indentation warns Andrew Morton 2022-03-25 1:09 ` [patch 009/114] lib/vsprintf: avoid redundant work with 0 size Andrew Morton 2022-03-25 1:09 ` [patch 010/114] mm/page_owner: use scnprintf() to avoid excessive buffer overrun check Andrew Morton 2022-03-25 1:09 ` [patch 011/114] mm/page_owner: print memcg information Andrew Morton 2022-03-25 1:09 ` [patch 012/114] mm/page_owner: record task command name Andrew Morton 2022-03-25 1:09 ` [patch 013/114] mm/page_owner.c: record tgid Andrew Morton 2022-03-25 1:09 ` [patch 014/114] tools/vm/page_owner_sort.c: fix the instructions for use Andrew Morton 2022-03-25 1:09 ` [patch 015/114] tools/vm/page_owner_sort.c: fix comments Andrew Morton 2022-03-25 1:09 ` [patch 016/114] tools/vm/page_owner_sort.c: add a security check Andrew Morton 2022-03-25 1:09 ` [patch 017/114] tools/vm/page_owner_sort.c: support sorting by tgid and update documentation Andrew Morton 2022-03-25 1:09 ` [patch 018/114] tools/vm/page_owner_sort: fix three trivival places Andrew Morton 2022-03-25 1:09 ` [patch 019/114] tools/vm/page_owner_sort: support for sorting by task command name Andrew Morton 2022-03-25 1:09 ` [patch 020/114] tools/vm/page_owner_sort.c: support for selecting by PID, TGID or " Andrew Morton 2022-03-25 1:09 ` [patch 021/114] tools/vm/page_owner_sort.c: support for user-defined culling rules Andrew Morton 2022-03-25 1:09 ` [patch 022/114] mm: unexport page_init_poison Andrew Morton 2022-03-25 1:09 ` [patch 023/114] selftest/vm: add util.h and and move helper functions there Andrew Morton 2022-03-25 1:09 ` [patch 024/114] selftest/vm: add helpers to detect PAGE_SIZE and PAGE_SHIFT Andrew Morton 2022-03-25 1:09 ` [patch 025/114] mm: delete __ClearPageWaiters() Andrew Morton 2022-03-25 1:09 ` [patch 026/114] mm: filemap_unaccount_folio() large skip mapcount fixup Andrew Morton 2022-03-25 1:09 ` [patch 027/114] mm/thp: fix NR_FILE_MAPPED accounting in page_*_file_rmap() Andrew Morton 2022-03-25 1:09 ` [patch 028/114] mm/migration: add trace events for THP migrations Andrew Morton 2022-03-25 1:10 ` [patch 029/114] mm/migration: add trace events for base page and HugeTLB migrations Andrew Morton 2022-03-25 1:10 ` [patch 030/114] kasan, page_alloc: deduplicate should_skip_kasan_poison Andrew Morton 2022-03-25 1:10 ` [patch 031/114] kasan, page_alloc: move tag_clear_highpage out of kernel_init_free_pages Andrew Morton 2022-03-25 1:10 ` [patch 032/114] kasan, page_alloc: merge kasan_free_pages into free_pages_prepare Andrew Morton 2022-03-25 1:10 ` [patch 033/114] kasan, page_alloc: simplify kasan_poison_pages call site Andrew Morton 2022-03-25 1:10 ` [patch 034/114] kasan, page_alloc: init memory of skipped pages on free Andrew Morton 2022-03-25 1:10 ` [patch 035/114] kasan: drop skip_kasan_poison variable in free_pages_prepare Andrew Morton 2022-03-25 1:10 ` [patch 036/114] mm: clarify __GFP_ZEROTAGS comment Andrew Morton 2022-03-25 1:10 ` [patch 037/114] kasan: only apply __GFP_ZEROTAGS when memory is zeroed Andrew Morton 2022-03-25 1:10 ` [patch 038/114] kasan, page_alloc: refactor init checks in post_alloc_hook Andrew Morton 2022-03-25 1:10 ` [patch 039/114] kasan, page_alloc: merge kasan_alloc_pages