From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id EEC901547FF; Fri, 29 Nov 2024 16:28:29 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=79.96.170.134 ARC-Seal:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1732897713; cv=none; b=KtvYWwgEChj0HjHVXsu5eEXJtsYxBHHv0FAZciXpMKbWDUJvWAwB4cq/tk7QMt+IAe9Yy15hlE0o91nWdOrM7P9B2RjcRyzKuECY2CZ/JORz8jOyGPU2dhhCnRnHWDWxDCmx39ItHENwfE5SIBWx1G9bhOluWAZyiRK2L6zl9is= ARC-Message-Signature:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1732897713; c=relaxed/simple; bh=XX0C2Et9q0+fKcYAwfuxgwl2sGZuOMtPTUd6hhHkFNM=; h=From:To:Cc:Subject:Date:Message-ID:MIME-Version:Content-Type; b=aLHnFCr0GxCDYk4sjatIZ2Hs2xlYAjfCc7PeyY1Q+7uoQMZRx/pTxY9OFT7srRTVbIhdzwhbGSP7zRDVdCSXuAXtxEeeZx+VXwqtJfre6//vrS4gKCkY/L8ZWjElMFj6uVOvSFJWZbmL6SPRcbdHiq+RWFJLNSACiGDIETSmTbQ= ARC-Authentication-Results:i=1; smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net; spf=pass smtp.mailfrom=rjwysocki.net; dkim=pass (2048-bit key) header.d=rjwysocki.net header.i=@rjwysocki.net header.b=Zai49uL5; arc=none smtp.client-ip=79.96.170.134 Authentication-Results: smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=rjwysocki.net header.i=@rjwysocki.net header.b="Zai49uL5" Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 6.2.1) id 6c5d0463aa7c4814; Fri, 29 Nov 2024 17:28:28 +0100 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by cloudserver094114.home.pl (Postfix) with ESMTPSA id 7827CA47B8B; Fri, 29 Nov 2024 17:28:27 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=rjwysocki.net; s=dkim; t=1732897708; bh=XX0C2Et9q0+fKcYAwfuxgwl2sGZuOMtPTUd6hhHkFNM=; h=From:Subject:Date; b=Zai49uL5kavDQ1GzqDEGlTZiuaHXweevroflx4QEtTgc+OcG3PiBxyxnTT2DNwb4m R1hZIGPMrY1TUckWGrFwXH13VDw7I7XBacmRezX2XC/eLyI/CiI8fIgmVEoAQEF++6 60xEaNjZcJfQyZ0lpyc5znwxudThusbqfKeSNNL3LbtDJhqYBGemp8F0sh2CHhprQN kZXuTu7bK3oy4TFTyzXPqGaOyMi8Ca6bN7M30etyg0aL0NRjEAkmQCPX0NUFjun4m1 /V8ebXRX8jufZb/Y83B7Q3YfDLsyCDUloTVW5c7gZQup4CRhrmnApE8t+VjkX6/XDV Boa0Q54i5lgww== From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Lukasz Luba , Peter Zijlstra , Srinivas Pandruvada , Dietmar Eggemann , Morten Rasmussen , Vincent Guittot , Ricardo Neri , Pierre Gondois Subject: [RFC][PATCH v021 0/9] cpufreq: intel_pstate: Enable EAS on hybrid platforms without SMT Date: Fri, 29 Nov 2024 16:55:12 +0100 Message-ID: <5861970.DvuYhMxLoT@rjwysocki.net> Precedence: bulk X-Mailing-List: linux-pm@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeefuddrheefgdekjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpeegfffhudejlefhtdegffekteduhfethffhieettefhkeevgfdvgfefieekiefgheenucffohhmrghinhepkhgvrhhnvghlrdhorhhgnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomheprhhjfiesrhhjfiihshhotghkihdrnhgvthdpnhgspghrtghpthhtohepuddtpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhukhgrshiirdhluhgsrgesrghrmhdrtghomhdprhgtphhtthhopehpvghtvghriiesihhnfhhrrgguvggrugdrohhrghdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhg X-DCC--Metrics: v370.home.net.pl 1024; Body=10 Fuz1=10 Fuz2=10 Hi Everyone, This is a new iteration of the "EAS for intel_pstate" work: https://lore.kernel.org/linux-pm/3607404.iIbC2pHGDl@rjwysocki.net/ It contains a few new patches and almost all of the patches sent previously have been updated. The following paragraph from the original cover letter still applies: "The underlying observation is that on the platforms targeted by these changes, Lunar Lake at the time of this writing, the "small" CPUs (E-cores), when run at the same performance level, are always more energy-efficient than the "big" or "performance" CPUs (P-cores). This means that, regardless of the scale- invariant utilization of a task, as long as there is enough