linux-kernel.vger.kernel.org archive mirror
 help / color / mirror / Atom feed
* Kernel Workqueue Lockup on Microchip PolarFire MPFS-250T During mtd-utils integck UBIFS Stress Test
@ 2025-09-01  9:55 Nikhil Kashyap H R
  0 siblings, 0 replies; only message in thread
From: Nikhil Kashyap H R @ 2025-09-01  9:55 UTC (permalink / raw)
  To: linux-mtd, linux-fsdevel, linux-kernel
  Cc: murulidhar.mahesh, Poojashree, Deeksha N


[-- Attachment #1.1: Type: text/plain, Size: 2621 bytes --]

Dear Linux Kernel and Microchip Support Teams,

I am seeking your assistance with a critical kernel stability issue 
observed on our Microchip PolarFire Video Kit MPFS-250T platform during 
file system stress testing.
While running the integck test from the mtd-utils package (version 
2.0.0) on a 64GB Micron NAND (MT29F64G08AFAAAWP) configured with UBIFS 
as the file system, we encounter a persistent kernel workqueue lockup 
error. The exact message from the kernel logs is:

*/BUG: workqueue lockup - pool cpus=3 node=0 flags=0x0 nice=0 stuck for 
122s!/*

This workqueue lockup occurs consistently during the integrated 
filesystem integrity test that performs extensive random file creation, 
writes, truncations, renames, symlinks, deletions, and remount 
operations designed to stress both metadata and data layers of UBIFS on MTD.
Environment:
     Hardware Platform: Microchip PolarFire Video Kit MPFS-250T
     NAND Flash: Micron MT29F64G08AFAAAWP (64GB)
     Kernel Version: 6.6 (custom build)
     Filesystem: UBIFS on MTD device
     mtd-utils Version: 2.0.0 (https://github.com/lgirdk/mtd-utils)
     Memory: Approx. 1.6 GB RAM; no swap configured

Troubleshooting Steps Undertaken:
     Verified system memory availability and absence of swapping during 
test runs.
     Analyzed kernel logs confirming prolonged workqueue thread stalls.
     Reduced workload parameters with limited success.
     Validated kernel and driver versions as latest stable for this 
platform.
     Inspected the integck test source code, identifying its intensive 
asynchronous filesystem operations which may overwhelm kernel deferred 
workqueues.
     Collected syslog excerpts, memory snapshots, and environment details.

Assistance Requested:
I would appreciate your expertise and guidance regarding:
     Any known kernel or UBIFS (MTD) driver issues in kernel 6.6 that 
may trigger workqueue lockups under stress conditions.
     Recommended kernel patches, driver updates, or configurations to 
mitigate or resolve this issue.
     Diagnostic approaches or kernel debugging mechanisms for capturing 
actionable insights concerning stalled workqueues.
     Best practices when running sustained UBIFS stress tests on large 
NAND devices on this platform.

Supporting Information Provided:
     Kernel and system logs highlighting workqueue lockup and timing.
     Memory utilization statistics.
     Complete integck test source code from mtd-utils v2.0.0.
     Filesystem mount configurations and system setup details.

*
Best Regards
Nikhil Kashyap H R
*



[-- Attachment #1.2: Type: text/html, Size: 3955 bytes --]

[-- Attachment #2: system_memeory.png --]
[-- Type: image/png, Size: 67647 bytes --]

[-- Attachment #3: integck_test_log.txt --]
[-- Type: text/plain, Size: 235777 bytes --]

OpenSBI v1.2
   ____                    _____ ____ _____
  / __ \                  / ____|  _ \_   _|
 | |  | |_ __   ___ _ __ | (___ | |_) || |
 | |  | | '_ \ / _ \ '_ \ \___ \|  _ < | |
 | |__| | |_) |  __/ | | |____) | |_) || |_
  \____/| .__/ \___|_| |_|_____/|____/_____|
        | |
        |_|

Platform Name             : Microchip PolarFire(R) SoC
Platform Features         : medeleg
Platform HART Count       : 5
Platform IPI Device       : aclint-mswi
Platform Timer Device     : aclint-mtimer @ 1000000Hz
Platform Console Device   : mmuart
Platform HSM Device       : mpfs_hsm
Platform PMU Device       : ---
Platform Reboot Device    : mpfs_reset
Platform Shutdown Device  : mpfs_reset
Firmware Base             : 0xa000000
Firmware Size             : 146 KB
Runtime SBI Version       : 1.0

Domain0 Name              : root
Domain0 Boot HART         : 1
Domain0 HARTs             : 1,2,3,4
Domain0 Region00          : 0x0000000002008000-0x000000000200bfff (I)
Domain0 Region01          : 0x0000000002000000-0x0000000002007fff (I)
Domain0 Region02          : 0x000000000a000000-0x000000000a03ffff ()
Domain0 Region03          : 0x0000000000000000-0xffffffffffffffff (R,W,X)
Domain0 Next Address      : 0x0000000080200000
Domain0 Next Arg1         : 0x0000000000000000
Domain0 Next Mode         : S-mode
Domain0 SysReset          : yes

Domain1 Name              : u-boot.bin
Domain1 Boot HART         : 1
Domain1 HARTs             : 1*,2*,3*,4*
Domain1 Region00          : 0x000000000a000000-0x000000000a03ffff ()
Domain1 Region01          : 0x0000000000000000-0xffffffffffffffff (R,W,X)
Domain1 Next Address      : 0x0000000080200000
Domain1 Next Arg1         : 0x0000000000000000
Domain1 Next Mode         : S-mode
Domain1 SysReset          : yes

Boot HART ID              : 1
Boot HART Domain          : u-boot.bin
Boot HART Priv Version    : v1.10
Boot HART Base ISA        : rv64imafdc
Boot HART ISA Extensions  : none
Boot HART PMP Count       : 16
Boot HART PMP Granularity : 4
Boot HART PMP Address Bits: 36
Boot HART MHPM Count      : 2
Boot HART MIDELEG         : 0x0000000000000222
Boot HART MEDELEG         : 0x000000000000b109


U-Boot 2023.07.02-linux4microchip+fpga-2025.03 (Mar 25 2025 - 10:59:43 +0000)

CPU:   rv64imafdc
Model: Microchip PolarFire-SoC Video Kit
DRAM:  1 GiB (effective 2.8 GiB)
Core:  51 devices, 13 uclasses, devicetree: separate
MMC:   mmc@20008000: 0
Loading Environment from FAT... OK
In:    serial@20100000
Out:   serial@20100000
Err:   serial@20100000
Net:   eth0: ethernet@20110000
Hit any key to stop autoboot:  0 
switch to partitions #0, OK
mmc0 is current device
Scanning mmc 0:1...
Found U-Boot script /boot.scr
399 bytes read in 31 ms (11.7 KiB/s)
## Executing script at 8e000000
6213539 bytes read in 299 ms (19.8 MiB/s)
## Loading kernel from FIT Image at 8e000000 ...
   Using 'conf-microchip_mpfs-video-kit.dtb' configuration
   Trying 'kernel-1' kernel subimage
     Description:  Linux kernel
     Type:         Kernel Image
     Compression:  gzip compressed
     Data Start:   0x8e0000e8
     Data Size:    6168648 Bytes = 5.9 MiB
     Architecture: RISC-V
     OS:           Linux
     Load Address: 0x80200000
     Entry Point:  0x80200000
     Hash algo:    sha256
     Hash value:   b1bcb509641e50ac2f5c955e335e548d2cf327d11ff4351e3065824e9913e8ce
   Verifying Hash Integrity ... sha256+ OK
## Loading fdt from FIT Image at 8e000000 ...
   Using 'conf-microchip_mpfs-video-kit.dtb' configuration
   Trying 'fdt-microchip_mpfs-video-kit.dtb' fdt subimage
     Description:  Flattened Device Tree blob
     Type:         Flat Device Tree
     Compression:  uncompressed
     Data Start:   0x8e5e2250
     Data Size:    19241 Bytes = 18.8 KiB
     Architecture: RISC-V
     Load Address: 0x8a000000
     Hash algo:    sha256
     Hash value:   5a6fb5313ffa51d8786359f7866a9408a06cbf983e88617dc0de20a1d805d6e8
   Verifying Hash Integrity ... sha256+ OK
   Loading fdt from 0x8e5e2250 to 0x8a000000
   Booting using the fdt blob at 0x8a000000
Working FDT set to 8a000000
   Uncompressing Kernel Image
   Using Device Tree in place at 000000008a000000, end 000000008a007b28
Working FDT set to 8a000000

Starting kernel ...

[    0.000000] Linux version 6.6.75-linux4microchip+fpga-2025.03-g4d49d0f23834 (oe-user@oe-host) (riscv64-oe-linux-gcc (GCC) 13.3.0, GNU ld (GNU Binutils) 2.42.0.20240716) #1 SMP Tue Mar 25 12:00:14 UTC5
[    0.000000] Machine model: Microchip PolarFire-SoC VIDEO Kit
[    0.000000] SBI specification v1.0 detected
[    0.000000] SBI implementation ID=0x8 Version=0x10002
[    0.000000] SBI TIME extension detected
[    0.000000] SBI IPI extension detected
[    0.000000] SBI RFENCE extension detected
[    0.000000] SBI SRST extension detected
[    0.000000] earlycon: ns16550a0 at MMIO32 0x0000000020100000 (options '115200n8')
[    0.000000] printk: bootconsole [ns16550a0] enabled
[    0.000000] efi: UEFI not found.
[    0.000000] Reserved memory: created DMA memory pool at 0x00000000c4000000, size 32 MiB
[    0.000000] OF: reserved mem: initialized node non-cached-low-buffer, compatible id shared-dma-pool
[    0.000000] OF: reserved mem: 0x00000000c4000000..0x00000000c5ffffff (32768 KiB) nomap non-reusable non-cached-low-buffer
[    0.000000] Reserved memory: created DMA memory pool at 0x0000001412000000, size 256 MiB
[    0.000000] OF: reserved mem: initialized node non-cached-high-buffer, compatible id shared-dma-pool
[    0.000000] OF: reserved mem: 0x0000001412000000..0x0000001421ffffff (262144 KiB) nomap non-reusable non-cached-high-buffer
[    0.000000] OF: reserved mem: 0x0000000084000000..0x0000000087ffffff (65536 KiB) nomap non-reusable region@84000000
[    0.000000] Reserved memory: created DMA memory pool at 0x0000000088000000, size 32 MiB
[    0.000000] OF: reserved mem: initialized node buffer@88000000, compatible id shared-dma-pool
[    0.000000] OF: reserved mem: 0x0000000088000000..0x0000000089ffffff (32768 KiB) nomap non-reusable buffer@88000000
[    0.000000] Reserved memory: created DMA memory pool at 0x00000000c8000000, size 32 MiB
[    0.000000] OF: reserved mem: initialized node buffer@c8000000, compatible id shared-dma-pool
[    0.000000] OF: reserved mem: 0x00000000c8000000..0x00000000c9ffffff (32768 KiB) nomap non-reusable buffer@c8000000
[    0.000000] Reserved memory: created DMA memory pool at 0x00000000d8000000, size 32 MiB
[    0.000000] OF: reserved mem: initialized node buffer@d8000000, compatible id shared-dma-pool
[    0.000000] OF: reserved mem: 0x00000000d8000000..0x00000000d9ffffff (32768 KiB) nomap non-reusable buffer@d8000000
[    0.000000] Reserved memory: created DMA memory pool at 0x000000103fc00000, size 4 MiB
[    0.000000] OF: reserved mem: initialized node hss-buffer@103fc00000, compatible id shared-dma-pool
[    0.000000] OF: reserved mem: 0x000000103fc00000..0x000000103fffffff (4096 KiB) nomap non-reusable hss-buffer@103fc00000
[    0.000000] Zone ranges:
[    0.000000]   DMA32    [mem 0x0000000080000000-0x00000000ffffffff]
[    0.000000]   Normal   [mem 0x0000000100000000-0x0000001421ffffff]
[    0.000000] Movable zone start for each node
[    0.000000] Early memory node ranges
[    0.000000]   node   0: [mem 0x0000000080000000-0x0000000083ffffff]
[    0.000000]   node   0: [mem 0x000000008a000000-0x0000000091ffffff]
[    0.000000]   node   0: [mem 0x00000000c4000000-0x00000000c5ffffff]
[    0.000000]   node   0: [mem 0x00000000c6000000-0x00000000c7ffffff]
[    0.000000]   node   0: [mem 0x00000000c8000000-0x00000000c9ffffff]
[    0.000000]   node   0: [mem 0x0000001022000000-0x000000103fbfffff]
[    0.000000]   node   0: [mem 0x000000103fc00000-0x000000103fffffff]
[    0.000000]   node   0: [mem 0x0000001040000000-0x000000107fffffff]
[    0.000000]   node   0: [mem 0x0000001412000000-0x0000001421ffffff]
[    0.000000] Initmem setup node 0 [mem 0x0000000080000000-0x0000001421ffffff]
[    0.000000] On node 0, zone DMA32: 24576 pages in unavailable ranges
[    0.000000] On node 0, zone DMA32: 40960 pages in unavailable ranges
[    0.000000] On node 0, zone Normal: 32768 pages in unavailable ranges
[    0.000000] On node 0, zone Normal: 8192 pages in unavailable ranges
[    0.000000] On node 0, zone Normal: 24576 pages in unavailable ranges
[    0.000000] SBI HSM extension detected
[    0.000000] CPU with hartid=0 is not available
[    0.000000] riscv: base ISA extensions acdfim
[    0.000000] riscv: ELF capabilities acdfim
[    0.000000] percpu: Embedded 18 pages/cpu s35944 r8192 d29592 u73728
[    0.000000] Kernel command line: earlycon root=/dev/mmcblk0p3 rootwait uio_pdrv_genirq.of_id=generic-uio
[    0.000000] Dentry cache hash table entries: 262144 (order: 9, 2097152 bytes, linear)
[    0.000000] Inode-cache hash table entries: 131072 (order: 8, 1048576 bytes, linear)
[    0.000000] Built 1 zonelists, mobility grouping on.  Total pages: 517120
[    0.000000] mem auto-init: stack:all(zero), heap alloc:off, heap free:off
[    0.000000] software IO TLB: area num 4.
[    0.000000] software IO TLB: mapped [mem 0x000000008e000000-0x0000000092000000] (64MB)
[    0.000000] Memory: 1622768K/2097152K available (7497K kernel code, 4842K rwdata, 4096K rodata, 2161K init, 384K bss, 474384K reserved, 0K cma-reserved)
[    0.000000] SLUB: HWalign=64, Order=0-3, MinObjects=0, CPUs=4, Nodes=1
[    0.000000] rcu: Hierarchical RCU implementation.
[    0.000000] rcu:     RCU event tracing is enabled.
[    0.000000] rcu:     RCU restricting CPUs from NR_CPUS=64 to nr_cpu_ids=4.
[    0.000000]  Tracing variant of Tasks RCU enabled.
[    0.000000] rcu: RCU calculated value of scheduler-enlistment delay is 25 jiffies.
[    0.000000] rcu: Adjusting geometry for rcu_fanout_leaf=16, nr_cpu_ids=4
[    0.000000] NR_IRQS: 64, nr_irqs: 64, preallocated irqs: 0
[    0.000000] riscv-intc: 64 local interrupts mapped
[    0.000000] plic: interrupt-controller@c000000: mapped 186 interrupts with 4 handlers for 9 contexts.
[    0.000000] riscv: providing IPIs using SBI IPI extension
[    0.000000] rcu: srcu_init: Setting srcu_struct sizes based on contention.
[    0.000000] clocksource: riscv_clocksource: mask: 0xffffffffffffffff max_cycles: 0x1d854df40, max_idle_ns: 3526361616960 ns
[    0.000004] sched_clock: 64 bits at 1000kHz, resolution 1000ns, wraps every 2199023255500ns
[    0.009566] Console: colour dummy device 80x25
[    0.014529] printk: console [tty0] enabled
[    0.019061] printk: bootconsole [ns16550a0] disabled
[    0.000000] Linux version 6.6.75-linux4microchip+fpga-2025.03-g4d49d0f23834 (oe-user@oe-host) (riscv64-oe-linux-gcc (GCC) 13.3.0, GNU ld (GNU Binutils) 2.42.0.20240716) #1 SMP Tue Mar 25 12:00:14 UTC5
[    0.000000] Machine model: Microchip PolarFire-SoC VIDEO Kit
[    0.000000] SBI specification v1.0 detected
[    0.000000] SBI implementation ID=0x8 Version=0x10002
[    0.000000] SBI TIME extension detected
[    0.000000] SBI IPI extension detected
[    0.000000] SBI RFENCE extension detected
[    0.000000] SBI SRST extension detected
[    0.000000] earlycon: ns16550a0 at MMIO32 0x0000000020100000 (options '115200n8')
[    0.000000] printk: bootconsole [ns16550a0] enabled
[    0.000000] efi: UEFI not found.
[    0.000000] Reserved memory: created DMA memory pool at 0x00000000c4000000, size 32 MiB
[    0.000000] OF: reserved mem: initialized node non-cached-low-buffer, compatible id shared-dma-pool
[    0.000000] OF: reserved mem: 0x00000000c4000000..0x00000000c5ffffff (32768 KiB) nomap non-reusable non-cached-low-buffer
[    0.000000] Reserved memory: created DMA memory pool at 0x0000001412000000, size 256 MiB
[    0.000000] OF: reserved mem: initialized node non-cached-high-buffer, compatible id shared-dma-pool
[    0.000000] OF: reserved mem: 0x0000001412000000..0x0000001421ffffff (262144 KiB) nomap non-reusable non-cached-high-buffer
[    0.000000] OF: reserved mem: 0x0000000084000000..0x0000000087ffffff (65536 KiB) nomap non-reusable region@84000000
[    0.000000] Reserved memory: created DMA memory pool at 0x0000000088000000, size 32 MiB
[    0.000000] OF: reserved mem: initialized node buffer@88000000, compatible id shared-dma-pool
[    0.000000] OF: reserved mem: 0x0000000088000000..0x0000000089ffffff (32768 KiB) nomap non-reusable buffer@88000000
[    0.000000] Reserved memory: created DMA memory pool at 0x00000000c8000000, size 32 MiB
[    0.000000] OF: reserved mem: initialized node buffer@c8000000, compatible id shared-dma-pool
[    0.000000] OF: reserved mem: 0x00000000c8000000..0x00000000c9ffffff (32768 KiB) nomap non-reusable buffer@c8000000
[    0.000000] Reserved memory: created DMA memory pool at 0x00000000d8000000, size 32 MiB
[    0.000000] OF: reserved mem: initialized node buffer@d8000000, compatible id shared-dma-pool
[    0.000000] OF: reserved mem: 0x00000000d8000000..0x00000000d9ffffff (32768 KiB) nomap non-reusable buffer@d8000000
[    0.000000] Reserved memory: created DMA memory pool at 0x000000103fc00000, size 4 MiB
[    0.000000] OF: reserved mem: initialized node hss-buffer@103fc00000, compatible id shared-dma-pool
[    0.000000] OF: reserved mem: 0x000000103fc00000..0x000000103fffffff (4096 KiB) nomap non-reusable hss-buffer@103fc00000
[    0.000000] Zone ranges:
[    0.000000]   DMA32    [mem 0x0000000080000000-0x00000000ffffffff]
[    0.000000]   Normal   [mem 0x0000000100000000-0x0000001421ffffff]
[    0.000000] Movable zone start for each node
[    0.000000] Early memory node ranges
[    0.000000]   node   0: [mem 0x0000000080000000-0x0000000083ffffff]
[    0.000000]   node   0: [mem 0x000000008a000000-0x0000000091ffffff]
[    0.000000]   node   0: [mem 0x00000000c4000000-0x00000000c5ffffff]
[    0.000000]   node   0: [mem 0x00000000c6000000-0x00000000c7ffffff]
[    0.000000]   node   0: [mem 0x00000000c8000000-0x00000000c9ffffff]
[    0.000000]   node   0: [mem 0x0000001022000000-0x000000103fbfffff]
[    0.000000]   node   0: [mem 0x000000103fc00000-0x000000103fffffff]
[    0.000000]   node   0: [mem 0x0000001040000000-0x000000107fffffff]
[    0.000000]   node   0: [mem 0x0000001412000000-0x0000001421ffffff]
[    0.000000] Initmem setup node 0 [mem 0x0000000080000000-0x0000001421ffffff]
[    0.000000] On node 0, zone DMA32: 24576 pages in unavailable ranges
[    0.000000] On node 0, zone DMA32: 40960 pages in unavailable ranges
[    0.000000] On node 0, zone Normal: 32768 pages in unavailable ranges
[    0.000000] On node 0, zone Normal: 8192 pages in unavailable ranges
[    0.000000] On node 0, zone Normal: 24576 pages in unavailable ranges
[    0.000000] SBI HSM extension detected
[    0.000000] CPU with hartid=0 is not available
[    0.000000] riscv: base ISA extensions acdfim
[    0.000000] riscv: ELF capabilities acdfim
[    0.000000] percpu: Embedded 18 pages/cpu s35944 r8192 d29592 u73728
[    0.000000] Kernel command line: earlycon root=/dev/mmcblk0p3 rootwait uio_pdrv_genirq.of_id=generic-uio
[    0.000000] Dentry cache hash table entries: 262144 (order: 9, 2097152 bytes, linear)
[    0.000000] Inode-cache hash table entries: 131072 (order: 8, 1048576 bytes, linear)
[    0.000000] Built 1 zonelists, mobility grouping on.  Total pages: 517120
[    0.000000] mem auto-init: stack:all(zero), heap alloc:off, heap free:off
[    0.000000] software IO TLB: area num 4.
[    0.000000] software IO TLB: mapped [mem 0x000000008e000000-0x0000000092000000] (64MB)
[    0.000000] Memory: 1622768K/2097152K available (7497K kernel code, 4842K rwdata, 4096K rodata, 2161K init, 384K bss, 474384K reserved, 0K cma-reserved)
[    0.000000] SLUB: HWalign=64, Order=0-3, MinObjects=0, CPUs=4, Nodes=1
[    0.000000] rcu: Hierarchical RCU implementation.
[    0.000000] rcu:     RCU event tracing is enabled.
[    0.000000] rcu:     RCU restricting CPUs from NR_CPUS=64 to nr_cpu_ids=4.
[    0.000000]  Tracing variant of Tasks RCU enabled.
[    0.000000] rcu: RCU calculated value of scheduler-enlistment delay is 25 jiffies.
[    0.000000] rcu: Adjusting geometry for rcu_fanout_leaf=16, nr_cpu_ids=4
[    0.000000] NR_IRQS: 64, nr_irqs: 64, preallocated irqs: 0
[    0.000000] riscv-intc: 64 local interrupts mapped
[    0.000000] plic: interrupt-controller@c000000: mapped 186 interrupts with 4 handlers for 9 contexts.
[    0.000000] riscv: providing IPIs using SBI IPI extension
[    0.000000] rcu: srcu_init: Setting srcu_struct sizes based on contention.
[    0.000000] clocksource: riscv_clocksource: mask: 0xffffffffffffffff max_cycles: 0x1d854df40, max_idle_ns: 3526361616960 ns
[    0.000004] sched_clock: 64 bits at 1000kHz, resolution 1000ns, wraps every 2199023255500ns
[    0.009566] Console: colour dummy device 80x25
[    0.014529] printk: console [tty0] enabled
[    0.019061] printk: bootconsole [ns16550a0] disabled
[    0.024658] Calibrating delay loop (skipped), value calculated using timer frequency.. 2.00 BogoMIPS (lpj=4000)
[    0.024713] pid_max: default: 32768 minimum: 301
[    0.025118] Mount-cache hash table entries: 4096 (order: 3, 32768 bytes, linear)
[    0.025310] Mountpoint-cache hash table entries: 4096 (order: 3, 32768 bytes, linear)
[    0.027615] CPU node for /cpus/cpu@0 exist but the possible cpu range is :0-3
[    0.030791] RCU Tasks Trace: Setting shift to 2 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=4.
[    0.031152] riscv: ELF compat mode unsupported
[    0.031171] ASID allocator disabled (0 bits)
[    0.031579] rcu: Hierarchical SRCU implementation.
[    0.031608] rcu:     Max phase no-delay instances is 1000.
[    0.032365] EFI services will not be available.
[    0.033517] smp: Bringing up secondary CPUs ...
[    0.060702] cpu1: Ratio of byte access time to unaligned word access is 0.01, unaligned accesses are slow
[    0.088782] cpu2: Ratio of byte access time to unaligned word access is 0.01, unaligned accesses are slow
[    0.116862] cpu3: Ratio of byte access time to unaligned word access is 0.01, unaligned accesses are slow
[    0.117131] smp: Brought up 1 node, 4 CPUs
[    0.120017] devtmpfs: initialized
[    0.127845] DMA: default coherent area is set
[    0.127905] clocksource: jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 7645041785100000 ns
[    0.127973] futex hash table entries: 1024 (order: 4, 65536 bytes, linear)
[    0.128589] pinctrl core: initialized pinctrl subsystem
[    0.130928] NET: Registered PF_NETLINK/PF_ROUTE protocol family
[    0.131704] DMA: preallocated 256 KiB GFP_KERNEL pool for atomic allocations
[    0.131844] DMA: preallocated 256 KiB GFP_KERNEL|GFP_DMA32 pool for atomic allocations
[    0.157068] cpu0: Ratio of byte access time to unaligned word access is 0.01, unaligned accesses are slow
[    0.157662] CCACHE: DataError @ 0x00000000.081DFFE0
[    0.157839] CCACHE: DataFail @ 0x00000000.081DFFF8
[    0.158074] CCACHE: 4 banks, 16 ways, sets/bank=512, bytes/block=64
[    0.158117] CCACHE: Index of the largest way enabled: 11
[    0.178547] SCSI subsystem initialized
[    0.179446] usbcore: registered new interface driver usbfs
[    0.179555] usbcore: registered new interface driver hub
[    0.179664] usbcore: registered new device driver usb
[    0.179945] mc: Linux media interface: v0.10
[    0.180056] videodev: Linux video capture interface: v2.00
[    0.180153] pps_core: LinuxPPS API ver. 1 registered
[    0.180187] pps_core: Software ver. 5.3.6 - Copyright 2005-2007 Rodolfo Giometti <giometti@linux.it>
[    0.180265] PTP clock support registered
[    0.180645] FPGA manager framework
[    0.182640] vgaarb: loaded
[    0.182982] clocksource: Switched to clocksource riscv_clocksource
[    0.203355] NET: Registered PF_INET protocol family
[    0.204954] IP idents hash table entries: 32768 (order: 6, 262144 bytes, linear)
[    0.214691] tcp_listen_portaddr_hash hash table entries: 1024 (order: 2, 16384 bytes, linear)
[    0.214869] Table-perturb hash table entries: 65536 (order: 6, 262144 bytes, linear)
[    0.214934] TCP established hash table entries: 16384 (order: 5, 131072 bytes, linear)
[    0.215922] TCP bind hash table entries: 16384 (order: 7, 524288 bytes, linear)
[    0.219126] TCP: Hash tables configured (established 16384 bind 16384)
[    0.219956] UDP hash table entries: 1024 (order: 3, 32768 bytes, linear)
[    0.220233] UDP-Lite hash table entries: 1024 (order: 3, 32768 bytes, linear)
[    0.220833] NET: Registered PF_UNIX/PF_LOCAL protocol family
[    0.220985] PCI: CLS 0 bytes, default 64
[    0.223078] workingset: timestamp_bits=62 max_order=19 bucket_order=0
[    0.224260] NET: Registered PF_ALG protocol family
[    0.224434] Block layer SCSI generic (bsg) driver version 0.4 loaded (major 248)
[    0.224486] io scheduler mq-deadline registered
[    0.224519] io scheduler kyber registered
[    0.224583] io scheduler bfq registered
[    0.226487] mpfs_irq_mux 20002000.syscon:interrupt-controller@54: mux configuration 0
[    0.228831] irq: IRQ27: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.228972] irq: IRQ28: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.229101] irq: IRQ29: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.229274] irq: IRQ30: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.229407] irq: IRQ31: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.229529] irq: IRQ32: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.229665] irq: IRQ33: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.229791] irq: IRQ34: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.229913] irq: IRQ35: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.230037] irq: IRQ36: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.230173] irq: IRQ37: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.230299] irq: IRQ38: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.230442] irq: IRQ39: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.230581] irq: IRQ40: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.230708] irq: IRQ41: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.230831] irq: IRQ42: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.231026] irq: IRQ43: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.231171] irq: IRQ44: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.231326] irq: IRQ45: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.231452] irq: IRQ46: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.231589] irq: IRQ47: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.231715] irq: IRQ48: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.231839] irq: IRQ49: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.231962] irq: IRQ50: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.232098] irq: IRQ51: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.232224] irq: IRQ52: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.232347] irq: IRQ53: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.232501] irq: IRQ54: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.232631] irq: IRQ55: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.232755] irq: IRQ56: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.232878] irq: IRQ57: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.233023] irq: IRQ58: trimming hierarchy from :soc:interrupt-controller@c000000
[    0.359486] Serial: 8250/16550 driver, 4 ports, IRQ sharing disabled
[    0.364746] 20100000.serial: ttyS1 at MMIO 0x20100000 (irq = 59, base_baud = 9375000) is a 16550A
[    0.364859] printk: console [ttyS1] enabled
[    1.541913] 20102000.serial: ttyS2 at MMIO 0x20102000 (irq = 60, base_baud = 9375000) is a 16550A
[    1.553058] 20104000.serial: ttyS3 at MMIO 0x20104000 (irq = 61, base_baud = 9375000) is a 16550A
[    1.564205] 20106000.serial: ttyS0 at MMIO 0x20106000 (irq = 62, base_baud = 9375000) is a 16550A
[    1.590526] loop: module loaded
[    1.749618] u-dma-buf udmabuf-ddr-c0: driver version = 4.5.3
[    1.755454] u-dma-buf udmabuf-ddr-c0: major number   = 247
[    1.761013] u-dma-buf udmabuf-ddr-c0: minor number   = 0
[    1.766390] u-dma-buf udmabuf-ddr-c0: phys address   = 0x0000000088000000
[    1.773236] u-dma-buf udmabuf-ddr-c0: buffer size    = 33554432
[    1.779220] u-dma-buf udmabuf0: driver installed.
[    2.542352] u-dma-buf udmabuf-ddr-nc0: driver version = 4.5.3
[    2.548180] u-dma-buf udmabuf-ddr-nc0: major number   = 247
[    2.553815] u-dma-buf udmabuf-ddr-nc0: minor number   = 1
[    2.559272] u-dma-buf udmabuf-ddr-nc0: phys address   = 0x00000000c8000000
[    2.566204] u-dma-buf udmabuf-ddr-nc0: buffer size    = 33554432
[    2.572282] u-dma-buf udmabuf1: driver installed.
[    2.595392] u-dma-buf udmabuf-ddr-nc-wcb0: driver version = 4.5.3
[    2.601562] u-dma-buf udmabuf-ddr-nc-wcb0: major number   = 247
[    2.607547] u-dma-buf udmabuf-ddr-nc-wcb0: minor number   = 2
[    2.613342] u-dma-buf udmabuf-ddr-nc-wcb0: phys address   = 0x00000000d8000000
[    2.620632] u-dma-buf udmabuf-ddr-nc-wcb0: buffer size    = 33554432
[    2.627038] u-dma-buf udmabuf2: driver installed.
[    2.634434] iWave NAND driver started loading
[    5.663060] nand: device found, Manufacturer ID: 0x2c, Chip ID: 0x68
[    5.669489] nand: Micron MT29F64G08AFAAAWP
[    5.673653] nand: 4096 MiB, SLC, erase size: 1024 KiB, page size: 8192, OOB size: 448
[    6.690957] nand: 2 chips detected
[    6.769277] Bad block table found at page 524160, version 0x03
[    6.775184] Bad block table found at page 1048448, version 0x01
[    6.790002] Bad block table found at page 524032, version 0x03
[    6.795908] Bad block table found at page 1048320, version 0x01
[    6.803982] nand_read_bbt: bad block at 0x000005a00000
[    6.809184] nand_read_bbt: bad block at 0x000005b00000
[    6.819333] Configuring NAND mode 5
[    6.824318] 1 fixed-partitions partitions found on MTD device iWave_nand.2
[    6.831306] Creating 1 MTD partitions on "iWave_nand.2":
[    6.836683] 0x000000000000-0x0000c0000000 : "iWave-nand"
[    6.848726] spi-nor spi0.0: n25q00 (131072 Kbytes)
[    6.857955] CAN device driver interface
[    6.868517] macb 20110000.ethernet eth0: Cadence GEM rev 0x0107010c at 0x20110000 irq 64 (00:04:a3:d3:5b:1e)
[    7.434390] macb 20112000.ethernet eth1: Cadence GEM rev 0x0107010c at 0x20112000 irq 68 (00:04:a3:d3:5b:1f)
[    7.448068] musb-hdrc musb-hdrc.1.auto: MUSB HDRC host driver
[    7.453943] musb-hdrc musb-hdrc.1.auto: new USB bus registered, assigned bus number 1
[    7.463445] hub 1-0:1.0: USB hub found
[    7.467351] hub 1-0:1.0: 1 port detected
[    7.472463] mpfs-musb 20201000.usb: Registered MPFS MUSB driver
[    7.479461] mpfs_rtc 20124000.rtc: prescaler set to: 999999
[    7.486020] mpfs_rtc 20124000.rtc: registered as rtc0
[    7.491210] mpfs_rtc 20124000.rtc: setting system clock to 1970-01-01T00:00:00 UTC (0)
[    7.499367] i2c_dev: i2c /dev entries driver
[    7.504965] microchip-corei2c 2010a000.i2c: registered CoreI2C bus driver
[    7.513320] sdhci: Secure Digital Host Controller Interface driver
[    7.519568] sdhci: Copyright(c) Pierre Ossman
[    7.524034] sdhci-pltfm: SDHCI platform and OF driver helper
[    7.530337] microchip-crypto: probe of 22000000.crypto failed with error -524
[    7.537851] usbcore: registered new interface driver usbhid
[    7.543541] usbhid: USB HID core driver
[    7.548409] mpfs-mailbox 37020800.mailbox: Registered MPFS mailbox controller driver
[    7.557849] NET: Registered PF_INET6 protocol family
[    7.566123] Segment Routing with IPv6
[    7.570049] In-situ OAM (IOAM) with IPv6
[    7.574202] sit: IPv6, IPv4 and MPLS over IPv4 tunneling driver
[    7.581457] NET: Registered PF_PACKET protocol family
[    7.586593] can: controller area network core
[    7.591207] NET: Registered PF_CAN protocol family
[    7.594492] mmc0: SDHCI controller on 20008000.mmc [20008000.mmc] using ADMA 64-bit
[    7.596046] can: raw protocol
[    7.606774] can: broadcast manager protocol
[    7.611029] can: netlink gateway - max_hops=1
[    7.615495] 8021q: 802.1Q VLAN Support v1.8
[    7.654651] sdhci-cdns 20008000.mmc: no tuning point found
[    7.660292] mmc0: tuning execution failed: -5
[    7.664728] mmc0: error -5 whilst initialising SD card
[    7.668792] random: crng init done
[    7.673429] mpfs-rng mpfs-rng: Registered MPFS hwrng
[    7.689276] mpfs-sys-controller syscontroller: Registered MPFS system controller
[    7.697944] clk: Disabling unused clocks
[    7.703180] Waiting for root device /dev/mmcblk0p3...
[    7.757259] sdhci-cdns 20008000.mmc: no tuning point found
[    7.762838] mmc0: tuning execution failed: -5
[    7.831759] mmc0: new high speed SDHC card at address aaaa
[    7.839627] mmcblk0: mmc0:aaaa SC16G 14.8 GiB
[    7.858246] GPT:Primary header thinks Alt. header is not at the end of the disk.
[    7.865777] GPT:11186565 != 31116287
[    7.869401] GPT:Alternate GPT header not at the end of the disk.
[    7.875456] GPT:11186565 != 31116287
[    7.879077] GPT: Use GNU Parted to correct GPT errors.
[    7.884330]  mmcblk0: p1 p2 p3
[    8.124029] EXT4-fs (mmcblk0p3): orphan cleanup on readonly fs
[    8.138299] EXT4-fs (mmcblk0p3): mounted filesystem 7eb9216d-06c6-4ec5-bfc3-bb5392b2f497 ro with ordered data mode. Quota mode: disabled.
[    8.150907] VFS: Mounted root (ext4 filesystem) readonly on device 179:3.
[    8.160714] devtmpfs: mounted
[    8.174579] Freeing unused kernel image (initmem) memory: 2160K
[    8.180754] Run /sbin/init as init process
[    8.736562] systemd[1]: System time before build time, advancing clock.
[    8.783431] systemd[1]: Inserted module 'autofs4'
[    8.851278] systemd[1]: systemd 255.4^ running in system mode (+PAM -AUDIT -SELINUX -APPARMOR +IMA -SMACK +SECCOMP -GCRYPT -GNUTLS +OPENSSL +ACL +BLKID -CURL -ELFUTILS -FIDO2 -IDN2 -IDN -IPTC +KMOD -)
[    8.883449] systemd[1]: Detected architecture riscv64.