into post_alloc_hook Andrew Morton 2022-03-25 1:10 ` [patch 040/114] kasan, page_alloc: combine tag_clear_highpage calls in post_alloc_hook Andrew Morton 2022-03-25 1:10 ` [patch 041/114] kasan, page_alloc: move SetPageSkipKASanPoison " Andrew Morton 2022-03-25 1:10 ` [patch 042/114] kasan, page_alloc: move kernel_init_free_pages " Andrew Morton 2022-03-25 1:10 ` [patch 043/114] kasan, page_alloc: rework kasan_unpoison_pages call site Andrew Morton 2022-03-25 1:10 ` [patch 044/114] kasan: clean up metadata byte definitions Andrew Morton 2022-03-25 1:10 ` [patch 045/114] kasan: define KASAN_VMALLOC_INVALID for SW_TAGS Andrew Morton 2022-03-25 1:10 ` [patch 046/114] kasan, x86, arm64, s390: rename functions for modules shadow Andrew Morton 2022-03-25 1:10 ` [patch 047/114] kasan, vmalloc: drop outdated VM_KASAN comment Andrew Morton 2022-03-25 1:10 ` [patch 048/114] kasan: reorder vmalloc hooks Andrew Morton 2022-03-25 1:11 ` [patch 049/114] kasan: add wrappers for " Andrew Morton 2022-03-25 1:11 ` [patch 050/114] kasan, vmalloc: reset tags in vmalloc functions Andrew Morton 2022-03-25 1:11 ` [patch 051/114] kasan, fork: reset pointer tags of vmapped stacks Andrew Morton 2022-03-25 1:11 ` [patch 052/114] kasan, arm64: " Andrew Morton 2022-03-25 1:11 ` [patch 053/114] kasan, vmalloc: add vmalloc tagging for SW_TAGS Andrew Morton 2022-03-25 1:11 ` [patch 054/114] kasan, vmalloc, arm64: mark vmalloc mappings as pgprot_tagged Andrew Morton 2022-03-25 1:11 ` [patch 055/114] kasan, vmalloc: unpoison VM_ALLOC pages after mapping Andrew Morton 2022-03-25 1:11 ` [patch 056/114] kasan, mm: only define ___GFP_SKIP_KASAN_POISON with HW_TAGS Andrew Morton 2022-03-25 1:11 ` [patch 057/114] kasan, page_alloc: allow skipping unpoisoning for HW_TAGS Andrew Morton 2022-03-25 1:11 ` [patch 058/114] kasan, page_alloc: allow skipping memory init " Andrew Morton 2022-03-25 1:11 ` [patch 059/114] kasan, vmalloc: add vmalloc tagging " Andrew Morton 2022-03-25 1:11 ` [patch 060/114] kasan, vmalloc: only tag normal vmalloc allocations Andrew Morton 2022-03-25 1:11 ` [patch 061/114] kasan, arm64: don't tag executable " Andrew Morton 2022-03-25 1:11 ` [patch 062/114] kasan: mark kasan_arg_stacktrace as __initdata Andrew Morton 2022-03-25 1:11 ` [patch 063/114] kasan: clean up feature flags for HW_TAGS mode Andrew Morton 2022-03-25 1:11 ` [patch 064/114] kasan: add kasan.vmalloc command line flag Andrew Morton 2022-03-25 1:11 ` [patch 065/114] kasan: allow enabling KASAN_VMALLOC and SW/HW_TAGS Andrew Morton 2022-03-25 1:11 ` [patch 066/114] arm64: select KASAN_VMALLOC for SW/HW_TAGS modes Andrew Morton 2022-03-25 1:11 ` [patch 067/114] kasan: documentation updates Andrew Morton 2022-03-25 1:11 ` [patch 068/114] kasan: improve vmalloc tests Andrew Morton 2022-03-25 1:12 ` [patch 069/114] kasan: test: support async (again) and asymm modes for HW_TAGS Andrew Morton 2022-03-25 1:12 ` [patch 070/114] mm/kasan: remove unnecessary CONFIG_KASAN option Andrew Morton 2022-03-25 1:12 ` [patch 071/114] kasan: update function name in comments Andrew Morton 2022-03-25 1:12 ` [patch 072/114] kasan: print virtual mapping info in reports Andrew Morton 2022-03-25 1:12 ` [patch 073/114] kasan: drop addr check from describe_object_addr Andrew Morton 2022-03-25 1:12 ` [patch 074/114] kasan: more line breaks in reports Andrew Morton 2022-03-25 1:12 ` [patch 075/114] kasan: rearrange stack frame info " Andrew Morton 2022-03-25 1:12 ` [patch 076/114] kasan: improve " Andrew Morton 2022-03-25 1:12 ` [patch 077/114] kasan: print basic stack frame info for SW_TAGS Andrew Morton 2022-03-25 1:12 ` [patch 078/114] kasan: simplify async check in end_report() Andrew Morton 2022-03-25 1:12 ` [patch 079/114] kasan: simplify kasan_update_kunit_status() and call sites Andrew Morton 2022-03-25 1:12 ` [patch 080/114] kasan: check CONFIG_KASAN_KUNIT_TEST instead of CONFIG_KUNIT Andrew Morton 2022-03-25 1:12 ` [patch 081/114] kasan: move update_kunit_status to start_report Andrew Morton 2022-03-25 1:12 ` [patch 082/114] kasan: move disable_trace_on_warning " Andrew Morton 2022-03-25 1:12 ` [patch 083/114] kasan: split out print_report from __kasan_report Andrew Morton 2022-03-25 1:12 ` [patch 084/114] kasan: simplify kasan_find_first_bad_addr call sites Andrew Morton 2022-03-25 1:12 ` [patch 085/114] kasan: restructure kasan_report Andrew Morton 2022-03-25 1:12 ` [patch 086/114] kasan: merge __kasan_report into kasan_report Andrew Morton 2022-03-25 1:12 ` [patch 087/114] kasan: call print_report from kasan_report_invalid_free Andrew Morton 2022-03-25 1:12 ` [patch 088/114] kasan: move and simplify kasan_report_async Andrew Morton 2022-03-25 1:13 ` [patch 089/114] kasan: rename kasan_access_info to kasan_report_info Andrew Morton 2022-03-25 1:13 ` [patch 090/114] kasan: add comment about UACCESS regions to kasan_report Andrew Morton 2022-03-25 1:13 ` [patch 091/114] kasan: respect KASAN_BIT_REPORTED in all reporting routines Andrew Morton 2022-03-25 1:13 ` [patch 092/114] kasan: reorder reporting functions Andrew Morton 2022-03-25 1:13 ` [patch 093/114] kasan: move and hide kasan_save_enable/restore_multi_shot Andrew Morton 2022-03-25 1:13 ` [patch 094/114] kasan: disable LOCKDEP when printing reports Andrew Morton 2022-03-25 1:13 ` [patch 095/114] mm: enable MADV_DONTNEED for hugetlb mappings Andrew Morton 2022-03-25 1:13 ` [patch 096/114] selftests/vm: add hugetlb madvise MADV_DONTNEED MADV_REMOVE test Andrew Morton 2022-03-25 1:13 ` [patch 097/114] userfaultfd/selftests: enable hugetlb remap and remove event testing Andrew Morton 2022-03-25 1:13 ` [patch 098/114] mm/huge_memory: make is_transparent_hugepage() static Andrew Morton 2022-03-25 1:13 ` [patch 099/114] mm: optimize do_wp_page() for exclusive pages in the swapcache Andrew Morton 2022-03-25 1:13 ` [patch 100/114] mm: optimize do_wp_page() for fresh pages in local LRU pagevecs Andrew Morton 2022-03-25 1:13 ` [patch 101/114] mm: slightly clarify KSM logic in do_swap_page() Andrew Morton 2022-03-25 1:13 ` [patch 102/114] mm: streamline COW " Andrew Morton 2022-03-25 1:13 ` [patch 103/114] mm/huge_memory: streamline COW logic in do_huge_pmd_wp_page() Andrew Morton 2022-03-25 1:13 ` [patch 104/114] mm/khugepaged: remove reuse_swap_page() usage Andrew Morton 2022-03-25 1:13 ` [patch 105/114] mm/swapfile: remove stale reuse_swap_page() Andrew Morton 