From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from bombadil.infradead.org (bombadil.infradead.org [198.137.202.133]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.lore.kernel.org (Postfix) with ESMTPS id 90230C433F5 for ; Thu, 21 Apr 2022 22:56:43 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=lists.infradead.org; s=bombadil.20210309; h=Sender:Content-Type: List-Subscribe:List-Help:List-Post:List-Archive:List-Unsubscribe:List-Id: In-Reply-To:MIME-Version:References:Message-ID:Subject:Cc:To:From:Date: Reply-To:Content-Transfer-Encoding:Content-ID:Content-Description:Resent-Date :Resent-From:Resent-Sender:Resent-To:Resent-Cc:Resent-Message-ID:List-Owner; bh=3kBWbWMJeiWtsxpYEL4UwxaDXl4Cu5rLlXkzRe+UUoE=; b=aE80NpR7PC/x71EnIGBwbOnXCW Jy3fQXnjqPf8rbGE0ivscPy+8SoEOlQGWWroiug+vCLeQ/4ZFVkCEvF/xtt547ZFeAc+FBedMri87 z0bXvAGRJBM/S1mmKhJjZ52wzTgMb0Q5iVWEOA712anT81nyD6a7PynYJSHaiRxcRq7exZmqbd+r6 wklrDZLpjrcF4Dcv09tnhj75B3V2MH9uXvk490TPFQmXKvvAQyag6A+Rd+GogcsANWX8JTrUgm30z YyqUoZkqVL+RZrww2uEprhofR3HkGC31daz4ckBPkmAXskvlUCyLvSfrqEVsXE0cHwcuiVXMQjV82 Kvc7A9hg==; Received: from localhost ([::1] helo=bombadil.infradead.org) by bombadil.infradead.org with esmtp (Exim 4.94.2 #2 (Red Hat Linux)) id 1nhfiz-00FJLy-9w; Thu, 21 Apr 2022 22:56:33 +0000 Received: from mail-qk1-x730.google.com ([2607:f8b0:4864:20::730]) by bombadil.infradead.org with esmtps (Exim 4.94.2 #2 (Red Hat Linux)) id 1nhfiu-00FJKy-Od for linux-riscv@lists.infradead.org; Thu, 21 Apr 2022 22:56:31 +0000 Received: by mail-qk1-x730.google.com with SMTP id j6so4681552qkp.9 for ; Thu, 21 Apr 2022 15:56:27 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20210112; h=date:from:to:cc:subject:message-id:references:mime-version :content-disposition:in-reply-to; bh=CQPKNi0BaTD+rxlffck9NNikRRrnCX9PAL2NggOjY8M=; b=SH+1rhcsztKrKbRBV1dMt2X/Bo9k9vwxwf6OJuUGH8OqdQCnKkfCZ+3qPIfL3guRKY QZuwgkTWNoEVdeXadfGVzVeE3PNnqqN6ax6HlWpFBIA0ynpY/pw6mnyY0ltc7S2Nzuzd CsnR26A2XgP4hx0eJGlJ530BCGAVVNo+5LcxnB5XFH0PL+b+4hDCmXnHeVPb5gXMggvI E9pxIVvfSCo/k/DkqLfkCFNgm7+Id1CxiLQR0xy7cVuwY86n+FQVpSJ+HiLB3y7VoGe9 LcLjht3MOuJm8q6vT8XeowzS1vCjNs26cpSxrWaYgEHwxplT24uweaxXueh11/7ZyKyb 0HlA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:date:from:to:cc:subject:message-id:references :mime-version:content-disposition:in-reply-to; bh=CQPKNi0BaTD+rxlffck9NNikRRrnCX9PAL2NggOjY8M=; b=MqK9r3LroOOV40WPn5b226pEqJ1rQbnP12CKZYpkj0JgtX2ydSZ0UL3yvdAgAoJRVG nCVlq2zDQPHvZXAUgHjMx7RHsTKEEF+foAa8cfM8HNY/tiGDzXAWjw+C5U/m7dxU0oYE Xj3LyhrnVU5Llxl4KFGWafuinabBy5XISVVWLcX/v0u96iHJFjvR5HzLgGkSdQmnW9me ccYwr+ntf9Zxe/bzQJbU0T4d+QlRvEOI1GM6LRJC2H3o2D1T0QX7MRTrBMvD0NoJRRTo h0+FFILzQSWalwXgwrMc7aCdQvRMsidwrKGTaAkd7QEPxc/anTh6LppbA0qQjVoso7Xu ziCg== X-Gm-Message-State: AOAM531UaS2ur82/AH5oe9iWDcnj1lTARtY3Em3Vcvx90tNWWJB9rhlG