Welcome to OpenEmbedded nodistro.0!

[    8.922289] systemd[1]: Hostname set to <mpfs-video-kit>.
[    8.941448] systemd[1]: Initializing machine ID from random generator.
[    8.948617] systemd[1]: Installed transient /etc/machine-id file.
[    9.146122] systemd-sysv-generator[88]: SysV service '/etc/init.d/halt' lacks a native systemd unit file. ~ Automatically generating a unit file for compatibility. Please update package to include a !
[    9.178812] systemd-sysv-generator[88]: SysV service '/etc/init.d/single' lacks a native systemd unit file. ~ Automatically generating a unit file for compatibility. Please update package to include !
[    9.210737] systemd-sysv-generator[88]: SysV service '/etc/init.d/reboot' lacks a native systemd unit file. ~ Automatically generating a unit file for compatibility. Please update package to include !
[    9.241833] systemd-sysv-generator[88]: SysV service '/etc/init.d/save-rtc.sh' lacks a native systemd unit file. ~ Automatically generating a unit file for compatibility. Please update package to inc!
[    9.273520] systemd-sysv-generator[88]: SysV service '/etc/init.d/umountnfs.sh' lacks a native systemd unit file. ~ Automatically generating a unit file for compatibility. Please update package to in!
[    9.304812] systemd-sysv-generator[88]: SysV service '/etc/init.d/umountfs' lacks a native systemd unit file. ~ Automatically generating a unit file for compatibility. Please update package to includ!
[    9.338425] systemd-sysv-generator[88]: SysV service '/etc/init.d/sendsigs' lacks a native systemd unit file. ~ Automatically generating a unit file for compatibility. Please update package to includ!
[    9.795233] systemd[1]: /usr/lib/systemd/system/php-fpm.service:11: PIDFile= references a path below legacy directory /var/run/, updating /var/run/php-fpm.pid �→ /run/php-fpm.pid; please update the u.
[   10.447237] systemd[1]: Queued start job for default target Multi-User System.
[   10.480793] systemd[1]: Created slice Slice /system/getty.
[  OK  ] Created slice Slice /system/getty.
[   10.509505] systemd[1]: Created slice Slice /system/modprobe.
[  OK  ] Created slice Slice /system/modprobe.
[   10.533430] systemd[1]: Created slice Slice /system/serial-getty.
[  OK  ] Created slice Slice /system/serial-getty.
[   10.556438] systemd[1]: Created slice User and Session Slice.
[  OK  ] Created slice User and Session Slice.
[   10.579712] systemd[1]: Started Dispatch Password Requests to Console Directory Watch.
[  OK  ] Started Dispatch Password Requests to Console Directory Watch.
[   10.607575] systemd[1]: Started Forward Password Requests to Wall Directory Watch.
[  OK  ] Started Forward Password Requests to Wall Directory Watch.
[   10.631629] systemd[1]: Reached target Path Units.
[  OK  ] Reached target Path Units.
[   10.651283] systemd[1]: Reached target Remote File Systems.
[  OK  ] Reached target Remote File Systems.
[   10.675323] systemd[1]: Reached target Slice Units.
[  OK  ] Reached target Slice Units.
[   10.695333] systemd[1]: Reached target Swaps.
[  OK  ] Reached target Swaps.
[   10.764028] systemd[1]: Listening on RPCbind Server Activation Socket.
[  OK  ] Listening on RPCbind Server Activation Socket.
[   10.791453] systemd[1]: Reached target RPC Port Mapper.
[  OK  ] Reached target RPC Port Mapper.
[   10.812393] systemd[1]: Listening on Syslog Socket.
[  OK  ] Listening on Syslog Socket.
[   10.831768] systemd[1]: Listening on initctl Compatibility Named Pipe.
[  OK  ] Listening on initctl Compatibility Named Pipe.
[   10.872223] systemd[1]: Journal Audit Socket was skipped because of an unmet condition check (ConditionSecurity=audit).
[   10.884628] systemd[1]: Listening on Journal Socket (/dev/log).
[  OK  ] Listening on Journal Socket (/dev/log).
[   10.912454] systemd[1]: Listening on Journal Socket.
[  OK  ] Listening on Journal Socket.
[   10.932760] systemd[1]: Listening on Network Service Netlink Socket.
[  OK  ] Listening on Network Service Netlink Socket.
[   10.966014] systemd[1]: Listening on udev Control Socket.
[  OK  ] Listening on udev Control Socket.
[   10.988102] systemd[1]: Listening on udev Kernel Socket.
[  OK  ] Listening on udev Kernel Socket.
[   11.012213] systemd[1]: Listening on User Database Manager Socket.
[  OK  ] Listening on User Database Manager Socket.
[   11.036056] systemd[1]: Huge Pages File System was skipped because of an unmet condition check (ConditionPathExists=/sys/kernel/mm/hugepages).
[   11.075605] systemd[1]: Mounting POSIX Message Queue File System...
         Mounting POSIX Message Queue File System...
[   11.127642] systemd[1]: Mounting Kernel Debug File System...
         Mounting Kernel Debug File System...
[   11.148219] systemd[1]: Kernel Trace File System was skipped because of an unmet condition check (ConditionPathExists=/sys/kernel/tracing).
[   11.170373] systemd[1]: Mounting Temporary Directory /tmp...
         Mounting Temporary Directory /tmp...
[   11.199790] systemd[1]: Starting Create List of Static Device Nodes...
         Starting Create List of Static Device Nodes...
[   11.230747] systemd[1]: Starting Load Kernel Module configfs...
         Starting Load Kernel Module configfs...
[   11.280328] systemd[1]: Starting Load Kernel Module dm_mod...
         Starting Load Kernel Module dm_mod...
[   11.314710] systemd[1]: Starting Load Kernel Module drm...
         Starting Load Kernel Module drm...
[   11.346691] systemd[1]: Starting Load Kernel Module fuse...
         Starting Load Kernel Module fuse...
[   11.379097] systemd[1]: Starting Load Kernel Module loop...
         Starting Load Kernel Module loop...
[   11.410047] systemd[1]: Starting RPC Bind...
         Starting RPC Bind...
[   11.434324] systemd[1]: Starting File System Check on Root Device...
         Starting File System Check on Root Device...
[   11.475575] systemd[1]: Starting Journal Service...
         Starting Journal Service...
[   11.503841] systemd[1]: Load Kernel Modules was skipped because no trigger condition checks were met.
[   11.531294] systemd[1]: Mounting NFSD configuration filesystem...
         Mounting NFSD configuration filesystem...
[   11.576010] systemd[1]: Starting Generate network units from Kernel command line...
         Starting Generate network units from Kernel command line...
[   11.611969] systemd[1]: Starting Apply Kernel Variables...
         Starting Apply Kernel Variables...
[   11.644425] systemd[1]: Starting Coldplug All udev Devices...
         Starting Coldplug All udev Devices...
[   11.670136] systemd[1]: Started RPC Bind.
[  OK  ] Started    11.676740] systemd[1]: Mounted POSIX Message Queue File System.
1;39mRPC Bind.
[  O[   11.685612] systemd[1]: Mounted Kernel Debug File System.
K  ] Mounted POSIX [   11.693847] systemd[1]: Mounted Temporary Directory /tmp.
Message Queue File System.
[  OK    11.703055] systemd[1]: Finished Create List of Static Device Nodes.
[0m] Mounted Kernel Debug File System   11.714602] systemd[1]: modprobe@configfs.service: Deactivated successfully.
0m.
[  OK  ] Mounted Tempo[   11.724840] systemd[1]: Finished Load Kernel Module configfs.
rary Directory /tmp.
[  OK  ] F[   11.734883] systemd[1]: modprobe@dm_mod.service: Deactivated successfully.
inished Create List of [   11.744498] systemd[1]: Finished Load Kernel Module dm_mod.
Static Device Nodes.
[  OK  ] F[   11.754150] systemd[1]: modprobe@drm.service: Deactivated successfully.
inished Load Kernel Mod[   11.764124] systemd[1]: Finished Load Kernel Module drm.
ule configfs.
[  OK  ] Finished[   11.772979] systemd[1]: modprobe@fuse.service: Deactivated successfully.
 Load K[   11.782061] systemd[1]: Finished Load Kernel Module fuse.
ernel Module dm_mod.
[   11.789999] systemd[1]: modprobe@loop.service: Deactivated successfully.
32m  OK  ] F[   11.798259] systemd[1]: Finished Load Kernel Module loop.
inished Load Kernel Mod[   11.805973] systemd[1]: Finished Generate network units from Kernel command line.
ule drm.
[  OK  ] Finished    11.817476] systemd[1]: FUSE Control File System was skipped because of an unmet condition check (ConditionPathExists=/sys/fs/fuse/connections).
1;39mLoad Kernel Module fuse.
[  OK  ] Finished[   11.836557] systemd[1]: Mounting Kernel Configuration File System...
 Load Kernel Module loop.
[  OK  ] Finished Generate network units from Kernel command line.
         Mounting Kernel Configuration File System...
[   12.260664] RPC: Registered named UNIX socket transport module.
[   12.266827] RPC: Registered udp transport module.
[   12.271642] RPC: Registered tcp transport module.
[   12.276415] RPC: Registered tcp-with-tls transport module.
[   12.282056] RPC: Registered tcp NFSv4.1 backchannel transport module.
[   12.324504] systemd[1]: Starting Repartition Root Disk...
         Starting Repartition Root Disk...
[   12.383155] systemd[1]: Starting Create Static Device Nodes in /dev gracefully...
[   12.397492] systemd[1]: Mounted Kernel Configuration File System.

[  OK  ] Mounted Kernel Conf[   12.408085] systemd-journald[107]: Collecting audit messages is disabled.
iguration File System.
[   12.494172] systemd[1]: Finished File System Check on Root Device.
[  OK  ] Finished File System Check on Root Device.
[   12.513337] systemd[1]: Finished Apply Kernel Variables.
[  OK  ] Finished Apply Kernel Variables.
[   12.624376] systemd[1]: Starting Remount Root and Kernel File Systems...
         Starting Remount Root and Kernel File Systems...
[   12.651911] systemd[1]: Started Journal Service.
[  OK  ] Started Journal Service.
[   12.667348] block mmcblk0: the capability attribute has been deprecated.
[  OK  ] Mounted NFSD configuration filesystem.
[  OK  ] Finished Repartition Root Disk.
[  OK     12.748559] EXT4-fs (mmcblk0p3): re-mounted 7eb9216d-06c6-4ec5-bfc3-bb5392b2f497 r/w. Quota mode: disabled.
0m] Finished Create Static Device Nodes in /dev gracefully.
[  OK  ] Finished Remount Root and Kernel File Systems.
         Starting Grow Root File System...
         Starting Flush Journal to Persistent Storage...
         Starting Create System Users...
[   12.976505] EXT4-fs (mmcblk0p3): resizing filesystem from 1378860 to 3870075 blocks
[   13.029520] systemd-journald[107]: Received client request to flush runtime journal.
[  OK  ] Finished Flush Journal to Persistent Storage.
         Starting User Database Manager...
[  OK  ] Started User Database Manager.
[   13.812866] EXT4-fs (mmcblk0p3): resized filesystem to 3870075
[  OK  ] Finished Create System Users.
         Starting Create Static Device Nodes in /dev...
[  OK  ] Finished Coldplug All udev Devices.
[  OK  ] Finished Grow Root File System.
[  OK  ] Finished Create Static Device Nodes in /dev.
[  OK  ] Reached target Preparation for Local File Systems.
         Mounting /var/volatile...
         Starting Rule-based Manager for Device Events and Files...
[  OK  ] Mounted /var/volatile.
         Starting Load/Save OS Random Seed...
[  OK  ] Reached target Local File Systems.
         Starting Rebuild Dynamic Linker Cache...
         Starting Create Volatile Files and Directories...
[  OK  ] Finished Load/Save OS Random Seed.
         Starting Commit a transient machine-id on disk...
[  OK  ] Finished Create Volatile Files and Directories.
         Starting Rebuild Journal Catalog...
         Starting Network Name Resolution...
         Starting Network Time Synchronization...
         Starting Record System Boot/Shutdown in UTMP...
[  OK  ] Finished Commit a transient machine-id on disk.
[  OK  ] Started Rule-based Manager for Device Events and Files.
[  OK  ] Finished Record System Boot/Shutdown in UTMP.
[  OK  ] Finished Rebuild Journal Catalog.
[   15.525102] macb 20112000.ethernet end0: renamed from eth1
[  OK  ] Started Network Time Synchronization.
[  OK  ] Started Network Name Resolution.
[  OK  ] Finished Rebuild Dynamic Linker Cache.
[  OK  ] Reached target Host and Network Name Lookups.
[  OK  ] Reached target System Time Set.
         Starting Update is Completed...
         Starting Virtual Console Setup...
[  OK  ] Finished Update is Completed.
[  OK  ] Finished Virtual Console Setup.
[  OK  ] Reached target System Initialization.
[  OK  ] Started Daily rotation of log files.
[  OK  ] Started Daily Cleanup of Temporary Directories.
[  OK  ] Reached target Timer Units.
[  OK  ] Listening on Avahi mDNS/DNS-SD Stack Activation Socket.
[  OK  ] Listening on D-Bus System Message Bus Socket.
         Starting sshd.socket...
[  OK  ] Listening on sshd.socket.
[  OK  ] Reached target Socket Units.
[  OK  ] Reached target Basic System.
[  OK  ] Started Job spooling tools.
         Starting Avahi mDNS/DNS-SD Stack...
[  OK  ] Started Periodic Command Scheduler.
         Starting D-Bus System Message Bus...
         Starting IPv6 Packet Filtering Framework...
         Starting IPv4 Packet Filtering Framework...
[  OK  ] Started System Logging Service.
         Starting User Login Management...
[  OK  ] Started Camera systemd service unit file..
         Starting OpenSSH Key Generation...
[  OK  ] Finished IPv6 Packet Filtering Framework.
[  OK  ] Finished IPv4 Packet Filtering Framework.
[  OK  ] Reached target Preparation for Network.
         Starting Network Configuration...
[  OK  ] Started D-Bus System Message Bus.
[  OK  ] Started Avahi mDNS/DNS-SD Stack.
[  OK  ] Started User Login Management.
[  OK  ] Started Network Configuration.
[  OK  ] Reached target Network.
[  OK  ] Started The Apache HTTP Server.
[  OK  ] Started The PHP FastCGI Process Manager.
         Starting Permit User Sessions...
[  OK  ] Finished Permit User Sessions.
[  OK  ] Started Getty on tty1.
[  OK  ] Started Serial Getty on ttyS0.
[  OK  ] Started Serial Getty on ttyS1.
[  OK  ] Reached target Login Prompts.
[  OK  ] Reached target Multi-User System.
         Starting Record Runlevel Change in UTMP...
[  OK  ] Finished Record Runlevel Change in UTMP.

OpenEmbedded nodistro.0 mpfs-video-kit ttyS1

mpfs-video-kit login: 
mpfs-video-kit login: root
This is version v2025.03 of the Polarfire SoC Yocto BSP.

Updated images and documentation are available at:
        https://github.com/polarfire-soc/

