From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 0CB08C001DE for ; Wed, 9 Aug 2023 11:07:29 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S233141AbjHILH2 (ORCPT ); Wed, 9 Aug 2023 07:07:28 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:40958 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S233133AbjHILH1 (ORCPT ); Wed, 9 Aug 2023 07:07:27 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id D7B04ED; Wed, 9 Aug 2023 04:07:25 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 9f9b59aa6d185479; Wed, 9 Aug 2023 13:07:23 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 63595662543; Wed, 9 Aug 2023 13:07:23 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v5.1 08/11] ACPI: thermal: Use trip point table to register thermal zones Date: Wed, 09 Aug 2023 13:07:23 +0200 Message-ID: <5707372.DvuYhMxLoT@kreacher> In-Reply-To: <3178745.5fSG56mABF@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4503814.LvFx2qVVIh@kreacher> <3178745.5fSG56mABF@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrleeggdefhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeejpdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphht thhopehmihgthhgrlhdrfihilhgtiiihnhhskhhisehinhhtvghlrdgtohhmpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org From: Rafael J. Wysocki Make the ACPI thermal driver use thermal_zone_device_register_with_trips() to register its thermal zones. For this purpose, make it create a trip point table that will be passed to thermal_zone_device_register_with_trips() as an argument. Also use the thermal_zone_update_trip_temp() helper introduced previously to update temperatures of the passive and active trip points after a trip points change notification from the platform firmware. Signed-off-by: Rafael J. Wysocki --- This is a bug fix update of just this patch that doesn't affect any other patches in the series, which is why it is sent separately. v5 -> v5.1: * Terminate the loop over active trip points in acpi_thermal_register_thermal_zone() on the first invalid one to avoid reaching out of array bounds. * Use acpi_trip instead of computing its value from scratch in two places. * Fix up white space. v4 -> v5: * Use for_each_thermal_trip() introduced previously to update trip temperatures with the help of a new trip callback function. * Drop a function that has no users after the above change. * Rebase on top of patch [07/11]. v3 -> v4: * Rework to use thermal_zone_update_trip_temp() for updating trip point temperatures. * Rebase on top of the new version of the previous patch. v2 -> v3: * Fix error code path memory leak in acpi_thermal_register_thermal_zone(). * Notice that the critical and hot trips never change after initialization, so don't add struct thermal_trip_ref to any of them. v1 -> v2: * Use thermal_zone_device_lock()/thermal_zone_device_unlock() in acpi_thermal_check_fn() explicitly and call __thermal_zone_device_update() from there without unlocking the thermal zone. * Export __thermal_zone_device_update() to modules (so it can be called by the ACPI thermal code). --- drivers/acpi/thermal.c | 93 +++++++++++++++++++++++++++++++++++++++++++++---- 1 file changed, 86 insertions(+), 7 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -125,6 +125,7 @@ struct acpi_thermal { unsigned long polling_frequency; volatile u8 zombie; struct acpi_thermal_trips trips; + struct thermal_trip *trip_table; struct acpi_handle_list devices; struct thermal_zone_device *thermal_zone; int kelvin_offset; /* in millidegrees */ @@ -178,6 +179,15 @@ static int acpi_thermal_get_polling_freq return 0; } +static int acpi_thermal_temp(struct acpi_thermal *tz, int temp_deci_k) +{ + if (temp_deci_k == THERMAL_TEMP_INVALID) + return THERMAL_TEMP_INVALID; + + return deci_kelvin_to_millicelsius_with_offset(temp_deci_k, + tz->kelvin_offset); +} + static void __acpi_thermal_trips_update(struct acpi_thermal *tz, int flag) { acpi_status status; @@ -389,10 +399,30 @@ static void __acpi_thermal_trips_update( } } +static int acpi_thermal_adjust_trip(struct thermal_trip *trip, void *data) +{ + struct acpi_thermal_trip *acpi_trip = trip->priv; + struct acpi_thermal *tz = data; + + if (!acpi_trip) + return 0; + + if (acpi_trip->valid) + trip->temperature = acpi_thermal_temp(tz, acpi_trip->temperature); + else + trip->temperature = THERMAL_TEMP_INVALID; + + return 0; +} + static void acpi_thermal_adjust_thermal_zone(struct thermal_zone_device *thermal, unsigned long data) { - __acpi_thermal_trips_update(thermal_zone_device_priv(thermal), data); + struct acpi_thermal *tz = thermal_zone_device_priv(thermal); + + __acpi_thermal_trips_update(tz, data); + + for_each_thermal_trip(tz->thermal_zone, acpi_thermal_adjust_trip, tz); } static void acpi_queue_thermal_check(struct acpi_thermal *tz) @@ -757,6 +787,8 @@ static void acpi_thermal_zone_sysfs_remo static int acpi_thermal_register_thermal_zone(struct acpi_thermal *tz) { + struct acpi_thermal_trip *acpi_trip; + struct thermal_trip *trip; int passive_delay = 0; int trip_count = 0; int result; @@ -776,12 +808,56 @@ static int acpi_thermal_register_thermal for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].trip.valid; i++) trip_count++; - tz->thermal_zone = thermal_zone_device_register("acpitz", trip_count, 0, - tz, &acpi_thermal_zone_ops, - NULL, passive_delay, - tz->polling_frequency * 100); - if (IS_ERR(tz->thermal_zone)) - return -ENODEV; + trip = kcalloc(trip_count, sizeof(*trip), GFP_KERNEL); + if (!trip) + return -ENOMEM; + + tz->trip_table = trip; + + if (tz->trips.critical.valid) { + trip->type = THERMAL_TRIP_CRITICAL; + trip->temperature = acpi_thermal_temp(tz, tz->trips.critical.temperature); + trip++; + } + + if (tz->trips.hot.valid) { + trip->type = THERMAL_TRIP_HOT; + trip->temperature = acpi_thermal_temp(tz, tz->trips.hot.temperature); + trip++; + } + + acpi_trip = &tz->trips.passive.trip; + if (acpi_trip->valid) { + trip->type = THERMAL_TRIP_PASSIVE; + trip->temperature = acpi_thermal_temp(tz, acpi_trip->temperature); + trip->priv = acpi_trip; + trip++; + } + + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { + acpi_trip = &tz->trips.active[i].trip; + + if (!acpi_trip->valid) + break; + + trip->type = THERMAL_TRIP_ACTIVE; + trip->temperature = acpi_thermal_temp(tz, acpi_trip->temperature); + trip->priv = acpi_trip; + trip++; + } + + tz->thermal_zone = thermal_zone_device_register_with_trips("acpitz", + tz->trip_table, + trip_count, + 0, tz, + &acpi_thermal_zone_ops, + NULL, + passive_delay, + tz->polling_frequency * 100); + if (IS_ERR(tz->thermal_zone)) { + result = PTR_ERR(tz->thermal_zone); + goto free_trip_table; + } result = acpi_thermal_zone_sysfs_add(tz); if (result) @@ -800,6 +876,8 @@ remove_links: acpi_thermal_zone_sysfs_remove(tz); unregister_tzd: thermal_zone_device_unregister(tz->thermal_zone); +free_trip_table: + kfree(tz->trip_table); return result; } @@ -808,6 +886,7 @@ static void acpi_thermal_unregister_ther { acpi_thermal_zone_sysfs_remove(tz); thermal_zone_device_unregister(tz->thermal_zone); + kfree(tz->trip_table); tz->thermal_zone = NULL; }