q7z+18vEVzVyx+LrxSU4I4w= X-Google-Smtp-Source: ABdhPJzlbhY67UXUaL2gv8hSkadiC/+XAOFMcmtpWMjFGWTkeawMR9fxN0c6S6ODRXKEmGlVvE/MDw== X-Received: by 2002:a05:620a:14f:b0:69e:e6d2:9915 with SMTP id e15-20020a05620a014f00b0069ee6d29915mr1068216qkn.59.1650581786564; Thu, 21 Apr 2022 15:56:26 -0700 (PDT) Received: from auth2-smtp.messagingengine.com (auth2-smtp.messagingengine.com. [66.111.4.228]) by smtp.gmail.com with ESMTPSA id j62-20020a378741000000b0069ebd098171sm164736qkd.8.2022.04.21.15.56.24 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Thu, 21 Apr 2022 15:56:25 -0700 (PDT) Received: from compute2.internal (compute2.nyi.internal [10.202.2.46]) by mailauth.nyi.internal (Postfix) with ESMTP id 5A70627C005A; Thu, 21 Apr 2022 18:56:24 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute2.internal (MEProxy); Thu, 21 Apr 2022 18:56:24 -0400 X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedvfedrtdefgdduiecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenuc fjughrpeffhffvvefukfhfgggtuggjsehgtderredttddvnecuhfhrohhmpeeuohhquhhn ucfhvghnghcuoegsohhquhhnrdhfvghnghesghhmrghilhdrtghomheqnecuggftrfgrth htvghrnhepvdekhfduveeitdehueehfeekgfduhfetvdefhffhteejhfelvddtgefftddu feffnecuffhomhgrihhnpehthhgvrdgrqhdpkhgvrhhnvghlrdhorhhgnecuvehluhhsth gvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomhepsghoqhhunhdomhgvshhm thhprghuthhhphgvrhhsohhnrghlihhthidqieelvdeghedtieegqddujeejkeehheehvd dqsghoqhhunhdrfhgvnhhgpeepghhmrghilhdrtghomhesfhhigihmvgdrnhgrmhgv X-ME-Proxy: Received: by mail.messagingengine.com (Postfix) with ESMTPA; Thu, 21 Apr 2022 18:56:21 -0400 (EDT) Date: Fri, 22 Apr 2022 06:56:17 +0800 From: Boqun Feng To: Guo Ren Cc: Dan Lustig , Andrea Parri , "Paul E. McKenney" , Arnd Bergmann , Palmer Dabbelt , Mark Rutland , Will Deacon , Peter Zijlstra , linux-arch , Linux Kernel Mailing List , linux-riscv , Guo Ren Subject: Re: [PATCH V2 0/3] riscv: atomic: Optimize AMO instructions usage Message-ID: References: <20220412034957.1481088-1-guoren@kernel.org> <3f7dd397-2ccd-dfa3-a0ec-dcce6cbc0476@nvidia.com> <41e01514-74ca-84f2-f5cc-2645c444fd8e@nvidia.com> MIME-Version: 1.0 In-Reply-To: X-CRM114-Version: 20100106-BlameMichelson ( TRE 0.8.0 (BSD) ) MR-646709E3 X-CRM114-CacheID: sfid-20220421_155628_887511_97A5E2EE X-CRM114-Status: GOOD ( 41.06 ) X-BeenThere: linux-riscv@lists.infradead.