From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 98857C0015E for ; Wed, 9 Aug 2023 20:28:25 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S232124AbjHIU2Y (ORCPT ); Wed, 9 Aug 2023 16:28:24 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:52500 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229659AbjHIU2Y (ORCPT ); Wed, 9 Aug 2023 16:28:24 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 3C24D2103; Wed, 9 Aug 2023 13:28:23 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 25c1ff97abbd2ea3; Wed, 9 Aug 2023 22:28:21 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 570A06625DB; Wed, 9 Aug 2023 22:28:21 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Srinivas Pandruvada , Zhang Rui , Daniel Lezcano Subject: [PATCH v1 1/2] thermal: intel: intel_soc_dts_iosf: Always use 2 trips Date: Wed, 09 Aug 2023 22:27:18 +0200 Message-ID: <4860900.31r3eYUQgx@kreacher> In-Reply-To: <12271935.O9o76ZdvQC@kreacher> References: <12271935.O9o76ZdvQC@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrleeggddugeejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohephedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdp rhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhg X-DCC--Metrics: v370.home.net.pl 1024; Body=5 Fuz1=5 Fuz2=5 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Both the existing callers of intel_soc_dts_iosf_init() pass 2 as the trip count argument, so it can be replaced with SOC_MAX_DTS_TRIPS everywhere in the code and the trip_count argument of that function can be dropped. This also allows the trip_count field to be dropped from struct intel_soc_dts_sensor_entry, as it is always equal to 2, and some related code can be simplified. Make changes accordingly. No intentional functional impact. Signed-off-by: Rafael J. Wysocki --- drivers/thermal/intel/int340x_thermal/processor_thermal_device_pci_legacy.c | 2 drivers/thermal/intel/intel_soc_dts_iosf.c | 26 +++------- drivers/thermal/intel/intel_soc_dts_iosf.h | 9 +-- drivers/thermal/intel/intel_soc_dts_thermal.c | 2 4 files changed, 15 insertions(+), 24 deletions(-) Index: linux-pm/drivers/thermal/intel/intel_soc_dts_iosf.c =================================================================== --- linux-pm.orig/drivers/thermal/intel/intel_soc_dts_iosf.c +++ linux-pm/drivers/thermal/intel/intel_soc_dts_iosf.c @@ -37,9 +37,6 @@ /* DTS encoding for TJ MAX temperature */ #define SOC_DTS_TJMAX_ENCODING 0x7F -/* Only 2 out of 4 is allowed for OSPM */ -#define SOC_MAX_DTS_TRIPS 2 - /* Mask for two trips in status bits */ #define SOC_DTS_TRIP_MASK 0x03 @@ -253,12 +250,10 @@ static void remove_dts_thermal_zone(stru } static int add_dts_thermal_zone(int id, struct intel_soc_dts_sensor_entry *dts, - bool notification_support, int trip_cnt, - int read_only_trip_cnt) + bool notification_support, int read_only_trip_cnt) { char name[10]; unsigned long trip; - int trip_count = 0; int trip_mask = 0; int writable_trip_cnt = 0; unsigned long ptps; @@ -274,8 +269,7 @@ static int add_dts_thermal_zone(int id, dts->id = id; if (notification_support) { - trip_count = min(SOC_MAX_DTS_TRIPS, trip_cnt); - writable_trip_cnt = trip_count - read_only_trip_cnt; + writable_trip_cnt = SOC_MAX_DTS_TRIPS - read_only_trip_cnt; trip_mask = GENMASK(writable_trip_cnt - 1, 0); } @@ -290,10 +284,9 @@ static int add_dts_thermal_zone(int id, trip_mask &= ~BIT(i / 8); } dts->trip_mask = trip_mask; - dts->trip_count = trip_count; snprintf(name, sizeof(name), "soc_dts%d", id); dts->tzone = thermal_zone_device_register(name, - trip_count, + SOC_MAX_DTS_TRIPS, trip_mask, dts, &tzone_ops, NULL, 0, 0); @@ -324,11 +317,10 @@ int intel_soc_dts_iosf_add_read_only_cri for (i = 0; i < SOC_MAX_DTS_SENSORS; ++i) { struct intel_soc_dts_sensor_entry *entry = &sensors->soc_dts[i]; int temp = sensors->tj_max - critical_offset; - unsigned long count = entry->trip_count; unsigned long mask = entry->trip_mask; - j = find_first_zero_bit(&mask, count); - if (j < count) + j = find_first_zero_bit(&mask, SOC_MAX_DTS_TRIPS); + if (j < SOC_MAX_DTS_TRIPS) return update_trip_temp(entry, j, temp, THERMAL_TRIP_CRITICAL); } @@ -372,8 +364,7 @@ void intel_soc_dts_iosf_interrupt_handle EXPORT_SYMBOL_GPL(intel_soc_dts_iosf_interrupt_handler); struct intel_soc_dts_sensors *intel_soc_dts_iosf_init( - enum intel_soc_dts_interrupt_type intr_type, int trip_count, - int read_only_trip_count) + enum intel_soc_dts_interrupt_type intr_type, int read_only_trip_count) { struct intel_soc_dts_sensors *sensors; bool notification; @@ -384,7 +375,7 @@ struct intel_soc_dts_sensors *intel_soc_ if (!iosf_mbi_available()) return ERR_PTR(-ENODEV); - if (!trip_count || read_only_trip_count > trip_count) + if (read_only_trip_count > SOC_MAX_DTS_TRIPS) return ERR_PTR(-EINVAL); tj_max = intel_tcc_get_tjmax(-1); @@ -406,8 +397,7 @@ struct intel_soc_dts_sensors *intel_soc_ for (i = 0; i < SOC_MAX_DTS_SENSORS; ++i) { sensors->soc_dts[i].sensors = sensors; ret = add_dts_thermal_zone(i, &sensors->soc_dts[i], - notification, trip_count, - read_only_trip_count); + notification, read_only_trip_count); if (ret) goto err_free; } Index: linux-pm/drivers/thermal/intel/intel_soc_dts_iosf.h =================================================================== --- linux-pm.orig/drivers/thermal/intel/intel_soc_dts_iosf.h +++ linux-pm/drivers/thermal/intel/intel_soc_dts_iosf.h @@ -12,6 +12,9 @@ /* DTS0 and DTS 1 */ #define SOC_MAX_DTS_SENSORS 2 +/* Only 2 out of 4 is allowed for OSPM */ +#define SOC_MAX_DTS_TRIPS 2 + enum intel_soc_dts_interrupt_type { INTEL_SOC_DTS_INTERRUPT_NONE, INTEL_SOC_DTS_INTERRUPT_APIC, @@ -26,8 +29,7 @@ struct intel_soc_dts_sensor_entry { int id; u32 store_status; u32 trip_mask; - u32 trip_count; - enum thermal_trip_type trip_types[2]; + enum thermal_trip_type trip_types[SOC_MAX_DTS_TRIPS]; struct thermal_zone_device *tzone; struct intel_soc_dts_sensors *sensors; }; @@ -41,8 +43,7 @@ struct intel_soc_dts_sensors { }; struct intel_soc_dts_sensors *intel_soc_dts_iosf_init( - enum intel_soc_dts_interrupt_type intr_type, int trip_count, - int read_only_trip_count); + enum intel_soc_dts_interrupt_type intr_type, int read_only_trip_count); void intel_soc_dts_iosf_exit(struct intel_soc_dts_sensors *sensors); void intel_soc_dts_iosf_interrupt_handler( struct intel_soc_dts_sensors *sensors); Index: linux-pm/drivers/thermal/intel/intel_soc_dts_thermal.c =================================================================== --- linux-pm.orig/drivers/thermal/intel/intel_soc_dts_thermal.c +++ linux-pm/drivers/thermal/intel/intel_soc_dts_thermal.c @@ -51,7 +51,7 @@ static int __init intel_soc_thermal_init return -ENODEV; /* Create a zone with 2 trips with marked as read only */ - soc_dts = intel_soc_dts_iosf_init(INTEL_SOC_DTS_INTERRUPT_APIC, 2, 1); + soc_dts = intel_soc_dts_iosf_init(INTEL_SOC_DTS_INTERRUPT_APIC, 1); if (IS_ERR(soc_dts)) { err = PTR_ERR(soc_dts); return err; Index: linux-pm/drivers/thermal/intel/int340x_thermal/processor_thermal_device_pci_legacy.c =================================================================== --- linux-pm.orig/drivers/thermal/intel/int340x_thermal/processor_thermal_device_pci_legacy.c +++ linux-pm/drivers/thermal/intel/int340x_thermal/processor_thermal_device_pci_legacy.c @@ -59,7 +59,7 @@ static int proc_thermal_pci_probe(struct * ACPI/MSR. So we don't want to fail for auxiliary DTSs. */ proc_priv->soc_dts = intel_soc_dts_iosf_init( - INTEL_SOC_DTS_INTERRUPT_MSI, 2, 0); + INTEL_SOC_DTS_INTERRUPT_MSI, 0); if (!IS_ERR(proc_priv->soc_dts) && pdev->irq) { ret = pci_enable_msi(pdev);