From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 6FE04C433FE for ; Tue, 5 Apr 2022 21:49:58 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S1383510AbiDEVpH (ORCPT ); Tue, 5 Apr 2022 17:45:07 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:46066 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S1457862AbiDEQwx (ORCPT ); Tue, 5 Apr 2022 12:52:53 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id E3BE5326E6; Tue, 5 Apr 2022 09:50:52 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.0.0) id b583b31e156ca061; Tue, 5 Apr 2022 18:50:50 +0200 Received: from kreacher.localnet (unknown [213.134.181.136]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 81B8F66BCB7; Tue, 5 Apr 2022 18:50:49 +0200 (CEST) From: "Rafael J. Wysocki" To: Abhishek Sahu Cc: Bjorn Helgaas , Bjorn Helgaas , linux-pci@vger.kernel.org, linux-kernel@vger.kernel.org, Linux PM , Mika Westerberg Subject: Re: [PATCH] PCI: Fix the ACPI power state during runtime resume Date: Tue, 05 Apr 2022 18:50:48 +0200 Message-ID: <2632919.mvXUDI8C0e@kreacher> In-Reply-To: <469a9db5-9868-cb17-dd5c-96ef29193fda@nvidia.com> References: <20220204233219.GA228585@bhelgaas> <8f89131c-41a2-02e4-1427-8a5b1704e0ea@nvidia.com> <469a9db5-9868-cb17-dd5c-96ef29193fda@nvidia.com> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 213.134.181.136 X-CLIENT-HOSTNAME: 213.134.181.136 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvvddrudejgedguddtudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepteeggfelteegudehueegieekveduleeuledvueefjeefffegfeejudfgteefhefhnecuffhomhgrihhnpehkvghrnhgvlhdrohhrghenucfkphepvddufedrudefgedrudekuddrudefieenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvudefrddufeegrddukedurddufeeipdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeejpdhrtghpthhtoheprggshhhsrghhuhesnhhvihguihgrrdgtohhmpdhrtghpthhtohephhgvlhhgrggrsheskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepsghhvghlghgrrghssehgohhoghhlvgdrtghomhdprhgtphhtthhopehlihhnuhigqdhptghisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepmhhikhgrrdifvghsthgvrhgsvghrgheslhhinhhugidrihhnthgvlhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org On Tuesday, April 5, 2022 6:36:34 PM CEST Abhishek Sahu wrote: > On 2/8/2022 4:00 PM, Abhishek Sahu wrote: > > On 2/8/2022 12:28 AM, Rafael J. Wysocki wrote: > >> On Saturday, February 5, 2022 12:32:19 AM CET Bjorn Helgaas wrote: > >>> [+cc Rafael, hoping for your review :) > >> > >> +Mika > >> > >>> Wonder if we should add something like this to MAINTAINERS so you get > >>> cc'd on power-related things: > >>> > >>> diff --git a/MAINTAINERS b/MAINTAINERS > >>> index ea3e6c914384..3d9a211cad5d 100644 > >>> --- a/MAINTAINERS > >>> +++ b/MAINTAINERS > >>> @@ -15422,6 +15422,7 @@ F: include/linux/pm.h > >>> F: include/linux/pm_* > >>> F: include/linux/powercap.h > >>> F: kernel/configs/nopm.config > >>> +K: pci_[a-z_]*power[a-z_]*\( > >> > >> It seems so, but generally PM patches should be CCed to linux-pm anyway. > >> > >>> > >>> DYNAMIC THERMAL POWER MANAGEMENT (DTPM) > >>> M: Daniel Lezcano > >>> ] > >>> > >>> On Mon, Jan 24, 2022 at 05:51:07PM +0530, Abhishek Sahu wrote: > >>>> Consider the following sequence during PCI device runtime > >>>> suspend/resume: > >>>> > >>>> 1. PCI device goes into runtime suspended state. The PCI state > >>>> will be changed to PCI_D0 and then pci_platform_power_transition() > >>>> will be called which changes the ACPI state to ACPI_STATE_D3_HOT. > >> > >> You mean PCI_D3hot I suppose? > >> > > > > Yes. It should be PCI_D3hot here. > > > >>>> 2. Parent bridge goes into runtime suspended state. If parent > >>>> bridge supports D3cold, then it will change the power state of all its > >>>> children to D3cold state and the power will be removed. > >>>> > >>>> 3. During wake-up time, the bridge will be runtime resumed first > >>>> and pci_power_up() will be called for the bridge. Now, the power > >>>> supply will be resumed. > >>>> > >>>> 4. pci_resume_bus() will be called which will internally invoke > >>>> pci_restore_standard_config(). pci_update_current_state() > >>>> will read PCI_PM_CTRL register and the current_state will be > >>>> updated to D0. > >>>> > >>>> In the above process, at step 4, the ACPI device state will still be > >>>> ACPI_STATE_D3_HOT since pci_platform_power_transition() is not being > >>>> invoked. > >> > >> I'm not quite following. > >> > >> I'm assuming that this description applies to the endpoint