root@mpfs-video-kit:~# cat /proc/mtd 
dev:    size   erasesize  name
mtd0: c0000000 00100000 "iWave-nand"
mtd1: 08000000 00001000 "spi0.0"
root@mpfs-video-kit:~# 
root@mpfs-video-kit:~# 
root@mpfs-video-kit:~# 
root@mpfs-video-kit:~#  ubiformat /dev/mtd0 
ubiformat: mtd0 (nand), size 3221225472 bytes (3.0 GiB), 3072 eraseblocks of 1048576 bytes (1024.0 KiB), min. I/O size 8192 bytes
libscan: scanning eraseblock 3071 -- 100 % complete  
ubiformat: 3068 eraseblocks have valid erase counter, mean value is 0
ubiformat: 2 eraseblocks are supposedly empty
ubiformat: 2 bad eraseblocks found, numbers: 90, 91
ubiformat: formatting eraseblock 3071 -- 100 % complete  
root@mpfs-video-kit:~#  ubiattach /dev/ubi_ctrl -m 0 
UBI device number 0, total 3070 LEBs (3168829440 bytes, 2.9 GiB), available 2908 LEBs (3001614336 bytes, 2.7 GiB), LEB size 1032192 bytes (1008.0 KiB)
root@mpfs-video-kit:~# ubimkvol /dev/ubi0 -N test -s 1GiB 
Volume ID 0, size 1041 LEBs (1074511872 bytes, 1.0 GiB), LEB size 1032192 bytes (1008.0 KiB), dynamic, name "test", alignment 1                
root@mpfs-video-kit:~#  mount -t ubifs ubi0:test /mnt/ 
root@mpfs-video-kit:~# 
root@mpfs-video-kit:~# /usr/libexec/mtd-utils/integck /mnt/ -v -e -p -m 0
integck: pid 367, testing "ubifs" at "/mnt"
integck: creating top dir integck_test_dir_367 (line 2795)
integck: fdatasyncing dir integck_test_dir_367 (line 2282)
integck: creating dir /mnt/integck_test_dir_367/882189 (line 556)
integck: creating dir /mnt/integck_test_dir_367/882189/390402 (line 556)
integck: creating file /mnt/integck_test_dir_367/937139 (line 638)
integck: write 503042 bytes, offset 0, file 937139 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/572378 ---> 882189/390402 (line 2132)
integck: write 9 bytes, offset 296846, file 937139 (line 900)
integck: write 26001 bytes, offset 503042, file 937139 (line 900)
integck: write 137280 bytes, offset 529043, file 937139 (line 900)
integck: creating file /mnt/integck_test_dir_367/890053 (line 638)
integck: write 6 bytes, offset 21219, file 937139 (line 900)
integck: write 166 bytes, offset 653211, file 937139 (line 900)
integck: write 9 bytes, offset 86273, file 937139 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/989830 ---> /mnt/integck_test_dir_367/937139 (line 683)
integck: write 794320 bytes, offset 92272, file 989830 (line 900)
integck: creating dir /mnt/integck_test_dir_367/882189/900183 (line 556)
integck: creating symlink /mnt/integck_test_dir_367/epedbfsosmxoglbabohyulvljuevsdlxherqzqootauyrpvudnywiicsjzbmibguibupspdskoaazhrnoiyvuzmjrs ---> 882189 (line 2132)
integck: write 7 bytes, offset 720844, file 989830 (line 900)
integck: write 20723 bytes, offset 886592, file 989830 (line 900)
integck: write 1446 bytes, offset 907315, file 989830 (line 900)
integck: write 143586 bytes, offset 908761, file 989830 (line 900)
integck: write 60588 bytes, offset 167167, file 989830 (line 900)
integck: creating dir /mnt/integck_test_dir_367/884992 (line 556)
integck: write 1 bytes, offset 1052347, file 989830 (line 900)
integck: write 445 bytes, offset 0, file 890053 (line 900)
integck: write 56 bytes, offset 442721, file 989830 (line 900)
integck: write 1 bytes, offset 1052348, file 989830 (line 900)
integck: creating file /mnt/integck_test_dir_367/70330 (line 638)
integck: write 1 bytes, offset 0, file 70330 (line 900)
integck: creating dir /mnt/integck_test_dir_367/314714 (line 556)
integck: write 43900 bytes, offset 1052349, file 989830 (line 900)
integck: creating dir /mnt/integck_test_dir_367/136533 (line 556)
integck: write 1 bytes, offset 378, file 890053 (line 900)
integck: write 2 bytes, offset 0, file 70330 (line 900)
integck: write 185146 bytes, offset 1096249, file 989830 (line 900)
integck: write 5 bytes, offset 2, file 70330 (line 900)
integck: write 9 bytes, offset 899179, file 989830 (line 900)
integck: write 602 bytes, offset 122381, file 989830 (line 900)
integck: write 1 bytes, offset 4, file 70330 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/933959 ---> /mnt/integck_test_dir_367/989830 (line 683)
integck: write 3940 bytes, offset 1281395, file 933959 (line 900)
integck: write 6085 bytes, offset 445, file 890053 (line 900)
integck: write 94881 bytes, offset 928325, file 933959 (line 900)
integck: write 4208633 bytes, offset 751126, file 933959 (line 900)
integck: write 7 bytes, offset 6530, file 890053 (line 900)
integck: write 74 bytes, offset 2174913, file 933959 (line 900)
integck: write 8594401 bytes, offset 7, file 70330 (line 900)
integck: write 9676477 bytes, offset 4009, file 890053 (line 900)
integck: creating file /mnt/integck_test_dir_367/664420 (line 638)
integck: write 65501 bytes, offset 4396796, file 933959 (line 900)
integck: write 1322 bytes, offset 9680486, file 890053 (line 900)
integck: write 1 bytes, offset 4959759, file 933959 (line 900)
integck: write 2300436 bytes, offset 4959760, file 933959 (line 900)
integck: write 44 bytes, offset 7260196, file 933959 (line 900)
integck: write 751 bytes, offset 8979100, file 890053 (line 900)
integck: write 795728 bytes, offset 7260240, file 933959 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/882189/228953 ---> /mnt/integck_test_dir_367/882189/390402/pwueodaypxuogdnfpahnnuoztwyiqskczdnsbxtnsswnnujqgwcojijvmrtozgoceqjxegbnbyfzfdlmntfciurfoxa)
integck: write 3 bytes, offset 8055968, file 933959 (line 900)
integck: write 732 bytes, offset 8055971, file 933959 (line 900)
integck: write 7 bytes, offset 4934829, file 933959 (line 900)
integck: write 191 bytes, offset 0, file 664420 (line 900)
integck: write 167 bytes, offset 1891900, file 933959 (line 900)
integck: write 46 bytes, offset 8056703, file 933959 (line 900)
integck: write 83 bytes, offset 8056749, file 933959 (line 900)
integck: write 79886 bytes, offset 8056832, file 933959 (line 900)
integck: write 1 bytes, offset 8594408, file 70330 (line 900)
integck: creating dir /mnt/integck_test_dir_367/710289 (line 556)
integck: write 1 bytes, offset 8136718, file 933959 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/882189/900183/owxnuymejzlzgfpfcvmevdwankhyruzlgbfqyjahdyhtxuwbonsbhqhawqyvihfmaskuxrevdnkxfguxdyfgrpkateepfxwqqqwrqofaccmvmwlasoggazmlvxchryctelgwdnh)
integck: write 2025496 bytes, offset 107, file 664420 (line 900)
integck: write 1185 bytes, offset 2846274, file 70330 (line 900)
integck: write 95287 bytes, offset 2180035, file owxnuymejzlzgfpfcvmevdwankhyruzlgbfqyjahdyhtxuwbonsbhqhawqyvihfmaskuxrevdnkxfguxdyfgrpkateepfxwqqqwrqofaccmvmwlasoggazmlvxchryctelgwdnha (line 900)
integck: write 28 bytes, offset 3373595, file owxnuymejzlzgfpfcvmevdwankhyruzlgbfqyjahdyhtxuwbonsbhqhawqyvihfmaskuxrevdnkxfguxdyfgrpkateepfxwqqqwrqofaccmvmwlasoggazmlvxchryctelgwdnha (line 900)
integck: write 368221 bytes, offset 755960, file 70330 (line 900)
integck: write 265 bytes, offset 3533420, file owxnuymejzlzgfpfcvmevdwankhyruzlgbfqyjahdyhtxuwbonsbhqhawqyvihfmaskuxrevdnkxfguxdyfgrpkateepfxwqqqwrqofaccmvmwlasoggazmlvxchryctelgwdnha (line 900)
integck: write 2306029 bytes, offset 7124291, file owxnuymejzlzgfpfcvmevdwankhyruzlgbfqyjahdyhtxuwbonsbhqhawqyvihfmaskuxrevdnkxfguxdyfgrpkateepfxwqqqwrqofaccmvmwlasoggazmlvxchryctelgwdnha (line 900)
integck: write 93957 bytes, offset 6487607, file 890053 (line 900)
integck: write 22 bytes, offset 378349, file owxnuymejzlzgfpfcvmevdwankhyruzlgbfqyjahdyhtxuwbonsbhqhawqyvihfmaskuxrevdnkxfguxdyfgrpkateepfxwqqqwrqofaccmvmwlasoggazmlvxchryctelgwdnha (line 900)
integck: write 3234312 bytes, offset 1481095, file owxnuymejzlzgfpfcvmevdwankhyruzlgbfqyjahdyhtxuwbonsbhqhawqyvihfmaskuxrevdnkxfguxdyfgrpkateepfxwqqqwrqofaccmvmwlasoggazmlvxchryctelgwdnha (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/766066 ---> /mnt/integck_test_dir_367/882189/900183/owxnuymejzlzgfpfcvmevdwankhyruzlgbfqyjahdyhtxuwbonsbhqhawqyvihfmaskuxrevdnkxfguxdyfgrpkateepfxwqq)
integck: write 5439 bytes, offset 703794, file 766066 (line 900)
integck: write 1 bytes, offset 436115, file 766066 (line 900)
integck: creating dir /mnt/integck_test_dir_367/lcqxkluclzbjpzfmaxklefnxlhrcspijdkkxwpmtqgeyjdvlazlelyfrtgrqyuawltjlvjfkifjrshnkyxeucogzkhhygglroesxtbakukgvgogxvzxnukdqavlibbnutxvurhzwjikuwbhvndms (line)
integck: creating dir /mnt/integck_test_dir_367/710289/642504 (line 556)
integck: write 4 bytes, offset 9430320, file 766066 (line 900)
integck: creating file /mnt/integck_test_dir_367/736742 (line 638)
integck: write 7662 bytes, offset 2025603, file 664420 (line 900)
integck: write 875000 bytes, offset 9681808, file 890053 (line 900)
integck: write 127455 bytes, offset 7060528, file 70330 (line 900)
integck: write 6623913 bytes, offset 9430324, file 766066 (line 900)
integck: write 51 bytes, offset 16054237, file 766066 (line 900)
integck: write 36 bytes, offset 2694672, file 890053 (line 900)
integck: write 919564 bytes, offset 10556808, file 890053 (line 900)
integck: write 1 bytes, offset 4327284, file 70330 (line 900)
integck: creating dir /mnt/integck_test_dir_367/136533/901637 (line 556)
integck: write 7 bytes, offset 519632, file 664420 (line 900)
integck: write 7 bytes, offset 2033265, file 664420 (line 900)
integck: creating file /mnt/integck_test_dir_367/688063 (line 638)
integck: write 3 bytes, offset 116896, file 664420 (line 900)
integck: write 85 bytes, offset 16054288, file 766066 (line 900)
integck: write 4 bytes, offset 11476372, file 890053 (line 900)
integck: write 4404 bytes, offset 2663011, file 890053 (line 900)
integck: write 937894 bytes, offset 3080386, file 890053 (line 900)
integck: write 6761707 bytes, offset 16054373, file 766066 (line 900)
integck: creating file /mnt/integck_test_dir_367/548772 (line 638)
integck: creating hardlink /mnt/integck_test_dir_367/56857 ---> /mnt/integck_test_dir_367/664420 (line 683)
integck: write 8 bytes, offset 11476376, file 890053 (line 900)
integck: creating file /mnt/integck_test_dir_367/511089 (line 638)
integck: write 23324 bytes, offset 4218569, file 890053 (line 900)
integck: write 779 bytes, offset 2033272, file 56857 (line 900)
integck: write 1574 bytes, offset 3588691, file 890053 (line 900)
integck: write 1 bytes, offset 9208130, file 890053 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/338132 ---> /mnt/integck_test_dir_367/766066 (line 683)
integck: write 4 bytes, offset 8594409, file 70330 (line 900)
integck: write 988 bytes, offset 8594413, file 70330 (line 900)
integck: write 527 bytes, offset 2034051, file 56857 (line 900)
integck: fdatasyncing dir /mnt/integck_test_dir_367 (line 2282)
integck: write 395299 bytes, offset 3119828, file 70330 (line 900)
integck: write 1 bytes, offset 22816080, file 338132 (line 900)
integck: write 593 bytes, offset 5700308, file 338132 (line 900)
integck: write 9 bytes, offset 18303799, file 338132 (line 900)
integck: write 48 bytes, offset 777398, file 890053 (line 900)
integck: fdatasyncing file 890053 (line 1297)
integck: write 873777 bytes, offset 0, file 338132 (line 900)
integck: write 493416 bytes, offset 22816081, file 338132 (line 900)
integck: write 53935 bytes, offset 3599158, file 70330 (line 900)
integck: fdatasyncing file 70330 (line 1297)
integck: write 810 bytes, offset 8595401, file 70330 (line 900)
integck: write 79852 bytes, offset 2585825, file 338132 (line 900)
integck: write 2127 bytes, offset 11476384, file 890053 (line 900)
integck: write 9441715 bytes, offset 11478511, file 890053 (line 900)
integck: write 94746 bytes, offset 20920226, file 890053 (line 900)
integck: write 9 bytes, offset 2285739, file 338132 (line 900)
integck: write 4 bytes, offset 13125375, file 338132 (line 900)
integck: write 26 bytes, offset 0, file 736742 (line 900)
integck: write 35 bytes, offset 21014972, file 890053 (line 900)
integck: write 4 bytes, offset 11, file 736742 (line 900)
integck: creating file /mnt/integck_test_dir_367/999764 (line 638)
integck: write 6530290 bytes, offset 23309497, file 338132 (line 900)
integck: write 393 bytes, offset 572, file 56857 (line 900)
integck: write 17945 bytes, offset 0, file 688063 (line 900)
integck: write 1 bytes, offset 9114612, file 338132 (line 900)
integck: write 9244998 bytes, offset 2034578, file 56857 (line 900)
integck: write 1 bytes, offset 17945, file 688063 (line 900)
integck: write 32 bytes, offset 2689983, file 70330 (line 900)
integck: creating dir /mnt/integck_test_dir_367/yrpejqsjjmpkmlvscyximluryskzhmhnrwrdlfjxwmszpztqqmjxkmypbihafeklkugsyhxyiyhqkafcmblh (line 556)
integck: write 415592 bytes, offset 21015007, file 890053 (line 900)
integck: write 647315 bytes, offset 29839787, file 338132 (line 900)
integck: write 23 bytes, offset 30487102, file 338132 (line 900)
integck: creating file /mnt/integck_test_dir_367/111106 (line 638)
integck: creating file /mnt/integck_test_dir_367/882189/390402/980563 (line 638)
integck: creating file /mnt/integck_test_dir_367/136533/901637/600283 (line 638)
integck: write 1603 bytes, offset 3619245, file 70330 (line 900)
integck: write 8 bytes, offset 0, file 600283 (line 900)
integck: write 967888 bytes, offset 8596211, file 70330 (line 900)
integck: creating file /mnt/integck_test_dir_367/ohbxubvnunmjtgnupltqhdgljjejrxkhozocsusacuwuuygahumbqryatbefkcwyuiyncvdcqyjwuyvdfcwowozkqtwmetbmypzzkeyqnfqirnymlbqkjqfzsnggvjyjrgzdttotrdrblfkbtvwzuxzee)
integck: write 117410 bytes, offset 30487125, file 338132 (line 900)
integck: write 5037 bytes, offset 3, file 736742 (line 900)
integck: write 495 bytes, offset 520, file 736742 (line 900)
integck: creating file /mnt/integck_test_dir_367/76191 (line 638)
integck: write 485 bytes, offset 9564099, file 70330 (line 900)
integck: write 94659 bytes, offset 0, file 76191 (line 900)
integck: write 8 bytes, offset 0, file 999764 (line 900)
integck: write 16981 bytes, offset 23825595, file 338132 (line 900)
integck: write 3 bytes, offset 18868048, file 338132 (line 900)
integck: write 1 bytes, offset 15001069, file 338132 (line 900)
integck: write 229378 bytes, offset 20858392, file 890053 (line 900)
integck: creating file /mnt/integck_test_dir_367/585201 (line 638)
integck: creating dir /mnt/integck_test_dir_367/27468 (line 556)
integck: write 368 bytes, offset 13563825, file 338132 (line 900)
integck: write 359109 bytes, offset 0, file ohbxubvnunmjtgnupltqhdgljjejrxkhozocsusacuwuuygahumbqryatbefkcwyuiyncvdcqyjwuyvdfcwowozkqtwmetbmypzzkeyqnfqirnymlbqkjqfzsnggvjyjrgzdttotrdrblfkbtvwzuxzeejgore)
integck: write 5139594 bytes, offset 15153306, file 890053 (line 900)
integck: write 4 bytes, offset 359109, file ohbxubvnunmjtgnupltqhdgljjejrxkhozocsusacuwuuygahumbqryatbefkcwyuiyncvdcqyjwuyvdfcwowozkqtwmetbmypzzkeyqnfqirnymlbqkjqfzsnggvjyjrgzdttotrdrblfkbtvwzuxzeejgore)
integck: write 1672 bytes, offset 818839, file 56857 (line 900)
integck: write 628307 bytes, offset 30604535, file 338132 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/907088 ---> /mnt/integck_test_dir_367/136533/901637/600283 (line 683)
integck: creating file /mnt/integck_test_dir_367/925538 (line 638)
integck: creating hardlink /mnt/integck_test_dir_367/136533/901637/389061 ---> /mnt/integck_test_dir_367/338132 (line 683)
integck: write 374293 bytes, offset 9564584, file 70330 (line 900)
integck: write 5 bytes, offset 9938877, file 70330 (line 900)
integck: write 786 bytes, offset 31232842, file 389061 (line 900)
integck: write 1 bytes, offset 1335998, file 70330 (line 900)
integck: write 4155982 bytes, offset 320416, file 56857 (line 900)
integck: write 5971 bytes, offset 4710776, file 56857 (line 900)
integck: write 447 bytes, offset 19431985, file 389061 (line 900)
integck: creating dir /mnt/integck_test_dir_367/751408 (line 556)
integck: write 416015 bytes, offset 9938882, file 70330 (line 900)
integck: write 7972 bytes, offset 3309, file 736742 (line 900)
integck: write 1 bytes, offset 10172002, file 389061 (line 900)
integck: write 1 bytes, offset 10354897, file 70330 (line 900)
integck: write 864523 bytes, offset 28509888, file 389061 (line 900)
integck: write 2725 bytes, offset 3498654, file 70330 (line 900)
integck: write 28 bytes, offset 31233628, file 389061 (line 900)
integck: creating file /mnt/integck_test_dir_367/136533/901637/nrzaryjetbdepvrpyceovatetbhirfvoazakqhwygtwbvxakirzlvfdicybmaysucfumoopynlpxxfuhdigwpzhpvjppiajtklwzfqdhzqcgyptfbfgeknbhcvcdden (line 638)
integck: write 1 bytes, offset 1315786, file 56857 (line 900)
integck: creating dir /mnt/integck_test_dir_367/314714/aldbfhtlutqzsnzfsjmrdtdutzuqjmgmipsnpzexzochsytctdasbkbbfcjcqzxrotjlrjbnrppfwvmahacbkgccysdxjlwnmkuyie (line 556)
integck: write 59429 bytes, offset 21430599, file 890053 (line 900)
integck: write 3 bytes, offset 11279576, file 56857 (line 900)
integck: write 1 bytes, offset 11281, file 736742 (line 900)
integck: write 5128059 bytes, offset 31233656, file 389061 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/183571 ---> /mnt/integck_test_dir_367/136533/901637/389061 (line 683)
integck: write 434 bytes, offset 4320770, file 56857 (line 900)
integck: write 4 bytes, offset 94659, file 76191 (line 900)
integck: creating file /mnt/integck_test_dir_367/225502 (line 638)
integck: creating dir /mnt/integck_test_dir_367/751408/827223 (line 556)
integck: write 415 bytes, offset 10354898, file 70330 (line 900)
integck: write 32908 bytes, offset 0, file 925538 (line 900)
integck: write 563 bytes, offset 21490028, file 890053 (line 900)
integck: write 727433 bytes, offset 25104946, file 183571 (line 900)
integck: write 77324 bytes, offset 12415990, file 183571 (line 900)
integck: creating dir /mnt/integck_test_dir_367/618571 (line 556)
integck: creating hardlink /mnt/integck_test_dir_367/917579 ---> /mnt/integck_test_dir_367/585201 (line 683)
integck: write 147095 bytes, offset 36361715, file 183571 (line 900)
integck: creating file /mnt/integck_test_dir_367/340151 (line 638)
integck: write 9 bytes, offset 9016813, file 70330 (line 900)
integck: write 90 bytes, offset 13501006, file 890053 (line 900)
integck: write 35 bytes, offset 11282, file 736742 (line 900)
integck: creating dir /mnt/integck_test_dir_367/edfnavxqrcolcspvpyqdhiksutbntilhtsextxnjmrxlnhoyiyjvxucpinzvgebcnsslsyprefstdnjrcagyioilpmeodibopmdybgysaltptdyjcyxmqlxuwcortvpvkfxhpmmsdqqeyavsyjjitujygd)
integck: write 123798 bytes, offset 11317, file 736742 (line 900)
integck: write 2 bytes, offset 0, file 917579 (line 900)
integck: write 968628 bytes, offset 24410171, file 183571 (line 900)
integck: write 2 bytes, offset 36508810, file 183571 (line 900)
integck: write 1 bytes, offset 4414244, file 70330 (line 900)
integck: write 702181 bytes, offset 638368, file 70330 (line 900)
integck: write 1 bytes, offset 36508812, file 183571 (line 900)
integck: write 6367 bytes, offset 0, file 183571 (line 900)
integck: write 1615955 bytes, offset 0, file 340151 (line 900)
integck: write 6 bytes, offset 36508813, file 183571 (line 900)
integck: creating file /mnt/integck_test_dir_367/254635 (line 638)
integck: write 4825328 bytes, offset 21490591, file 890053 (line 900)
integck: write 7 bytes, offset 1615955, file 340151 (line 900)
integck: write 1 bytes, offset 15502949, file 183571 (line 900)
integck: creating file /mnt/integck_test_dir_367/510194 (line 638)
integck: write 409 bytes, offset 8, file 999764 (line 900)
integck: write 1 bytes, offset 2, file 917579 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/882189/853592 ---> /mnt/integck_test_dir_367/917579 (line 683)
integck: write 2 bytes, offset 36508819, file 183571 (line 900)
integck: write 71664 bytes, offset 10355313, file 70330 (line 900)
integck: creating file /mnt/integck_test_dir_367/63236 (line 638)
integck: write 531812 bytes, offset 0, file 63236 (line 900)
integck: write 941 bytes, offset 36508821, file 183571 (line 900)
integck: write 1 bytes, offset 135115, file 736742 (line 900)
integck: write 8 bytes, offset 1, file 853592 (line 900)
integck: write 1 bytes, offset 11279579, file 56857 (line 900)
integck: write 3538 bytes, offset 0, file 225502 (line 900)
integck: write 17 bytes, offset 424113, file 70330 (line 900)
integck: write 38998 bytes, offset 6, file 853592 (line 900)
integck: write 6 bytes, offset 36509762, file 183571 (line 900)
integck: creating file /mnt/integck_test_dir_367/sosgbzrwyzjpgymlutbttdhvpicwddabytmlsmfybchx (line 638)
integck: write 1 bytes, offset 26315919, file 890053 (line 900)
integck: write 2925 bytes, offset 0, file 111106 (line 900)
integck: write 809009 bytes, offset 3248041, file 70330 (line 900)
integck: write 3801 bytes, offset 10426977, file 70330 (line 900)
integck: write 115998 bytes, offset 39004, file 853592 (line 900)
integck: write 1687815 bytes, offset 0, file 254635 (line 900)
integck: write 2459 bytes, offset 36509768, file 183571 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/112238 ---> /mnt/integck_test_dir_367/56857 (line 683)
integck: creating hardlink /mnt/integck_test_dir_367/641230 ---> /mnt/integck_test_dir_367/70330 (line 683)
integck: write 1 bytes, offset 36512227, file 183571 (line 900)
integck: write 581512 bytes, offset 36345138, file 183571 (line 900)
integck: write 1 bytes, offset 2755092, file 890053 (line 900)
integck: write 4122309 bytes, offset 99600, file 736742 (line 900)
integck: write 9488 bytes, offset 10218312, file 112238 (line 900)
integck: write 8262 bytes, offset 26315920, file 890053 (line 900)
integck: write 212 bytes, offset 719659, file 736742 (line 900)
integck: write 8 bytes, offset 761556, file 254635 (line 900)
integck: write 1 bytes, offset 36926650, file 183571 (line 900)
integck: write 3886 bytes, offset 8928295, file 641230 (line 900)
integck: write 1 bytes, offset 26324182, file 890053 (line 900)
integck: write 1 bytes, offset 6471242, file 641230 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/lcqxkluclzbjpzfmaxklefnxlhrcspijdkkxwpmtqgeyjdvlazlelyfrtgrqyuawltjlvjfkifjrshnkyxeucogzkhhygglroesxtbakukgvgogxvzxnukdqavlibbnutxvurhzwjikuwbhvndms/)
integck: creating hardlink /mnt/integck_test_dir_367/edfnavxqrcolcspvpyqdhiksutbntilhtsextxnjmrxlnhoyiyjvxucpinzvgebcnsslsyprefstdnjrcagyioilpmeodibopmdybgysaltptdyjcyxmqlxuwcortvpvkfxhpmmsdqqeyavsyjjit)
integck: write 1 bytes, offset 22050371, file 362857 (line 900)
integck: creating file /mnt/integck_test_dir_367/kxvmumojjrfbtcvazrxligwtgqirhtdxjvyvfaxowmrdqvarirutnuuieqfhufilcpuqxbirgtaggpfmdoccymnrjwlbfsulxpwvoeqzgjbuhzpietlveiilewkeewodcqvbkbbrxkridjkftlmuoysbc)
integck: creating file /mnt/integck_test_dir_367/62957 (line 638)
integck: creating dir /mnt/integck_test_dir_367/291994 (line 556)
integck: write 1968 bytes, offset 17304729, file 890053 (line 900)
integck: write 762454 bytes, offset 9550445, file 112238 (line 900)
integck: write 6274 bytes, offset 17946, file 688063 (line 900)
integck: write 777 bytes, offset 4221909, file 736742 (line 900)
integck: write 1 bytes, offset 4764525, file 641230 (line 900)
integck: write 120 bytes, offset 1868742, file 890053 (line 900)
integck: write 47313 bytes, offset 0, file kxvmumojjrfbtcvazrxligwtgqirhtdxjvyvfaxowmrdqvarirutnuuieqfhufilcpuqxbirgtaggpfmdoccymnrjwlbfsulxpwvoeqzgjbuhzpietlveiilewkeewodcqvbkbbrxkridjkftlmuoysbcadcvgb)
integck: write 6 bytes, offset 18903424, file 890053 (line 900)
integck: write 4 bytes, offset 26324183, file 890053 (line 900)
integck: write 2167 bytes, offset 11279580, file 112238 (line 900)
integck: creating file /mnt/integck_test_dir_367/dejjbrubdayulyxjhbofrsbbjupkketfknuihghlqezeoxfmnpfitjdigvrbryhqjovocweddvsclifwhilpsqrqbxoikuzsfleyobbqowzjaeqsegigbslolzcrosotsdzrexqjwzenydeljyifckzbj)
integck: creating file /mnt/integck_test_dir_367/247004 (line 638)
integck: write 68584 bytes, offset 69, file 999764 (line 900)
integck: write 2308040 bytes, offset 45251711, file 362857 (line 900)
integck: write 30 bytes, offset 531812, file 63236 (line 900)
integck: write 11 bytes, offset 47559751, file 362857 (line 900)
integck: write 31 bytes, offset 749175, file 254635 (line 900)
integck: write 252404 bytes, offset 26324187, file 890053 (line 900)
integck: write 3439 bytes, offset 26576591, file 890053 (line 900)
integck: write 42950 bytes, offset 4214129, file 736742 (line 900)
integck: creating dir /mnt/integck_test_dir_367/884992/997568 (line 556)
integck: creating hardlink /mnt/integck_test_dir_367/641060 ---> /mnt/integck_test_dir_367/lcqxkluclzbjpzfmaxklefnxlhrcspijdkkxwpmtqgeyjdvlazlelyfrtgrqyuawltjlvjfkifjrshnkyxeucogzkhhygglroesxtbakukgvgog)
integck: write 56816 bytes, offset 359113, file ohbxubvnunmjtgnupltqhdgljjejrxkhozocsusacuwuuygahumbqryatbefkcwyuiyncvdcqyjwuyvdfcwowozkqtwmetbmypzzkeyqnfqirnymlbqkjqfzsnggvjyjrgzdttotrdrblfkbtvwzuxzeej)
integck: write 389220 bytes, offset 26580030, file 890053 (line 900)
integck: write 243675 bytes, offset 19766266, file 641060 (line 900)
integck: creating dir /mnt/integck_test_dir_367/29700 (line 556)
integck: write 1 bytes, offset 13720722, file 641060 (line 900)
integck: write 7 bytes, offset 47559762, file 641060 (line 900)
integck: write 1376 bytes, offset 19470221, file 641060 (line 900)
integck: write 1898 bytes, offset 3169504, file 112238 (line 900)
integck: creating dir /mnt/integck_test_dir_367/yrpejqsjjmpkmlvscyximluryskzhmhnrwrdlfjxwmszpztqqmjxkmypbihafeklkugsyhxyiyhqkafcmblh/wpmrvttfdlxmihirjxjhnleqbavudanguodgpxwckgfviwmrwwuzusidrkeqnvsjcxpon)
integck: write 1 bytes, offset 26969250, file 890053 (line 900)
integck: write 85 bytes, offset 0, file dejjbrubdayulyxjhbofrsbbjupkketfknuihghlqezeoxfmnpfitjdigvrbryhqjovocweddvsclifwhilpsqrqbxoikuzsfleyobbqowzjaeqsegigbslolzcrosotsdzrexqjwzenydeljyifckzbjnxuuzweeu)
integck: write 37483 bytes, offset 26969251, file 890053 (line 900)
integck: write 1 bytes, offset 9118748, file 112238 (line 900)
integck: write 1 bytes, offset 51901, file 999764 (line 900)
integck: write 62774 bytes, offset 415929, file ohbxubvnunmjtgnupltqhdgljjejrxkhozocsusacuwuuygahumbqryatbefkcwyuiyncvdcqyjwuyvdfcwowozkqtwmetbmypzzkeyqnfqirnymlbqkjqfzsnggvjyjrgzdttotrdrblfkbtvwzuxzeej)
integck: write 4047295 bytes, offset 11281747, file 112238 (line 900)
integck: creating file /mnt/integck_test_dir_367/249883 (line 638)
integck: write 50 bytes, offset 85710, file 76191 (line 900)
integck: write 12958 bytes, offset 6677432, file 112238 (line 900)
integck: write 1 bytes, offset 4235235, file 890053 (line 900)
integck: write 7739 bytes, offset 9298892, file 890053 (line 900)
integck: write 1 bytes, offset 15329042, file 112238 (line 900)
integck: write 8409405 bytes, offset 32759447, file 641060 (line 900)
integck: write 47210 bytes, offset 27006734, file 890053 (line 900)
integck: creating file /mnt/integck_test_dir_367/hzwjmdnvwn (line 638)
integck: write 2 bytes, offset 0, file 510194 (line 900)
integck: write 1 bytes, offset 0, file 249883 (line 900)
integck: write 4105671 bytes, offset 15329043, file 112238 (line 900)
integck: write 724973 bytes, offset 1687815, file 254635 (line 900)
integck: write 6022883 bytes, offset 14687465, file 641230 (line 900)
integck: write 91986 bytes, offset 3538, file 225502 (line 900)
integck: write 1 bytes, offset 4257079, file 736742 (line 900)
integck: write 5051173 bytes, offset 27053944, file 890053 (line 900)
integck: write 573307 bytes, offset 0, file 249883 (line 900)
integck: write 1 bytes, offset 32105117, file 890053 (line 900)
integck: write 24 bytes, offset 5603644, file 641060 (line 900)
integck: write 1 bytes, offset 32105118, file 890053 (line 900)
integck: write 3177 bytes, offset 47559769, file 641060 (line 900)
integck: write 83124 bytes, offset 19434714, file 112238 (line 900)
integck: write 82 bytes, offset 47562946, file 641060 (line 900)
integck: write 819 bytes, offset 0, file 511089 (line 900)
integck: write 243 bytes, offset 2925, file 111106 (line 900)
integck: write 9330 bytes, offset 0, file 548772 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/627821 ---> /mnt/integck_test_dir_367/dejjbrubdayulyxjhbofrsbbjupkketfknuihghlqezeoxfmnpfitjdigvrbryhqjovocweddvsclifwhilpsqrqbxoikuzsfleyobbqowzjaeq)
integck: write 74 bytes, offset 47563028, file 641060 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/295571 ---> /mnt/integck_test_dir_367/627821 (line 683)
integck: write 43 bytes, offset 361019, file 434071 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/52632 ---> /mnt/integck_test_dir_367/edfnavxqrcolcspvpyqdhiksutbntilhtsextxnjmrxlnhoyiyjvxucpinzvgebcnsslsyprefstdnjrcagyioilpmeodibopmdybgysaltptdyjc)
integck: write 9 bytes, offset 3099126, file 641060 (line 900)
integck: write 1 bytes, offset 4257080, file 736742 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/645175 ---> /mnt/integck_test_dir_367/641060 (line 683)
integck: write 1613 bytes, offset 29058027, file 645175 (line 900)
integck: write 3307286 bytes, offset 32105119, file 890053 (line 900)
integck: write 598550 bytes, offset 95524, file 225502 (line 900)
integck: write 84344 bytes, offset 4257081, file 736742 (line 900)
integck: write 723 bytes, offset 16269439, file 645175 (line 900)
integck: creating dir /mnt/integck_test_dir_367/dwrfyrmfqdeoirsckhmrnvrknpayhlgaelvklbjbxoqjjkjuumhxzdjpxwrjbdtkgdhgsnohufsvwyloyipplykbgzkztlonjhecczjvtwwljapzfludshvkkggjfnkojfpdyq (line 556)
integck: write 483581 bytes, offset 2501576, file 641230 (line 900)
integck: write 70 bytes, offset 20710348, file 641230 (line 900)
integck: write 1 bytes, offset 3028254, file 645175 (line 900)
integck: write 128470 bytes, offset 14689564, file 645175 (line 900)
integck: write 1 bytes, offset 0, file 645175 (line 900)
integck: write 4329 bytes, offset 85, file 295571 (line 900)
integck: write 326877 bytes, offset 47563102, file 645175 (line 900)
integck: write 712 bytes, offset 4043124, file 890053 (line 900)
integck: write 3680 bytes, offset 35412405, file 890053 (line 900)
integck: write 4685132 bytes, offset 47889979, file 645175 (line 900)
integck: fsyncing file 645175 (line 1292)
integck: creating dir /mnt/integck_test_dir_367/515410 (line 556)
integck: write 665 bytes, offset 9924525, file 641230 (line 900)
integck: write 590365 bytes, offset 35416085, file 890053 (line 900)
integck: write 4814 bytes, offset 10973791, file 645175 (line 900)
integck: write 2 bytes, offset 52575111, file 645175 (line 900)
integck: write 1001 bytes, offset 19517838, file 112238 (line 900)
integck: write 7 bytes, offset 47560196, file 645175 (line 900)
integck: write 5 bytes, offset 1678222, file 736742 (line 900)
integck: write 966 bytes, offset 36006450, file 890053 (line 900)
integck: write 9043382 bytes, offset 36007416, file 890053 (line 900)
integck: write 80 bytes, offset 51131440, file 645175 (line 900)
integck: write 29688 bytes, offset 8276760, file 641230 (line 900)
integck: creating dir /mnt/integck_test_dir_367/884992/997568/198717 (line 556)
integck: write 14 bytes, offset 0, file 62957 (line 900)
integck: write 73 bytes, offset 155002, file 853592 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/754140 ---> /mnt/integck_test_dir_367/225502 (line 683)
integck: creating hardlink /mnt/integck_test_dir_367/aruwidvvgfpaiutmssqmcozqmfczpiwvkaxhqbfdvleuoeizpjtpexengdxdgstrfrwhsyeyvdrqqppwvveglgwwlgbomucbicbviusnqogcfmtdcgjvfgipi ---> /mnt/integck_test_dir_)
integck: write 31 bytes, offset 531842, file 63236 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/314714/705457 ---> /mnt/integck_test_dir_367/sosgbzrwyzjpgymlutbttdhvpicwddabytmlsmfybchx (line 683)
integck: write 2520164 bytes, offset 316163, file 249883 (line 900)
integck: write 99 bytes, offset 155075, file 853592 (line 900)
integck: write 85404 bytes, offset 4341425, file 736742 (line 900)
integck: write 24669 bytes, offset 317, file 511089 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/otdrahhbtxwnlvkhyjbyhoupllkdghvksmbqljdjngkrlhopjnbyhibfebyegqxfgybhecyffpnopotekevfjymuocmjhxzoztntypfdewkpbwtjeotvxkgkfowgwhlieibsijsavsjojsjcrzdey)
integck: creating file /mnt/integck_test_dir_367/639391 (line 638)
integck: write 83 bytes, offset 4426829, file 736742 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/238243 ---> /mnt/integck_test_dir_367/otdrahhbtxwnlvkhyjbyhoupllkdghvksmbqljdjngkrlhopjnbyhibfebyegqxfgybhecyffpnopotekevfjymuocmjhxzoztntypfdewkpbwt)
integck: write 153699 bytes, offset 21869, file 925538 (line 900)
integck: write 67336 bytes, offset 20710418, file 641230 (line 900)
integck: write 4 bytes, offset 51661, file 853592 (line 900)
integck: write 1 bytes, offset 52575113, file 238243 (line 900)
integck: write 42126 bytes, offset 61016, file 925538 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/372829 ---> /mnt/integck_test_dir_367/925538 (line 683)
integck: write 1 bytes, offset 0, file 238243 (line 900)
integck: write 6077141 bytes, offset 0, file 111106 (line 900)
integck: fdatasyncing dir /mnt/integck_test_dir_367 (line 2282)
integck: write 8 bytes, offset 41794426, file 238243 (line 900)
integck: write 5 bytes, offset 20777754, file 641230 (line 900)
integck: write 5 bytes, offset 52575114, file 238243 (line 900)
integck: write 8985 bytes, offset 18122084, file 890053 (line 900)
integck: write 1 bytes, offset 52575119, file 238243 (line 900)
integck: write 7180510 bytes, offset 20777759, file 641230 (line 900)
integck: write 4883930 bytes, offset 17464375, file 890053 (line 900)
integck: write 1 bytes, offset 20479403, file 238243 (line 900)
integck: write 6266361 bytes, offset 41088177, file 238243 (line 900)
integck: write 34963 bytes, offset 52575120, file 238243 (line 900)
integck: write 7410533 bytes, offset 17914842, file 641230 (line 900)
integck: write 6612 bytes, offset 694074, file 754140 (line 900)
integck: write 8377 bytes, offset 52610083, file 238243 (line 900)
integck: write 266684 bytes, offset 47253870, file 238243 (line 900)
integck: write 7927 bytes, offset 155174, file 853592 (line 900)
integck: write 759 bytes, offset 27958269, file 641230 (line 900)
integck: write 11252 bytes, offset 47313, file kxvmumojjrfbtcvazrxligwtgqirhtdxjvyvfaxowmrdqvarirutnuuieqfhufilcpuqxbirgtaggpfmdoccymnrjwlbfsulxpwvoeqzgjbuhzpietlveiilewkeewodcqvbkbbrxkridjkftlmuoysbcad)
integck: write 4451081 bytes, offset 52618460, file 238243 (line 900)
integck: write 11573 bytes, offset 75793, file 853592 (line 900)
integck: write 13 bytes, offset 57069541, file 238243 (line 900)
integck: write 61 bytes, offset 11007725, file 112238 (line 900)
integck: write 3649 bytes, offset 13146722, file 238243 (line 900)
integck: write 5836 bytes, offset 18838178, file 890053 (line 900)
integck: write 1 bytes, offset 71262, file 63236 (line 900)
integck: write 2368125 bytes, offset 0, file 853592 (line 900)
integck: write 6 bytes, offset 57069554, file 238243 (line 900)
integck: write 4515000 bytes, offset 2186, file 295571 (line 900)
integck: write 1 bytes, offset 237815, file ohbxubvnunmjtgnupltqhdgljjejrxkhozocsusacuwuuygahumbqryatbefkcwyuiyncvdcqyjwuyvdfcwowozkqtwmetbmypzzkeyqnfqirnymlbqkjqfzsnggvjyjrgzdttotrdrblfkbtvwzuxzeejgore)
integck: write 1114851 bytes, offset 4426912, file 736742 (line 900)
integck: creating file /mnt/integck_test_dir_367/242251 (line 638)
integck: creating hardlink /mnt/integck_test_dir_367/590478 ---> /mnt/integck_test_dir_367/641230 (line 683)
integck: creating file /mnt/integck_test_dir_367/yrpejqsjjmpkmlvscyximluryskzhmhnrwrdlfjxwmszpztqqmjxkmypbihafeklkugsyhxyiyhqkafcmblh/wpmrvttfdlxmihirjxjhnleqbavudanguodgpxwckgfviwmrwwuzusidrkeqnvsjcxpo)
integck: write 22 bytes, offset 3920553, file 736742 (line 900)
integck: write 5984 bytes, offset 18718202, file 112238 (line 900)
integck: write 6804709 bytes, offset 25093892, file 890053 (line 900)
integck: write 2840358 bytes, offset 57069560, file 238243 (line 900)
