From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id BA6B4183CB0; Fri, 7 Mar 2025 19:42:48 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=79.96.170.134 ARC-Seal:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1741376571; cv=none; b=iPoXC7qRi3/koYuqtkcL+ff2oKckZXT3ix2abAOPF+noCQD2ZCzysfD8FVIYVTGbzroDnQfDU5dQS+CIZ5pBzYh8DSeiHdOLZ8w+dlT5cDPf5ldnkdr3SWuneiLgggT09aXamijvBS3Y6CdHTLowhgbsOfndR+jX8UepPaMtfgs= ARC-Message-Signature:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1741376571; c=relaxed/simple; bh=jSPlM41dWFTbPXF7V5lCIMCIGH9Lb5+mtbSwIByMCl0=; h=From:To:Cc:Subject:Date:Message-ID:In-Reply-To:References: MIME-Version:Content-Type; b=cR2AzoxQKCkpDSuqvLJbYueu+LoXP9xdUCPTlsup4f30Rji4NIRORaGScXuUsJmQuBhSUYTpQN4+Qet9sOpxpEgMs44l9hU2MDnVy8A/JYbIUvhG004iXdOvreH0q9vYiL7yLcaxZGbNYyjC0LlsvVuZts4RbHJe1E9g3gAHn0A= ARC-Authentication-Results:i=1; smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net; spf=pass smtp.mailfrom=rjwysocki.net; dkim=pass (2048-bit key) header.d=rjwysocki.net header.i=@rjwysocki.net header.b=eQLSakU8; arc=none smtp.client-ip=79.96.170.134 Authentication-Results: smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=rjwysocki.net header.i=@rjwysocki.net header.b="eQLSakU8" Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 6.3.1) id f32e28ba78c6fdc3; Fri, 7 Mar 2025 20:42:41 +0100 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by cloudserver094114.home.pl (Postfix) with ESMTPSA id A53B59A0BFB; Fri, 7 Mar 2025 20:42:40 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=rjwysocki.net; s=dkim; t=1741376561; bh=jSPlM41dWFTbPXF7V5lCIMCIGH9Lb5+mtbSwIByMCl0=; h=From:Subject:Date; b=eQLSakU86HKhbNp0rrOsCLm8V04zzVHJU6+vfHK4TlXD7aZNSgGUtQ88U2MO6qH8I 7nch8+tnET/wdRgC0gt0GsDvMY3wWqFiI8gT0nZ0dot+zLlR7wKPLi+27Q8nd/vcB9 vpZX3qqcS1MyJKHrwuOEnKiYVD2SG2TF1QAG8qo1LPKAJTEnz3mvh0I0SnwB4Y6W5E Ge8TFAWuI3jRNQT3gJyoUKB47e5E2AcXGby8CNcxpAC0LH8dBE/oNZIR8uG6qwvpPb CXzskM671AgeV3eOyMWpkYR+oyre06A6zDXuEtJlK9v3T1He/4eXUHck2h05thscXD Wffvm7kRPqYTg== From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Lukasz Luba , Peter Zijlstra , Srinivas Pandruvada , Dietmar Eggemann , Morten Rasmussen , Vincent Guittot , Ricardo Neri , Pierre Gondois , Christian Loehle , Viresh Kumar Subject: [RFC][PATCH v0.3 5/6] PM: EM: Introduce em_adjust_cpu_capacity() Date: Fri, 07 Mar 2025 20:39:34 +0100 Message-ID: <2446858.NG923GbCHz@rjwysocki.net> In-Reply-To: <22640172.EfDdHjke4D@rjwysocki.net> References: <22640172.EfDdHjke4D@rjwysocki.net> Precedence: bulk X-Mailing-List: linux-kernel@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdduudduheegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomheprhhjfiesrhhjfiihshhotghkihdrnhgvthdpnhgspghrtghpthhtohepuddvpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhukhgrshiirdhluhgsrgesrghrmhdrtghomhdprhgtphhtthhopehpvghtvghriiesihhnfhhrrgguvggrugdrohhrghdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdh X-DCC--Metrics: v370.home.net.pl 1024; Body=12 Fuz1=12 Fuz2=12 From: Rafael J. Wysocki Add a function for updating the Energy Model for a CPU after its capacity has changed, which subsequently will be used by the intel_pstate driver. An EM_PERF_DOMAIN_ARTIFICIAL check is added to em_adjust_new_capacity() to prevent it from calling em_compute_costs() for an "artificial" perf domain with a NULL cb parameter which would cause it to crash. Signed-off-by: Rafael J. Wysocki --- Note that this function is needed because the performance level values in the EM "state" table need to be adjusted on CPU capacity changes. In the intel_pstate case the cost values associated with them don't change because they are artificial anyway, so replacing the entire table just in order to update the performance level values is a bit wasteful, but it seems to be an exception (in the other cases when the CPU capacity changes, the cost values change too AFAICS). --- include/linux/energy_model.h | 2 ++ kernel/power/energy_model.c | 28 ++++++++++++++++++++++++---- 2 files changed, 26 insertions(+), 4 deletions(-) --- a/include/linux/energy_model.h +++ b/include/linux/energy_model.h @@ -179,6 +179,7 @@ int em_dev_update_chip_binning(struct device *dev); int em_update_performance_limits(struct em_perf_domain *pd, unsigned long freq_min_khz, unsigned long freq_max_khz); +void em_adjust_cpu_capacity(unsigned int cpu); void em_rebuild_sched_domains(void); /** @@ -405,6 +406,7 @@ { return -EINVAL; } +void em_adjust_cpu_capacity(unsigned int cpu) {} static inline void em_rebuild_sched_domains(void) {} #endif --- a/kernel/power/energy_model.c +++ b/kernel/power/energy_model.c @@ -698,10 +698,12 @@ { int ret; - ret = em_compute_costs(dev, em_table->state, NULL, pd->nr_perf_states, - pd->flags); - if (ret) - goto free_em_table; + if (!(pd->flags & EM_PERF_DOMAIN_ARTIFICIAL)) { + ret = em_compute_costs(dev, em_table->state, NULL, + pd->nr_perf_states, pd->flags); + if (ret) + goto free_em_table; + } ret = em_dev_update_perf_domain(dev, em_table); if (ret) @@ -751,6 +753,24 @@ em_recalc_and_update(dev, pd, em_table); } +/** + * em_adjust_cpu_capacity() - Adjust the EM for a CPU after a capacity update. + * @cpu: Target CPU. + * + * Adjust the existing EM for @cpu after a capacity update under the assumption + * that the capacity has been updated in the same way for all of the CPUs in + * the same perf domain. + */ +void em_adjust_cpu_capacity(unsigned int cpu) +{ + struct device *dev = get_cpu_device(cpu); + struct em_perf_domain *pd; + + pd = em_pd_get(dev); + if (pd) + em_adjust_new_capacity(cpu, dev, pd); +} + static void em_check_capacity_update(void) { cpumask_var_t cpu_done_mask;