spare capacity on E-cores, the relative cost of running it there is always lower." Thus the idea is still to register a perf domain per CPU type, but this time there may be more than just two of them because of the first patch. The states table in each of these perf domains is still one-element and that element only contains the cost value, but this time the costs are computed and not prescribed (see the last patch). Nevertheless, the expected effect is still that the perf domains (or CPU types) with lower cost values will be preferred so long as there is enough spare capacity in them. The first two patches are not really RFC, but they are included here because patches [8-9/9] depend on patch [1/9]. They will be resent next week as non-RFC 6.14-candidate material. The difference made by them is significant because it is now not known in advance how many CPU types will be there and the cost values for each of them cannot be prescribed. Patch [3/9] is also a change that I'd like to make regardless of what happens to the rest of the series because it effectively moves EM code from the schedutil governor to EM where it belongs. Of course, it is also depended on by patch [9/9]. Patch [4/9] differs from its previous version, https://lore.kernel.org/linux-pm/1889415.atdPhlSkOF@rjwysocki.net/ because gov is NULL not only when it is not used at all, but also during the cpufreq policy init and exit, so the check in the patch had to be adjusted to match the former case only. [As a side note, I don't think that the code modified by patch [4/9] belongs to sched/topology as it messes around the cpufreq internals. At least, it should be moved to cpufreq and called by sched_is_eas_possible(), but I'm also not convinced that it is necessary at all. This is not directly related to the $subject series, though.] Patch [5/9] adds a new function needed by patch [9/9] and it is the same as its previous version: https://lore.kernel.org/linux-pm/2223963.Mh6RI2rZIc@rjwysocki.net/ Patch [6/9] is almost the same as its previous version: https://lore.kernel.org/linux-pm/1821040.VLH7GnMWUR@rjwysocki.net/ but its changelog has been expanded a bit as suggested by Dietmar. It simply rearranges the EM code without changing its functionality, so the next patch looks more straightforward. Patch [7/9] is a somewhat updated counterpart of https://lore.kernel.org/linux-pm/2017201.usQuhbGJ8B@rjwysocki.net/ It still changes the EM code to allow a perf domains with one-element states table to be registered without providing the :active_power() callback (which is then done in the last patch), but it is somewhat simpler. It also contains some discussion regarding the requirement that the capacity of all CPUs in a perf domain must be the same. In a short summary, I'm not convinced that it is actually valid. Patches [8-9/9] modify intel_pstate. The first one is preparatory, but it is useful for explaining the basic concept, which is "hybrid domains" that each contain CPUs of the same type. The last patch is just the registration of EM perf domains (one for each hybrid domain), expanding them when needed and rebuilding sched domains in some corner cases. It also contains some discussion that doesn't technically belong to the changelog, but is useful for explaining the background for some decisions. Please refer to the individual patch changelogs for details. For easier access, the series is available on the experimental/intel_ostate branch in linux-pm.git: https://git.kernel.org/pub/scm/linux/kernel/git/rafael/linux-pm.git/log/?h=experimental/intel_pstate Thanks! or https://git.kernel.org/pub/scm/linux/kernel/git/rafael/linux-pm.git/log/?h=experimental/intel_pstate Thanks!