2022-03-25 1:13 ` [patch 106/114] mm/huge_memory: remove stale page_trans_huge_mapcount() Andrew Morton 2022-03-25 1:13 ` [patch 107/114] mm/huge_memory: remove stale locking logic from __split_huge_pmd() Andrew Morton 2022-03-25 1:13 ` [patch 108/114] mm: warn on deleting redirtied only if accounted Andrew Morton 2022-03-25 1:14 ` [patch 109/114] mm: unmap_mapping_range_tree() with i_mmap_rwsem shared Andrew Morton 2022-03-25 1:14 ` [patch 111/114] mm: fix race between MADV_FREE reclaim and blkdev direct IO read Andrew Morton 2022-03-25 1:14 ` [patch 112/114] mm: madvise: MADV_DONTNEED_LOCKED Andrew Morton 2022-03-25 1:14 ` [patch 113/114] selftests: vm: remove dependecy from internal kernel macros Andrew Morton 2022-03-25 1:56 ` Linus Torvalds 2022-03-25 1:14 ` [patch 114/114] selftests: kselftest framework: provide "finished" helper Andrew Morton -- strict thread matches above, loose matches on Subject: below -- 2022-04-27 19:41 incoming Andrew Morton 2022-04-21 23:35 incoming Andrew Morton 2022-04-15 2:12 incoming Andrew Morton 2022-04-08 20:08 incoming Andrew Morton 2022-04-01 18:27 incoming Andrew Morton 2022-04-01 18:20 incoming Andrew Morton 2022-04-01 18:27 ` incoming Andrew Morton 2022-03-23 23:04 incoming Andrew Morton 2022-03-22 21:38 incoming Andrew Morton 2022-03-16 23:14 incoming Andrew Morton 2022-03-05 4:28 incoming Andrew Morton 2022-02-26 3:10 incoming Andrew Morton 2022-02-12 0:27 incoming Andrew Morton 2022-02-12 2:02 ` incoming Linus Torvalds 2022-02-12 5:24 ` incoming Andrew Morton 2022-02-04 4:48 incoming Andrew Morton 2022-01-29 21:40 incoming Andrew Morton 2022-01-29 2:13 incoming Andrew Morton 2022-01-29 4:25 ` incoming Matthew Wilcox 2022-01-29 6:23 ` incoming Andrew Morton 2022-01-22 6:10 incoming Andrew Morton 2022-01-20 2:07 incoming Andrew Morton 2022-01-14 22:02 incoming Andrew Morton 2021-12-31 4:12 incoming Andrew Morton 2021-12-25 5:11 incoming Andrew Morton 2021-12-10 22:45 incoming Andrew Morton 2021-11-20 0:42 incoming Andrew Morton 2021-11-11 4:32 incoming Andrew Morton 2021-11-09 2:30 incoming Andrew Morton 2021-11-05 20:34 incoming Andrew Morton 2021-10-28 21:35 incoming Andrew Morton 2021-10-18 22:14 incoming Andrew Morton 2021-09-24 22:42 incoming Andrew Morton 2021-09-10 3:09 incoming Andrew Morton 2021-09-10 17:11 ` incoming Kees Cook 2021-09-10 20:13 ` incoming Kees Cook 2021-09-09 1:08 incoming Andrew Morton 2021-09-08 22:17 incoming Andrew Morton 2021-09-08 2:52 incoming Andrew Morton 2021-09-08 8:57 ` incoming Vlastimil Babka 2021-09-02 21:48 incoming Andrew Morton 2021-09-02 21:49 ` incoming Andrew Morton 2021-08-25 19:17 incoming Andrew Morton 2021-08-20 2:03 incoming Andrew Morton 2021-08-13 23:53 incoming Andrew Morton 2021-07-29 21:52 incoming Andrew Morton 2021-07-23 22:49 incoming Andrew Morton 2021-07-15 4:26 incoming Andrew Morton 2021-07-08 0:59 incoming Andrew Morton 2021-07-01 1:46 incoming Andrew Morton 2021-07-03 0:28 ` incoming Linus Torvalds 2021-07-03 1:06 ` incoming Linus Torvalds 2021-06-29 2:32 incoming Andrew Morton 2021-06-25 1:38 incoming Andrew Morton 2021-06-16 1:22 incoming Andrew Morton 2021-06-05 3:00 incoming Andrew Morton 2021-05-23 0:41 incoming Andrew