integck: creating file /mnt/integck_test_dir_367/726765 (line 638)
integck: write 87463 bytes, offset 25056480, file 590478 (line 900)
integck: write 1 bytes, offset 59909918, file 238243 (line 900)
integck: write 4376081 bytes, offset 59909919, file 238243 (line 900)
integck: write 1 bytes, offset 64286000, file 238243 (line 900)
integck: write 4 bytes, offset 8936709, file 890053 (line 900)
integck: write 2840 bytes, offset 25460404, file 590478 (line 900)
integck: write 1 bytes, offset 45050798, file 890053 (line 900)
integck: write 10649 bytes, offset 23775276, file 238243 (line 900)
integck: write 17 bytes, offset 9729311, file 238243 (line 900)
integck: write 6260567 bytes, offset 4517186, file 295571 (line 900)
integck: write 993743 bytes, offset 12889709, file 112238 (line 900)
integck: write 4228 bytes, offset 64286001, file 238243 (line 900)
integck: write 323 bytes, offset 27959028, file 590478 (line 900)
integck: write 204343 bytes, offset 1645361, file 590478 (line 900)
integck: write 1 bytes, offset 2368125, file 853592 (line 900)
integck: write 2 bytes, offset 2368126, file 853592 (line 900)
integck: write 729 bytes, offset 2095404, file 249883 (line 900)
integck: write 6 bytes, offset 2836327, file 249883 (line 900)
integck: write 7209127 bytes, offset 19518839, file 112238 (line 900)
integck: write 1 bytes, offset 57528168, file 238243 (line 900)
integck: creating file /mnt/integck_test_dir_367/sehfzplapusvcwqyvcifglkbupbfsrjfegbpmbooshlhjzijzkyxsaxuhpnjgtfcfdkevrcpygxqjnpe (line 638)
integck: write 1277528 bytes, offset 45050799, file 890053 (line 900)
integck: creating dir /mnt/integck_test_dir_367/148150 (line 556)
integck: write 1 bytes, offset 21564609, file 890053 (line 900)
integck: write 4034 bytes, offset 47747481, file 238243 (line 900)
integck: write 9069 bytes, offset 27959351, file 590478 (line 900)
integck: write 139459 bytes, offset 27968420, file 590478 (line 900)
integck: write 2508084 bytes, offset 22993118, file 890053 (line 900)
integck: write 5 bytes, offset 28107879, file 590478 (line 900)
integck: write 6 bytes, offset 5541763, file 736742 (line 900)
integck: write 4708 bytes, offset 3608859, file 238243 (line 900)
integck: write 8 bytes, offset 64290229, file 238243 (line 900)
integck: write 1 bytes, offset 48952111, file 238243 (line 900)
integck: write 1 bytes, offset 84475, file 372829 (line 900)
integck: write 9303066 bytes, offset 12600616, file 590478 (line 900)
integck: write 1 bytes, offset 11499977, file 238243 (line 900)
integck: write 902 bytes, offset 5541769, file 736742 (line 900)
integck: write 8708 bytes, offset 4886270, file 238243 (line 900)
integck: write 9242 bytes, offset 4963131, file 736742 (line 900)
integck: write 350 bytes, offset 25952193, file 238243 (line 900)
integck: write 2534608 bytes, offset 2368128, file 853592 (line 900)
integck: fsyncing dir /mnt/integck_test_dir_367 (line 2277)
integck: write 1295 bytes, offset 46328327, file 890053 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/447727 ---> /mnt/integck_test_dir_367/754140 (line 683)
integck: creating file /mnt/integck_test_dir_367/dwrfyrmfqdeoirsckhmrnvrknpayhlgaelvklbjbxoqjjkjuumhxzdjpxwrjbdtkgdhgsnohufsvwyloyipplykbgzkztlonjhecczjvtwwljapzfludshvkkggjfnkojfpdyq/243512 (line 638)
integck: write 9 bytes, offset 4934894, file 112238 (line 900)
integck: write 85231 bytes, offset 64290237, file 238243 (line 900)
integck: write 615874 bytes, offset 28817022, file 238243 (line 900)
integck: write 6122356 bytes, offset 46329622, file 890053 (line 900)
integck: write 1081 bytes, offset 5542671, file 736742 (line 900)
integck: write 714009 bytes, offset 0, file 726765 (line 900)
integck: write 1 bytes, offset 3328662, file 853592 (line 900)
integck: write 27 bytes, offset 16918187, file 238243 (line 900)
integck: write 1 bytes, offset 1324174, file 736742 (line 900)
integck: write 15577 bytes, offset 2719749, file 249883 (line 900)
integck: write 8482421 bytes, offset 11089389, file 890053 (line 900)
integck: write 85028 bytes, offset 88871, file 372829 (line 900)
integck: write 6896 bytes, offset 64375468, file 238243 (line 900)
integck: write 914005 bytes, offset 26497042, file 590478 (line 900)
integck: write 7 bytes, offset 5543752, file 736742 (line 900)
integck: write 9 bytes, offset 48132723, file 890053 (line 900)
integck: write 1 bytes, offset 5543759, file 736742 (line 900)
integck: write 205 bytes, offset 965640, file 736742 (line 900)
integck: write 1 bytes, offset 22521638, file 238243 (line 900)
integck: write 94 bytes, offset 2991258, file 736742 (line 900)
integck: write 1 bytes, offset 14558930, file 112238 (line 900)
integck: write 849 bytes, offset 2836333, file 249883 (line 900)
integck: write 7976 bytes, offset 31829, file 999764 (line 900)
integck: write 1327 bytes, offset 4902736, file 853592 (line 900)
integck: write 30 bytes, offset 28107884, file 590478 (line 900)
integck: write 2372 bytes, offset 0, file 705457 (line 900)
integck: write 42960 bytes, offset 5543760, file 736742 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/116575 ---> /mnt/integck_test_dir_367/510194 (line 683)
integck: write 1 bytes, offset 1107722, file 853592 (line 900)
integck: creating file /mnt/integck_test_dir_367/44277 (line 638)
integck: write 29528 bytes, offset 17885075, file 890053 (line 900)
integck: write 2040 bytes, offset 52451978, file 890053 (line 900)
integck: write 5088 bytes, offset 4904063, file 853592 (line 900)
integck: write 542 bytes, offset 52454018, file 890053 (line 900)
integck: write 5065 bytes, offset 546086, file 853592 (line 900)
integck: write 14490 bytes, offset 52454560, file 890053 (line 900)
integck: creating dir /mnt/integck_test_dir_367/126522 (line 556)
integck: write 29 bytes, offset 1174159, file 736742 (line 900)
integck: write 715386 bytes, offset 5586720, file 736742 (line 900)
integck: write 567 bytes, offset 28107914, file 590478 (line 900)
integck: write 1 bytes, offset 64382364, file 238243 (line 900)
integck: write 7043 bytes, offset 57460987, file 238243 (line 900)
integck: write 55379 bytes, offset 52469050, file 890053 (line 900)
integck: write 2263 bytes, offset 2038785, file 112238 (line 900)
integck: write 1 bytes, offset 28108481, file 590478 (line 900)
integck: write 5911392 bytes, offset 8, file 907088 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/515410/475603 ---> /mnt/integck_test_dir_367/295571 (line 683)
integck: write 88 bytes, offset 36320558, file 238243 (line 900)
integck: creating file /mnt/integck_test_dir_367/yrpejqsjjmpkmlvscyximluryskzhmhnrwrdlfjxwmszpztqqmjxkmypbihafeklkugsyhxyiyhqkafcmblh/787699 (line 638)
integck: write 660 bytes, offset 4909151, file 853592 (line 900)
integck: write 9 bytes, offset 20570933, file 238243 (line 900)
integck: write 3662880 bytes, offset 64382365, file 238243 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/66304 ---> /mnt/integck_test_dir_367/edfnavxqrcolcspvpyqdhiksutbntilhtsextxnjmrxlnhoyiyjvxucpinzvgebcnsslsyprefstdnjrcagyioilpmeodibopmdybgysaltptdyjc)
integck: write 57496 bytes, offset 28941866, file 890053 (line 900)
integck: write 87 bytes, offset 52524429, file 890053 (line 900)
integck: write 3 bytes, offset 23394663, file 590478 (line 900)
integck: write 2327488 bytes, offset 68045245, file 238243 (line 900)
integck: write 9 bytes, offset 52524516, file 890053 (line 900)
integck: write 1 bytes, offset 16973043, file 238243 (line 900)
integck: write 1 bytes, offset 4909811, file 853592 (line 900)
integck: write 694 bytes, offset 9720069, file 238243 (line 900)
integck: write 949 bytes, offset 52524525, file 890053 (line 900)
integck: write 235 bytes, offset 12707002, file 238243 (line 900)
integck: write 504 bytes, offset 4301786, file 112238 (line 900)
integck: write 3969788 bytes, offset 38405537, file 238243 (line 900)
integck: write 1 bytes, offset 0, file 238243 (line 900)
integck: write 4242867 bytes, offset 34565865, file 890053 (line 900)
integck: write 2830501 bytes, offset 0, file 44277 (line 900)
integck: write 28377 bytes, offset 0, file 372829 (line 900)
integck: write 1 bytes, offset 0, file nrzaryjetbdepvrpyceovatetbhirfvoazakqhwygtwbvxakirzlvfdicybmaysucfumoopynlpxxfuhdigwpzhpvjppiajtklwzfqdhzqcgyptfbfgeknbhcvcdden (line 900)
integck: write 1 bytes, offset 34645, file ohbxubvnunmjtgnupltqhdgljjejrxkhozocsusacuwuuygahumbqryatbefkcwyuiyncvdcqyjwuyvdfcwowozkqtwmetbmypzzkeyqnfqirnymlbqkjqfzsnggvjyjrgzdttotrdrblfkbtvwzuxzeejgoreu)
integck: write 3954136 bytes, offset 6302106, file 736742 (line 900)
integck: write 44 bytes, offset 94663, file 76191 (line 900)
integck: write 6558 bytes, offset 35885332, file 238243 (line 900)
integck: creating dir /mnt/integck_test_dir_367/213413 (line 556)
integck: write 1 bytes, offset 28108482, file 590478 (line 900)
integck: write 482541 bytes, offset 4045, file 372829 (line 900)
integck: write 1913978 bytes, offset 41986363, file 890053 (line 900)
integck: creating file /mnt/integck_test_dir_367/213413/236213 (line 638)
integck: write 54 bytes, offset 24537893, file 112238 (line 900)
integck: write 986 bytes, offset 486586, file 372829 (line 900)
integck: write 54808 bytes, offset 14460284, file 238243 (line 900)
integck: write 7 bytes, offset 70372733, file 238243 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/743721 ---> /mnt/integck_test_dir_367/sehfzplapusvcwqyvcifglkbupbfsrjfegbpmbooshlhjzijzkyxsaxuhpnjgtfcfdkevrcpygxqjnpe (line 683)
integck: write 1 bytes, offset 37181926, file 890053 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/480175 ---> 291994 (line 2132)
integck: write 68 bytes, offset 2188610, file 853592 (line 900)
integck: write 1 bytes, offset 4007911, file 853592 (line 900)
integck: write 1 bytes, offset 4020167, file 736742 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/314714/640823 ---> /mnt/integck_test_dir_367/238243 (line 683)
integck: write 26647 bytes, offset 10256242, file 736742 (line 900)
integck: write 78769 bytes, offset 46050404, file 640823 (line 900)
integck: write 1 bytes, offset 1, file nrzaryjetbdepvrpyceovatetbhirfvoazakqhwygtwbvxakirzlvfdicybmaysucfumoopynlpxxfuhdigwpzhpvjppiajtklwzfqdhzqcgyptfbfgeknbhcvcdden (line 900)
integck: write 85492 bytes, offset 2412788, file 254635 (line 900)
integck: write 22 bytes, offset 2843029, file 112238 (line 900)
integck: write 5295864 bytes, offset 4909812, file 853592 (line 900)
integck: write 228508 bytes, offset 10282889, file 736742 (line 900)
integck: write 1 bytes, offset 33216, file 63236 (line 900)
integck: write 367 bytes, offset 23662, file 511089 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/135506 ---> /mnt/integck_test_dir_367/726765 (line 683)
integck: creating hardlink /mnt/integck_test_dir_367/62315 ---> /mnt/integck_test_dir_367/314714/640823 (line 683)
integck: write 96023 bytes, offset 13500054, file 62315 (line 900)
integck: write 4271 bytes, offset 64042, file 249883 (line 900)
integck: write 7366 bytes, offset 487572, file 372829 (line 900)
integck: write 2 bytes, offset 700686, file 447727 (line 900)
integck: write 1 bytes, offset 57265209, file 62315 (line 900)
integck: write 8095 bytes, offset 38866565, file 62315 (line 900)
integck: write 4 bytes, offset 26727966, file 112238 (line 900)
integck: creating dir /mnt/integck_test_dir_367/659660 (line 556)
integck: write 54801 bytes, offset 27813592, file 890053 (line 900)
integck: write 1 bytes, offset 52525474, file 890053 (line 900)
integck: write 32 bytes, offset 45833799, file 890053 (line 900)
integck: write 57905 bytes, offset 112784, file 372829 (line 900)
integck: write 6713383 bytes, offset 51223554, file 62315 (line 900)
integck: write 3652097 bytes, offset 0, file 116575 (line 900)
integck: write 5481 bytes, offset 52525475, file 890053 (line 900)
integck: write 207773 bytes, offset 10511397, file 736742 (line 900)
integck: write 83 bytes, offset 32677853, file 62315 (line 900)
integck: write 3907256 bytes, offset 778979, file 116575 (line 900)
integck: write 1 bytes, offset 494938, file 372829 (line 900)
integck: write 1 bytes, offset 38560, file 999764 (line 900)
integck: creating file /mnt/integck_test_dir_367/pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 638)
integck: write 79 bytes, offset 0, file 639391 (line 900)
integck: write 78590 bytes, offset 15357171, file 62315 (line 900)
integck: write 1 bytes, offset 70372740, file 62315 (line 900)
integck: fdatasyncing file 62315 (line 1297)
integck: write 2946444 bytes, offset 45200486, file 62315 (line 900)
integck: write 680240 bytes, offset 70372741, file 62315 (line 900)
integck: write 1 bytes, offset 0, file 243512 (line 900)
integck: write 47 bytes, offset 10205676, file 853592 (line 900)
integck: write 68052 bytes, offset 0, file 242251 (line 900)
integck: write 5 bytes, offset 494939, file 372829 (line 900)
integck: write 17546 bytes, offset 700688, file 447727 (line 900)
integck: creating file /mnt/integck_test_dir_367/654323 (line 638)
integck: write 1122756 bytes, offset 15311064, file 590478 (line 900)
integck: write 76 bytes, offset 572544, file 447727 (line 900)
integck: fdatasyncing file 447727 (line 1297)
integck: write 9816507 bytes, offset 10205723, file 853592 (line 900)
integck: write 432761 bytes, offset 18270832, file 62315 (line 900)
integck: write 51 bytes, offset 25247002, file 112238 (line 900)
integck: creating file /mnt/integck_test_dir_367/370668 (line 638)
integck: write 7972042 bytes, offset 28108483, file 590478 (line 900)
integck: creating file /mnt/integck_test_dir_367/739185 (line 638)
integck: write 1 bytes, offset 26727970, file 112238 (line 900)
integck: write 4067103 bytes, offset 36080525, file 590478 (line 900)
integck: write 66513 bytes, offset 26727971, file 112238 (line 900)
integck: write 8 bytes, offset 20022230, file 853592 (line 900)
integck: write 620 bytes, offset 494944, file 372829 (line 900)
integck: write 28 bytes, offset 71052981, file 62315 (line 900)
integck: creating file /mnt/integck_test_dir_367/bscyklbauwizsxplruwxhoirczroowiwdrufdrnnutcdmbigdcficcarzoebyuawafyvkjhmbfgvlydnrfeazxaobzbfpyfugqzfrfhheuruiepxljajdtpkrcesruizbeakgcmtdpbyprndwcvesjekj)
integck: write 1 bytes, offset 0, file 980563 (line 900)
integck: write 78085 bytes, offset 29939406, file 890053 (line 900)
integck: write 3519799 bytes, offset 52530956, file 890053 (line 900)
integck: write 1 bytes, offset 20022238, file 853592 (line 900)
integck: write 83 bytes, offset 183748, file 447727 (line 900)
integck: write 263 bytes, offset 71053009, file 62315 (line 900)
integck: write 9635 bytes, offset 10230369, file 475603 (line 900)
integck: write 1 bytes, offset 54693818, file 62315 (line 900)
integck: write 9134463 bytes, offset 2837182, file 249883 (line 900)
integck: creating dir /mnt/integck_test_dir_367/538249 (line 556)
integck: write 4 bytes, offset 40147628, file 590478 (line 900)
integck: write 94062 bytes, offset 6944058, file 890053 (line 900)
integck: write 1 bytes, offset 495564, file 372829 (line 900)
integck: write 831 bytes, offset 17392126, file 62315 (line 900)
integck: write 675112 bytes, offset 24986, file 511089 (line 900)
integck: write 1 bytes, offset 5911400, file 907088 (line 900)
integck: write 84 bytes, offset 0, file 247004 (line 900)
integck: write 514429 bytes, offset 0, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: creating file /mnt/integck_test_dir_367/57830 (line 638)
integck: write 1 bytes, offset 31345614, file 62315 (line 900)
integck: write 69 bytes, offset 3955125, file 112238 (line 900)
integck: write 9064 bytes, offset 0, file 370668 (line 900)
integck: creating file /mnt/integck_test_dir_367/172794 (line 638)
integck: write 626841 bytes, offset 26794484, file 112238 (line 900)
integck: write 3 bytes, offset 10719170, file 736742 (line 900)
integck: creating dir /mnt/integck_test_dir_367/700573 (line 556)
integck: write 1 bytes, offset 265380, file 447727 (line 900)
integck: write 390 bytes, offset 10719173, file 736742 (line 900)
integck: write 29 bytes, offset 68052, file 242251 (line 900)
integck: write 10 bytes, offset 201558, file 372829 (line 900)
integck: write 7 bytes, offset 514429, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 1 bytes, offset 71053272, file 62315 (line 900)
integck: write 2121807 bytes, offset 56050755, file 890053 (line 900)
integck: write 1 bytes, offset 69589304, file 62315 (line 900)
integck: write 746003 bytes, offset 19340979, file 853592 (line 900)
integck: write 1 bytes, offset 1292, file 705457 (line 900)
integck: write 5047 bytes, offset 27421325, file 112238 (line 900)
integck: creating file /mnt/integck_test_dir_367/127835 (line 638)
integck: creating file /mnt/integck_test_dir_367/tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 638)
integck: write 1 bytes, offset 40147632, file 590478 (line 900)
integck: write 1 bytes, offset 975431, file 475603 (line 900)
integck: write 30992 bytes, offset 3495850, file 736742 (line 900)
integck: write 782 bytes, offset 71053273, file 62315 (line 900)
integck: write 4 bytes, offset 40147633, file 590478 (line 900)
integck: write 1537505 bytes, offset 58172562, file 890053 (line 900)
integck: write 228129 bytes, offset 2533916, file 447727 (line 900)
integck: write 1310489 bytes, offset 71054055, file 62315 (line 900)
integck: write 21 bytes, offset 5911401, file 907088 (line 900)
integck: write 306 bytes, offset 20086982, file 853592 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/710289/642504/293964 ---> /mnt/integck_test_dir_367/62315 (line 683)
integck: write 70 bytes, offset 16135, file 688063 (line 900)
integck: write 6 bytes, offset 40147637, file 590478 (line 900)
integck: write 239 bytes, offset 72364544, file 293964 (line 900)
integck: write 220 bytes, offset 2112039, file 736742 (line 900)
integck: write 50466 bytes, offset 101410, file 372829 (line 900)
integck: write 86182 bytes, offset 714009, file 135506 (line 900)
integck: write 7012770 bytes, offset 24735600, file 293964 (line 900)
integck: creating file /mnt/integck_test_dir_367/qudrmqusqkzcwkllmojdbykxevpfohhhbyzkwevrrtzfnayjszftvtczls (line 638)
integck: write 1 bytes, offset 6891596, file 112238 (line 900)
integck: write 75641 bytes, offset 72364783, file 293964 (line 900)
integck: write 1 bytes, offset 32394097, file 293964 (line 900)
integck: write 2665 bytes, offset 700098, file 511089 (line 900)
integck: write 12876 bytes, offset 702763, file 511089 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/397031 ---> /mnt/integck_test_dir_367/907088 (line 683)
integck: write 3709 bytes, offset 0, file 743721 (line 900)
integck: write 29242 bytes, offset 19994012, file 853592 (line 900)
integck: write 9 bytes, offset 5936879, file 590478 (line 900)
integck: write 225238 bytes, offset 59710067, file 890053 (line 900)
integck: write 1 bytes, offset 9274467, file 853592 (line 900)
integck: creating dir /mnt/integck_test_dir_367/640388 (line 556)
integck: creating file /mnt/integck_test_dir_367/710289/642504/44121 (line 638)
integck: write 4054231 bytes, offset 59935305, file 890053 (line 900)
integck: write 1 bytes, offset 46671767, file 890053 (line 900)
integck: write 468 bytes, offset 6077141, file 111106 (line 900)
integck: write 54 bytes, offset 63989536, file 890053 (line 900)
integck: write 1 bytes, offset 24220, file 688063 (line 900)
integck: write 683180 bytes, offset 60393998, file 293964 (line 900)
integck: write 7 bytes, offset 33457391, file 293964 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/463663 ---> /mnt/integck_test_dir_367/710289/642504/293964 (line 683)
integck: creating hardlink /mnt/integck_test_dir_367/316719 ---> /mnt/integck_test_dir_367/590478 (line 683)
integck: write 592 bytes, offset 56954107, file 463663 (line 900)
integck: write 86166 bytes, offset 72440424, file 463663 (line 900)
integck: write 1 bytes, offset 40147643, file 316719 (line 900)
integck: write 2886 bytes, offset 72526590, file 463663 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/419246 ---> /mnt/integck_test_dir_367/116575 (line 683)
integck: write 678 bytes, offset 32820207, file 463663 (line 900)
integck: write 3223515 bytes, offset 24986947, file 463663 (line 900)
integck: write 32 bytes, offset 9963063, file 736742 (line 900)
integck: write 54 bytes, offset 10380126, file 890053 (line 900)
integck: write 65 bytes, offset 0, file 463663 (line 900)
integck: write 93806 bytes, offset 72529476, file 463663 (line 900)
integck: fdatasyncing file 463663 (line 1297)
integck: creating hardlink /mnt/integck_test_dir_367/owwzylqzyhgfwphrwaqnknmnyywbufgypecmylhbwqqnrrffmzgxqpmmckittusozhrnzbubyxszfdszsgwbbrnlerfnfxokohowhpyxokkixapxepepmvnyiukzuhsmddkhubtfgqhd ---> /mn)
integck: write 301 bytes, offset 19725804, file 463663 (line 900)
integck: write 1 bytes, offset 72623282, file 463663 (line 900)
integck: write 4 bytes, offset 0, file owwzylqzyhgfwphrwaqnknmnyywbufgypecmylhbwqqnrrffmzgxqpmmckittusozhrnzbubyxszfdszsgwbbrnlerfnfxokohowhpyxokkixapxepepmvnyiukzuhsmddkhubtfgqhd (line 900)
integck: write 5129512 bytes, offset 4192220, file 463663 (line 900)
integck: write 632658 bytes, offset 713105, file 419246 (line 900)
integck: write 3 bytes, offset 30299102, file 463663 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/602225 ---> /mnt/integck_test_dir_367/edfnavxqrcolcspvpyqdhiksutbntilhtsextxnjmrxlnhoyiyjvxucpinzvgebcnsslsyprefstdnjrcagyioilpmeodibopmdybgysaltptdyj)
integck: write 983 bytes, offset 27426372, file 112238 (line 900)
integck: write 3323119 bytes, offset 63989590, file 890053 (line 900)
integck: write 4 bytes, offset 9929268, file 853592 (line 900)
integck: write 75 bytes, offset 10256328, file 463663 (line 900)
integck: write 1 bytes, offset 72623283, file 463663 (line 900)
integck: write 1 bytes, offset 27427355, file 112238 (line 900)
integck: write 88 bytes, offset 45736406, file 463663 (line 900)
integck: write 722295 bytes, offset 0, file 792797 (line 900)
integck: fdatasyncing dir /mnt/integck_test_dir_367 (line 2282)
integck: creating dir /mnt/integck_test_dir_367/rcdhzxcqipczqnmykznqihktgsdouhyfydlgdwyhkkmsq (line 556)
integck: write 3294209 bytes, offset 2372, file 705457 (line 900)
integck: write 499540 bytes, offset 4, file owwzylqzyhgfwphrwaqnknmnyywbufgypecmylhbwqqnrrffmzgxqpmmckittusozhrnzbubyxszfdszsgwbbrnlerfnfxokohowhpyxokkixapxepepmvnyiukzuhsmddkhubtfgqhd (line 900)
integck: write 70 bytes, offset 12384015, file 853592 (line 900)
integck: write 60453 bytes, offset 29615981, file 890053 (line 900)
integck: write 31 bytes, offset 16641962, file 112238 (line 900)
integck: write 3 bytes, offset 1, file 62957 (line 900)
integck: write 7 bytes, offset 20087288, file 853592 (line 900)
integck: write 1 bytes, offset 14813012, file 112238 (line 900)
integck: write 749282 bytes, offset 72419487, file 463663 (line 900)
integck: write 8772 bytes, offset 46917677, file 463663 (line 900)
integck: write 6964281 bytes, offset 73168769, file 463663 (line 900)
integck: write 8 bytes, offset 8045166, file 736742 (line 900)
integck: write 6558422 bytes, offset 67312709, file 890053 (line 900)
integck: write 409 bytes, offset 73871131, file 890053 (line 900)
integck: write 7 bytes, offset 3609, file 370668 (line 900)
integck: write 4205264 bytes, offset 11588700, file 463663 (line 900)
integck: write 5 bytes, offset 4686235, file 419246 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/lcqxkluclzbjpzfmaxklefnxlhrcspijdkkxwpmtqgeyjdvlazlelyfrtgrqyuawltjlvjfkifjrshnkyxeucogzkhhygglroesxtbakukgvgogxvzxnukdqavlibbnutxvurhzwjikuwbhvndms/)
integck: write 4478455 bytes, offset 80133050, file 463663 (line 900)
integck: write 1 bytes, offset 14, file 62957 (line 900)
integck: write 43 bytes, offset 495565, file 85473 (line 900)
integck: write 2060852 bytes, offset 372985, file 85473 (line 900)
integck: write 7 bytes, offset 5791686, file 853592 (line 900)
integck: write 607375 bytes, offset 715639, file 511089 (line 900)
integck: write 402634 bytes, offset 23004852, file 890053 (line 900)
integck: write 287717 bytes, offset 10719563, file 736742 (line 900)
integck: creating file /mnt/integck_test_dir_367/518333 (line 638)
integck: write 9227 bytes, offset 14612442, file 463663 (line 900)
integck: write 1894 bytes, offset 11007280, file 736742 (line 900)
integck: write 558683 bytes, offset 53584, file owwzylqzyhgfwphrwaqnknmnyywbufgypecmylhbwqqnrrffmzgxqpmmckittusozhrnzbubyxszfdszsgwbbrnlerfnfxokohowhpyxokkixapxepepmvnyiukzuhsmddkhubtfgqhd (line 900)
integck: write 12 bytes, offset 9330, file 548772 (line 900)
integck: write 38191 bytes, offset 13183353, file 316719 (line 900)
integck: write 794 bytes, offset 1095510, file 511089 (line 900)
integck: write 9553550 bytes, offset 84611505, file 463663 (line 900)
integck: write 92 bytes, offset 73871540, file 890053 (line 900)
integck: write 8236312 bytes, offset 94165055, file 463663 (line 900)
integck: write 4244111 bytes, offset 0, file 654323 (line 900)
integck: write 1 bytes, offset 0, file 463663 (line 900)
integck: creating dir /mnt/integck_test_dir_367/888533 (line 556)
integck: write 19426 bytes, offset 0, file 44121 (line 900)
integck: write 1 bytes, offset 2762045, file 447727 (line 900)
integck: fsyncing dir /mnt/integck_test_dir_367 (line 2277)
integck: write 1 bytes, offset 57147204, file 890053 (line 900)
integck: fsyncing file 890053 (line 1292)
integck: write 3983 bytes, offset 26464302, file 463663 (line 900)
integck: write 1 bytes, offset 9285733, file 463663 (line 900)
integck: write 81 bytes, offset 10700283, file 853592 (line 900)
integck: write 32200 bytes, offset 94707, file 76191 (line 900)
integck: creating file /mnt/integck_test_dir_367/27467 (line 638)
integck: write 552 bytes, offset 843866, file 112238 (line 900)
integck: write 907407 bytes, offset 1158457, file 85473 (line 900)
integck: write 3866659 bytes, offset 73871632, file 890053 (line 900)
integck: write 1 bytes, offset 77738291, file 890053 (line 900)
integck: write 28220 bytes, offset 19343924, file 112238 (line 900)
integck: write 1401524 bytes, offset 0, file 463663 (line 900)
integck: write 655 bytes, offset 3043421, file 419246 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/422713 ---> /mnt/integck_test_dir_367/ohbxubvnunmjtgnupltqhdgljjejrxkhozocsusacuwuuygahumbqryatbefkcwyuiyncvdcqyjwuyvdfcwowozkqtwmetbmypzzkeyqnfqirny)
integck: write 18879 bytes, offset 444, file 743721 (line 900)
integck: write 8492 bytes, offset 0, file qudrmqusqkzcwkllmojdbykxevpfohhhbyzkwevrrtzfnayjszftvtczls (line 900)
integck: write 6086795 bytes, offset 9392514, file 447727 (line 900)
integck: write 5257 bytes, offset 102401367, file 463663 (line 900)
integck: write 971 bytes, offset 27427356, file 112238 (line 900)
integck: write 482189 bytes, offset 26692144, file 890053 (line 900)
integck: write 400 bytes, offset 77738292, file 890053 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/618571/75883 ---> /mnt/integck_test_dir_367/463663 (line 683)
integck: write 19 bytes, offset 23250543, file 112238 (line 900)
integck: write 508 bytes, offset 9940507, file 75883 (line 900)
integck: creating dir /mnt/integck_test_dir_367/714947 (line 556)
integck: write 21 bytes, offset 1212102, file 85473 (line 900)
integck: write 6124679 bytes, offset 102406624, file 75883 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/268825 ---> /mnt/integck_test_dir_367/419246 (line 683)
integck: write 67 bytes, offset 531873, file 63236 (line 900)
integck: write 77 bytes, offset 612267, file owwzylqzyhgfwphrwaqnknmnyywbufgypecmylhbwqqnrrffmzgxqpmmckittusozhrnzbubyxszfdszsgwbbrnlerfnfxokohowhpyxokkixapxepepmvnyiukzuhsmddkhubtfgqhd (line 900)
integck: write 3161248 bytes, offset 612344, file owwzylqzyhgfwphrwaqnknmnyywbufgypecmylhbwqqnrrffmzgxqpmmckittusozhrnzbubyxszfdszsgwbbrnlerfnfxokohowhpyxokkixapxepepmvnyiukzuhsmddkhubtfgqhd (line 900)
integck: write 29894 bytes, offset 20087295, file 853592 (line 900)
integck: write 70000 bytes, offset 7974440, file 736742 (line 900)
integck: write 764979 bytes, offset 107925750, file 75883 (line 900)
integck: write 1 bytes, offset 108690729, file 75883 (line 900)
integck: write 1 bytes, offset 70120377, file 75883 (line 900)
integck: write 7534 bytes, offset 52073700, file 75883 (line 900)
integck: write 56 bytes, offset 3195146, file 268825 (line 900)
integck: creating file /mnt/integck_test_dir_367/905019 (line 638)
integck: write 40702 bytes, offset 0, file 787699 (line 900)
integck: write 73 bytes, offset 11002357, file 853592 (line 900)
integck: write 1 bytes, offset 19323, file 743721 (line 900)
integck: creating file /mnt/integck_test_dir_367/531639 (line 638)
integck: creating hardlink /mnt/integck_test_dir_367/atmrdfiavobkrlnsbpmxqbamczcyusghpzqfgtkqaaackisrmbqqmwckyeuapikypepotdlykxbwxppfggfmnnvwfunqdesjfyrplichljyxpcmtwbuzvtoatfzzputxlielepjhjomyxaaeosamd)
integck: write 461505 bytes, offset 72206714, file 75883 (line 900)
integck: write 6996 bytes, offset 2674605, file 890053 (line 900)
integck: write 50609 bytes, offset 12400, file 743721 (line 900)
integck: write 1041 bytes, offset 20117189, file 853592 (line 900)
integck: write 11 bytes, offset 211901, file 135506 (line 900)
integck: write 979 bytes, offset 21951, file 76191 (line 900)
integck: write 5252 bytes, offset 10288964, file 112238 (line 900)
integck: write 6860 bytes, offset 68653, file 999764 (line 900)
integck: write 1 bytes, offset 108690730, file 75883 (line 900)
integck: creating dir /mnt/integck_test_dir_367/681003 (line 556)
integck: write 31339 bytes, offset 1, file atmrdfiavobkrlnsbpmxqbamczcyusghpzqfgtkqaaackisrmbqqmwckyeuapikypepotdlykxbwxppfggfmnnvwfunqdesjfyrplichljyxpcmtwbuzvtoatfzzputxlielepjhjomyxaaeosamdmkbcrbyrca)
integck: write 233296 bytes, offset 11009174, file 736742 (line 900)
integck: write 1 bytes, offset 14345109, file 316719 (line 900)
integck: write 6079 bytes, offset 66836569, file 75883 (line 900)
integck: write 8399 bytes, offset 0, file 736742 (line 900)
integck: write 692 bytes, offset 446064, file 422713 (line 900)
integck: write 72942 bytes, offset 14331, file kxvmumojjrfbtcvazrxligwtgqirhtdxjvyvfaxowmrdqvarirutnuuieqfhufilcpuqxbirgtaggpfmdoccymnrjwlbfsulxpwvoeqzgjbuhzpietlveiilewkeewodcqvbkbbrxkridjkftlmuoysbcad)
integck: write 3061 bytes, offset 31340, file atmrdfiavobkrlnsbpmxqbamczcyusghpzqfgtkqaaackisrmbqqmwckyeuapikypepotdlykxbwxppfggfmnnvwfunqdesjfyrplichljyxpcmtwbuzvtoatfzzputxlielepjhjomyxaaeosamdmkbcrby)
integck: write 53449 bytes, offset 80028, file kxvmumojjrfbtcvazrxligwtgqirhtdxjvyvfaxowmrdqvarirutnuuieqfhufilcpuqxbirgtaggpfmdoccymnrjwlbfsulxpwvoeqzgjbuhzpietlveiilewkeewodcqvbkbbrxkridjkftlmuoysbcad)
integck: write 264584 bytes, offset 7249789, file 736742 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/ywqrcxuxwmbyugzwicqtgggimpjeboifagxizvdlfstqnyodhnsxjnbzwcdmutkdplkrbtfgndmswkahiyqhswniewbksffonkvqpxcedwaokxpogjybhgmyjuxknaesdresdbxytj ---> /mnt/)
integck: write 55221 bytes, offset 800191, file 135506 (line 900)
integck: write 1 bytes, offset 108690731, file 75883 (line 900)
integck: creating dir /mnt/integck_test_dir_367/856483 (line 556)
integck: write 7 bytes, offset 108690732, file 75883 (line 900)
integck: write 221268 bytes, offset 48342199, file 890053 (line 900)
integck: creating dir /mnt/integck_test_dir_367/rcdhzxcqipczqnmykznqihktgsdouhyfydlgdwyhkkmsq/287251 (line 556)
integck: write 55 bytes, offset 0, file 518333 (line 900)
integck: write 8 bytes, offset 52641182, file 890053 (line 900)
integck: write 50 bytes, offset 76393241, file 75883 (line 900)
integck: write 138517 bytes, offset 27428327, file 112238 (line 900)
integck: write 49 bytes, offset 68081, file 242251 (line 900)
integck: write 78132 bytes, offset 3723869, file 397031 (line 900)
integck: write 1 bytes, offset 2086574, file 736742 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/824824 ---> /mnt/integck_test_dir_367/888533/252766 (line 2132)
integck: write 1459 bytes, offset 108690739, file 75883 (line 900)
integck: write 875 bytes, offset 9699978, file 853592 (line 900)
integck: write 93102 bytes, offset 855412, file 135506 (line 900)
integck: write 716613 bytes, offset 108692198, file 75883 (line 900)
integck: write 1 bytes, offset 20118230, file 853592 (line 900)
integck: write 46 bytes, offset 5911422, file 397031 (line 900)
integck: write 9405 bytes, offset 109408811, file 75883 (line 900)
integck: write 820 bytes, offset 531940, file 63236 (line 900)
integck: write 1 bytes, offset 20118231, file 853592 (line 900)
integck: creating file /mnt/integck_test_dir_367/wrymaumzrqlmcvdtvdklkuhxefdgelxkeqys (line 638)
integck: write 9294042 bytes, offset 7653659, file 853592 (line 900)
integck: write 1 bytes, offset 40147644, file 316719 (line 900)
integck: write 65 bytes, offset 54993271, file 75883 (line 900)
integck: write 607 bytes, offset 77738692, file 890053 (line 900)
integck: write 50058 bytes, offset 77739299, file 890053 (line 900)
integck: write 991317 bytes, offset 3773592, file owwzylqzyhgfwphrwaqnknmnyywbufgypecmylhbwqqnrrffmzgxqpmmckittusozhrnzbubyxszfdszsgwbbrnlerfnfxokohowhpyxokkixapxepepmvnyiukzuhsmddkhubtfgqhd (line 900)
integck: write 1 bytes, offset 61813461, file 890053 (line 900)
integck: write 2395514 bytes, offset 27566844, file 112238 (line 900)
integck: write 78 bytes, offset 40147645, file 316719 (line 900)
integck: write 76020 bytes, offset 10777753, file 475603 (line 900)
integck: write 960677 bytes, offset 109418216, file 75883 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/884992/997568/198717/870525 ---> /mnt/integck_test_dir_367/447727 (line 683)
integck: creating dir /mnt/integck_test_dir_367/362686 (line 556)
integck: write 94663 bytes, offset 110378893, file 75883 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/yrpejqsjjmpkmlvscyximluryskzhmhnrwrdlfjxwmszpztqqmjxkmypbihafeklkugsyhxyiyhqkafcmblh/515485 ---> /mnt/integck_test_dir_367/268825 (line 683)
integck: write 283135 bytes, offset 4338221, file owwzylqzyhgfwphrwaqnknmnyywbufgypecmylhbwqqnrrffmzgxqpmmckittusozhrnzbubyxszfdszsgwbbrnlerfnfxokohowhpyxokkixapxepepmvnyiukzuhsmddkhubtfgqhd (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/362686/161391 ---> /mnt/integck_test_dir_367/618571/75883 (line 683)
integck: write 1 bytes, offset 44754009, file 890053 (line 900)
integck: write 9541 bytes, offset 110473556, file 161391 (line 900)
integck: write 60 bytes, offset 322741, file 511089 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/670318 ---> /mnt/integck_test_dir_367/qudrmqusqkzcwkllmojdbykxevpfohhhbyzkwevrrtzfnayjszftvtczls (line 683)
integck: write 1 bytes, offset 53389579, file 161391 (line 900)
integck: write 812 bytes, offset 64224086, file 161391 (line 900)
integck: write 156083 bytes, offset 29962358, file 112238 (line 900)
integck: write 3711 bytes, offset 11242470, file 736742 (line 900)
integck: write 3847096 bytes, offset 54753164, file 161391 (line 900)
integck: write 5518 bytes, offset 4764909, file owwzylqzyhgfwphrwaqnknmnyywbufgypecmylhbwqqnrrffmzgxqpmmckittusozhrnzbubyxszfdszsgwbbrnlerfnfxokohowhpyxokkixapxepepmvnyiukzuhsmddkhubtfgqhd (line 900)
integck: write 7 bytes, offset 2498280, file 254635 (line 900)
integck: write 753 bytes, offset 3790, file 743721 (line 900)
integck: creating dir /mnt/integck_test_dir_367/888533/38495 (line 556)
integck: write 373124 bytes, offset 51832050, file 890053 (line 900)
integck: write 1 bytes, offset 13714658, file 853592 (line 900)
integck: write 96619 bytes, offset 77789357, file 890053 (line 900)
integck: write 1 bytes, offset 91927205, file 161391 (line 900)
