From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 1F53A221D80; Wed, 16 Apr 2025 18:12:56 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=79.96.170.134 ARC-Seal:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1744827178; cv=none; b=JPnu8/gObIOYZcjpvqvQTVvKRSPBENfZTqmdNjbYeao4MMo1a43iDqDullCU/2Wwn0u6yZBDmSE2d5veVmtvVqZLgwa6lw55ENjlpWPX32ilPLhgq7zg2Opsjtr0docja/hoO/TCOTLkzL6eP8i23KuuY8XgqLQMe++deXxnJyM= ARC-Message-Signature:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1744827178; c=relaxed/simple; bh=SXPUl90BjvGcpXMvmbXxCsof9c3BOGco/bFN/nHJFmI=; h=From:To:Cc:Subject:Date:Message-ID:MIME-Version:Content-Type; b=ibIknG6lMl5UtXgBEZDTe5qH22WDTiZAshHjqIVl6WfsLVsKkv4AfAkX2qs0A5RhgQynSuvA8DcjputdByxNAl9m47h3w2y2HRM8M7AkkafycGb4+G88roPGerFwxs5MsFfL8pOyZDi0WHC2MxVlKUDN7KEaxmt0MaGPRpjSgNE= ARC-Authentication-Results:i=1; smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net; spf=pass smtp.mailfrom=rjwysocki.net; dkim=pass (2048-bit key) header.d=rjwysocki.net header.i=@rjwysocki.net header.b=xT57oqYN; arc=none smtp.client-ip=79.96.170.134 Authentication-Results: smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=rjwysocki.net header.i=@rjwysocki.net header.b="xT57oqYN" Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by cloudserver094114.home.pl (Postfix) with ESMTPSA id 73572662716; Wed, 16 Apr 2025 20:12:53 +0200 (CEST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=rjwysocki.net; s=dkim; t=1744827174; bh=SXPUl90BjvGcpXMvmbXxCsof9c3BOGco/bFN/nHJFmI=; h=From:Subject:Date; b=xT57oqYNKhSfN3LgVlcpUWX8w/K2GWnDdEl1KZ3TtBmOpI2981uCUqUuAHCs+zFCy /BTJNP5EaZyVib/0FodXuC41vNftwI6nKZVQmLZ89JJ2zQ08blESOIHNm/vavVQLS8 DfEWzgL7Xb6+T95uD6AqJugjKA4dLl1qcl5VHvIoc3QL3Thdjq/Oj5vAO+8XwKZigy 5Ok87vtcGabzs5KVJwogUKPIAcDizn5CuV1LOYGNEV/Z1Bmw8jlAkIgT2yDsukaiX/ taADtHZfKsYiFLMR12KdygJ69cXaxq5gtJI/pMCEgf+Tf2LzMoCes18A83JfyRC0yO MeFJ+H/zcpcIg== From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Lukasz Luba , Peter Zijlstra , Srinivas Pandruvada , Dietmar Eggemann , Morten Rasmussen , Vincent Guittot , Ricardo Neri , Pierre Gondois , Christian Loehle Subject: [RFT][PATCH v1 0/8] cpufreq: intel_pstate: Enable EAS on hybrid platforms without SMT Date: Wed, 16 Apr 2025 19:44:43 +0200 Message-ID: <3344336.aeNJFYEL58@rjwysocki.net> Precedence: bulk X-Mailing-List: linux-pm@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddvvdejtdeiucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepgeffhfdujeelhfdtgeffkeetudfhtefhhfeiteethfekvefgvdfgfeeikeeigfehnecuffhomhgrihhnpehkvghrnhgvlhdrohhrghenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpehrjhifsehrjhifhihsohgtkhhirdhnvghtpdhnsggprhgtphhtthhopeduuddprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehluhhkrghsiidrlhhusggrsegrrhhmrdgtohhmpdhrtghpthhtohepphgvthgvrhiisehinhhfrhgruggvrggurdhorhhgpdhrtghpthhtohepshhrihhnihhvrghsrdh X-DCC--Metrics: v370.home.net.pl 1024; Body=11 Fuz1=11 Fuz2=11 Hi Everyone, This is a new version of https://lore.kernel.org/linux-pm/22640172.EfDdHjke4D@rjwysocki.net/ which is not regarded as RFC any more. It appears to be better than https://lore.kernel.org/linux-pm/5861970.DvuYhMxLoT@rjwysocki.net/ but still requires more testing, so I'd appreciate any help here. The following paragraph from the original cover letter still applies: "The underlying observation is that on the platforms targeted by these changes, Lunar Lake at the time of this writing, the "small" CPUs (E-cores), when run at the same performance level, are always more energy-efficient than the "big" or "performance" CPUs (P-cores). This means that, regardless of the scale- invariant utilization of a task, as long as there is enough spare capacity on E-cores, the relative cost of running it there is always lower." The first 3 patches have been updated since v0.3 and they now depend on the new cpufreq material in linux-next. The next 2 patches (Energy Model code changes) have been reviewed in the meantime, but they are only needed for the last 3 patches. Patch [6/8] is essentially the same as before. It causes perf domains to be registered per CPU and in addition to the primary cost component, which is related to the CPU type, there is a small component proportional to performance whose role is to help balance the load between CPUs of the same type. This is done to avoid migrating tasks too much between CPUs of the same type, especially between E-cores, which has been observed in tests of https://lore.kernel.org/linux-pm/5861970.DvuYhMxLoT@rjwysocki.net/ The expected effect is still that the CPUs of the "low-cost" type will be preferred so long as there is enough spare capacity on any of them. The last 2 patches are new. Patch [7/8] looks at the cache topology to avoid creating per-CPU perf domains for CPUs sharing an L2 cache. Typically, on the chips that will be affected by this patch, CPUs sharing an L2 cache also share a voltage regulator and a clock, so they technically belong to the same OPP domain and they will be put into a shared perf domain after this patch. Patch [8/8] makes CPUs sharing the L3 cache look slightly more expensive to cause the scheduler to prefer placing tasks on CPUs that don't use the L3, which in some cases should allow all of the CPUs sharing the L3 to stay in idle states and the energy usage should be reduced. Please refer to the individual patch changelogs for details. Since patches [7-8/8] also apply on top of the v0.3, I have created a git branch at git://git.kernel.org/pub/scm/linux/kernel/git/rafael/linux-pm.git \ experimental/intel_pstate/eas-take2-extended or https://web.git.kernel.org/pub/scm/linux/kernel/git/rafael/linux-pm.git/log/?h=experimental/intel_pstate/eas-take2-extended to allow the difference they make with respect to the v0.3 to be seen (if any). Later, I'm going to put this series as a whole into a new git branch on top of the mainline and the cpufreq material queued up for 6.16. Thanks!