Morton 2021-05-15 0:26 incoming Andrew Morton 2021-05-07 1:01 incoming Andrew Morton 2021-05-07 7:12 ` incoming Linus Torvalds 2021-05-05 1:32 incoming Andrew Morton 2021-05-05 1:47 ` incoming Linus Torvalds 2021-05-05 3:16 ` incoming Andrew Morton 2021-05-05 17:10 ` incoming Linus Torvalds 2021-05-05 17:44 ` incoming Andrew Morton 2021-05-06 3:19 ` incoming Anshuman Khandual 2021-04-30 5:52 incoming Andrew Morton 2021-04-23 21:28 incoming Andrew Morton 2021-04-16 22:45 incoming Andrew Morton 2021-04-09 20:26 incoming Andrew Morton 2021-03-25 4:36 incoming Andrew Morton 2021-03-13 5:06 incoming Andrew Morton 2021-02-26 1:14 incoming Andrew Morton 2021-02-26 17:55 ` incoming Linus Torvalds 2021-02-26 19:16 ` incoming Andrew Morton 2021-02-24 19:58 incoming Andrew Morton 2021-02-24 21:30 ` incoming Linus Torvalds 2021-02-24 21:37 ` incoming Linus Torvalds 2021-02-25 8:53 ` incoming Arnd Bergmann 2021-02-25 9:12 ` incoming Andrey Ryabinin 2021-02-25 11:07 ` incoming Walter Wu 2021-02-13 4:52 incoming Andrew Morton 2021-02-09 21:41 incoming Andrew Morton 2021-02-10 19:30 ` incoming Linus Torvalds 2021-02-05 2:31 incoming Andrew Morton 2021-01-24 5:00 incoming Andrew Morton 2021-01-12 23:48 incoming Andrew Morton 2021-01-15 23:32 ` incoming Linus Torvalds 2020-12-29 23:13 incoming Andrew Morton 2020-12-22 19:58 incoming Andrew Morton 2020-12-22 21:43 ` incoming Linus Torvalds 2020-12-18 22:00 incoming Andrew Morton 2020-12-16 4:41 incoming Andrew Morton 2020-12-15 20:32 incoming Andrew Morton 2020-12-15 21:00 ` incoming Linus Torvalds 2020-12-15 22:48 ` incoming Linus Torvalds 2020-12-15 22:49 ` incoming Linus Torvalds 2020-12-15 22:55 ` incoming Andrew Morton 2020-12-15 3:02 incoming Andrew Morton 2020-12-15 3:25 ` incoming Linus Torvalds 2020-12-15 3:30 ` incoming Linus Torvalds 2020-12-15 14:04 ` incoming Konstantin Ryabitsev 2020-12-11 21:35 incoming Andrew Morton 2020-12-06 6:14 incoming Andrew Morton 2020-11-22 6:16 incoming Andrew Morton 2020-11-14 6:51 incoming Andrew Morton 2020-11-02 1:06 incoming Andrew Morton 2020-10-17 23:13 incoming Andrew Morton 2020-10-16 2:40 incoming Andrew Morton 2020-10-16 3:03 ` incoming Andrew Morton 2020-10-13 23:46 incoming Andrew Morton 2020-10-11 6:15 incoming Andrew Morton 2020-10-03 5:20 incoming Andrew Morton 2020-09-26 4:17 incoming Andrew Morton 2020-09-19 4:19 incoming Andrew Morton 2020-09-04 23:34 incoming Andrew Morton 2020-08-21 0:41 incoming Andrew Morton 2020-08-15 0:29 incoming Andrew Morton 2020-08-12 1:29 incoming Andrew Morton 2020-08-07 6:16 incoming Andrew Morton 2020-07-24 4:14 incoming Andrew Morton 2020-07-03 22:14 incoming Andrew Morton 2020-06-26 3:28 incoming Andrew Morton 2020-06-26 6:51 ` incoming Linus Torvalds 2020-06-26 7:31 ` incoming Linus Torvalds 2020-06-26 17:39 ` incoming Konstantin Ryabitsev 2020-06-26 17:40 ` incoming Konstantin Ryabitsev 2020-06-12 0:30 incoming Andrew Morton 2020-06-11 1:40 incoming Andrew Morton 2020-06-09 4:29 incoming Andrew Morton 2020-06-09 16:58 ` incoming Linus Torvalds 2020-06-08 4:35 incoming Andrew Morton 2020-06-04 23:45 incoming Andrew Morton 2020-06-03 22:55 incoming Andrew Morton 2020-06-02 20:09 incoming Andrew