integck: write 601 bytes, offset 7567, file 44121 (line 900)
integck: write 7 bytes, offset 26307615, file 316719 (line 900)
integck: write 9732 bytes, offset 110483097, file 161391 (line 900)
integck: write 6539971 bytes, offset 110492829, file 161391 (line 900)
integck: creating file /mnt/integck_test_dir_367/856483/815564 (line 638)
integck: write 1 bytes, offset 1465371, file 515485 (line 900)
integck: write 1783 bytes, offset 86302, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 1205 bytes, offset 43995021, file 161391 (line 900)
integck: write 466383 bytes, offset 0, file 62957 (line 900)
integck: write 233 bytes, offset 15479309, file 870525 (line 900)
integck: write 21 bytes, offset 30118441, file 112238 (line 900)
integck: write 94 bytes, offset 2433837, file 85473 (line 900)
integck: write 9 bytes, offset 2433931, file 85473 (line 900)
integck: write 357 bytes, offset 1075305, file 112238 (line 900)
integck: write 58134 bytes, offset 948514, file 135506 (line 900)
integck: write 90773 bytes, offset 20118232, file 853592 (line 900)
integck: write 181 bytes, offset 117032800, file 161391 (line 900)
integck: write 72863 bytes, offset 34401, file atmrdfiavobkrlnsbpmxqbamczcyusghpzqfgtkqaaackisrmbqqmwckyeuapikypepotdlykxbwxppfggfmnnvwfunqdesjfyrplichljyxpcmtwbuzvtoatfzzputxlielepjhjomyxaaeosamdmkbcrb)
integck: write 5998632 bytes, offset 53897444, file 890053 (line 900)
integck: write 94303 bytes, offset 30853027, file 316719 (line 900)
integck: write 49 bytes, offset 2151087, file 736742 (line 900)
integck: write 416 bytes, offset 38711102, file 316719 (line 900)
integck: write 248550 bytes, offset 8622592, file 736742 (line 900)
integck: write 2 bytes, offset 39477163, file 161391 (line 900)
integck: creating file /mnt/integck_test_dir_367/333095 (line 638)
integck: write 654353 bytes, offset 117032981, file 161391 (line 900)
integck: write 7 bytes, offset 25742627, file 316719 (line 900)
integck: write 1 bytes, offset 3925, file 548772 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/268062 ---> /mnt/integck_test_dir_367/884992/997568/198717/870525 (line 683)
integck: write 677 bytes, offset 8128494, file 161391 (line 900)
integck: write 4 bytes, offset 23025613, file 316719 (line 900)
integck: write 23723 bytes, offset 3929064, file 397031 (line 900)
integck: write 207129 bytes, offset 9588363, file 853592 (line 900)
integck: write 1 bytes, offset 53997468, file 161391 (line 900)
integck: write 20721 bytes, offset 117687334, file 161391 (line 900)
integck: write 8794 bytes, offset 55, file 518333 (line 900)
integck: write 5668807 bytes, offset 85010468, file 161391 (line 900)
integck: write 4 bytes, offset 2433940, file 85473 (line 900)
integck: write 352543 bytes, offset 40147723, file 316719 (line 900)
integck: write 1 bytes, offset 61442321, file 890053 (line 900)
integck: write 6982 bytes, offset 20209005, file 853592 (line 900)
integck: write 578 bytes, offset 342027, file 422713 (line 900)
integck: write 1 bytes, offset 77885976, file 890053 (line 900)
integck: write 86 bytes, offset 554121, file 515485 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/783193 ---> /mnt/integck_test_dir_367/76191 (line 2132)
integck: write 1 bytes, offset 126907, file 76191 (line 900)
integck: write 332 bytes, offset 4928523, file 397031 (line 900)
integck: write 9066 bytes, offset 44168651, file 161391 (line 900)
integck: write 7 bytes, offset 77885977, file 890053 (line 900)
integck: write 478782 bytes, offset 4770427, file owwzylqzyhgfwphrwaqnknmnyywbufgypecmylhbwqqnrrffmzgxqpmmckittusozhrnzbubyxszfdszsgwbbrnlerfnfxokohowhpyxokkixapxepepmvnyiukzuhsmddkhubtfgqhd (line 900)
integck: write 952 bytes, offset 20215987, file 853592 (line 900)
integck: write 45839 bytes, offset 59671, file 743721 (line 900)
integck: write 1 bytes, offset 77885984, file 890053 (line 900)
integck: creating dir /mnt/integck_test_dir_367/640388/592919 (line 556)
integck: creating dir /mnt/integck_test_dir_367/yrpejqsjjmpkmlvscyximluryskzhmhnrwrdlfjxwmszpztqqmjxkmypbihafeklkugsyhxyiyhqkafcmblh/309116 (line 556)
integck: creating file /mnt/integck_test_dir_367/154464 (line 638)
integck: creating symlink /mnt/integck_test_dir_367/893440 ---> /mnt/integck_test_dir_367/515410/475603 (line 2132)
integck: write 842476 bytes, offset 30118462, file 112238 (line 900)
integck: write 3518 bytes, offset 11246181, file 736742 (line 900)
integck: write 3885 bytes, offset 77885985, file 890053 (line 900)
integck: write 85256 bytes, offset 0, file 127835 (line 900)
integck: write 8018 bytes, offset 83791014, file 161391 (line 900)
integck: write 3250008 bytes, offset 8849, file 518333 (line 900)
integck: write 1 bytes, offset 0, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 22687 bytes, offset 117708055, file 161391 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/770514 ---> /mnt/integck_test_dir_367/ywqrcxuxwmbyugzwicqtgggimpjeboifagxizvdlfstqnyodhnsxjnbzwcdmutkdplkrbtfgndmswkahiyqhswniewbksffonkvqpxcedwaokxp)
integck: write 4518280 bytes, offset 40500266, file 316719 (line 900)
integck: write 2 bytes, offset 117730742, file 161391 (line 900)
integck: write 593718 bytes, offset 34589328, file 161391 (line 900)
integck: write 282682 bytes, offset 30960938, file 112238 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/751408/zerekjllhvssamgmcnwttcpuyotegjdjfgqeeuxkmfxliufsbncvqcrvsyohjjqugeklmmjffyrzdbpddfhnetrciqitiwycwqxptweqfreresjarnxbyxnwsorizahvwgwwsrxcjofdkd)
integck: write 1 bytes, offset 1363893, file 853592 (line 900)
integck: creating file /mnt/integck_test_dir_367/318608 (line 638)
integck: write 74480 bytes, offset 0, file 268062 (line 900)
integck: write 445049 bytes, offset 112501135, file 161391 (line 900)
integck: write 778961 bytes, offset 0, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 715196 bytes, offset 117730744, file 161391 (line 900)
integck: write 411877 bytes, offset 26067408, file 890053 (line 900)
integck: write 1 bytes, offset 552553, file 770514 (line 900)
integck: write 55 bytes, offset 55816, file 85473 (line 900)
integck: write 31 bytes, offset 11249699, file 736742 (line 900)
integck: write 543217 bytes, offset 16875036, file 316719 (line 900)
integck: creating dir /mnt/integck_test_dir_367/568628 (line 556)
integck: write 463 bytes, offset 11249730, file 736742 (line 900)
integck: write 2955 bytes, offset 118445940, file 161391 (line 900)
integck: creating dir /mnt/integck_test_dir_367/136533/901637/ebxmuizeeieccgylqdnkklezkddtnafbfgiciunxjfjwubykowowmiuefpzlntryzsxxgopgezjbfcgvssuikeeodohmcesfejosgtlwtqgghnfigqpowvawcnknrhxbixyoobnprhlv)
integck: write 924853 bytes, offset 45018546, file 316719 (line 900)
integck: write 12 bytes, offset 77889870, file 890053 (line 900)
integck: write 9 bytes, offset 118448895, file 161391 (line 900)
integck: write 760 bytes, offset 91832420, file 161391 (line 900)
integck: write 55 bytes, offset 380096, file 135506 (line 900)
integck: creating file /mnt/integck_test_dir_367/160588 (line 638)
integck: write 80661 bytes, offset 11652296, file 853592 (line 900)
integck: write 1 bytes, offset 45943399, file 316719 (line 900)
integck: write 5626549 bytes, offset 740227, file 511089 (line 900)
integck: write 1 bytes, offset 45943400, file 316719 (line 900)
integck: write 68 bytes, offset 952951, file 397031 (line 900)
integck: creating file /mnt/integck_test_dir_367/937914 (line 638)
integck: write 787041 bytes, offset 5911468, file 397031 (line 900)
integck: write 5813890 bytes, offset 302540, file 135506 (line 900)
integck: write 1 bytes, offset 11250193, file 736742 (line 900)
integck: write 3 bytes, offset 118448904, file 161391 (line 900)
integck: write 5 bytes, offset 10853773, file 475603 (line 900)
integck: write 1 bytes, offset 32629385, file 316719 (line 900)
integck: creating dir /mnt/integck_test_dir_367/iecjrfrbbbmhjfvthymzwhpemmthidnamfklsbrjzkjkcfoidchrfuncqybjrjrfmmqneqxidhlbunnsvblrrujlnvxqyzwuhjupkrxpgskrtasnipqntetdqfxmolsxjohntrvdzmohygcyjvqkuf (li)
integck: fsyncing dir /mnt/integck_test_dir_367 (line 2277)
integck: write 1 bytes, offset 45943401, file 316719 (line 900)
integck: creating file /mnt/integck_test_dir_367/672362 (line 638)
integck: write 5 bytes, offset 0, file 318608 (line 900)
integck: write 895 bytes, offset 118448907, file 161391 (line 900)
integck: write 724 bytes, offset 118449802, file 161391 (line 900)
integck: write 7453 bytes, offset 40527790, file 316719 (line 900)
integck: write 197 bytes, offset 2184684, file 85473 (line 900)
integck: write 1336 bytes, offset 118450526, file 161391 (line 900)
integck: creating file /mnt/integck_test_dir_367/884992/300236 (line 638)
integck: write 5758751 bytes, offset 7948067, file 736742 (line 900)
integck: write 7825 bytes, offset 9064, file 370668 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/867972 ---> /mnt/integck_test_dir_367/770514 (line 683)
integck: write 71409 bytes, offset 6116430, file 135506 (line 900)
integck: creating dir /mnt/integck_test_dir_367/383828 (line 556)
integck: creating dir /mnt/integck_test_dir_367/214099 (line 556)
integck: write 32642 bytes, offset 3, file 318608 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/kwtmpmxjeawnwmzxboydgxtzzyurkoupajroflhuuirldwueywmstjtgqwhsxoggjbzgjlsvjlaaxiwhbwqjveqwndziyalmvhmbuqesoueijwowsbitxmujkzkvvyedjtxtpmvhiqmeskmsqcedxl)
integck: creating hardlink /mnt/integck_test_dir_367/rcdhzxcqipczqnmykznqihktgsdouhyfydlgdwyhkkmsq/287251/849724 ---> /mnt/integck_test_dir_367/362686/161391 (line 683)
integck: write 213 bytes, offset 45943402, file 316719 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/291994/722944 ---> /mnt/integck_test_dir_367/lcqxkluclzbjpzfmaxklefnxlhrcspijdkkxwpmtqgeyjdvlazlelyfrtgrqyuawltjlvjfkifjrshnkyxeucogzkhhygglroesxtbak)
integck: write 71826 bytes, offset 17465572, file 853592 (line 900)
integck: creating file /mnt/integck_test_dir_367/728294 (line 638)
integck: write 44138 bytes, offset 55012618, file 316719 (line 900)
integck: creating dir /mnt/integck_test_dir_367/139477 (line 556)
integck: write 180274 bytes, offset 0, file 672362 (line 900)
integck: write 452628 bytes, offset 1398851, file 853592 (line 900)
integck: write 398 bytes, offset 31243620, file 112238 (line 900)
integck: write 514 bytes, offset 2433944, file 722944 (line 900)
integck: write 29338 bytes, offset 118451862, file 849724 (line 900)
integck: write 1955 bytes, offset 6085787, file 135506 (line 900)
integck: write 40876 bytes, offset 72819202, file 849724 (line 900)
integck: write 2077007 bytes, offset 778961, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 1 bytes, offset 117645964, file 849724 (line 900)
integck: write 1767 bytes, offset 0, file 112238 (line 900)
integck: creating file /mnt/integck_test_dir_367/362686/380618 (line 638)
integck: write 2345 bytes, offset 10453059, file 268062 (line 900)
integck: write 4585144 bytes, offset 0, file 905019 (line 900)
integck: write 1 bytes, offset 246578, file 268062 (line 900)
integck: write 238 bytes, offset 118481200, file 849724 (line 900)
integck: write 2 bytes, offset 31244018, file 112238 (line 900)
integck: write 51 bytes, offset 118481438, file 849724 (line 900)
integck: write 85 bytes, offset 76990, file 743721 (line 900)
integck: write 27 bytes, offset 1526994, file 867972 (line 900)
integck: write 1 bytes, offset 1853241, file 518333 (line 900)
integck: write 1919 bytes, offset 9789496, file 268062 (line 900)
integck: write 904979 bytes, offset 95744731, file 849724 (line 900)
integck: write 5335 bytes, offset 11971645, file 249883 (line 900)
integck: write 4130074 bytes, offset 15479542, file 268062 (line 900)
integck: write 694 bytes, offset 118481489, file 849724 (line 900)
integck: write 1812203 bytes, offset 118482183, file 849724 (line 900)
integck: write 1 bytes, offset 4686240, file 515485 (line 900)
integck: write 50 bytes, offset 478703, file 422713 (line 900)
integck: write 1 bytes, offset 24135671, file 112238 (line 900)
integck: write 14294 bytes, offset 8345090, file 849724 (line 900)
integck: write 35252 bytes, offset 18, file 247004 (line 900)
integck: write 1 bytes, offset 15401111, file 849724 (line 900)
integck: write 5019 bytes, offset 772240, file owwzylqzyhgfwphrwaqnknmnyywbufgypecmylhbwqqnrrffmzgxqpmmckittusozhrnzbubyxszfdszsgwbbrnlerfnfxokohowhpyxokkixapxepepmvnyiukzuhsmddkhubtfgqhd (line 900)
integck: write 755 bytes, offset 0, file 787699 (line 900)
integck: write 8445512 bytes, offset 116388410, file 849724 (line 900)
integck: write 8701 bytes, offset 6698509, file 397031 (line 900)
integck: write 27 bytes, offset 13706818, file 736742 (line 900)
integck: write 23755 bytes, offset 15410504, file 853592 (line 900)
integck: write 2604752 bytes, offset 124833922, file 849724 (line 900)
integck: write 5403390 bytes, offset 32580036, file 849724 (line 900)
integck: write 6580522 bytes, offset 4408409, file 135506 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/547430 ---> /mnt/integck_test_dir_367/rcdhzxcqipczqnmykznqihktgsdouhyfydlgdwyhkkmsq/287251/849724 (line 683)
integck: write 684 bytes, offset 10853778, file 475603 (line 900)
integck: write 1 bytes, offset 346492, file 705457 (line 900)
integck: creating dir /mnt/integck_test_dir_367/731593 (line 556)
integck: write 89 bytes, offset 6660726, file 736742 (line 900)
integck: write 3 bytes, offset 633154, file 654323 (line 900)
integck: write 1 bytes, offset 105510, file 743721 (line 900)
integck: write 6 bytes, offset 23785617, file 112238 (line 900)
integck: write 82669 bytes, offset 34358, file 999764 (line 900)
integck: write 1 bytes, offset 127438674, file 547430 (line 900)
integck: write 1 bytes, offset 66047534, file 547430 (line 900)
integck: write 5923 bytes, offset 10988931, file 135506 (line 900)
integck: write 1 bytes, offset 6366776, file 511089 (line 900)
integck: write 14 bytes, offset 1004872, file 511089 (line 900)
integck: write 1 bytes, offset 2434458, file 722944 (line 900)
integck: creating file /mnt/integck_test_dir_367/5833 (line 638)
integck: creating hardlink /mnt/integck_test_dir_367/177374 ---> /mnt/integck_test_dir_367/999764 (line 683)
integck: write 92 bytes, offset 7731872, file 736742 (line 900)
integck: write 1 bytes, offset 29791075, file 112238 (line 900)
integck: write 315 bytes, offset 127438675, file 547430 (line 900)
integck: write 1 bytes, offset 35204076, file 547430 (line 900)
integck: write 915 bytes, offset 127438990, file 547430 (line 900)
integck: write 620387 bytes, offset 22686875, file 112238 (line 900)
integck: creating dir /mnt/integck_test_dir_367/349619 (line 556)
integck: write 516 bytes, offset 3232664, file 135506 (line 900)
integck: write 595262 bytes, offset 67603290, file 547430 (line 900)
integck: write 2 bytes, offset 61450509, file 547430 (line 900)
integck: write 1864013 bytes, offset 50059745, file 547430 (line 900)
integck: write 1 bytes, offset 13706845, file 736742 (line 900)
integck: write 2399 bytes, offset 127439905, file 547430 (line 900)
integck: write 4159 bytes, offset 11065469, file 112238 (line 900)
integck: write 82151 bytes, offset 77889882, file 890053 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/650170 ---> /mnt/integck_test_dir_367/268062 (line 683)
integck: write 35730 bytes, offset 127442304, file 547430 (line 900)
integck: write 7080 bytes, offset 25780891, file 547430 (line 900)
integck: write 35 bytes, offset 127478034, file 547430 (line 900)
integck: write 53 bytes, offset 19486285, file 853592 (line 900)
integck: write 2361 bytes, offset 20302986, file 316719 (line 900)
integck: write 92089 bytes, offset 13057668, file 853592 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/362686/866941 ---> /mnt/integck_test_dir_367/670318 (line 683)
integck: write 212 bytes, offset 31244020, file 112238 (line 900)
integck: write 1028810 bytes, offset 8669608, file 736742 (line 900)
integck: write 4131 bytes, offset 0, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 5261916 bytes, offset 84268414, file 547430 (line 900)
integck: write 7368 bytes, offset 10976329, file 135506 (line 900)
integck: write 380 bytes, offset 53646341, file 547430 (line 900)
integck: write 3 bytes, offset 0, file atmrdfiavobkrlnsbpmxqbamczcyusghpzqfgtkqaaackisrmbqqmwckyeuapikypepotdlykxbwxppfggfmnnvwfunqdesjfyrplichljyxpcmtwbuzvtoatfzzputxlielepjhjomyxaaeosamdmkbcrbyrcapbmj)
integck: write 9453892 bytes, offset 17550720, file 853592 (line 900)
integck: write 58470 bytes, offset 0, file 867972 (line 900)
integck: write 1091782 bytes, offset 115133251, file 547430 (line 900)
integck: write 7206642 bytes, offset 18511092, file 853592 (line 900)
integck: write 8605 bytes, offset 121502642, file 547430 (line 900)
integck: write 7257932 bytes, offset 21982425, file 650170 (line 900)
integck: write 643 bytes, offset 127478069, file 547430 (line 900)
integck: fsyncing file 547430 (line 1292)
integck: write 5927 bytes, offset 14973737, file 890053 (line 900)
integck: write 4940 bytes, offset 5563, file 866941 (line 900)
integck: write 6 bytes, offset 2352, file 548772 (line 900)
integck: write 1 bytes, offset 5224894, file 112238 (line 900)
integck: write 1 bytes, offset 2434459, file 722944 (line 900)
integck: write 1 bytes, offset 5249209, file owwzylqzyhgfwphrwaqnknmnyywbufgypecmylhbwqqnrrffmzgxqpmmckittusozhrnzbubyxszfdszsgwbbrnlerfnfxokohowhpyxokkixapxepepmvnyiukzuhsmddkhubtfgqhd (line 900)
integck: write 969 bytes, offset 1615962, file 434071 (line 900)
integck: write 1 bytes, offset 2855968, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 508 bytes, offset 102638309, file 547430 (line 900)
integck: write 316317 bytes, offset 0, file bscyklbauwizsxplruwxhoirczroowiwdrufdrnnutcdmbigdcficcarzoebyuawafyvkjhmbfgvlydnrfeazxaobzbfpyfugqzfrfhheuruiepxljajdtpkrcesruizbeakgcmtdpbyprndwcvesjekjkknql)
integck: write 3763460 bytes, offset 1616931, file 434071 (line 900)
integck: write 9266 bytes, offset 6365461, file 853592 (line 900)
integck: creating file /mnt/integck_test_dir_367/352350 (line 638)
integck: write 1706 bytes, offset 2498287, file 254635 (line 900)
integck: write 4 bytes, offset 31244232, file 112238 (line 900)
integck: write 72 bytes, offset 42069894, file 547430 (line 900)
integck: write 769154 bytes, offset 5552084, file 254635 (line 900)
integck: write 26117 bytes, offset 1617992, file 650170 (line 900)
integck: fsyncing dir /mnt/integck_test_dir_367 (line 2277)
integck: write 587865 bytes, offset 62404, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 55 bytes, offset 70405068, file 547430 (line 900)
integck: write 92 bytes, offset 2080174, file 722944 (line 900)
integck: write 761545 bytes, offset 22772251, file 650170 (line 900)
integck: write 5 bytes, offset 127478712, file 547430 (line 900)
integck: write 698 bytes, offset 127478717, file 547430 (line 900)
integck: write 381562 bytes, offset 127479415, file 547430 (line 900)
integck: write 1 bytes, offset 1595747, file 518333 (line 900)
integck: creating dir /mnt/integck_test_dir_367/djcbxgmxmailgyjsknbkfquowqxlnsgjhujqrurdaicsfjnynoislbylexbhbudvsupquthgswbpdbjpeowcgoczhkkdsorqovpgdlcdvlnkfmfwubhlwq (line 556)
integck: creating dir /mnt/integck_test_dir_367/874090 (line 556)
integck: write 137 bytes, offset 127860977, file 547430 (line 900)
integck: write 5 bytes, offset 127861114, file 547430 (line 900)
integck: write 6 bytes, offset 4799111, file 547430 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/595546 ---> /mnt/integck_test_dir_367/882189/853592 (line 683)
integck: write 40 bytes, offset 20657819, file 547430 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/756092 ---> /mnt/integck_test_dir_367/177374 (line 683)
integck: write 2805801 bytes, offset 27004612, file 595546 (line 900)
integck: write 159 bytes, offset 15773622, file 890053 (line 900)
integck: write 8 bytes, offset 127861119, file 547430 (line 900)
integck: write 8752 bytes, offset 0, file 937914 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/510541 ---> /mnt/integck_test_dir_367/650170 (line 2132)
integck: write 249 bytes, offset 9191348, file 112238 (line 900)
integck: write 1 bytes, offset 55056756, file 316719 (line 900)
integck: write 309255 bytes, offset 2855969, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 10 bytes, offset 136935, file 654323 (line 900)
integck: write 1 bytes, offset 55056757, file 316719 (line 900)
integck: write 7643096 bytes, offset 66455513, file 890053 (line 900)
integck: write 1 bytes, offset 7155195, file 650170 (line 900)
integck: write 24 bytes, offset 15782284, file 650170 (line 900)
integck: write 1 bytes, offset 4327081, file 736742 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/389094 ---> /mnt/integck_test_dir_367/397031 (line 683)
integck: write 1 bytes, offset 27682177, file 595546 (line 900)
integck: write 786 bytes, offset 53075899, file 316719 (line 900)
integck: write 3 bytes, offset 31244236, file 112238 (line 900)
integck: write 7 bytes, offset 33300586, file 547430 (line 900)
integck: write 94 bytes, offset 10994854, file 135506 (line 900)
integck: write 758 bytes, offset 26771157, file 112238 (line 900)
integck: write 7618 bytes, offset 105511, file 743721 (line 900)
integck: write 5489914 bytes, offset 113129, file 743721 (line 900)
integck: write 5133218 bytes, offset 45674, file atmrdfiavobkrlnsbpmxqbamczcyusghpzqfgtkqaaackisrmbqqmwckyeuapikypepotdlykxbwxppfggfmnnvwfunqdesjfyrplichljyxpcmtwbuzvtoatfzzputxlielepjhjomyxaaeosamdmkbc)
integck: creating hardlink /mnt/integck_test_dir_367/46977 ---> /mnt/integck_test_dir_367/422713 (line 683)
integck: write 22218 bytes, offset 316317, file bscyklbauwizsxplruwxhoirczroowiwdrufdrnnutcdmbigdcficcarzoebyuawafyvkjhmbfgvlydnrfeazxaobzbfpyfugqzfrfhheuruiepxljajdtpkrcesruizbeakgcmtdpbyprndwcvesjekjk)
integck: write 144 bytes, offset 94920699, file 547430 (line 900)
integck: write 801789 bytes, offset 9422, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 8934 bytes, offset 6707210, file 389094 (line 900)
integck: write 67 bytes, offset 6509, file 76191 (line 900)
integck: write 2679229 bytes, offset 127861127, file 547430 (line 900)
integck: write 807 bytes, offset 5249210, file owwzylqzyhgfwphrwaqnknmnyywbufgypecmylhbwqqnrrffmzgxqpmmckittusozhrnzbubyxszfdszsgwbbrnlerfnfxokohowhpyxokkixapxepepmvnyiukzuhsmddkhubtfgqhd (line 900)
integck: write 59 bytes, offset 130540356, file 547430 (line 900)
integck: creating file /mnt/integck_test_dir_367/35146 (line 638)
integck: write 83 bytes, offset 327553, file 389094 (line 900)
integck: write 755 bytes, offset 130540415, file 547430 (line 900)
integck: write 89374 bytes, offset 19532770, file 890053 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/fuxaiyznabsluovrkdiyrqzlirsldgkyhrycntkeztxetzkdnywpakjdxurloqnezpbmhibvstmlpmuqgtmqujjwuhmoopwrcuggnwqlsxhixrncszbskuccqhhufhduxauspdlliygkmjredajfb)
integck: write 749236 bytes, offset 10503, file 866941 (line 900)
integck: write 468 bytes, offset 50336650, file 547430 (line 900)
integck: write 62593 bytes, offset 31244239, file 112238 (line 900)
integck: write 746 bytes, offset 130541170, file 547430 (line 900)
integck: write 3 bytes, offset 4389757, file 316719 (line 900)
integck: creating file /mnt/integck_test_dir_367/583138 (line 638)
integck: write 228 bytes, offset 10854462, file 475603 (line 900)
integck: creating file /mnt/integck_test_dir_367/65717 (line 638)
integck: write 1 bytes, offset 24854778, file 547430 (line 900)
integck: write 1 bytes, offset 6267614, file 511089 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/anejblzponjesrvoyiuxspoxobuybcdxyxzyaittjysnhruxnrqfxlundbouxpeskxrcxzzmdxrrnfldtpautsqqtomhmzlkqmmprsfdqky ---> /mnt/integck_test_dir_367/383828/3475)
integck: creating dir /mnt/integck_test_dir_367/456910 (line 556)
integck: write 1 bytes, offset 678458, file 515485 (line 900)
integck: write 12093 bytes, offset 126908, file 76191 (line 900)
integck: write 7 bytes, offset 50425143, file 547430 (line 900)
integck: write 1 bytes, offset 5603043, file 743721 (line 900)
integck: write 708422 bytes, offset 55056758, file 316719 (line 900)
integck: write 3083 bytes, offset 109185, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 292995 bytes, offset 31306832, file 112238 (line 900)
integck: write 1 bytes, offset 0, file 475603 (line 900)
integck: creating dir /mnt/integck_test_dir_367/681003/509486 (line 556)
integck: write 1 bytes, offset 77972033, file 890053 (line 900)
integck: write 45219 bytes, offset 2221235, file 511089 (line 900)
integck: write 5221 bytes, offset 0, file 531639 (line 900)
integck: write 3 bytes, offset 0, file 515485 (line 900)
integck: write 42 bytes, offset 13706846, file 736742 (line 900)
integck: write 4547240 bytes, offset 13706888, file 736742 (line 900)
integck: write 503 bytes, offset 41191018, file 547430 (line 900)
integck: write 3 bytes, offset 6077609, file 111106 (line 900)
integck: write 827649 bytes, offset 130541916, file 547430 (line 900)
integck: write 8 bytes, offset 0, file 728294 (line 900)
integck: write 498831 bytes, offset 0, file 5833 (line 900)
integck: write 161 bytes, offset 2006368, file 518333 (line 900)
integck: write 9945 bytes, offset 2811080, file 547430 (line 900)
integck: write 8956 bytes, offset 802058, file 511089 (line 900)
integck: creating file /mnt/integck_test_dir_367/884992/774586 (line 638)
integck: write 6857 bytes, offset 0, file 352350 (line 900)
integck: write 4954510 bytes, offset 29810413, file 595546 (line 900)
integck: write 7450087 bytes, offset 55765180, file 316719 (line 900)
integck: write 983916 bytes, offset 24221, file 688063 (line 900)
integck: write 8460 bytes, offset 31599827, file 112238 (line 900)
integck: write 300360 bytes, offset 343884, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 1 bytes, offset 30257136, file 595546 (line 900)
integck: write 1 bytes, offset 131369565, file 547430 (line 900)
integck: write 7247147 bytes, offset 6366777, file 511089 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/236336 ---> /mnt/integck_test_dir_367/389094 (line 683)
integck: write 11 bytes, offset 69706140, file 547430 (line 900)
integck: write 1 bytes, offset 34764923, file 595546 (line 900)
integck: write 72 bytes, offset 133477, file zerekjllhvssamgmcnwttcpuyotegjdjfgqeeuxkmfxliufsbncvqcrvsyohjjqugeklmmjffyrzdbpddfhnetrciqitiwycwqxptweqfreresjarnxbyxnwsorizahvwgwwsrxcjofdkdixsnxzsqzf (lin)
integck: write 3 bytes, offset 2434460, file 722944 (line 900)
integck: write 1824 bytes, offset 10854690, file 475603 (line 900)
integck: creating dir /mnt/integck_test_dir_367/861922 (line 556)
integck: write 2 bytes, offset 63215267, file 316719 (line 900)
integck: write 2424406 bytes, offset 16491108, file 736742 (line 900)
integck: write 1891746 bytes, offset 131369566, file 547430 (line 900)
integck: write 1 bytes, offset 3286818, file 705457 (line 900)
integck: write 12 bytes, offset 18915514, file 736742 (line 900)
integck: write 32 bytes, offset 3647, file 937914 (line 900)
integck: creating file /mnt/integck_test_dir_367/782223 (line 638)
integck: write 2 bytes, offset 2906244, file 736742 (line 900)
integck: write 982 bytes, offset 5057424, file 475603 (line 900)
integck: write 333126 bytes, offset 34764924, file 595546 (line 900)
integck: write 8966974 bytes, offset 9505, file 62957 (line 900)
integck: write 4 bytes, offset 4686241, file 515485 (line 900)
integck: write 703 bytes, offset 18915526, file 736742 (line 900)
integck: write 81765 bytes, offset 63215269, file 316719 (line 900)
integck: write 486 bytes, offset 45098051, file 316719 (line 900)
integck: write 3257 bytes, offset 0, file 583138 (line 900)
integck: fsyncing dir /mnt/integck_test_dir_367 (line 2277)
integck: write 5 bytes, offset 21988489, file 595546 (line 900)
integck: creating file /mnt/integck_test_dir_367/291994/491183 (line 638)
integck: write 228 bytes, offset 13555150, file 595546 (line 900)
integck: write 24261 bytes, offset 117027, file 756092 (line 900)
integck: fdatasyncing dir /mnt/integck_test_dir_367 (line 2282)
integck: write 3 bytes, offset 8976479, file 62957 (line 900)
integck: fdatasyncing file 62957 (line 1297)
integck: write 67 bytes, offset 3165224, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 1 bytes, offset 133261312, file 547430 (line 900)
integck: fdatasyncing file 547430 (line 1297)
integck: write 57527 bytes, offset 2830501, file 867972 (line 900)
integck: creating dir /mnt/integck_test_dir_367/577946 (line 556)
integck: creating file /mnt/integck_test_dir_367/331543 (line 638)
integck: write 8540337 bytes, offset 10482949, file 736742 (line 900)
integck: write 38513 bytes, offset 94263040, file 547430 (line 900)
integck: write 26490 bytes, offset 33923947, file 650170 (line 900)
integck: write 62104 bytes, offset 20714119, file 316719 (line 900)
integck: write 8 bytes, offset 39369959, file 890053 (line 900)
integck: write 3289732 bytes, offset 2888028, file 867972 (line 900)
integck: write 4296 bytes, offset 35270, file 247004 (line 900)
integck: write 653712 bytes, offset 133261313, file 547430 (line 900)
integck: write 78104 bytes, offset 1949769, file 518333 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/922785 ---> /mnt/integck_test_dir_367/650170 (line 683)
integck: write 8254 bytes, offset 6716144, file 236336 (line 900)
integck: write 587 bytes, offset 31608287, file 112238 (line 900)
integck: write 2571 bytes, offset 133915025, file 547430 (line 900)
integck: write 94 bytes, offset 2434463, file 722944 (line 900)
integck: write 8205 bytes, offset 5, file 728294 (line 900)
integck: write 287146 bytes, offset 4585144, file 905019 (line 900)
integck: write 6876804 bytes, offset 133917596, file 547430 (line 900)
integck: write 57 bytes, offset 140794400, file 547430 (line 900)
integck: write 610982 bytes, offset 4872290, file 905019 (line 900)
integck: write 1 bytes, offset 5250017, file owwzylqzyhgfwphrwaqnknmnyywbufgypecmylhbwqqnrrffmzgxqpmmckittusozhrnzbubyxszfdszsgwbbrnlerfnfxokohowhpyxokkixapxepepmvnyiukzuhsmddkhubtfgqhd (line 900)
integck: write 2953 bytes, offset 1008137, file 688063 (line 900)
integck: write 3343689 bytes, offset 0, file 774586 (line 900)
integck: write 2106 bytes, offset 147440800, file 547430 (line 900)
integck: creating dir /mnt/integck_test_dir_367/258824 (line 556)
integck: write 29 bytes, offset 1343653, file 867972 (line 900)
integck: write 300 bytes, offset 147442906, file 547430 (line 900)
integck: write 502330 bytes, offset 6724398, file 236336 (line 900)
integck: write 58 bytes, offset 6177760, file 867972 (line 900)
integck: write 5549 bytes, offset 63297034, file 316719 (line 900)
integck: write 5153 bytes, offset 1837399, file 905019 (line 900)
integck: write 98 bytes, offset 75824407, file 547430 (line 900)
integck: write 2 bytes, offset 19023286, file 736742 (line 900)
integck: write 1 bytes, offset 77972034, file 890053 (line 900)
integck: write 70 bytes, offset 13613924, file 511089 (line 900)
integck: write 1 bytes, offset 34484019, file 595546 (line 900)
integck: fdatasyncing file 595546 (line 1297)
integck: write 5 bytes, offset 0, file 57830 (line 900)
integck: write 1 bytes, offset 13831486, file 135506 (line 900)
integck: write 2926949 bytes, offset 92321601, file 547430 (line 900)
integck: write 9834 bytes, offset 147443206, file 547430 (line 900)
integck: write 7379 bytes, offset 3438375, file 867972 (line 900)
integck: write 19 bytes, offset 3165291, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 125632 bytes, offset 2430946, file 922785 (line 900)
integck: creating dir /mnt/integck_test_dir_367/728029 (line 556)
integck: write 446 bytes, offset 4413232, file 515485 (line 900)
integck: write 55233 bytes, offset 141288, file 756092 (line 900)
integck: write 797844 bytes, offset 8210, file 728294 (line 900)
integck: write 331 bytes, offset 29129, file 127835 (line 900)
integck: write 901833 bytes, offset 43983970, file 890053 (line 900)
integck: write 4087406 bytes, offset 147453040, file 547430 (line 900)
integck: write 1 bytes, offset 63302583, file 316719 (line 900)
integck: write 3885 bytes, offset 63302584, file 316719 (line 900)
integck: write 2018561 bytes, offset 139001, file 76191 (line 900)
integck: write 828737 bytes, offset 63306469, file 316719 (line 900)
integck: write 32955 bytes, offset 0, file 316719 (line 900)
integck: write 829204 bytes, offset 3926663, file 922785 (line 900)
integck: write 1 bytes, offset 33950437, file 922785 (line 900)
integck: write 8708538 bytes, offset 4585902, file 515485 (line 900)
integck: write 605697 bytes, offset 31608874, file 112238 (line 900)
integck: write 47 bytes, offset 2592881, file 236336 (line 900)
integck: write 116939 bytes, offset 243223, file 728294 (line 900)
integck: write 21529 bytes, offset 1948472, file 434071 (line 900)
integck: creating file /mnt/integck_test_dir_367/888533/62559 (line 638)
integck: write 1 bytes, offset 8750287, file 792797 (line 900)
integck: write 8 bytes, offset 7226728, file 236336 (line 900)
integck: creating dir /mnt/integck_test_dir_367/kswihpyyziadyyhqzusxqjrgtrrldvrmwatxlnfavykymzfbjatlhxgpmpfkmyfmjzgiawfvecysbmuhnwmhzrrngpsnqrebmftptpouhoknjdtxdtbgifvakajimbyqurmffqphurawprcjbtfgbcvclz)
integck: write 57972 bytes, offset 4438341, file 743721 (line 900)
integck: write 58 bytes, offset 6177818, file 867972 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/687628 ---> /mnt/integck_test_dir_367/owwzylqzyhgfwphrwaqnknmnyywbufgypecmylhbwqqnrrffmzgxqpmmckittusozhrnzbubyxszfdszsgwbbrnlerfnfxokohowhpyxokkixap)
integck: write 8 bytes, offset 10856514, file 475603 (line 900)
integck: write 481880 bytes, offset 3257, file 583138 (line 900)
integck: write 13 bytes, offset 19023288, file 736742 (line 900)
integck: write 1 bytes, offset 3165310, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: creating file /mnt/integck_test_dir_367/817878 (line 638)
integck: write 4929 bytes, offset 2746017, file 511089 (line 900)
integck: write 4415555 bytes, offset 5603044, file 743721 (line 900)
integck: write 1 bytes, offset 26726137, file 112238 (line 900)
integck: write 31125 bytes, offset 10767523, file 736742 (line 900)
integck: creating dir /mnt/integck_test_dir_367/89288 (line 556)
integck: write 85477 bytes, offset 0, file 172794 (line 900)
integck: write 6907928 bytes, offset 1454833, file 743721 (line 900)
integck: write 5 bytes, offset 35098050, file 595546 (line 900)
integck: write 611 bytes, offset 1335791, file 722944 (line 900)
integck: write 7860236 bytes, offset 552063, file 728294 (line 900)
integck: write 2757190 bytes, offset 33307856, file 922785 (line 900)
integck: write 23587 bytes, offset 151540446, file 547430 (line 900)
integck: write 296445 bytes, offset 36065046, file 922785 (line 900)
integck: write 3325 bytes, offset 5250018, file 687628 (line 900)
integck: write 680 bytes, offset 151564033, file 547430 (line 900)
integck: write 9589040 bytes, offset 5253343, file 687628 (line 900)
integck: write 1 bytes, offset 29729442, file 922785 (line 900)
integck: write 38 bytes, offset 61569206, file 547430 (line 900)
integck: creating dir /mnt/integck_test_dir_367/525445 (line 556)
integck: write 76911 bytes, offset 7245274, file 922785 (line 900)
integck: write 403179 bytes, offset 37757588, file 547430 (line 900)
integck: write 213 bytes, offset 36361491, file 922785 (line 900)
integck: write 938860 bytes, offset 338535, file bscyklbauwizsxplruwxhoirczroowiwdrufdrnnutcdmbigdcficcarzoebyuawafyvkjhmbfgvlydnrfeazxaobzbfpyfugqzfrfhheuruiepxljajdtpkrcesruizbeakgcmtdpbyprndwcvesjekj)
