From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id D477AEE3F13 for ; Tue, 12 Sep 2023 18:47:54 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S237515AbjILSr5 (ORCPT ); Tue, 12 Sep 2023 14:47:57 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:41220 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S237590AbjILSry (ORCPT ); Tue, 12 Sep 2023 14:47:54 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id DD9C21716; Tue, 12 Sep 2023 11:47:43 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 1f78031281b7904c; Tue, 12 Sep 2023 20:47:42 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id E0F5A663BE5; Tue, 12 Sep 2023 20:47:41 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v1 3/9] ACPI: thermal: Determine the number of trip points earlier Date: Tue, 12 Sep 2023 20:37:59 +0200 Message-ID: <1863318.tdWV9SEqCh@kreacher> In-Reply-To: <5708760.DvuYhMxLoT@kreacher> References: <5708760.DvuYhMxLoT@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudeiiedgudeftdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehs rhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Compute the number of trip points in acpi_thermal_add() so as to allow the driver's data structures to be simplified going forward. No intentional functional impact. Signed-off-by: Rafael J. Wysocki --- drivers/acpi/thermal.c | 60 +++++++++++++++++++++++-------------------------- 1 file changed, 29 insertions(+), 31 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -452,7 +452,7 @@ static void acpi_thermal_get_hot_trip(st static int acpi_thermal_get_trip_points(struct acpi_thermal *tz) { - bool valid; + unsigned int count = 0; int i; acpi_thermal_get_critical_trip(tz); @@ -460,18 +460,24 @@ static int acpi_thermal_get_trip_points( /* Passive and active trip points (optional). */ __acpi_thermal_trips_update(tz, ACPI_TRIPS_INIT); - valid = tz->trips.critical.valid | - tz->trips.hot.valid | - tz->trips.passive.trip.valid; - - for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) - valid = valid || tz->trips.active[i].trip.valid; - - if (!valid) { - pr_warn(FW_BUG "No valid trip found\n"); - return -ENODEV; + if (tz->trips.critical.valid) + count++; + + if (tz->trips.hot.valid) + count++; + + if (tz->trips.passive.trip.valid) + count++; + + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { + if (tz->trips.active[i].trip.valid) + count++; + else + break; + } - return 0; + + return count; } /* sys I/F for generic thermal sysfs support */ @@ -681,29 +687,15 @@ static void acpi_thermal_zone_sysfs_remo sysfs_remove_link(&tzdev->kobj, "device"); } -static int acpi_thermal_register_thermal_zone(struct acpi_thermal *tz) +static int acpi_thermal_register_thermal_zone(struct acpi_thermal *tz, + unsigned int trip_count) { struct acpi_thermal_trip *acpi_trip; struct thermal_trip *trip; int passive_delay = 0; - int trip_count = 0; int result; int i; - if (tz->trips.critical.valid) - trip_count++; - - if (tz->trips.hot.valid) - trip_count++; - - if (tz->trips.passive.trip.valid) { - trip_count++; - passive_delay = tz->trips.passive.tsp * 100; - } - - for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].trip.valid; i++) - trip_count++; - trip = kcalloc(trip_count, sizeof(*trip), GFP_KERNEL); if (!trip) return -ENOMEM; @@ -724,6 +716,8 @@ static int acpi_thermal_register_thermal acpi_trip = &tz->trips.passive.trip; if (acpi_trip->valid) { + passive_delay = tz->trips.passive.tsp * 100; + trip->type = THERMAL_TRIP_PASSIVE; trip->temperature = acpi_thermal_temp(tz, acpi_trip->temperature); trip->priv = acpi_trip; @@ -893,6 +887,7 @@ static void acpi_thermal_check_fn(struct static int acpi_thermal_add(struct acpi_device *device) { struct acpi_thermal *tz; + unsigned int trip_count; int result; if (!device) @@ -911,9 +906,12 @@ static int acpi_thermal_add(struct acpi_ acpi_thermal_aml_dependency_fix(tz); /* Get trip points [_CRT, _PSV, etc.] (required). */ - result = acpi_thermal_get_trip_points(tz); - if (result) + trip_count = acpi_thermal_get_trip_points(tz); + if (!trip_count) { + pr_warn(FW_BUG "No valid trip points!\n"); + result = -ENODEV; goto free_memory; + } /* Get temperature [_TMP] (required). */ result = acpi_thermal_get_temperature(tz); @@ -932,7 +930,7 @@ static int acpi_thermal_add(struct acpi_ acpi_thermal_guess_offset(tz); - result = acpi_thermal_register_thermal_zone(tz); + result = acpi_thermal_register_thermal_zone(tz, trip_count); if (result) goto free_memory;