From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id D4763C433EF for ; Fri, 10 Dec 2021 16:12:22 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S239094AbhLJQP4 (ORCPT ); Fri, 10 Dec 2021 11:15:56 -0500 Received: from cloudserver094114.home.pl ([79.96.170.134]:52546 "EHLO cloudserver094114.home.pl" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S236753AbhLJQP4 (ORCPT ); Fri, 10 Dec 2021 11:15:56 -0500 Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 3.0.1) id f00c592c3ba2d407; Fri, 10 Dec 2021 17:12:20 +0100 Received: from kreacher.localnet (unknown [213.134.162.58]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id C5C0666AD3B; Fri, 10 Dec 2021 17:12:19 +0100 (CET) From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Srinivas Pandruvada Subject: [PATCH] cpufreq: intel_pstate: Drop redundant intel_pstate_get_hwp_cap() call Date: Fri, 10 Dec 2021 17:12:18 +0100 Message-ID: <5782812.lOV4Wx5bFT@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 213.134.162.58 X-CLIENT-HOSTNAME: 213.134.162.58 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvuddrkedvgdekiecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvufffkfgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhephfegtdffjeehkeegleejveevtdeugfffieeijeduuddtkefgjedvheeujeejtedvnecukfhppedvudefrddufeegrdduiedvrdehkeenucevlhhushhtvghrufhiiigvpedunecurfgrrhgrmhepihhnvghtpedvudefrddufeegrdduiedvrdehkedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=3 Fuz1=3 Fuz2=3 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki It is not necessary to call intel_pstate_get_hwp_cap() from intel_pstate_update_perf_limits(), because it gets called from intel_pstate_verify_cpu_policy() which is either invoked directly right before intel_pstate_update_perf_limits(), in intel_cpufreq_verify_policy() in the passive mode, or called from driver callbacks in a sequence that causes it to be followed by an immediate intel_pstate_update_perf_limits(). Namely, in the active mode intel_cpufreq_verify_policy() is called by intel_pstate_verify_policy() which is the ->verify() callback routine of intel_pstate and gets called by the cpufreq core right before intel_pstate_set_policy(), which is the driver's ->setoplicy() callback routine, where intel_pstate_update_perf_limits() is called. Signed-off-by: Rafael J. Wysocki --- drivers/cpufreq/intel_pstate.c | 18 +++++++----------- 1 file changed, 7 insertions(+), 11 deletions(-) Index: linux-pm/drivers/cpufreq/intel_pstate.c =================================================================== --- linux-pm.orig/drivers/cpufreq/intel_pstate.c +++ linux-pm/drivers/cpufreq/intel_pstate.c @@ -2486,18 +2486,14 @@ static void intel_pstate_update_perf_lim * HWP needs some special consideration, because HWP_REQUEST uses * abstract values to represent performance rather than pure ratios. */ - if (hwp_active) { - intel_pstate_get_hwp_cap(cpu); + if (hwp_active && cpu->pstate.scaling != perf_ctl_scaling) { + int scaling = cpu->pstate.scaling; + int freq; - if (cpu->pstate.scaling != perf_ctl_scaling) { - int scaling = cpu->pstate.scaling; - int freq; - - freq = max_policy_perf * perf_ctl_scaling; - max_policy_perf = DIV_ROUND_UP(freq, scaling); - freq = min_policy_perf * perf_ctl_scaling; - min_policy_perf = DIV_ROUND_UP(freq, scaling); - } + freq = max_policy_perf * perf_ctl_scaling; + max_policy_perf = DIV_ROUND_UP(freq, scaling); + freq = min_policy_perf * perf_ctl_scaling; + min_policy_perf = DIV_ROUND_UP(freq, scaling); } pr_debug("cpu:%d min_policy_perf:%d max_policy_perf:%d\n",