integck: write 5 bytes, offset 12418441, file 595546 (line 900)
integck: write 466 bytes, offset 64135206, file 316719 (line 900)
integck: fdatasyncing file 316719 (line 1297)
integck: write 3917 bytes, offset 32214571, file 112238 (line 900)
integck: write 1 bytes, offset 660096, file 867972 (line 900)
integck: write 51 bytes, offset 1738026, file 705457 (line 900)
integck: write 8 bytes, offset 77972035, file 890053 (line 900)
integck: write 30 bytes, offset 77972043, file 890053 (line 900)
integck: write 4 bytes, offset 14842383, file 687628 (line 900)
integck: write 86 bytes, offset 8161, file 548772 (line 900)
integck: write 3 bytes, offset 24953352, file 547430 (line 900)
integck: write 1 bytes, offset 3159441, file 236336 (line 900)
integck: write 4859071 bytes, offset 8179469, file 728294 (line 900)
integck: write 21491 bytes, offset 10580130, file 890053 (line 900)
integck: write 75 bytes, offset 91079253, file 547430 (line 900)
integck: write 1330 bytes, offset 14497885, file 595546 (line 900)
integck: write 7 bytes, offset 8030893, file 728294 (line 900)
integck: write 6432704 bytes, offset 3165311, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 291 bytes, offset 32218488, file 112238 (line 900)
integck: write 483 bytes, offset 10856522, file 475603 (line 900)
integck: write 9153 bytes, offset 9392716, file 475603 (line 900)
integck: write 8879032 bytes, offset 151564713, file 547430 (line 900)
integck: write 94716 bytes, offset 0, file 160588 (line 900)
integck: write 91249 bytes, offset 21567463, file 112238 (line 900)
integck: write 819 bytes, offset 156251270, file 547430 (line 900)
integck: write 3182 bytes, offset 4787067, file 595546 (line 900)
integck: write 1 bytes, offset 55690777, file 316719 (line 900)
integck: write 26 bytes, offset 64135672, file 316719 (line 900)
integck: write 135 bytes, offset 64135698, file 316719 (line 900)
integck: write 1 bytes, offset 9598015, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 5424 bytes, offset 890689, file 112238 (line 900)
integck: write 6829 bytes, offset 205707, file 46977 (line 900)
integck: write 853310 bytes, offset 32218779, file 112238 (line 900)
integck: creating dir /mnt/integck_test_dir_367/266158 (line 556)
integck: write 473 bytes, offset 0, file 548772 (line 900)
integck: creating file /mnt/integck_test_dir_367/314714/531768 (line 638)
integck: write 532 bytes, offset 34115362, file 922785 (line 900)
integck: write 76 bytes, offset 160443745, file 547430 (line 900)
integck: write 228 bytes, offset 11116394, file 112238 (line 900)
integck: write 6 bytes, offset 19157402, file 112238 (line 900)
integck: write 5 bytes, offset 10018599, file 743721 (line 900)
integck: creating dir /mnt/integck_test_dir_367/349619/751565 (line 556)
integck: write 8 bytes, offset 138159647, file 547430 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfo)
integck: write 37684 bytes, offset 650269, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 210 bytes, offset 0, file 817878 (line 900)
integck: write 4838 bytes, offset 34004603, file 316719 (line 900)
integck: write 21 bytes, offset 5337873, file 236336 (line 900)
integck: write 4 bytes, offset 33072089, file 112238 (line 900)
integck: write 37 bytes, offset 47629134, file 890053 (line 900)
integck: write 547 bytes, offset 9342, file 548772 (line 900)
integck: write 9452 bytes, offset 19023301, file 736742 (line 900)
integck: creating file /mnt/integck_test_dir_367/xuzxdvlmooyxwgdsenkizpxwizoreracohoyvixshsnsbfllqpkmbqnjvapfzubapwhzwoqssxgotduubtvbgvofzefklokbzbzbtnlf (line 638)
integck: write 3058577 bytes, offset 8230933, file 728294 (line 900)
integck: write 74 bytes, offset 19032753, file 736742 (line 900)
integck: write 1437 bytes, offset 4672813, file 236336 (line 900)
integck: creating file /mnt/integck_test_dir_367/419106 (line 638)
integck: write 2 bytes, offset 5272742, file 890053 (line 900)
integck: write 60 bytes, offset 11976980, file 249883 (line 900)
integck: write 4316 bytes, offset 21472377, file 316719 (line 900)
integck: write 85 bytes, offset 13038540, file 728294 (line 900)
integck: write 20756 bytes, offset 8608009, file 316719 (line 900)
integck: creating dir /mnt/integck_test_dir_367/882189/wuhdofmjfrebwuajixaljljohigtdkgklxatzptxyxxliwfameojzlalimbardquokaujzfobchneudnjwjymfsflkwtbxbduxadvpehbzjiegzyhuzyttvesitjhebazfmnrubtcouzeueyjee)
integck: write 1 bytes, offset 134852982, file 547430 (line 900)
integck: write 7279375 bytes, offset 15571752, file 736742 (line 900)
integck: write 396 bytes, offset 2714635, file 774586 (line 900)
integck: write 35 bytes, offset 37443945, file 890053 (line 900)
integck: write 72 bytes, offset 0, file 511089 (line 900)
integck: write 1 bytes, offset 41604829, file 316719 (line 900)
integck: write 1 bytes, offset 35713446, file 890053 (line 900)
integck: write 14 bytes, offset 160443821, file 547430 (line 900)
integck: write 739019 bytes, offset 4594454, file 316719 (line 900)
integck: write 885616 bytes, offset 0, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 97554 bytes, offset 160443835, file 547430 (line 900)
integck: write 1 bytes, offset 112834026, file 547430 (line 900)
integck: write 1 bytes, offset 160541389, file 547430 (line 900)
integck: write 895143 bytes, offset 1260099, file 236336 (line 900)
integck: write 1889 bytes, offset 160541390, file 547430 (line 900)
integck: write 100 bytes, offset 183975, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 3680 bytes, offset 13471826, file 112238 (line 900)
integck: write 294244 bytes, offset 0, file 722944 (line 900)
integck: write 697 bytes, offset 22851127, file 736742 (line 900)
integck: write 1 bytes, offset 9889, file 548772 (line 900)
integck: write 621 bytes, offset 160543279, file 547430 (line 900)
integck: write 459 bytes, offset 6177876, file 867972 (line 900)
integck: write 7 bytes, offset 7226736, file 236336 (line 900)
integck: write 491245 bytes, offset 6178335, file 867972 (line 900)
integck: write 336 bytes, offset 55315114, file 547430 (line 900)
integck: write 97 bytes, offset 36361704, file 922785 (line 900)
integck: creating dir /mnt/integck_test_dir_367/157739 (line 556)
integck: write 49769 bytes, offset 14842387, file 687628 (line 900)
integck: write 9668325 bytes, offset 33072093, file 112238 (line 900)
integck: write 6379479 bytes, offset 2468904, file 518333 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/278341 ---> /mnt/integck_test_dir_367/236336 (line 683)
integck: write 29 bytes, offset 915786, file 743721 (line 900)
integck: write 2 bytes, offset 7226743, file 278341 (line 900)
integck: write 339106 bytes, offset 90419092, file 547430 (line 900)
integck: write 1 bytes, offset 11977040, file 249883 (line 900)
integck: write 1 bytes, offset 160543900, file 547430 (line 900)
integck: write 5601577 bytes, offset 77972073, file 890053 (line 900)
integck: creating dir /mnt/integck_test_dir_367/157739/368765 (line 556)
integck: write 676 bytes, offset 14892156, file 687628 (line 900)
integck: write 1 bytes, offset 13038625, file 728294 (line 900)
integck: creating file /mnt/integck_test_dir_367/829611 (line 638)
integck: creating file /mnt/integck_test_dir_367/28489 (line 638)
integck: write 4116054 bytes, offset 23958841, file 316719 (line 900)
integck: write 15556 bytes, offset 497470, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 8 bytes, offset 11977041, file 249883 (line 900)
integck: write 1 bytes, offset 2157562, file 76191 (line 900)
integck: fsyncing file 76191 (line 1292)
integck: write 956545 bytes, offset 6321238, file 254635 (line 900)
integck: write 1 bytes, offset 14892832, file 687628 (line 900)
integck: fsyncing dir /mnt/integck_test_dir_367 (line 2277)
integck: write 3875 bytes, offset 42740418, file 112238 (line 900)
integck: creating dir /mnt/integck_test_dir_367/591957 (line 556)
integck: write 65814 bytes, offset 83573650, file 890053 (line 900)
integck: write 52996 bytes, offset 666789, file 434071 (line 900)
integck: write 5852544 bytes, offset 0, file 728294 (line 900)
integck: write 16 bytes, offset 44031629, file 890053 (line 900)
integck: write 510 bytes, offset 160543901, file 547430 (line 900)
integck: write 9 bytes, offset 9598016, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 6448 bytes, offset 13845193, file 687628 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/749012 ---> /mnt/integck_test_dir_367/314714/705457 (line 683)
integck: write 7 bytes, offset 0, file 27467 (line 900)
integck: creating dir /mnt/integck_test_dir_367/730047 (line 556)
integck: write 9704917 bytes, offset 8752, file 937914 (line 900)
integck: write 4920071 bytes, offset 35098055, file 595546 (line 900)
integck: write 806092 bytes, offset 22851824, file 736742 (line 900)
integck: write 7521 bytes, offset 91491504, file 547430 (line 900)
integck: write 1 bytes, offset 164729517, file 547430 (line 900)
integck: write 1 bytes, offset 3829812, file 278341 (line 900)
integck: write 717601 bytes, offset 9598025, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 76994 bytes, offset 164729518, file 547430 (line 900)
integck: write 419674 bytes, offset 0, file 782223 (line 900)
integck: write 294316 bytes, offset 16876530, file 595546 (line 900)
integck: write 447 bytes, offset 42744293, file 112238 (line 900)
integck: write 594 bytes, offset 3533934, file 112238 (line 900)
integck: creating dir /mnt/integck_test_dir_367/62841 (line 556)
integck: write 496 bytes, offset 9478699, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwjnha)
integck: write 51 bytes, offset 21340517, file 547430 (line 900)
integck: write 8 bytes, offset 93269911, file 547430 (line 900)
integck: write 43207 bytes, offset 9656806, file 687628 (line 900)
integck: write 643 bytes, offset 196521, file 756092 (line 900)
integck: write 86 bytes, offset 10857005, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwjnha)
integck: write 10 bytes, offset 42744740, file 112238 (line 900)
integck: write 1 bytes, offset 18980788, file 890053 (line 900)
integck: write 504349 bytes, offset 101509143, file 547430 (line 900)
integck: write 7 bytes, offset 10018604, file 743721 (line 900)
integck: write 9052295 bytes, offset 1929698, file 867972 (line 900)
integck: write 50705 bytes, offset 6557447, file 518333 (line 900)
integck: write 396790 bytes, offset 10981993, file 867972 (line 900)
integck: write 312 bytes, offset 108202, file 46977 (line 900)
integck: write 557 bytes, offset 20179072, file 736742 (line 900)
integck: creating file /mnt/integck_test_dir_367/515410/ccxnyyyccwkludiekzscyreyekrsjsssjwkguuzhwmocdblsneymksvrhhwwjomjfmomdizniulosxpszqmjnneawfyvuqmvlmrcdzzri (line 638)
integck: write 9 bytes, offset 66037, file 127835 (line 900)
integck: write 7820892 bytes, offset 164806512, file 547430 (line 900)
integck: write 14607 bytes, offset 8512714, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwjn)
integck: write 1 bytes, offset 42744750, file 112238 (line 900)
integck: write 9625 bytes, offset 10424445, file 687628 (line 900)
integck: write 5437 bytes, offset 23657916, file 736742 (line 900)
integck: write 431352 bytes, offset 172627404, file 547430 (line 900)
integck: write 384 bytes, offset 134092575, file 547430 (line 900)
integck: write 7 bytes, offset 260857, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 80064 bytes, offset 42744751, file 112238 (line 900)
integck: write 1 bytes, offset 4353139, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 7519718 bytes, offset 1500482, file 743721 (line 900)
integck: write 8188414 bytes, offset 54273, file 160588 (line 900)
integck: write 855666 bytes, offset 26559498, file 547430 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/530514 ---> /mnt/integck_test_dir_367/349619/751565/499625 (line 2132)
integck: write 44016 bytes, offset 64135833, file 316719 (line 900)
integck: write 1 bytes, offset 40018126, file 595546 (line 900)
integck: write 1 bytes, offset 7226745, file 278341 (line 900)
integck: write 6275 bytes, offset 70269466, file 547430 (line 900)
integck: write 5882 bytes, offset 173058756, file 547430 (line 900)
integck: write 85226 bytes, offset 10857091, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwj)
integck: write 7429 bytes, offset 33780712, file 112238 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/304665 ---> /mnt/integck_test_dir_367/46977 (line 683)
integck: write 3863 bytes, offset 73812297, file 547430 (line 900)
integck: write 6 bytes, offset 9801759, file 736742 (line 900)
integck: write 7077 bytes, offset 36361801, file 922785 (line 900)
integck: write 43 bytes, offset 13831487, file 135506 (line 900)
integck: write 1 bytes, offset 173064638, file 547430 (line 900)
integck: write 34992 bytes, offset 5342384, file 728294 (line 900)
integck: write 8868 bytes, offset 180274, file 672362 (line 900)
integck: write 82 bytes, offset 42824815, file 112238 (line 900)
integck: write 710015 bytes, offset 4022087, file 743721 (line 900)
integck: write 36548 bytes, offset 72554673, file 547430 (line 900)
integck: write 1 bytes, offset 173064639, file 547430 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/mfidighfvfguwqdgyuodjyqaoluojicedgmhcivcyjaxdriodgtbbyneqbaxdprpgoibgvmmzyqryhymyvumwtjzwjtgathxiwyvmbxvteugjdeqhdkqkxspbqvzunsibufxayfvmelsylpxyoqzd)
integck: write 98477 bytes, offset 0, file 547430 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/269882 ---> /mnt/integck_test_dir_367/mfidighfvfguwqdgyuodjyqaoluojicedgmhcivcyjaxdriodgtbbyneqbaxdprpgoibgvmmzyqryhymyvumwtjzwjtgathxiwyvmbxvteugjde)
integck: creating file /mnt/integck_test_dir_367/caxqgtfmgpmqatleoqerdzpuuazxrddmscptiieycmsdfqkxvntdjgdrdwbobrdulpnurdxmpwzmesovdlmcrqlgautvionyjppyxuyqwhyooqfiywfujhrsdsqbgmaxrwhynpoiqslrdyrhvairftuzk)
integck: creating hardlink /mnt/integck_test_dir_367/684261 ---> /mnt/integck_test_dir_367/817878 (line 683)
integck: write 4 bytes, offset 99876306, file 547430 (line 900)
integck: creating dir /mnt/integck_test_dir_367/250881 (line 556)
integck: write 73 bytes, offset 2666, file 548772 (line 900)
integck: write 1 bytes, offset 78, file 684261 (line 900)
integck: write 13619 bytes, offset 9890, file 548772 (line 900)
integck: write 168805 bytes, offset 26279, file 247004 (line 900)
integck: write 3899820 bytes, offset 2, file nrzaryjetbdepvrpyceovatetbhirfvoazakqhwygtwbvxakirzlvfdicybmaysucfumoopynlpxxfuhdigwpzhpvjppiajtklwzfqdhzqcgyptfbfgeknbhcvcdden (line 900)
integck: write 83116 bytes, offset 10942317, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwj)
integck: write 46 bytes, offset 232530, file 782223 (line 900)
integck: write 94 bytes, offset 0, file 547430 (line 900)
integck: write 7207312 bytes, offset 4737860, file 249883 (line 900)
integck: write 5410347 bytes, offset 62928870, file 547430 (line 900)
integck: creating file /mnt/integck_test_dir_367/982115 (line 638)
integck: write 1 bytes, offset 129475290, file 547430 (line 900)
integck: write 70321 bytes, offset 1011090, file 688063 (line 900)
integck: write 53825 bytes, offset 874875, file 518333 (line 900)
integck: write 1508692 bytes, offset 24043151, file 595546 (line 900)
integck: write 56 bytes, offset 64179849, file 316719 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/430437 ---> /mnt/integck_test_dir_367/922785 (line 683)
integck: write 609889 bytes, offset 42824897, file 112238 (line 900)
integck: write 1 bytes, offset 43434786, file 112238 (line 900)
integck: write 6 bytes, offset 14892833, file 687628 (line 900)
integck: write 6446 bytes, offset 0, file 333095 (line 900)
integck: write 2935463 bytes, offset 0, file 595546 (line 900)
integck: write 65 bytes, offset 83639464, file 890053 (line 900)
integck: write 148 bytes, offset 85477, file 172794 (line 900)
integck: write 743 bytes, offset 405504, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 9 bytes, offset 92175195, file 547430 (line 900)
integck: write 43821 bytes, offset 173064640, file 547430 (line 900)
integck: write 1 bytes, offset 11083941, file 249883 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/874090/676247 ---> /mnt/integck_test_dir_367/568628/qzcfpzyetdafaohilsicymuazfxiesfcqkueavlvvcyoipdasjaxpgyfjkskietwqtvdwvlkvopdkvvezlhlbhrthkgxvjlneh)
integck: write 3546692 bytes, offset 43434787, file 112238 (line 900)
integck: write 296100 bytes, offset 5221, file 531639 (line 900)
integck: write 3925 bytes, offset 45564605, file 547430 (line 900)
integck: write 183435 bytes, offset 14474206, file 547430 (line 900)
integck: write 960536 bytes, offset 41625198, file 890053 (line 900)
integck: write 38 bytes, offset 13031068, file 687628 (line 900)
integck: write 390 bytes, offset 8020244, file 547430 (line 900)
integck: write 935492 bytes, offset 568767, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwjn)
integck: write 959 bytes, offset 687953, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 9128559 bytes, offset 36368878, file 430437 (line 900)
integck: write 8839629 bytes, offset 173108461, file 547430 (line 900)
integck: write 4456326 bytes, offset 7649332, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofw)
integck: creating hardlink /mnt/integck_test_dir_367/136533/901637/401756 ---> /mnt/integck_test_dir_367/518333 (line 683)
integck: write 5 bytes, offset 12363, file 548772 (line 900)
integck: write 59458 bytes, offset 10018611, file 743721 (line 900)
integck: write 56607 bytes, offset 19759563, file 595546 (line 900)
integck: write 310054 bytes, offset 46981479, file 112238 (line 900)
integck: write 12504 bytes, offset 553788, file 688063 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/574323 ---> /mnt/integck_test_dir_367/639391 (line 683)
integck: write 2538 bytes, offset 285411, file 688063 (line 900)
integck: write 63846 bytes, offset 179597390, file 547430 (line 900)
integck: write 5 bytes, offset 23663353, file 736742 (line 900)
integck: write 4507 bytes, offset 62057, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 3148751 bytes, offset 47291533, file 112238 (line 900)
integck: write 4 bytes, offset 171687234, file 547430 (line 900)
integck: write 8730 bytes, offset 0, file caxqgtfmgpmqatleoqerdzpuuazxrddmscptiieycmsdfqkxvntdjgdrdwbobrdulpnurdxmpwzmesovdlmcrqlgautvionyjppyxuyqwhyooqfiywfujhrsdsqbgmaxrwhynpoiqslrdyrhvairftuzkgfnmbqc)
integck: write 139 bytes, offset 17178469, file 316719 (line 900)
integck: write 7 bytes, offset 14892839, file 687628 (line 900)
integck: write 4926 bytes, offset 29430368, file 430437 (line 900)
integck: write 18 bytes, offset 181948090, file 547430 (line 900)
integck: write 1 bytes, offset 27819898, file 736742 (line 900)
integck: write 1 bytes, offset 181948108, file 547430 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/349619/rgmzhfaofpvygrfqhavcfjyqzapixficutcpenmgmevfpdzasieohqyyojeozvpltwkujnqojigxvchexdjjzgivitboptfkipytcgjtozuecwuk ---> /mnt/integck_test_dir_36)
integck: creating hardlink /mnt/integck_test_dir_367/983937 ---> /mnt/integck_test_dir_367/430437 (line 683)
integck: write 34716 bytes, offset 3132008, file 434071 (line 900)
integck: fsyncing file 434071 (line 1292)
integck: creating file /mnt/integck_test_dir_367/150977 (line 638)
integck: write 6119354 bytes, offset 2985596, file 249883 (line 900)
integck: write 289263 bytes, offset 62377694, file 890053 (line 900)
integck: write 4717 bytes, offset 83639529, file 890053 (line 900)
integck: write 1 bytes, offset 26289717, file 595546 (line 900)
integck: write 5 bytes, offset 5804248, file 867972 (line 900)
integck: write 511442 bytes, offset 10315626, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 56810 bytes, offset 4690689, file 687628 (line 900)
integck: write 779 bytes, offset 12921657, file 547430 (line 900)
integck: write 875 bytes, offset 159380429, file 547430 (line 900)
integck: write 13866 bytes, offset 83644246, file 890053 (line 900)
integck: write 7514702 bytes, offset 45497437, file 983937 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/508791 ---> /mnt/integck_test_dir_367/574323 (line 683)
integck: write 1 bytes, offset 9713669, file 937914 (line 900)
integck: write 1 bytes, offset 183840, file 247004 (line 900)
integck: write 8587 bytes, offset 40018127, file 595546 (line 900)
integck: write 76 bytes, offset 12105658, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwjnha)
integck: write 2 bytes, offset 0, file wrymaumzrqlmcvdtvdklkuhxefdgelxkeqys (line 900)
integck: write 77 bytes, offset 158787596, file 547430 (line 900)
integck: creating file /mnt/integck_test_dir_367/256374 (line 638)
integck: write 702 bytes, offset 13831530, file 135506 (line 900)
integck: write 21 bytes, offset 40026714, file 595546 (line 900)
integck: write 6635816 bytes, offset 40026735, file 595546 (line 900)
integck: creating file /mnt/integck_test_dir_367/659220 (line 638)
integck: write 685715 bytes, offset 532760, file rgmzhfaofpvygrfqhavcfjyqzapixficutcpenmgmevfpdzasieohqyyojeozvpltwkujnqojigxvchexdjjzgivitboptfkipytcgjtozuecwuk (line 900)
integck: write 5 bytes, offset 2240575, file 112238 (line 900)
integck: fdatasyncing file 112238 (line 1297)
integck: write 898560 bytes, offset 68130, file 242251 (line 900)
integck: write 448478 bytes, offset 688912, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 786 bytes, offset 721280, file 983937 (line 900)
integck: write 59536 bytes, offset 43496031, file 112238 (line 900)
integck: write 47 bytes, offset 53012139, file 983937 (line 900)
integck: write 1 bytes, offset 181948109, file 547430 (line 900)
integck: write 1 bytes, offset 11378783, file 867972 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/56259 ---> /mnt/integck_test_dir_367/331543 (line 2132)
integck: creating dir /mnt/integck_test_dir_367/467637 (line 556)
integck: write 5 bytes, offset 8324722, file 401756 (line 900)
integck: write 1 bytes, offset 52668905, file 890053 (line 900)
integck: write 15 bytes, offset 210, file 684261 (line 900)
integck: write 1 bytes, offset 225, file 684261 (line 900)
integck: write 72 bytes, offset 7226746, file 278341 (line 900)
integck: write 100 bytes, offset 27819899, file 736742 (line 900)
integck: write 4198601 bytes, offset 75389740, file 547430 (line 900)
integck: creating dir /mnt/integck_test_dir_367/882189/390402/450431 (line 556)
integck: write 5858505 bytes, offset 11378784, file 867972 (line 900)
integck: write 1446 bytes, offset 16889, file 370668 (line 900)
integck: write 11281 bytes, offset 64179905, file 316719 (line 900)
integck: write 1 bytes, offset 2642992, file 743721 (line 900)
integck: creating file /mnt/integck_test_dir_367/589041 (line 638)
integck: write 53860 bytes, offset 5585860, file 743721 (line 900)
integck: write 694 bytes, offset 8848383, file 401756 (line 900)
integck: write 3859 bytes, offset 50440284, file 112238 (line 900)
integck: write 13 bytes, offset 27819999, file 736742 (line 900)
integck: write 925 bytes, offset 0, file 547430 (line 900)
integck: creating file /mnt/integck_test_dir_367/754588 (line 638)
integck: write 2765 bytes, offset 181948110, file 547430 (line 900)
integck: write 1 bytes, offset 0, file 28489 (line 900)
integck: write 8145741 bytes, offset 17237289, file 867972 (line 900)
integck: write 8 bytes, offset 13038626, file 728294 (line 900)
integck: write 83 bytes, offset 24565789, file 890053 (line 900)
integck: write 2396 bytes, offset 56575155, file 316719 (line 900)
integck: write 4823 bytes, offset 11977049, file 249883 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/934018 ---> /mnt/integck_test_dir_367/508791 (line 683)
integck: write 2798932 bytes, offset 181950875, file 547430 (line 900)
integck: write 37130 bytes, offset 169061558, file 547430 (line 900)
integck: write 9 bytes, offset 14892846, file 687628 (line 900)
integck: write 4587 bytes, offset 14892855, file 687628 (line 900)
integck: write 7 bytes, offset 2, file 27467 (line 900)
integck: write 6828 bytes, offset 1137390, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 2703943 bytes, offset 7681357, file 687628 (line 900)
integck: write 620 bytes, offset 25383030, file 867972 (line 900)
integck: write 43 bytes, offset 5163765, file 278341 (line 900)
integck: write 673980 bytes, offset 0, file 150977 (line 900)
integck: write 63 bytes, offset 3, file 934018 (line 900)
integck: fdatasyncing dir /mnt/integck_test_dir_367 (line 2282)
integck: creating file /mnt/integck_test_dir_367/327508 (line 638)
integck: write 5 bytes, offset 50444143, file 112238 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/71305 ---> /mnt/integck_test_dir_367/782223 (line 683)
integck: write 1631607 bytes, offset 12105734, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfof)
integck: write 38423 bytes, offset 5273, file 370668 (line 900)
integck: write 74 bytes, offset 24920240, file 595546 (line 900)
integck: write 9 bytes, offset 184749807, file 547430 (line 900)
integck: write 827 bytes, offset 184749816, file 547430 (line 900)
integck: write 9517 bytes, offset 0, file 278341 (line 900)
integck: creating dir /mnt/integck_test_dir_367/328150 (line 556)
integck: write 3000201 bytes, offset 1851903, file 736742 (line 900)
integck: write 93 bytes, offset 2330, file 548772 (line 900)
integck: write 44159 bytes, offset 0, file ccxnyyyccwkludiekzscyreyekrsjsssjwkguuzhwmocdblsneymksvrhhwwjomjfmomdizniulosxpszqmjnneawfyvuqmvlmrcdzzri (line 900)
integck: write 1297 bytes, offset 22090016, file 112238 (line 900)
integck: write 55 bytes, offset 77866908, file 890053 (line 900)
integck: write 46202 bytes, offset 55446201, file 316719 (line 900)
integck: write 12332 bytes, offset 4526055, file 278341 (line 900)
integck: write 1 bytes, offset 184750643, file 547430 (line 900)
integck: creating file /mnt/integck_test_dir_367/664603 (line 638)
integck: write 378 bytes, offset 13038634, file 728294 (line 900)
integck: creating dir /mnt/integck_test_dir_367/245564 (line 556)
integck: write 58 bytes, offset 95923577, file 547430 (line 900)
integck: write 215292 bytes, offset 48, file 934018 (line 900)
integck: write 9 bytes, offset 0, file 983937 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/26089 ---> /mnt/integck_test_dir_367/884992/774586 (line 683)
integck: write 68379 bytes, offset 7220792, file 112238 (line 900)
integck: write 806 bytes, offset 7464971, file 736742 (line 900)
integck: write 96 bytes, offset 0, file 982115 (line 900)
integck: write 1 bytes, offset 18834278, file 547430 (line 900)
integck: creating file /mnt/integck_test_dir_367/65158 (line 638)
integck: write 67428 bytes, offset 25383650, file 867972 (line 900)
integck: write 4582 bytes, offset 0, file 154464 (line 900)
integck: write 1 bytes, offset 184750644, file 547430 (line 900)
integck: write 10 bytes, offset 6011105, file 401756 (line 900)
integck: write 908222 bytes, offset 5244281, file 278341 (line 900)
integck: creating dir /mnt/integck_test_dir_367/669202 (line 556)
integck: write 8 bytes, offset 2020716, file 905019 (line 900)
integck: write 89520 bytes, offset 8976482, file 62957 (line 900)
integck: write 4343 bytes, offset 729990, file 76191 (line 900)
integck: write 6806 bytes, offset 184750645, file 547430 (line 900)
integck: write 1 bytes, offset 10078069, file 743721 (line 900)
integck: creating file /mnt/integck_test_dir_367/74005 (line 638)
integck: write 1 bytes, offset 2379860, file 905019 (line 900)
integck: write 89 bytes, offset 11534634, file 249883 (line 900)
integck: write 9939625 bytes, offset 64191186, file 316719 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/577221 ---> /mnt/integck_test_dir_367/edfnavxqrcolcspvpyqdhiksutbntilhtsextxnjmrxlnhoyiyjvxucpinzvgebcnsslsyprefstdnjrcagyioilpmeodibopmdybgysaltptdyj)
integck: write 5796 bytes, offset 74130811, file 316719 (line 900)
integck: write 94 bytes, offset 13294440, file 515485 (line 900)
integck: write 67233 bytes, offset 184757451, file 547430 (line 900)
integck: write 57375 bytes, offset 6428208, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwjn)
integck: write 94 bytes, offset 49904948, file 112238 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/380011 ---> /mnt/integck_test_dir_367/349619/751565/177196 (line 2132)
integck: write 1 bytes, offset 62540258, file 547430 (line 900)
integck: write 95827 bytes, offset 4215462, file 112238 (line 900)
integck: write 1882481 bytes, offset 13613994, file 511089 (line 900)
integck: write 8 bytes, offset 10827068, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 1 bytes, offset 113422410, file 547430 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/hgpvqojfnhgkuklyzojpxohrcrjzaacjfbblsriuujtsgqpcrms ---> /mnt/integck_test_dir_367/486694 (line 2132)
integck: write 498 bytes, offset 21706752, file 547430 (line 900)
integck: write 869967 bytes, offset 215340, file 934018 (line 900)
integck: fsyncing file 934018 (line 1292)
integck: write 749488 bytes, offset 25451078, file 867972 (line 900)
integck: write 1 bytes, offset 4891759, file 515485 (line 900)
integck: write 1 bytes, offset 24083883, file 112238 (line 900)
integck: write 1 bytes, offset 5276301, file 743721 (line 900)
integck: write 1109264 bytes, offset 22647723, file 983937 (line 900)
integck: fsyncing file 983937 (line 1292)
integck: write 82299 bytes, offset 197164, file 756092 (line 900)
integck: write 1 bytes, offset 184824684, file 547430 (line 900)
integck: write 6616 bytes, offset 3999661, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/ayhktkimwosflnbonnzuyrtpauhzbbzmhmdoacyhcesgfudkigbneiimrexmzwoynfeffwlvszqicjcfqgxsgue ---> /mnt/integck_test_dir_367/65158 (line 683)
integck: write 20 bytes, offset 1144218, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 3587292 bytes, offset 151758, file 76191 (line 900)
integck: write 5616077 bytes, offset 5117091, file 515485 (line 900)
integck: write 8176 bytes, offset 18434813, file 112238 (line 900)
integck: write 9749700 bytes, offset 43696, file 370668 (line 900)
integck: write 9788053 bytes, offset 0, file 589041 (line 900)
integck: write 1 bytes, offset 5178892, file fuxaiyznabsluovrkdiyrqzlirsldgkyhrycntkeztxetzkdnywpakjdxurloqnezpbmhibvstmlpmuqgtmqujjwuhmoopwrcuggnwqlsxhixrncszbskuccqhhufhduxauspdlliygkmjredajfbfqcrsomy)
integck: write 1 bytes, offset 161712483, file 547430 (line 900)
integck: creating dir /mnt/integck_test_dir_367/565211 (line 556)
integck: creating file /mnt/integck_test_dir_367/624544 (line 638)
integck: write 6055 bytes, offset 2171225, file 278341 (line 900)
integck: write 2025422 bytes, offset 11559341, file 736742 (line 900)
integck: write 9390555 bytes, offset 508622, file 866941 (line 900)
integck: write 855 bytes, offset 2434557, file 722944 (line 900)
integck: creating file /mnt/integck_test_dir_367/250881/320268 (line 638)
integck: write 654 bytes, offset 47540, file 756092 (line 900)
integck: write 56 bytes, offset 3739050, file 76191 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/100734 ---> /mnt/integck_test_dir_367/882189/390402/450431 (line 2132)
integck: write 364 bytes, offset 7044399, file 595546 (line 900)
integck: write 5129090 bytes, offset 14897442, file 687628 (line 900)
integck: write 1 bytes, offset 6540628, file 743721 (line 900)
integck: write 9009 bytes, offset 25753914, file 595546 (line 900)
integck: write 35859 bytes, offset 1234841, file 905019 (line 900)
integck: write 2 bytes, offset 33191436, file 595546 (line 900)
integck: write 471479 bytes, offset 27289501, file 112238 (line 900)
integck: write 7557077 bytes, offset 301321, file 531639 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/iupzdjaaszxvbponxcbsincxpkghapyuyusyiopdooymhigmzgzgpqtddqteexuofhiazpsmszzwhgpopweblphdxqswrjuhcimnumzhbkwchrdfrntrquswgwgbowtrtxmqcjzplpqmcdrnrliiv)
integck: write 1 bytes, offset 3229110, file 867972 (line 900)
integck: write 140678 bytes, offset 2435412, file 722944 (line 900)
integck: write 5736832 bytes, offset 107109559, file 547430 (line 900)
integck: write 5420 bytes, offset 50444148, file 112238 (line 900)
integck: creating dir /mnt/integck_test_dir_367/830492 (line 556)
integck: write 3 bytes, offset 15496475, file 511089 (line 900)
integck: write 1 bytes, offset 53012186, file 983937 (line 900)
integck: write 2 bytes, offset 0, file ayhktkimwosflnbonnzuyrtpauhzbbzmhmdoacyhcesgfudkigbneiimrexmzwoynfeffwlvszqicjcfqgxsgue (line 900)
integck: write 4846 bytes, offset 144483678, file 547430 (line 900)
integck: creating dir /mnt/integck_test_dir_367/874090/711043 (line 556)
integck: write 1 bytes, offset 27820012, file 736742 (line 900)
integck: write 74946 bytes, offset 50449568, file 112238 (line 900)
integck: write 5 bytes, offset 5547131, file 249883 (line 900)
integck: write 300 bytes, offset 49127786, file 983937 (line 900)
integck: write 1 bytes, offset 15496478, file 511089 (line 900)
integck: creating file /mnt/integck_test_dir_367/456910/340158 (line 638)
integck: write 7628 bytes, offset 20026532, file 687628 (line 900)
integck: creating file /mnt/integck_test_dir_367/307719 (line 638)
integck: write 1 bytes, offset 184824685, file 547430 (line 900)
integck: creating dir /mnt/integck_test_dir_367/467703 (line 556)
integck: write 3 bytes, offset 83658112, file 890053 (line 900)
integck: write 47217 bytes, offset 0, file 815564 (line 900)
integck: write 5 bytes, offset 1468167, file 269882 (line 900)
integck: write 6803133 bytes, offset 184824686, file 547430 (line 900)
integck: creating dir /mnt/integck_test_dir_367/452553 (line 556)
integck: write 74089 bytes, offset 0, file 867972 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleay)
integck: write 760299 bytes, offset 145870463, file 547430 (line 900)
integck: write 2509252 bytes, offset 2344596, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofw)
integck: write 5302 bytes, offset 20034160, file 687628 (line 900)
integck: write 2 bytes, offset 109442465, file 547430 (line 900)
integck: write 4 bytes, offset 8710398, file 595546 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/khcvougcklektffmbfongbaujfhydizegxtyenbuupfyuxenukopdtzgapafydycpiosqkxnluwavwzyvhcrfsecuidmtcgchwcmdkmpfqujkgvgsitrmjqqojltmaiwvcytabzogpouekzdbjvrub)
integck: write 78 bytes, offset 32645, file 318608 (line 900)
integck: write 260 bytes, offset 180503815, file 547430 (line 900)
integck: creating file /mnt/integck_test_dir_367/bauyqwkghwmztiavgoqsaavddddxnvesyyyuyblmmnnsmnlppxhzfblktavbplxmnbjmvqqsqfibfomidehsitumvovtkifbzbnjugzmmidszdbpfejthfibabrcjwczbxhualjvhwgxwmvhcrcrbcifs)
integck: creating dir /mnt/integck_test_dir_367/hxzdwffiegxnvgntdywzrynrxxzsqytpkeornrvvvgolebucxjjeqdrydylacxlooygrpwoszrfrrcnexqjxbkamitgqp (line 556)
integck: creating symlink /mnt/integck_test_dir_367/iecjrfrbbbmhjfvthymzwhpemmthidnamfklsbrjzkjkcfoidchrfuncqybjrjrfmmqneqxidhlbunnsvblrrujlnvxqyzwuhjupkrxpgskrtasnipqntetdqfxmolsxjohntrvdzmohygcyjvqkuf)
integck: write 1 bytes, offset 191627819, file 547430 (line 900)
integck: write 1 bytes, offset 3296581, file 269882 (line 900)
integck: creating dir /mnt/integck_test_dir_367/389467 (line 556)
integck: fdatasyncing dir /mnt/integck_test_dir_367 (line 2282)
integck: write 8438445 bytes, offset 13794044, file 547430 (line 900)
integck: creating file /mnt/integck_test_dir_367/944462 (line 638)
integck: write 210691 bytes, offset 2397508, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwj)
integck: write 8 bytes, offset 7256395, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwjnharx)
integck: write 9813 bytes, offset 1, file ayhktkimwosflnbonnzuyrtpauhzbbzmhmdoacyhcesgfudkigbneiimrexmzwoynfeffwlvszqicjcfqgxsgue (line 900)