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Content-Type: multipart/mixed; boundary="===============3835913222087355796==" Sender: "linux-riscv" Errors-To: linux-riscv-bounces+linux-riscv=archiver.kernel.org@lists.infradead.org --===============3835913222087355796== Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="ADJQozg734NwqhZw" Content-Disposition: inline --ADJQozg734NwqhZw Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Thu, Apr 21, 2022 at 05:39:09PM +0800, Guo Ren wrote: > Hi Dan, >=20 > On Thu, Apr 21, 2022 at 1:03 AM Dan Lustig wrote: > > > > On 4/20/2022 1:33 AM, Guo Ren wrote: > > > Thx Dan, > > > > > > On Wed, Apr 20, 2022 at 1:12 AM Dan Lustig wrote: > > >> > > >> On 4/17/2022 12:51 AM, Guo Ren wrote: > > >>> Hi Boqun & Andrea, > > >>> > > >>> On Sun, Apr 17, 2022 at 10:26 AM Boqun Feng = wrote: > > >>>> > > >>>> On Sun, Apr 17, 2022 at 12:49:44AM +0800, Guo Ren wrote: > > >>>> [...] > > >>>>> > > >>>>> If both the aq and rl bits are set, the atomic memory operation is > > >>>>> sequentially consistent and cannot be observed to happen before a= ny > > >>>>> earlier memory operations or after any later memory operations in= the > > >>>>> same RISC-V hart and to the same address domain. > > >>>>> "0: lr.w %[p], %[c]\n" > > >>>>> " sub %[rc], %[p], %[o]\n" > > >>>>> " bltz %[rc], 1f\n". > > >>>>> - " sc.w.rl %[rc], %[rc], %[c]\n" > > >>>>> + " sc.w.aqrl %[rc], %[rc], %[c]\n" > > >>>>> " bnez %[rc], 0b\n" > > >>>>> - " fence rw, rw\n" > > >>>>> "1:\n" > > >>>>> So .rl + fence rw, rw is over constraints, only using sc.w.aqrl i= s more proper. > > >>>>> > > >>>> > > >>>> Can .aqrl order memory accesses before and after it (not against i= tself, > > >>>> against each other), i.e. act as a full memory barrier? For exampl= e, can > > >>> From the RVWMO spec description, the .aqrl annotation appends the s= ame > > >>> effect with "fence rw, rw" to the AMO instruction, so it's RCsc. > > >>> > > >>> Not only .aqrl, and I think the below also could be an RCsc when > > >>> sc.w.aq is executed: > > >>> A: Pre-Access > > >>> B: lr.w.rl ADDR-0 > > >>> ... > > >>> C: sc.w.aq ADDR-0 > > >>> D: Post-Acess > > >>> Because sc.w.aq has overlap address & data dependency on lr.w.rl, t= he > > >>> global memory order should be A->B->C->D when sc.w.aq is executed. = For > > >>> the amoswap > > >> > > >> These opcodes aren't actually meaningful, unfortunately. > > >> > > >> Quoting the ISA manual chapter 10.2: "Software should not set the rl= bit > > >> on an LR instruction unless the aq bit is also set, nor should softw= are > > >> set the aq bit on an SC instruction unless the rl bit is also set." > > > 1. Oh, I've missed the behind half of the ISA manual. But why can't we > > > utilize lr.rl & sc.aq in software programming to guarantee the > > > sequence? > > > > lr.aq and sc.rl map more naturally to hardware than lr.rl and sc.aq. > > Plus, they just aren't common operations to begin with, e.g., there > > is no smp_store_acquire() or smp_load_release(), nor are there > > equivalents in C/C++ atomics. > First, thx for pointing out that my patch violates the rules defined > in the ISA manual. I've