device that was > >> previously put into D3_hot. > >> > > > > Yes. This is applicable for endpoint devices which was previously put > > into D3hot. > > > >> Since its current state is D3_hot, it is not D0 (in particular) and the > >> pci_set_power_state() in pci_restore_standard_config() should put int into > >> D0 proper, including the platform firmware part. > >> > > > > The pci_restore_standard_config() for endpoint devices are being called > > internally during wake-up of upstream bridge. > > > > pci_power_up(struct pci_dev *dev) > > { > > ... > > if (dev->runtime_d3cold) { > > /* > > * When powering on a bridge from D3cold, the whole hierarchy > > * may be powered on into D0uninitialized state, resume them to > > * give them a chance to suspend again > > */ > > pci_resume_bus(dev->subordinate); > > } > > ... > > } > > > > For the upstream bridge, the above code will trigger the wake-up of > > endpoint devices and then following code will be executed for the > > endpoint devices: > > > > pci_update_current_state(struct pci_dev *dev, pci_power_t state) > > { > > if (platform_pci_get_power_state(dev) == PCI_D3cold || > > !pci_device_is_present(dev)) { > > dev->current_state = PCI_D3cold; > > } else if (dev->pm_cap) { > > u16 pmcsr; > > > > pci_read_config_word(dev, dev->pm_cap + PCI_PM_CTRL, &pmcsr); > > dev->current_state = (pmcsr & PCI_PM_CTRL_STATE_MASK); > > } else { > > dev->current_state = state; > > } > > } > > > > In the above code, the current_state will be set to D0 for the > > endpoint devices since it will go into second block where > > it will read the PM_CTRL register. > > > >>>> We need call the pci_platform_power_transition() with state > >>>> D0 to change the ACPI state to ACPI_STATE_D0. > >>>> > >>>> This patch calls pci_power_up() if current power state is D0 inside > >>>> pci_restore_standard_config(). This pci_power_up() will change the > >>>> ACPI state to ACPI_STATE_D0. > >>>> > >>>> Following are the steps to confirm: > >>>> > >>>> Enable the debug prints in acpi_pci_set_power_state() > >>>> > >>>> 0000:01:00.0 is PCI device and 0000:00:01.0 is parent bridge device > >>>> > >>>> Before: > >>>> > >>>> 0000:01:00.0: power state changed by ACPI to D3hot > >>>> 0000:00:01.0: power state changed by ACPI to D3cold > >>>> 0000:00:01.0: power state changed by ACPI to D0 > >>>> > >>>> After: > >>>> > >>>> 0000:01:00.0: power state changed by ACPI to D3hot > >>>> 0000:00:01.0: power state changed by ACPI to D3cold > >>>> 0000:00:01.0: power state changed by ACPI to D0 > >>>> 0000:01:00.0: power state changed by ACPI to D0 > >>>> > >>>> So with this patch, the PCI device ACPI state is also being > >>>> changed to D0. > >>>> > >>>> Signed-off-by: Abhishek Sahu > >>>> --- > >>>> drivers/pci/pci-driver.c | 14 +++++++++++--- > >>>> 1 file changed, 11 insertions(+), 3 deletions(-) > >>>> > >>>> diff --git a/drivers/pci/pci-driver.c b/drivers/pci/pci-driver.c > >>>> index 588588cfda48..64e0cca12f16 100644 > >>>> --- a/drivers/pci/pci-driver.c > >>>> +++ b/drivers/pci/pci-driver.c > >>>> @@ -521,14 +521,22 @@ static void pci_device_shutdown(struct device *dev) > >>>> */ > >>>> static int pci_restore_standard_config(struct pci_dev *pci_dev) > >>>> { > >>>> + int error = 0; > >>>> pci_update_current_state(pci_dev, PCI_UNKNOWN); > >>>> > >>>> if (pci_dev->current_state != PCI_D0) { > >>>> - int error = pci_set_power_state(pci_dev, PCI_D0); > >>>> - if (error) > >>>> - return error; > >>>> + error = pci_set_power_state(pci_dev, PCI_D0); > >>>> + } else { > >>>> + /* > >>>> + * The platform power state can still be non-D0, so this is > >>>> + * required to change the platform power state to D0. > >>>> + */ > >> > >> This really isn't expected to happen. > >> > >> If the device's power state has been changed to D3hot by ACPI, it is not in D0. > >> > >> It looks like the state tracking is not working here. > >> > > > > The state setting to D0 is happening due to the current logic present in > > pci_update_current_state(). If we can fix the logic in > > pci_update_current_state() to detect this condition and return state D3hot, > > then it should also fix the issue. > > > > Thanks, > > Abhishek > > > > Hi Rafael/Mika, > > Could you please help regarding the correct way to fix this issue. > I can update the patch accordingly. I think you can try one of the patches posted recently: https://patchwork.kernel.org/project/linux-pm/patch/3623886.MHq7AAxBmi@kreacher/ Thanks!