From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id E489D14C5B3; Fri, 29 Nov 2024 16:28:28 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=79.96.170.134 ARC-Seal:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1732897711; cv=none; b=McruElrG1nyD4qqTqXNeN7xj2el/kFSgNJ4RLHfJlL3lXqzj768Ko7tfnLwkf2gHd3EL1RIIshM1YbxgVJwgKugziHkx/1SfRXJsCrPtV8YnuprAGifiuvD+1wlGkU4wx5duXDhzTHVSbgh/Ygxfr/QXixXxJFNpHeC/v7XmQq4= ARC-Message-Signature:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1732897711; c=relaxed/simple; bh=OYoXq9Htw15pDNwhKe3wmKi9nfDTgqvonQ9dTbuSg84=; h=From:To:Cc:Subject:Date:Message-ID:In-Reply-To:References: MIME-Version:Content-Type; b=YOhYPIr40MFmlcX9VcHMXfFdn50SbYfebkApmPCiUYROzGiXkO5RvRruSZ8pzto4ptSIBI6Udd7FS87OnD3ZWXfNJ6Cz6TdGeEt0r6NsCH2M/uKHA8h345mzyohcAvxJjNTeMnxUbs/8dbpqDQTrKwN481Lt7oCy6XdVOZPndjs= ARC-Authentication-Results:i=1; smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net; spf=pass smtp.mailfrom=rjwysocki.net; dkim=pass (2048-bit key) header.d=rjwysocki.net header.i=@rjwysocki.net header.b=iyxU5GY/; arc=none smtp.client-ip=79.96.170.134 Authentication-Results: smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=rjwysocki.net header.i=@rjwysocki.net header.b="iyxU5GY/" Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 6.2.1) id 5f518de4bde3e1e6; Fri, 29 Nov 2024 17:28:21 +0100 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by cloudserver094114.home.pl (Postfix) with ESMTPSA id D5E56A47B8B; Fri, 29 Nov 2024 17:28:20 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=rjwysocki.net; s=dkim; t=1732897701; bh=OYoXq9Htw15pDNwhKe3wmKi9nfDTgqvonQ9dTbuSg84=; h=From:Subject:Date; b=iyxU5GY/ArKuU8HnZM+epBBnOro2bqsKPxWgzpzvZ8DNMNQFXXjnKY7X9OfmRwZrD 2bOAQpi+XKBLJqrdArSchnvurDoSO19PUpBuNjoi822povcdACcdRuddwJIphl7PDj I1inSGuwhLDpRZngzTRwi05TL6nEVzTq1IxE+3jag6g4UrrW7uanGig/2S88LlP1jZ 2a2Tdteh51I4/uVWWBtKF9KQgZY1RrCXI83NJ59CZZ87Vkpc3cewxr9Q6d6G8+/iDc +ESxhmkK76AxPu1PX+jHGVyFUOeENO8jvDPYv2OZw8q7gsLQQpMaJBLySnVVNl+nfw S4y/vzxX4XGeQ== From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Lukasz Luba , Peter Zijlstra , Srinivas Pandruvada , Dietmar Eggemann , Morten Rasmussen , Vincent Guittot , Ricardo Neri , Pierre Gondois Subject: [RFC][PATCH v021 7/9] PM: EM: Register perf domains with ho :active_power() callbacks Date: Fri, 29 Nov 2024 17:15:45 +0100 Message-ID: <3278518.5fSG56mABF@rjwysocki.net> In-Reply-To: <5861970.DvuYhMxLoT@rjwysocki.net> References: <5861970.DvuYhMxLoT@rjwysocki.net> Precedence: bulk X-Mailing-List: linux-kernel@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeefuddrheefgdekjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpehrjhifsehrjhifhihsohgtkhhirdhnvghtpdhnsggprhgtphhtthhopedutddprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehluhhkrghsiidrlhhusggrsegrrhhmrdgtohhmpdhrtghpthhtohepphgvthgvrhiisehinhhfrhgruggvrggurdhorhhgpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthg X-DCC--Metrics: v370.home.net.pl 1024; Body=10 Fuz1=10 Fuz2=10 From: Rafael J. Wysocki Allow em_dev_register_perf_domain() to register a cost-only perf domain with a one-element states table if the :active_power() callback is not provided. Subsequently, this will be used by the intel_pstate driver to register such perf domains for CPUs on hybrid systems. No intentional functional impact. Signed-off-by: Rafael J. Wysocki --- v0.1 -> v0.2: * Do not add one more local variable to em_dev_register_perf_domain() and make it skip the capacity check if the :active_power() callback is NULL. Add a comment explaining why it is correct to do so. For the time being, intel_pstate will only need to be able to say something like "this group of CPUs is preferred to that other group of CPUs for energy-efficiency reasons regardless of the required performance level" (and there may be multiple groups). For this purpose, it only needs a one-element states table in a perf domain for each of the groups