From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 5AC76C001DE for ; Mon, 7 Aug 2023 18:21:13 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231477AbjHGSVM (ORCPT ); Mon, 7 Aug 2023 14:21:12 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:53350 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230502AbjHGSVB (ORCPT ); Mon, 7 Aug 2023 14:21:01 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 1E1E58F; Mon, 7 Aug 2023 11:20:59 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id dd494a809452f723; Mon, 7 Aug 2023 20:20:58 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id B2A3A6625B2; Mon, 7 Aug 2023 20:20:57 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v5 05/11] ACPI: thermal: Carry out trip point updates under zone lock Date: Mon, 07 Aug 2023 20:08:26 +0200 Message-ID: <2236767.iZASKD2KPV@kreacher> In-Reply-To: <4503814.LvFx2qVVIh@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4503814.LvFx2qVVIh@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrledtgdduudejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki There is a race condition between acpi_thermal_trips_update() and acpi_thermal_check_fn(), because the trip points may get updated while the latter is running which in theory may lead to inconsistent results. For example, if two trips are updated together, using the temperature value of one of them from before the update and the temperature value of the other one from after the update may not lead to the expected outcome. Moreover, if thermal_get_trend() runs when a trip points update is in progress, it may end up using stale trip point temperatures. To address this, make acpi_thermal_trips_update() call thermal_zone_device_adjust() to carry out the trip points update and provide a new acpi_thermal_adjust_thermal_zone() wrapper around __acpi_thermal_trips_update() as the callback function for the latter. While at it, change the acpi_thermal_trips_update() return data type to void as that function always returns 0 anyway. Signed-off-by: Rafael J. Wysocki --- v4 -> v5: No changes. v3 -> v4: * Rework to use thermal_zone_device_adjust() and the .update() callback instead of using the (exported) zone lock directly. * Call acpi_queue_thermal_check() from acpi_thermal_trips_update() which allows code duplication in acpi_thermal_notify() to be reduced. v2 -> v3: No changes. v1 -> v2: * Hold the thermal zone lock instead of thermal_check_lock around trip point updates (this also helps to protect thermal_get_trend() from using stale trip temperatures). * Add a comment documenting the purpose of the locking. * Make acpi_thermal_trips_update() void. --- drivers/acpi/thermal.c | 41 ++++++++++++++++++++++++++++------------- 1 file changed, 28 insertions(+), 13 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -185,7 +185,7 @@ static int acpi_thermal_get_polling_freq return 0; } -static int acpi_thermal_trips_update(struct acpi_thermal *tz, int flag) +static void __acpi_thermal_trips_update(struct acpi_thermal *tz, int flag) { acpi_status status; unsigned long long tmp; @@ -393,17 +393,39 @@ static int acpi_thermal_trips_update(str ACPI_THERMAL_TRIPS_EXCEPTION(flag, tz, "device"); } } +} - return 0; +static void acpi_thermal_adjust_thermal_zone(struct thermal_zone_device *thermal, + unsigned long data) +{ + __acpi_thermal_trips_update(thermal_zone_device_priv(thermal), data); +} + +static void acpi_queue_thermal_check(struct acpi_thermal *tz) +{ + if (!work_pending(&tz->thermal_check_work)) + queue_work(acpi_thermal_pm_queue, &tz->thermal_check_work); +} + +static void acpi_thermal_trips_update(struct acpi_thermal *tz, int flag) +{ + /* + * Use thermal_zone_device_adjust() to carry out the trip points + * update, so as to protect thermal_get_trend() from getting stale + * trip point temperatures and to prevent thermal_zone_device_update() + * invoked from acpi_thermal_check_fn() from producing inconsistent + * results. + */ + thermal_zone_device_adjust(tz->thermal_zone, flag); + acpi_queue_thermal_check(tz); } static int acpi_thermal_get_trip_points(struct acpi_thermal *tz) { - int i, ret = acpi_thermal_trips_update(tz, ACPI_TRIPS_INIT); bool valid; + int i; - if (ret) - return ret; + __acpi_thermal_trips_update(tz, ACPI_TRIPS_INIT); valid = tz->trips.critical.valid | tz->trips.hot.valid | @@ -710,6 +732,7 @@ static struct thermal_zone_device_ops ac .get_trend = thermal_get_trend, .hot = acpi_thermal_zone_device_hot, .critical = acpi_thermal_zone_device_critical, + .update = acpi_thermal_adjust_thermal_zone, }; static int acpi_thermal_zone_sysfs_add(struct acpi_thermal *tz) @@ -810,12 +833,6 @@ static void acpi_thermal_unregister_ther Driver Interface -------------------------------------------------------------------------- */ -static void acpi_queue_thermal_check(struct acpi_thermal *tz) -{ - if (!work_pending(&tz->thermal_check_work)) - queue_work(acpi_thermal_pm_queue, &tz->thermal_check_work); -} - static void acpi_thermal_notify(acpi_handle handle, u32 event, void *data) { struct acpi_device *device = data; @@ -830,13 +847,11 @@ static void acpi_thermal_notify(acpi_han break; case ACPI_THERMAL_NOTIFY_THRESHOLDS: acpi_thermal_trips_update(tz, ACPI_TRIPS_THRESHOLDS); - acpi_queue_thermal_check(tz); acpi_bus_generate_netlink_event(device->pnp.device_class, dev_name(&device->dev), event, 0); break; case ACPI_THERMAL_NOTIFY_DEVICES: acpi_thermal_trips_update(tz, ACPI_TRIPS_DEVICES); - acpi_queue_thermal_check(tz); acpi_bus_generate_netlink_event(device->pnp.device_class, dev_name(&device->dev), event, 0); break;