integck: write 13850 bytes, offset 48655198, file 316719 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/iecjrfrbbbmhjfvthymzwhpemmthidnamfklsbrjzkjkcfoidchrfuncqybjrjrfmmqneqxidhlbunnsvblrrujlnvxqyzwuhjupkrxpgskrtasnipqntetdqfxmolsxjohntrvdzmohygcyjvqku)
integck: write 100 bytes, offset 13737341, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwjnh)
integck: write 1 bytes, offset 20039462, file 687628 (line 900)
integck: write 40 bytes, offset 13737441, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwjnha)
integck: creating file /mnt/integck_test_dir_367/922517 (line 638)
integck: creating file /mnt/integck_test_dir_367/456910/657652 (line 638)
integck: write 1 bytes, offset 788252, file 722944 (line 900)
integck: creating file /mnt/integck_test_dir_367/384283 (line 638)
integck: creating file /mnt/integck_test_dir_367/696346 (line 638)
integck: write 7104 bytes, offset 0, file 829611 (line 900)
integck: write 441 bytes, offset 0, file 236213 (line 900)
integck: write 2945951 bytes, offset 0, file 62559 (line 900)
integck: write 618031 bytes, offset 53012187, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqc)
integck: write 58 bytes, offset 191627820, file 118480 (line 900)
integck: write 1 bytes, offset 7105501, file 401756 (line 900)
integck: write 69052 bytes, offset 13039012, file 728294 (line 900)
integck: write 6885 bytes, offset 61110, file 127835 (line 900)
integck: write 28525 bytes, offset 74136607, file 316719 (line 900)
integck: creating file /mnt/integck_test_dir_367/467637/327073 (line 638)
integck: write 2031 bytes, offset 7104, file 829611 (line 900)
integck: write 2840 bytes, offset 53630218, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqchn)
integck: write 1 bytes, offset 7479305, file 401756 (line 900)
integck: write 222868 bytes, offset 74165132, file 316719 (line 900)
integck: write 5476 bytes, offset 64089097, file 890053 (line 900)
integck: write 74949 bytes, offset 53611718, file 316719 (line 900)
integck: write 357 bytes, offset 393755, file 304665 (line 900)
integck: write 828944 bytes, offset 872376, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 8840 bytes, offset 7680869, file 743721 (line 900)
integck: write 6323704 bytes, offset 478753, file 304665 (line 900)
integck: write 6575165 bytes, offset 13294534, file 515485 (line 900)
integck: write 1154 bytes, offset 67883750, file 890053 (line 900)
integck: write 97 bytes, offset 40101926, file 112238 (line 900)
integck: write 7 bytes, offset 0, file 419106 (line 900)
integck: write 9 bytes, offset 0, file 657652 (line 900)
integck: write 8426584 bytes, offset 581693, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 34 bytes, offset 3761138, file 736742 (line 900)
integck: write 93368 bytes, offset 4801970, file fuxaiyznabsluovrkdiyrqzlirsldgkyhrycntkeztxetzkdnywpakjdxurloqnezpbmhibvstmlpmuqgtmqujjwuhmoopwrcuggnwqlsxhixrncszbskuccqhhufhduxauspdlliygkmjredajfbfqcr)
integck: write 51023 bytes, offset 156983919, file 118480 (line 900)
integck: write 9 bytes, offset 191627878, file 118480 (line 900)
integck: write 62 bytes, offset 3634519, file 278341 (line 900)
integck: write 6616 bytes, offset 0, file iupzdjaaszxvbponxcbsincxpkghapyuyusyiopdooymhigmzgzgpqtddqteexuofhiazpsmszzwhgpopweblphdxqswrjuhcimnumzhbkwchrdfrntrquswgwgbowtrtxmqcjzplpqmcdrnrliivanruuyhtrmz)
integck: write 5616240 bytes, offset 34650244, file 118480 (line 900)
integck: creating file /mnt/integck_test_dir_367/29700/wpesrvvhhncevyxixhrzavsrpgqiaovoayqoxrcgsjdharcfctughkpwormtfvryyenorvelhyzppxavqtlxogktymjqfgowrdwoyzipkezbgbkmyqmskvhpcjcavndhlmidbwhjxmvfqylmksw)
integck: write 84131 bytes, offset 3170, file caxqgtfmgpmqatleoqerdzpuuazxrddmscptiieycmsdfqkxvntdjgdrdwbobrdulpnurdxmpwzmesovdlmcrqlgautvionyjppyxuyqwhyooqfiywfujhrsdsqbgmaxrwhynpoiqslrdyrhvairftuzkgfn)
integck: write 912922 bytes, offset 48435066, file 316719 (line 900)
integck: write 8 bytes, offset 53633058, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqchnxul)
integck: write 6007837 bytes, offset 6802457, file 304665 (line 900)
integck: write 2878775 bytes, offset 9135, file 829611 (line 900)
integck: write 308911 bytes, offset 2377041, file 728294 (line 900)
integck: write 291 bytes, offset 12810294, file 304665 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/rlbqamvjnlqdmcyahhampogxqqqhzwawcupcudfevlejeryhyqhittiryvaandpunwhbkr ---> /mnt/integck_test_dir_367/595546 (line 683)
integck: write 1 bytes, offset 191627887, file 118480 (line 900)
integck: creating dir /mnt/integck_test_dir_367/88399 (line 556)
integck: write 378858 bytes, offset 20039463, file 687628 (line 900)
integck: write 2115 bytes, offset 165687707, file 118480 (line 900)
integck: write 2989 bytes, offset 419674, file 71305 (line 900)
integck: creating file /mnt/integck_test_dir_367/946577 (line 638)
integck: write 2465980 bytes, offset 1123655, file 722944 (line 900)
integck: write 137516 bytes, offset 3739106, file 76191 (line 900)
integck: write 9209 bytes, offset 2260573, file rlbqamvjnlqdmcyahhampogxqqqhzwawcupcudfevlejeryhyqhittiryvaandpunwhbkr (line 900)
integck: write 42 bytes, offset 11578316, file 511089 (line 900)
integck: creating file /mnt/integck_test_dir_367/30680 (line 638)
integck: creating file /mnt/integck_test_dir_367/88399/651298 (line 638)
integck: write 412 bytes, offset 3589635, file 722944 (line 900)
integck: write 8672 bytes, offset 0, file 944462 (line 900)
integck: write 7 bytes, offset 50524514, file 112238 (line 900)
integck: write 7 bytes, offset 64939828, file 890053 (line 900)
integck: creating symlink /mnt/integck_test_dir_367/861922/944622 ---> ../82189/900183/owxnuymejzlzgfpfcvmevdwankhyruzlgbfqyjahdyhtxuwbonsbhqhawqyvihfmaskuxrevdnkxfguxdyfgrpkateepfxwqqqwrqofaccmvmwlasog)
integck: write 1 bytes, offset 11981872, file 249883 (line 900)
integck: write 109982 bytes, offset 74388000, file 316719 (line 900)
integck: write 447 bytes, offset 74497982, file 316719 (line 900)
integck: write 30 bytes, offset 19869699, file 515485 (line 900)
integck: write 7605 bytes, offset 7226818, file 278341 (line 900)
integck: write 479341 bytes, offset 9008277, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: creating dir /mnt/integck_test_dir_367/909716 (line 556)
integck: creating dir /mnt/integck_test_dir_367/962181 (line 556)
integck: creating hardlink /mnt/integck_test_dir_367/407179 ---> /mnt/integck_test_dir_367/iecjrfrbbbmhjfvthymzwhpemmthidnamfklsbrjzkjkcfoidchrfuncqybjrjrfmmqneqxidhlbunnsvblrrujlnvxqyzwuhjupkrxpgskrtas)
integck: write 6702 bytes, offset 22989958, file 112238 (line 900)
integck: write 7662 bytes, offset 12729206, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwjn)
integck: creating file /mnt/integck_test_dir_367/873366 (line 638)
integck: write 2077 bytes, offset 38297721, file 316719 (line 900)
integck: write 1756 bytes, offset 3590047, file 722944 (line 900)
integck: write 4117441 bytes, offset 3005212, file 304665 (line 900)
integck: write 5 bytes, offset 9487618, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 7561268 bytes, offset 13108064, file 728294 (line 900)
integck: write 769856 bytes, offset 191627888, file 407179 (line 900)
integck: creating file /mnt/integck_test_dir_367/ojayyaqcswpfwkfaqowdbforkhvgntnsoynuzvurvesgabgogckcrjhwjfmowaiccrltfkzvligqksnwpfzkuvttamgwpbcbuqjyrfgmgkygxffvbzbdwycylwmotauuozsssnicaucnzohmgkgcgycak)
integck: write 17 bytes, offset 192397744, file 407179 (line 900)
integck: write 990632 bytes, offset 1350677, file 867972 (line 900)
integck: write 429 bytes, offset 10815935, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 1 bytes, offset 192397761, file 407179 (line 900)
integck: write 359841 bytes, offset 4224, file ayhktkimwosflnbonnzuyrtpauhzbbzmhmdoacyhcesgfudkigbneiimrexmzwoynfeffwlvszqicjcfqgxsgue (line 900)
integck: write 54 bytes, offset 1218475, file rgmzhfaofpvygrfqhavcfjyqzapixficutcpenmgmevfpdzasieohqyyojeozvpltwkujnqojigxvchexdjjzgivitboptfkipytcgjtozuecwuk (line 900)
integck: write 498348 bytes, offset 53633066, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqc)
integck: creating hardlink /mnt/integck_test_dir_367/338820 ---> /mnt/integck_test_dir_367/307719 (line 683)
integck: write 1 bytes, offset 50524521, file 112238 (line 900)
integck: write 7 bytes, offset 0, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwjnharxcqdovn)
integck: creating hardlink /mnt/integck_test_dir_367/696087 ---> /mnt/integck_test_dir_367/384283 (line 683)
integck: write 70 bytes, offset 72641799, file 316719 (line 900)
integck: creating file /mnt/integck_test_dir_367/djcbxgmxmailgyjsknbkfquowqxlnsgjhujqrurdaicsfjnynoislbylexbhbudvsupquthgswbpdbjpeowcgoczhkkdsorqovpgdlcdvlnkfmfwubhlwq/464902 (line 638)
integck: creating hardlink /mnt/integck_test_dir_367/274843 ---> /mnt/integck_test_dir_367/867972 (line 683)
integck: write 76 bytes, offset 7739733, file 249883 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/577946/972163 ---> /mnt/integck_test_dir_367/65717 (line 683)
integck: write 4698289 bytes, offset 46153658, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayq)
integck: write 4993256 bytes, offset 191524955, file 407179 (line 900)
integck: write 1 bytes, offset 113824, file 756092 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/cjrpc ---> /mnt/integck_test_dir_367/743721 (line 683)
integck: creating file /mnt/integck_test_dir_367/887076 (line 638)
integck: write 820241 bytes, offset 360250, file 249883 (line 900)
integck: write 1 bytes, offset 23430636, file 736742 (line 900)
integck: creating dir /mnt/integck_test_dir_367/319703 (line 556)
integck: write 5310 bytes, offset 83658115, file 890053 (line 900)
integck: write 6642659 bytes, offset 5483272, file 905019 (line 900)
integck: write 244269 bytes, offset 54131414, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqc)
integck: write 39197 bytes, offset 119775, file 71305 (line 900)
integck: write 2132935 bytes, offset 993438, file 829611 (line 900)
integck: write 2 bytes, offset 6917509, file 407179 (line 900)
integck: write 67 bytes, offset 4020202, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwjnhar)
integck: write 7420804 bytes, offset 44810217, file 112238 (line 900)
integck: write 382 bytes, offset 0, file 873366 (line 900)
integck: write 95 bytes, offset 23509, file 548772 (line 900)
integck: write 9 bytes, offset 166380041, file 407179 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/368300 ---> /mnt/integck_test_dir_367/30680 (line 683)
integck: write 1 bytes, offset 83663425, file 890053 (line 900)
integck: creating file /mnt/integck_test_dir_367/qhflanyoqpsdachestcokvyxcmpvviwmvbkthrgrwcgrichohudcuatfmqrbtpwsofipfyptrtplouzcwbxvlasagwu (line 638)
integck: write 210792 bytes, offset 196518211, file 407179 (line 900)
integck: write 53 bytes, offset 52231021, file 112238 (line 900)
integck: write 7 bytes, offset 13737481, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwjnhar)
integck: creating file /mnt/integck_test_dir_367/xpfwwglavmmmclzwbrqkfvckqhyrqfbmvanabipydthaswynslyvautapqcpfaqcyiafdteaojaepwkaqlualuaipjokmegwozqvihfrhltof (line 638)
integck: write 976 bytes, offset 196729003, file 407179 (line 900)
integck: creating dir /mnt/integck_test_dir_367/406662 (line 556)
integck: creating hardlink /mnt/integck_test_dir_367/882189/900183/svdqawbagcrsxhshxeflfggnkwmvzeakjhltzmsulvymmutctpffdoopnbokxxzfsnldolqwjcjmcsszflewxnaomagbjajodvkjwgzpqqsuptpoyynyugxllsrrxtphrjinsti)
integck: write 374171 bytes, offset 62552127, file 407179 (line 900)
integck: write 3 bytes, offset 23450868, file 112238 (line 900)
integck: write 1 bytes, offset 498831, file 5833 (line 900)
integck: write 2 bytes, offset 5079098, file 905019 (line 900)
integck: write 1 bytes, offset 19869729, file 515485 (line 900)
integck: creating file /mnt/integck_test_dir_367/790443 (line 638)
integck: write 7820 bytes, offset 19426, file 44121 (line 900)
integck: write 1 bytes, offset 278862, file ayhktkimwosflnbonnzuyrtpauhzbbzmhmdoacyhcesgfudkigbneiimrexmzwoynfeffwlvszqicjcfqgxsgue (line 900)
integck: write 42 bytes, offset 0, file 736742 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/224607 ---> /mnt/integck_test_dir_367/269882 (line 683)
integck: write 5427775 bytes, offset 1986060, file 829611 (line 900)
integck: write 32395 bytes, offset 28666543, file 112238 (line 900)
integck: write 3 bytes, offset 0, file 278341 (line 900)
integck: write 6270189 bytes, offset 82799928, file 407179 (line 900)
integck: write 70 bytes, offset 173080757, file 407179 (line 900)
integck: write 6 bytes, offset 115818286, file 407179 (line 900)
integck: write 912809 bytes, offset 3296582, file 224607 (line 900)
integck: write 801 bytes, offset 32409722, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqchnx)
integck: write 1 bytes, offset 19869730, file 515485 (line 900)
integck: write 1 bytes, offset 46662551, file rlbqamvjnlqdmcyahhampogxqqqhzwawcupcudfevlejeryhyqhittiryvaandpunwhbkr (line 900)
integck: write 278272 bytes, offset 11981873, file 249883 (line 900)
integck: write 10 bytes, offset 130263868, file 407179 (line 900)
integck: write 263511 bytes, offset 6086546, file 304665 (line 900)
integck: write 273 bytes, offset 140721690, file 407179 (line 900)
integck: write 2 bytes, offset 0, file 946577 (line 900)
integck: write 1 bytes, offset 0, file 274843 (line 900)
integck: creating dir /mnt/integck_test_dir_367/sapxwxaovndyyqapmekmghnmotqtcwchavmryhsyjnhqnekpmyjjnhcddlbplgedadnbeziarhmcxjbkcntmbjtpiopxjomsfyahoxrdhrjalybxzoqckdyducucoeouwakitgxryykvg (line 556)
integck: write 1261 bytes, offset 54375683, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqchn)
integck: write 1 bytes, offset 0, file 887076 (line 900)
integck: write 1 bytes, offset 960, file 154464 (line 900)
integck: write 2 bytes, offset 83663426, file 890053 (line 900)
integck: write 168 bytes, offset 33293860, file 407179 (line 900)
integck: write 1364 bytes, offset 3979297, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqchnx)
integck: write 828892 bytes, offset 46662552, file rlbqamvjnlqdmcyahhampogxqqqhzwawcupcudfevlejeryhyqhittiryvaandpunwhbkr (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/gsakkmofbohaeqrgopxbixvkgpddvmlbxjwxdbkvtuaasrehjdbqlzfjilsmtrgfhrnfzypzhcothgtluopthoeynlejijbbpgkmyydjndojfrhamqzdxxcscestwganxwqiyglmmuqyliimcqkta)
integck: write 1 bytes, offset 3399266, file 434071 (line 900)
integck: write 196204 bytes, offset 0, file 316719 (line 900)
integck: write 534969 bytes, offset 9879, file 548772 (line 900)
integck: creating dir /mnt/integck_test_dir_367/fhcubxqaigotyljvmmogzytyjjhnxfuoojkndvjzglpzkyorrdmkchyepsimtbncrihenllwslvekhukzrfmccqkbfbsbzjblzmvwjyzzvmdmkhrtgvdvahctkfec (line 556)
integck: write 1 bytes, offset 0, file 331543 (line 900)
integck: write 1 bytes, offset 196729979, file 407179 (line 900)
integck: write 9300601 bytes, offset 234012, file ayhktkimwosflnbonnzuyrtpauhzbbzmhmdoacyhcesgfudkigbneiimrexmzwoynfeffwlvszqicjcfqgxsgue (line 900)
integck: write 8684564 bytes, offset 10078070, file cjrpc (line 900)
integck: write 1 bytes, offset 9534613, file ayhktkimwosflnbonnzuyrtpauhzbbzmhmdoacyhcesgfudkigbneiimrexmzwoynfeffwlvszqicjcfqgxsgue (line 900)
integck: write 9532519 bytes, offset 54376944, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayq)
integck: creating file /mnt/integck_test_dir_367/553406 (line 638)
integck: write 584926 bytes, offset 4589204, file cjrpc (line 900)
integck: write 37 bytes, offset 7120289, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 16 bytes, offset 10827076, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: creating file /mnt/integck_test_dir_367/952358 (line 638)
integck: write 874579 bytes, offset 16212263, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqc)
integck: write 4 bytes, offset 13737488, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwjnhar)
integck: write 3847 bytes, offset 9587015, file 687628 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/236735 ---> /mnt/integck_test_dir_367/71305 (line 683)
integck: write 8 bytes, offset 196729980, file 407179 (line 900)
integck: write 839806 bytes, offset 11420841, file 304665 (line 900)
integck: write 6273 bytes, offset 196729988, file 407179 (line 900)
integck: write 37 bytes, offset 196736261, file 407179 (line 900)
integck: write 10059 bytes, offset 13737492, file ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprqipjmzfazmrsrjxmgvoeocpbvfrxjmnduluyqfofwj)
integck: write 1 bytes, offset 1218529, file rgmzhfaofpvygrfqhavcfjyqzapixficutcpenmgmevfpdzasieohqyyojeozvpltwkujnqojigxvchexdjjzgivitboptfkipytcgjtozuecwuk (line 900)
integck: write 1 bytes, offset 6002007, file 687628 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/612901 ---> /mnt/integck_test_dir_367/ruhgszwfnbvqqsobqkihauxsgxclrhcopyufmjralqhulnajndsyhyarhsunlxwewgbmyejikfhzgetvgipcatexbdzqxlcursnkjaawsqzsprq)
integck: write 1219270 bytes, offset 10827092, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 456 bytes, offset 0, file 327508 (line 900)
integck: write 58943 bytes, offset 50376296, file 316719 (line 900)
integck: write 4638239 bytes, offset 6616, file iupzdjaaszxvbponxcbsincxpkghapyuyusyiopdooymhigmzgzgpqtddqteexuofhiazpsmszzwhgpopweblphdxqswrjuhcimnumzhbkwchrdfrntrquswgwgbowtrtxmqcjzplpqmcdrnrliivanruu)
integck: write 6494 bytes, offset 52231074, file 112238 (line 900)
integck: write 85 bytes, offset 83663428, file 890053 (line 900)
integck: write 2626903 bytes, offset 46625879, file 112238 (line 900)
integck: write 790 bytes, offset 456, file 327508 (line 900)
integck: write 6 bytes, offset 0, file 407179 (line 900)
integck: write 787685 bytes, offset 196736298, file 407179 (line 900)
integck: write 4025846 bytes, offset 12080856, file 515485 (line 900)
integck: write 8967428 bytes, offset 0, file 407179 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/603066 ---> /mnt/integck_test_dir_367/751408/zerekjllhvssamgmcnwttcpuyotegjdjfgqeeuxkmfxliufsbncvqcrvsyohjjqugeklmmjffyrzdbpddfhnetrciqitiwycwqxptweq)
integck: write 9110657 bytes, offset 52237568, file 112238 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/349619/rhyrqtpqdcurjivcfxehuouoskbjgyymdddjkhqvkwgsoaugtqmylvjcwcwpbfuqkcfjahkmxxutnolymxxtlxlinkcjtelurimbbianmqytldxcwlaytprivprloduutaaoajyxttouyi)
integck: write 62 bytes, offset 3591803, file 722944 (line 900)
integck: write 3148 bytes, offset 26200566, file 274843 (line 900)
integck: creating file /mnt/integck_test_dir_367/nivktbdkcqlxjxwojrmrhyerzcxtjaxhxzvccdyfwdmohjlcqcghdnhmmevfcbtcsmjjvlkriiwjabeeuurolahakkpejlqcbytsvkftnebknikyeuteinqzqtpkarawnlpyin (line 638)
integck: write 9 bytes, offset 197523983, file 407179 (line 900)
integck: write 239 bytes, offset 24348492, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqchnx)
integck: write 886 bytes, offset 825, file 327508 (line 900)
integck: write 5 bytes, offset 27820013, file 736742 (line 900)
integck: write 6841251 bytes, offset 12125931, file 905019 (line 900)
integck: write 676 bytes, offset 12046362, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: write 17 bytes, offset 12270784, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqchnxu)
integck: write 1992 bytes, offset 7413835, file 829611 (line 900)
integck: write 192 bytes, offset 165861267, file 407179 (line 900)
integck: write 67139 bytes, offset 46385791, file rlbqamvjnlqdmcyahhampogxqqqhzwawcupcudfevlejeryhyqhittiryvaandpunwhbkr (line 900)
integck: write 581334 bytes, offset 22113919, file 407179 (line 900)
integck: write 2748 bytes, offset 3235007, file 304665 (line 900)
integck: write 1 bytes, offset 68035134, file 407179 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/5838 ---> /mnt/integck_test_dir_367/710289/642504/44121 (line 683)
integck: write 6755 bytes, offset 0, file 890053 (line 900)
integck: write 741072 bytes, offset 3582935, file 612901 (line 900)
integck: write 80157 bytes, offset 2713194, file iupzdjaaszxvbponxcbsincxpkghapyuyusyiopdooymhigmzgzgpqtddqteexuofhiazpsmszzwhgpopweblphdxqswrjuhcimnumzhbkwchrdfrntrquswgwgbowtrtxmqcjzplpqmcdrnrliivanru)
integck: write 1 bytes, offset 83663513, file 890053 (line 900)
integck: write 80 bytes, offset 0, file 664603 (line 900)
integck: write 6026037 bytes, offset 0, file 553406 (line 900)
integck: write 42803 bytes, offset 82330, file 603066 (line 900)
integck: write 3692 bytes, offset 26203714, file 274843 (line 900)
integck: write 348357 bytes, offset 5380391, file 434071 (line 900)
integck: creating dir /mnt/integck_test_dir_367/336559 (line 556)
integck: write 1 bytes, offset 45, file 664603 (line 900)
integck: write 9227 bytes, offset 83663514, file 890053 (line 900)
integck: write 772049 bytes, offset 49922, file 172794 (line 900)
integck: write 4993391 bytes, offset 1711, file 327508 (line 900)
integck: write 70 bytes, offset 68289074, file 316719 (line 900)
integck: write 5682 bytes, offset 8849077, file 401756 (line 900)
integck: write 12544 bytes, offset 30305804, file rlbqamvjnlqdmcyahhampogxqqqhzwawcupcudfevlejeryhyqhittiryvaandpunwhbkr (line 900)
integck: creating file /mnt/integck_test_dir_367/461123 (line 638)
integck: write 91 bytes, offset 279463, file 756092 (line 900)
integck: write 7337 bytes, offset 0, file 696087 (line 900)
integck: write 1 bytes, offset 9534614, file ayhktkimwosflnbonnzuyrtpauhzbbzmhmdoacyhcesgfudkigbneiimrexmzwoynfeffwlvszqicjcfqgxsgue (line 900)
integck: creating file /mnt/integck_test_dir_367/hxzdwffiegxnvgntdywzrynrxxzsqytpkeornrvvvgolebucxjjeqdrydylacxlooygrpwoszrfrrcnexqjxbkamitgqp/498809 (line 638)
integck: write 246856 bytes, offset 4995102, file 327508 (line 900)
integck: write 73240 bytes, offset 5875887, file 401756 (line 900)
integck: write 51441 bytes, offset 12796040, file 316719 (line 900)
integck: write 5586920 bytes, offset 2581618, file 722944 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/700573/70690 ---> /mnt/integck_test_dir_367/873366 (line 683)
integck: write 886550 bytes, offset 4394068, file ayhktkimwosflnbonnzuyrtpauhzbbzmhmdoacyhcesgfudkigbneiimrexmzwoynfeffwlvszqicjcfqgxsgue (line 900)
integck: creating file /mnt/integck_test_dir_367/181485 (line 638)
integck: write 9588890 bytes, offset 7513591, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqc)
integck: write 1 bytes, offset 1132590, file rgmzhfaofpvygrfqhavcfjyqzapixficutcpenmgmevfpdzasieohqyyojeozvpltwkujnqojigxvchexdjjzgivitboptfkipytcgjtozuecwuk (line 900)
integck: write 9919 bytes, offset 1081411, file 688063 (line 900)
integck: write 1 bytes, offset 11904641, file 515485 (line 900)
integck: write 49 bytes, offset 6402936, file 612901 (line 900)
integck: write 494 bytes, offset 117672304, file 407179 (line 900)
integck: creating file /mnt/integck_test_dir_367/330422 (line 638)
integck: write 7456352 bytes, offset 197523992, file 407179 (line 900)
integck: write 55 bytes, offset 204980344, file 407179 (line 900)
integck: write 9 bytes, offset 1114458, file 722944 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/990585 ---> /mnt/integck_test_dir_367/756092 (line 683)
integck: write 39793 bytes, offset 28, file 684261 (line 900)
integck: write 1 bytes, offset 4956852, file 249883 (line 900)
integck: write 1 bytes, offset 148370, file 672362 (line 900)
integck: write 1 bytes, offset 10949783, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqchnxul)
integck: write 1 bytes, offset 5178893, file fuxaiyznabsluovrkdiyrqzlirsldgkyhrycntkeztxetzkdnywpakjdxurloqnezpbmhibvstmlpmuqgtmqujjwuhmoopwrcuggnwqlsxhixrncszbskuccqhhufhduxauspdlliygkmjredajfbfqcrsomy)
integck: write 591043 bytes, offset 26207406, file 274843 (line 900)
integck: write 614 bytes, offset 4328820, file 829611 (line 900)
integck: write 134478 bytes, offset 9487623, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 46327 bytes, offset 0, file qhflanyoqpsdachestcokvyxcmpvviwmvbkthrgrwcgrichohudcuatfmqrbtpwsofipfyptrtplouzcwbxvlasagwu (line 900)
integck: write 1 bytes, offset 83672741, file 890053 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/431329 ---> /mnt/integck_test_dir_367/687628 (line 683)
integck: write 2303237 bytes, offset 63909463, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayq)
integck: write 5 bytes, offset 1, file 887076 (line 900)
integck: write 527040 bytes, offset 204980399, file 407179 (line 900)
integck: write 6692853 bytes, offset 120127111, file 407179 (line 900)
integck: write 22036 bytes, offset 0, file 327073 (line 900)
integck: write 988371 bytes, offset 10184622, file 612901 (line 900)
integck: write 67143 bytes, offset 74498429, file 316719 (line 900)
integck: write 1 bytes, offset 83672742, file 890053 (line 900)
integck: write 3735 bytes, offset 0, file 905019 (line 900)
integck: write 9000 bytes, offset 7277783, file 254635 (line 900)
integck: creating dir /mnt/integck_test_dir_367/692559 (line 556)
integck: write 4 bytes, offset 61348225, file 112238 (line 900)
integck: write 795250 bytes, offset 55680245, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqc)
integck: write 40539 bytes, offset 12047038, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: creating dir /mnt/integck_test_dir_367/598775 (line 556)
integck: write 1 bytes, offset 20418321, file 431329 (line 900)
integck: write 587980 bytes, offset 9534615, file ayhktkimwosflnbonnzuyrtpauhzbbzmhmdoacyhcesgfudkigbneiimrexmzwoynfeffwlvszqicjcfqgxsgue (line 900)
integck: write 14079 bytes, offset 205507439, file 407179 (line 900)
integck: write 691086 bytes, offset 4811790, file 612901 (line 900)
integck: write 186659 bytes, offset 4474457, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 832 bytes, offset 12260145, file 249883 (line 900)
integck: write 2320 bytes, offset 8854759, file 401756 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/832213 ---> /mnt/integck_test_dir_367/cjrpc (line 683)
integck: write 1 bytes, offset 74633361, file 407179 (line 900)
integck: write 34257 bytes, offset 0, file bauyqwkghwmztiavgoqsaavddddxnvesyyyuyblmmnnsmnlppxhzfblktavbplxmnbjmvqqsqfibfomidehsitumvovtkifbzbnjugzmmidszdbpfejthfibabrcjwczbxhualjvhwgxwmvhcrcrbcifstjahzn)
integck: write 6082 bytes, offset 47491444, file rlbqamvjnlqdmcyahhampogxqqqhzwawcupcudfevlejeryhyqhittiryvaandpunwhbkr (line 900)
integck: write 4562 bytes, offset 20474099, file 112238 (line 900)
integck: write 5604 bytes, offset 0, file 461123 (line 900)
integck: creating dir /mnt/integck_test_dir_367/710289/317020 (line 556)
integck: creating symlink /mnt/integck_test_dir_367/897181 ---> /mnt/integck_test_dir_367/640388/592919/484838 (line 2132)
integck: write 6625277 bytes, offset 20418322, file 431329 (line 900)
integck: write 1 bytes, offset 0, file 651298 (line 900)
integck: write 27002 bytes, offset 195084, file 247004 (line 900)
integck: write 45 bytes, offset 0, file hzwjmdnvwn (line 900)
integck: write 5084036 bytes, offset 39821, file 684261 (line 900)
integck: write 615 bytes, offset 10212268, file 407179 (line 900)
integck: write 481 bytes, offset 17090995, file 905019 (line 900)
integck: write 6221304 bytes, offset 50037733, file 407179 (line 900)
integck: write 79 bytes, offset 205521518, file 407179 (line 900)
integck: write 749814 bytes, offset 205521597, file 407179 (line 900)
integck: creating dir /mnt/integck_test_dir_367/957478 (line 556)
integck: write 1 bytes, offset 5123857, file 684261 (line 900)
integck: creating dir /mnt/integck_test_dir_367/185654 (line 556)
integck: creating dir /mnt/integck_test_dir_367/938017 (line 556)
integck: write 68231 bytes, offset 45, file hzwjmdnvwn (line 900)
integck: write 1 bytes, offset 32182653, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqchnxul)
integck: write 4639778 bytes, offset 0, file 934018 (line 900)
integck: write 1 bytes, offset 27820018, file 736742 (line 900)
integck: write 311182 bytes, offset 3748, file 318608 (line 900)
integck: creating file /mnt/integck_test_dir_367/185654/586040 (line 638)
integck: write 76066 bytes, offset 4803328, file 905019 (line 900)
integck: write 3832 bytes, offset 47497526, file rlbqamvjnlqdmcyahhampogxqqqhzwawcupcudfevlejeryhyqhittiryvaandpunwhbkr (line 900)
integck: write 82274 bytes, offset 0, file 419106 (line 900)
integck: write 3931815 bytes, offset 99604472, file 407179 (line 900)
integck: write 1 bytes, offset 206271411, file 407179 (line 900)
integck: write 5701 bytes, offset 9713670, file 937914 (line 900)
integck: write 69538 bytes, offset 8082281, file ayhktkimwosflnbonnzuyrtpauhzbbzmhmdoacyhcesgfudkigbneiimrexmzwoynfeffwlvszqicjcfqgxsgue (line 900)
integck: write 75 bytes, offset 83672743, file 890053 (line 900)
integck: creating dir /mnt/integck_test_dir_367/573848 (line 556)
integck: write 6421184 bytes, offset 2875751, file 304665 (line 900)
integck: write 132888 bytes, offset 191273, file 318608 (line 900)
integck: write 74059 bytes, offset 26798449, file 274843 (line 900)
integck: write 4914 bytes, offset 9622101, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 35262 bytes, offset 206271412, file 407179 (line 900)
integck: write 95468 bytes, offset 2079382, file 249883 (line 900)
integck: write 1785 bytes, offset 57546054, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqchn)
integck: write 385529 bytes, offset 206306674, file 407179 (line 900)
integck: write 1 bytes, offset 5241958, file 327508 (line 900)
integck: write 28 bytes, offset 19869731, file 515485 (line 900)
integck: write 5374 bytes, offset 26798149, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqchn)
integck: write 342 bytes, offset 3306120, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 49 bytes, offset 23545231, file 612901 (line 900)
integck: write 6536 bytes, offset 10122595, file ayhktkimwosflnbonnzuyrtpauhzbbzmhmdoacyhcesgfudkigbneiimrexmzwoynfeffwlvszqicjcfqgxsgue (line 900)
integck: write 418 bytes, offset 66212700, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqchnx)
integck: write 74 bytes, offset 206692203, file 407179 (line 900)
integck: write 63801 bytes, offset 36570453, file 407179 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/954233 ---> /mnt/integck_test_dir_367/250881/320268 (line 683)
integck: write 2377 bytes, offset 26823439, file 832213 (line 900)
integck: write 1 bytes, offset 16890746, file 431329 (line 900)
integck: write 8212 bytes, offset 9627015, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 926 bytes, offset 21730953, file 612901 (line 900)
integck: fdatasyncing dir /mnt/integck_test_dir_367 (line 2282)
integck: write 7997 bytes, offset 0, file 181485 (line 900)
integck: creating file /mnt/integck_test_dir_367/407966 (line 638)
integck: write 2419171 bytes, offset 5728748, file 434071 (line 900)
integck: creating dir /mnt/integck_test_dir_367/363466 (line 556)
integck: write 31 bytes, offset 0, file 338820 (line 900)
integck: write 78405 bytes, offset 1901945, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqchn)
integck: creating dir /mnt/integck_test_dir_367/930744 (line 556)
integck: write 95345 bytes, offset 3350239, file 274843 (line 900)
integck: write 193 bytes, offset 8302500, file 62957 (line 900)
integck: write 18 bytes, offset 0, file 407966 (line 900)
integck: write 5 bytes, offset 189981752, file 407179 (line 900)
integck: write 1375339 bytes, offset 0, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqchnxulm)
integck: write 1 bytes, offset 61348229, file 112238 (line 900)
integck: fdatasyncing file 112238 (line 1297)
integck: creating dir /mnt/integck_test_dir_367/719201 (line 556)
integck: write 633281 bytes, offset 3114835, file 934018 (line 900)
integck: write 33 bytes, offset 5721, file qhflanyoqpsdachestcokvyxcmpvviwmvbkthrgrwcgrichohudcuatfmqrbtpwsofipfyptrtplouzcwbxvlasagwu (line 900)
integck: write 1 bytes, offset 22218244, file 316719 (line 900)
integck: write 185920 bytes, offset 12810585, file 304665 (line 900)
integck: write 5228 bytes, offset 52036745, file pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrcyqsklpbaqyhbdcwyhdihmcfpxuassaptasleayqchn)
integck: write 35716 bytes, offset 0, file pcaaftlgxefhgreislfghmwotvjurihvsetufjtnqwlccxeolbgtrcjdzlymkvisaglrxbjhvxvbe (line 900)
integck: write 3 bytes, offset 206692277, file 407179 (line 900)
integck: write 8240 bytes, offset 26872508, file 274843 (line 900)
integck: write 2129506 bytes, offset 878154, file iupzdjaaszxvbponxcbsincxpkghapyuyusyiopdooymhigmzgzgpqtddqteexuofhiazpsmszzwhgpopweblphdxqswrjuhcimnumzhbkwchrdfrntrquswgwgbowtrtxmqcjzplpqmcdrnrliivanr)
integck: write 251166 bytes, offset 6384977, file 434071 (line 900)
integck: write 986314 bytes, offset 8147919, file 434071 (line 900)
integck: write 850 bytes, offset 4042819, file 890053 (line 900)
integck: write 34971 bytes, offset 123147487, file 407179 (line 900)
integck: write 556313 bytes, offset 1, file wrymaumzrqlmcvdtvdklkuhxefdgelxkeqys (line 900)
integck: write 750 bytes, offset 61573, file caxqgtfmgpmqatleoqerdzpuuazxrddmscptiieycmsdfqkxvntdjgdrdwbobrdulpnurdxmpwzmesovdlmcrqlgautvionyjppyxuyqwhyooqfiywfujhrsdsqbgmaxrwhynpoiqslrdyrhvairftuzkgfnm)
integck: write 3765992 bytes, offset 0, file 954233 (line 900)
integck: write 8631774 bytes, offset 18967182, file 905019 (line 900)
integck: write 341029 bytes, offset 12087577, file tjplvfwixzaxlfeufjdmcgsgbpqxwginfduteghwbsnbhsngnmpttuqvuzgrlundjerqwsgxsjxglhmelepnjcjbqqvjupopiprmnmkknbqjhnyzupsmsclvwjdgyynkhmnzaludyne (line 900)
integck: creating dir /mnt/integck_test_dir_367/403052 (line 556)
integck: creating dir /mnt/integck_test_dir_367/pfnptvaluqgaapzihzglbtzhkqarnxgmhcxebafkazmtmbtwfauqznplhwibfhlpqmmlerkntzrgxychbioba (line 556)
integck: write 9454939 bytes, offset 544848, file 548772 (line 900)
integck: write 13 bytes, offset 23545280, file 612901 (line 900)
integck: write 88233 bytes, offset 19869759, file 515485 (line 900)
integck: creating dir /mnt/integck_test_dir_367/387326 (line 556)
integck: write 57 bytes, offset 26825816, file 832213 (line 900)
integck: write 7429532 bytes, offset 0, file 431329 (line 900)
integck: write 991 bytes, offset 206692280, file 407179 (line 900)
integck: write 95347 bytes, offset 27598956, file 905019 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/816993 ---> /mnt/integck_test_dir_367/pnrjekamukdofpwsjprtaqbspxjdizxaaofkslzwfoxzlwcrgnsbxjdarfwzmnjbtmfthsmrbmpwvnofkzfoodnuysmlonkozpxzcmpbgiqvkrc)
integck: creating dir /mnt/integck_test_dir_367/182494 (line 556)
integck: write 3 bytes, offset 19545727, file 832213 (line 900)
integck: fdatasyncing file 832213 (line 1297)
integck: write 571 bytes, offset 206693271, file 407179 (line 900)
integck: creating hardlink /mnt/integck_test_dir_367/715970 ---> /mnt/integck_test_dir_367/362686/866941 (line 683)
integck: creating hardlink /mnt/integck_test_dir_367/336752 ---> /mnt/integck_test_dir_367/431329 (line 683)
integck: write 143 bytes, offset 4639778, file 934018 (line 900)
integck: creating dir /mnt/integck_test_dir_367/612447 (line 556)
integck: write 8 bytes, offset 0, file 434071 (line 900)
integck: write 10 bytes, offset 4644855, file iupzdjaaszxvbponxcbsincxpkghapyuyusyiopdooymhigmzgzgpqtddqteexuofhiazpsmszzwhgpopweblphdxqswrjuhcimnumzhbkwchrdfrntrquswgwgbowtrtxmqcjzplpqmcdrnrliivanruuyh)
integck: write 6 bytes, offset 74565572, file 316719 (line 900)
integck: write 9062 bytes, offset 8097817, file 304665 (line 900)
integck: creating dir /mnt/integck_test_dir_367/139477/338588 (line 556)
integck: write 64122 bytes, offset 8168538, file 722944 (line 900)
integck: creating dir /mnt/integck_test_dir_367/518653 (line 556)
integck: write 1 bytes, offset 3029938, file 829611 (line 900)
integck: write 84859 bytes, offset 810887, file 684261 (line 900)