and it only needs to set the cost value for each of them to reflect the preference. However, it may need to put CPUs of different capacity into the same group because of favored cores and this doesn't mean that one group will contain CPUs of different mincro-architectures. Favored cores essentially follow the same power-performance curve as the other CPUs of the same type up to a certain point, but they can get beyond that point on the curve which the other CPUs of the same type cannot do. Thus it would make sense to use the same states table for favored cores and the other CPUs of the same type even if there were multiple states in it, and em_pd_get_efficient_state() could easily take that into account by only using the states where "performance" is at most equal to the current CPU capacity. Unfortunately, this doesn't match the em_create_perf_table() code design and in particular em_init_performance() which scales the "performance" values the the current capacity of the "domain leader" CPU represented by "dev". IMV, it should instead scale them to the maximum possible capacity of the highest-capacity CPU in the domain (without requiring equal capacity at all). That would also help to handle the cases when CPU capacity changes, at least on Intel platforms, if it's necessary to worry about this some day. Namely, when CPU capacity is reduced, say by the platform firmware (for thermal or power distribution reasons, for example), this effectively means chopping off the top-most section of the power-performance curve, but the rest of it remains intact, so the same states table as before can be used, only the current CPU capacity needs to be changed to prevent the top-most performance states from being taken into consideration (and analogously when CPU capacity increases). Turbo works pretty much in the same way: When it's enabled, the power-performance curve is effectively extended by adding some states to it and when turbo is disabled, the top-most part of the power-performance curve effectively gets chopped off. This observation may help to avoid having to update the energy model for a chip. --- kernel/power/energy_model.c | 23 ++++++++++++++++++++--- 1 file changed, 20 insertions(+), 3 deletions(-) Index: linux-pm/kernel/power/energy_model.c =================================================================== --- linux-pm.orig/kernel/power/energy_model.c +++ linux-pm/kernel/power/energy_model.c @@ -426,9 +426,11 @@ static int em_create_pd(struct device *d if (!em_table) goto free_pd; - ret = em_create_perf_table(dev, pd, em_table->state, cb, flags); - if (ret) - goto free_pd_table; + if (cb->active_power) { + ret = em_create_perf_table(dev, pd, em_table->state, cb, flags); + if (ret) + goto free_pd_table; + } ret = em_compute_costs(dev, em_table->state, cb, nr_states, flags); if (ret) @@ -566,6 +568,9 @@ int em_dev_register_perf_domain(struct d if (!dev || !nr_states || !cb) return -EINVAL; + if (!cb->active_power && (!cb->get_cost || nr_states > 1 || microwatts)) + return -EINVAL; + /* * Use a mutex to serialize the registration of performance domains and * let the driver-defined callback functions sleep. @@ -594,7 +599,19 @@ int em_dev_register_perf_domain(struct d * All CPUs of a domain must have the same * micro-architecture since they all share the same * table. + * + * If the :active_power() callback is present, the + * performance values for different states in the table + * computed by em_create_perf_table() depend on the CPU + * capacity which therefore must be the same for all + * CPUs in the domain. However, if the :active_power() + * callback is not NULL, em_create_perf_table() doesn't + * run and there is no requirement regarding CPU + * capacity any more. */ + if (!cb->active_power) + continue; + cap = arch_scale_cpu_capacity(cpu); if (prev_cap && prev_cap != cap) { dev_err(dev, "EM: CPUs of %*pbl must have the same capacity\n",