Morton 2020-06-02 4:44 incoming Andrew Morton 2020-06-02 20:08 ` incoming Andrew Morton 2020-06-02 20:45 ` incoming Linus Torvalds 2020-06-02 21:38 ` incoming Andrew Morton 2020-06-02 22:18 ` incoming Linus Torvalds 2020-05-28 5:20 incoming Andrew Morton 2020-05-28 20:10 ` incoming Linus Torvalds 2020-05-29 20:31 ` incoming Andrew Morton 2020-05-29 20:38 ` incoming Linus Torvalds 2020-05-29 21:12 ` incoming Andrew Morton 2020-05-29 21:20 ` incoming Linus Torvalds 2020-05-23 5:22 incoming Andrew Morton 2020-05-14 0:50 incoming Andrew Morton 2020-05-08 1:35 incoming Andrew Morton 2020-04-21 1:13 incoming Andrew Morton 2020-04-12 7:41 incoming Andrew Morton 2020-04-10 21:30 incoming Andrew Morton 2020-04-07 3:02 incoming Andrew Morton 2020-04-02 4:01 incoming Andrew Morton 2020-03-29 2:14 incoming Andrew Morton 2020-03-22 1:19 incoming Andrew Morton 2020-03-06 6:27 incoming Andrew Morton 2020-02-21 4:00 incoming Andrew Morton 2020-02-21 4:03 ` incoming Andrew Morton 2020-02-21 18:21 ` incoming Linus Torvalds 2020-02-21 18:32 ` incoming Konstantin Ryabitsev 2020-02-27 9:59 ` incoming Vlastimil Babka 2020-02-21 19:33 ` incoming Linus Torvalds 2020-02-04 1:33 incoming Andrew Morton 2020-02-04 2:27 ` incoming Linus Torvalds 2020-02-04 2:46 ` incoming Andrew Morton 2020-02-04 3:11 ` incoming Linus Torvalds 2020-01-31 6:10 incoming Andrew Morton 2020-01-14 0:28 incoming Andrew Morton 2020-01-04 20:55 incoming Andrew Morton 2019-12-18 4:50 incoming Andrew Morton 2019-12-05 0:48 incoming Andrew Morton 2019-12-01 1:47 incoming Andrew Morton 2019-12-01 5:17 ` incoming James Bottomley 2019-12-01 21:07 ` incoming Linus Torvalds 2019-12-02 8:21 ` incoming Steven Price 2019-11-22 1:53 incoming Andrew Morton 2019-11-16 1:34 incoming Andrew Morton 2019-11-06 5:16 incoming Andrew Morton 2019-10-19 3:19 incoming Andrew Morton 2019-10-14 21:11 incoming Andrew Morton 2019-10-07 0:57 incoming Andrew Morton 2019-09-25 23:45 incoming Andrew Morton 2019-09-23 22:31 incoming Andrew Morton 2019-09-24 0:55 ` incoming Linus Torvalds 2019-09-24 4:31 ` incoming Andrew Morton 2019-09-24 7:48 ` incoming Michal Hocko 2019-09-24 15:34 ` incoming Linus Torvalds 2019-09-25 6:36 ` incoming Michal Hocko 2019-09-24 19:55 ` incoming Vlastimil Babka 2019-08-30 23:04 incoming Andrew Morton 2019-08-25 0:54 incoming Andrew Morton [not found] <20190716162536.bb52b8f34a8ecf5331a86a42@linux-foundation.org> 2019-07-17 8:47 ` incoming Vlastimil Babka 2019-07-17 8:57 ` incoming Bhaskar Chowdhury 2019-07-17 16:13 ` incoming Linus Torvalds 2019-07-17 17:09 ` incoming Christian Brauner 2019-07-17 18:13 ` incoming Vlastimil Babka 2007-05-02 22:02 incoming Andrew Morton 2007-05-02 22:31 ` incoming Benjamin Herrenschmidt 2007-05-03 7:55 ` incoming Russell King 2007-05-03 8:05 ` incoming Andrew Morton 2007-05-04 13:37 ` incoming Greg KH 2007-05-04 16:14 ` incoming Andrew Morton 2007-05-04 17:02 ` incoming Greg KH 2007-05-04 18:57 ` incoming Roland McGrath 2007-05-04 19:24 ` incoming Greg KH 2007-05-04 19:29 ` incoming Roland McGrath
This is a public inbox, see mirroring instructions for how to clone and mirror all data and code used for this inbox; as well as URLs for NNTP newsgroup(s).