abandoned these parts in v3. >=20 > It's easy to let hw support lr.rl & sc.aq (eg: our hardware supports > them). I agree there are no equivalents in C/C++ atomics. But they are > useful for LR/SC pairs to implement atomic_acqurie/release semantics. > Compare below: > A): fence rw, r; lr > B): lr.rl > The A has another "fence ,r" effect in semantics, it's over commit > from a software design view. >=20 > ps: Current definition has problems: > #define RISCV_ACQUIRE_BARRIER "\tfence r , rw\n" > #define RISCV_RELEASE_BARRIER "\tfence rw, w\n" >=20 > #define __cmpxchg_release(ptr, old, new, size) \ > ... > __asm__ __volatile__ ( \ > RISCV_RELEASE_BARRIER \ > "0: lr.w %0, %2\n" \ >=20 > That means "fence rw, w" can't prevent lr.w beyond the fence, we need > a "fence.rw. r" here. Here is the Fixup patch which I'm preparing: >=20 That's not true. Note that RELEASE semantics only applies to the write/store part of a read-modify-write atomic, similarly, ACQUIRE only applies to the read/load part. For example, the following litmus test can observe the exists clause being true. {} P0(int *x, int *y) { int r0; int r1; r0 =3D cmpxchg_acquire(x, 0, 1); r1 =3D READ_ONCE(*y); } P1(int *x, int *y) { int r0; WRITE_ONCE(*y, 1); smp_mb(); r0 =3D READ_ONCE(*x); } exists (0:r0=3D0 /\ 0:r1=3D0 /\ 1:r0=3D0) Regards, Boqun > From 14c93aca0c3b10cf134791cf491b459972a36ec4 Mon Sep 17 00:00:00 2001 > From: Guo Ren > Date: Thu, 21 Apr 2022 16:44:48 +0800 > Subject: [PATCH] riscv: atomic: Fixup wrong __atomic_acquire/release_fence > implementation >=20 > Current RISCV_ACQUIRE/RELEASE_BARRIER is for spin_lock not atomic. >=20 > __cmpxchg_release(ptr, old, new, size) > ... > __asm__ __volatile__ ( > RISCV_RELEASE_BARRIER > "0: lr.w %0, %2\n" >=20 > The "fence rw, w -> lr.w" is invalid and lr would beyond fence, so > we need "fence rw, r -> lr.w" here. Atomic acquire is the same. >=20 > Fixes: 0123f4d76ca6 ("riscv/spinlock: Strengthen implementations with fen= ces") > Signed-off-by: Guo Ren > Signed-off-by: Guo Ren > Cc: Palmer Dabbelt > Cc: Mark Rutland > Cc: Andrea Parri > Cc: Dan Lustig > Cc: stable@vger.kernel.org > --- > arch/riscv/include/asm/atomic.h | 4 ++-- > arch/riscv/include/asm/cmpxchg.h | 8 ++++---- > arch/riscv/include/asm/fence.h | 4 ++++ > 3 files changed, 10 insertions(+), 6 deletions(-) >=20 > diff --git a/arch/riscv/include/asm/atomic.h b/arch/riscv/include/asm/ato= mic.h > index aef8aa9ac4f4..7cd66eba6ec3 100644 > --- a/arch/riscv/include/asm/atomic.h > +++ b/arch/riscv/include/asm/atomic.h > @@ -20,10 +20,10 @@ > #include >=20 > #define __atomic_acquire_fence() \ > - __asm__ __volatile__(RISCV_ACQUIRE_BARRIER "" ::: "memory") > + __asm__ __volatile__(RISCV_ATOMIC_ACQUIRE_BARRIER "":::"memory") >=20 > #define __atomic_release_fence() \ > - __asm__ __volatile__(RISCV_RELEASE_BARRIER "" ::: "memory"); > + __asm__ __volatile__(RISCV_ATOMIC_RELEASE_BARRIER"" ::: "memory"); >=20 > static __always_inline int arch_atomic_read(const atomic_t *v) > { > diff --git a/arch/riscv/include/asm/cmpxchg.h b/arch/riscv/include/asm/cm= pxchg.h > index 9269fceb86e0..605edc2fca3b 100644 > --- a/arch/riscv/include/asm/cmpxchg.h > +++ b/arch/riscv/include/asm/cmpxchg.h > @@ -217,7 +217,7 @@ > " bne %0, %z3, 1f\n" \ > " sc.w %1, %z4, %2\n" \ > " bnez %1, 0b\n" \ > - RISCV_ACQUIRE_BARRIER \ > + RISCV_ATOMIC_ACQUIRE_BARRIER \ > "1:\n" \ > : "=3D&r" (__ret), "=3D&r" (__rc), "+A" (*__ptr) = \ > : "rJ" ((long)__old), "rJ" (__new) \ > @@ -229,7 +229,7 @@ > " bne %0, %z3, 1f\n" \ > " sc.d %1, %z4, %2\n" \ > " bnez %1, 0b\n" \ > - RISCV_ACQUIRE_BARRIER \ > + RISCV_ATOMIC_ACQUIRE_BARRIER \ > "1:\n" \ > : "=3D&r" (__ret), "=3D&r" (__rc), "+A" (*__ptr) = \ > : "rJ" (__old), "rJ" (__new) \ > @@ -259,7 +259,7 @@ > switch (size) { \ > case 4: \ > __asm__ __volatile__ ( \ > - RISCV_RELEASE_BARRIER \ > + RISCV_ATOMIC_RELEASE_BARRIER \ > "0: lr.w %0, %2\n" \ > " bne %0, %z3, 1f\n" \ > " sc.w %1, %z4, %2\n" \ > @@ -271,7 +271,7 @@ > break; \ > case 8: \ > __asm__ __volatile__ ( \ > - RISCV_RELEASE_BARRIER \ > + RISCV_ATOMIC_RELEASE_BARRIER \ > "0: lr.d %0, %2\n" \ > " bne %0, %z3, 1f\n" \ > " sc.d %1, %z4, %2\n" \ > diff --git a/arch/riscv/include/asm/fence.h b/arch/riscv/include/asm/fenc= e.h > index 2b443a3a487f..4e446d64f04f 100644 > --- a/arch/riscv/include/asm/fence.h > +++ b/arch/riscv/include/asm/fence.h > @@ -4,9 +4,13 @@ > #ifdef CONFIG_SMP > #define RISCV_ACQUIRE_BARRIER "\tfence r , rw\n" > #define RISCV_RELEASE_BARRIER "\tfence rw, w\n" > +#define RISCV_ATOMIC_ACQUIRE_BARRIER "\tfence w , rw\n" > +#define RISCV_ATOMIC_RELEASE_BARRIER "\tfence rw, r\n" > #else > #define RISCV_ACQUIRE_BARRIER > #define RISCV_RELEASE_BARRIER > +#define RISCV_ATOMIC_ACQUIRE_BARRIER > +#define RISCV_ATOMIC_RELEASE_BARRIER > #endif >=20 > #endif /* _ASM_RISCV_FENCE_H */ >=20 >=20 > > > > > 2. Using .aqrl to replace the fence rw, rw is okay to ISA manual, > > > right? And reducing a fence instruction to gain better performance: > > > "0: lr.w %[p], %[c]\n" > > > " sub %[rc], %[p], %[o]\n" > > > " bltz %[rc], 1f\n". > > > - " sc.w.rl %[rc], %[rc], %[c]\n" > > > + " sc.w.aqrl %[rc], %[rc], %[c]\n" > > > " bnez %[rc], 0b\n" > > > - " fence rw, rw\n" > > > > Yes, using .aqrl is valid. > Thx and I think the below is also valid, right? >=20 > - RISCV_RELEASE_BARRIER \ > - " amoswap.w %0, %2, %1\n" \ > + " amoswap.w.rl %0, %2, %1\n" \ >=20 > - " amoswap.d %0, %2, %1\n" \ > - RISCV_ACQUIRE_BARRIER \ > + " amoswap.d.aq %0, %2, %1\n" \ >=20 > > > > Dan > > > > >> > > >> Dan > > >> > > >>> The