From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id C2A43C001E0 for ; Thu, 10 Aug 2023 19:17:50 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S236311AbjHJTRt (ORCPT ); Thu, 10 Aug 2023 15:17:49 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:53862 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S236312AbjHJTRs (ORCPT ); Thu, 10 Aug 2023 15:17:48 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 2A9DE271E; Thu, 10 Aug 2023 12:17:48 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 956638716e953904; Thu, 10 Aug 2023 21:17:46 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 37BD2662742; Thu, 10 Aug 2023 21:17:46 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Srinivas Pandruvada , Zhang Rui , Daniel Lezcano Subject: [PATCH v1 4/7] thermal: intel: intel_soc_dts_iosf: Change initialization ordering Date: Thu, 10 Aug 2023 21:13:25 +0200 Message-ID: <13337847.uLZWGnKmhe@kreacher> In-Reply-To: <5713357.DvuYhMxLoT@kreacher> References: <5713357.DvuYhMxLoT@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrleeigddufeegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohephedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdp rhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhg X-DCC--Metrics: v370.home.net.pl 1024; Body=5 Fuz1=5 Fuz2=5 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki The initial configuration of trip points in intel_soc_dts_iosf_init() takes place after registering the sensor thermal zones which is potentially problematic, because it may race with the setting of trip point temperatures via sysfs, as there is no synchronization between it and sys_set_trip_temp(). To address this, change the initialization ordering so that the trip points are configured prior to the registration of thermal zones. Accordingly, change the cleanup ordering in intel_soc_dts_iosf_exit() to remove the thermal zones before resetting the trip points. Signed-off-by: Rafael J. Wysocki --- drivers/thermal/intel/intel_soc_dts_iosf.c | 25 ++++++++++++++++--------- 1 file changed, 16 insertions(+), 9 deletions(-) Index: linux-pm/drivers/thermal/intel/intel_soc_dts_iosf.c =================================================================== --- linux-pm.orig/drivers/thermal/intel/intel_soc_dts_iosf.c +++ linux-pm/drivers/thermal/intel/intel_soc_dts_iosf.c @@ -398,30 +398,37 @@ struct intel_soc_dts_sensors *intel_soc_ for (i = 0; i < SOC_MAX_DTS_SENSORS; ++i) { sensors->soc_dts[i].sensors = sensors; - ret = add_dts_thermal_zone(i, &sensors->soc_dts[i], - read_only_trip_count); - if (ret) - goto err_free; - } - for (i = 0; i < SOC_MAX_DTS_SENSORS; ++i) { ret = configure_trip(&sensors->soc_dts[i], 0, THERMAL_TRIP_PASSIVE, 0); if (ret) - goto err_remove_zone; + goto err_reset_trips; ret = configure_trip(&sensors->soc_dts[i], 1, THERMAL_TRIP_PASSIVE, 0); if (ret) + goto err_reset_trips; + } + + for (i = 0; i < SOC_MAX_DTS_SENSORS; ++i) { + ret = add_dts_thermal_zone(i, &sensors->soc_dts[i], + read_only_trip_count); + if (ret) goto err_remove_zone; } return sensors; + err_remove_zone: for (i = 0; i < SOC_MAX_DTS_SENSORS; ++i) remove_dts_thermal_zone(&sensors->soc_dts[i]); -err_free: +err_reset_trips: + for (i = 0; i < SOC_MAX_DTS_SENSORS; i++) { + configure_trip(&sensors->soc_dts[i], 0, 0, 0); + configure_trip(&sensors->soc_dts[i], 1, 0, 0); + } + kfree(sensors); return ERR_PTR(ret); } @@ -432,9 +439,9 @@ void intel_soc_dts_iosf_exit(struct inte int i; for (i = 0; i < SOC_MAX_DTS_SENSORS; ++i) { + remove_dts_thermal_zone(&sensors->soc_dts[i]); configure_trip(&sensors->soc_dts[i], 0, 0, 0); configure_trip(&sensors->soc_dts[i], 1, 0, 0); - remove_dts_thermal_zone(&sensors->soc_dts[i]); } kfree(sensors); }