[ 2264.058980] BUG: workqueue lockup - pool cpus=3 node=0 flags=0x0 nice=0 stuck for 30s!

Message from syslogd@mpfs-video-kit at Tue Feb 27 18:03:39 2024 ...
kernel: BUG: workqueue lockup - pool cpus=3 node=0 flags=0x0 nice=0 stuck for 30s!

[ 2294.778977] BUG: workqueue lockup - pool cpus=3 node=0 flags=0x0 nice=0 stuck for 61s!

Message from syslogd@mpfs-video-kit at Tue Feb 27 18:04:10 2024 ...
kernel: BUG: workqueue lockup - pool cpus=3 node=0 flags=0x0 nice=0 stuck for 61s!

[ 2325.498976] BUG: workqueue lockup - pool cpus=3 node=0 flags=0x0 nice=0 stuck for 92s!

Message from syslogd@mpfs-video-kit at Tue Feb 27 18:04:40 2024 ...
kernel: BUG: workqueue lockup - pool cpus=3 node=0 flags=0x0 nice=0 stuck for 92s!
[ 2356.218977] BUG: workqueue lockup - pool cpus=3 node=0 flags=0x0 nice=0 stuck for 122s!

Message from syslogd@mpfs-video-kit at Tue Feb 27 18:05:11 2024 ...
kernel: BUG: workqueue lockup - pool cpus=3 node=0 flags=0x0 nice=0 stuck for 122s!

^ permalink raw reply	[flat|nested] only message in thread

only message in thread, other threads:[~2025-09-01  9:56 UTC | newest]

Thread overview: (only message) (download: mbox.gz follow: Atom feed
-- links below jump to the message on this page --
2025-09-01  9:55 Kernel Workqueue Lockup on Microchip PolarFire MPFS-250T During mtd-utils integck UBIFS Stress Test Nikhil Kashyap H R

This is a public inbox, see mirroring instructions
for how to clone and mirror all data and code used for this inbox;
as well as URLs for NNTP newsgroup(s).