purpose of the whole patchset is to reduce the usage of > > >>> independent fence rw, rw instructions, and maximize the usage of the > > >>> .aq/.rl/.aqrl aonntation of RISC-V. > > >>> > > >>> __asm__ __volatile__ ( = \ > > >>> "0: lr.w %0, %2\n" = \ > > >>> " bne %0, %z3, 1f\n" = \ > > >>> " sc.w.rl %1, %z4, %2\n" = \ > > >>> " bnez %1, 0b\n" = \ > > >>> " fence rw, rw\n" = \ > > >>> "1:\n" = \ > > >>> > > >>>> we end up with u =3D=3D 1, v =3D=3D 1, r1 on P0 is 0 and r1 on P1 = is 0, for the > > >>>> following litmus test? > > >>>> > > >>>> C lr-sc-aqrl-pair-vs-full-barrier > > >>>> > > >>>> {} > > >>>> > > >>>> P0(int *x, int *y, atomic_t *u) > > >>>> { > > >>>> int r0; > > >>>> int r1; > > >>>> > > >>>> WRITE_ONCE(*x, 1); > > >>>> r0 =3D atomic_cmpxchg(u, 0, 1); > > >>>> r1 =3D READ_ONCE(*y); > > >>>> } > > >>>> > > >>>> P1(int *x, int *y, atomic_t *v) > > >>>> { > > >>>> int r0; > > >>>> int r1; > > >>>> > > >>>> WRITE_ONCE(*y, 1); > > >>>> r0 =3D atomic_cmpxchg(v, 0, 1); > > >>>> r1 =3D READ_ONCE(*x); > > >>>> } > > >>>> > > >>>> exists (u=3D1 /\ v=3D1 /\ 0:r1=3D0 /\ 1:r1=3D0) > > >>> I think my patchset won't affect the above sequence guarantee. Curr= ent > > >>> RISC-V implementation only gives RCsc when the original value is the > > >>> same at least once. So I prefer RISC-V cmpxchg should be: > > >>> > > >>> > > >>> - "0: lr.w %0, %2\n" = \ > > >>> + "0: lr.w.rl %0, %2\n" = \ > > >>> " bne %0, %z3, 1f\n" = \ > > >>> " sc.w.rl %1, %z4, %2\n" = \ > > >>> " bnez %1, 0b\n" = \ > > >>> - " fence rw, rw\n" = \ > > >>> "1:\n" = \ > > >>> + " fence w, rw\n" \ > > >>> > > >>> To give an unconditional RSsc for atomic_cmpxchg. > > >>> > > >>>> > > >>>> Regards, > > >>>> Boqun > > >>> > > >>> > > >>> > > > > > > > > > >=20 >=20 >=20 > -- > Best Regards > Guo Ren >=20 > ML: https://lore.kernel.org/linux-csky/ --ADJQozg734NwqhZw Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAABCAAdFiEEj5IosQTPz8XU1wRHSXnow7UH+rgFAmJh4QgACgkQSXnow7UH +rjbMwgAibXhL/PGFhY4YDVW4ifVuBc1hDq9S16KT/hYVXuoxm9yJvdJ9aOCuTOx Iodj6fbxLlF0CBfbrcxzsGrQS/vP/JsL+9CA7k3Z1S30/ywtc3MZ8LKWEcQRkkXH kaw012z2WuuvS81iKxB/+fgRZEfwrrBwkbxzhzimHLKhwa6dS9hLRfPCp64BZ3v4 nkskMHYXOVkjQZ/efann2mciYK8Hgj5hGZsOzNf4helshuEg8LsQtldLiT3/gQ27 U+bCFGrD+CRD2g6W7uShqlIDDlU+Hr40J3VRvvmjgv+wmi+eKnBd9r9MmI7iGp0X kINUNJm+/95Q+7tPeUXZ4it7xOPneA== =yJKO -----END PGP SIGNATURE----- --ADJQozg734NwqhZw-- --===============3835913222087355796== Content-Type: text/plain; charset="us-ascii" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit Content-Disposition: inline _______________________________________________ linux-riscv mailing list linux-riscv@lists.infradead.org http://lists.infradead.org/mailman/listinfo/linux-riscv --===============3835913222087355796==--