From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 91BA8C433EF for ; Sun, 17 Apr 2022 06:31:08 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S233482AbiDQGdi (ORCPT ); Sun, 17 Apr 2022 02:33:38 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:47972 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229492AbiDQGdh (ORCPT ); Sun, 17 Apr 2022 02:33:37 -0400 Received: from mail-qv1-xf33.google.com (mail-qv1-xf33.google.com [IPv6:2607:f8b0:4864:20::f33]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 97AFF21E37; Sat, 16 Apr 2022 23:31:00 -0700 (PDT) Received: by mail-qv1-xf33.google.com with SMTP id y19so9089739qvk.5; Sat, 16 Apr 2022 23:31:00 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20210112; h=date:from:to:cc:subject:message-id:references:mime-version :content-disposition:in-reply-to; bh=Vfmh10AIjKhxbv0qitn8kLvuk+Cu75U8u1UgKPRnj9Y=; b=PZXa7U1As9//OVTHp6l3Oy8K28hLO82xDGAtXw8wM5HfB+XFJ7jThau3k40bb5Sr16 gjTzXJKLzp4B53OdD04OofHerzOxRXw18S7unz3EBkY0x2EfeMy0LEyi5+TIgXDH/qiG 45AYfEgPAHAtFp4lCVqnmM67lVrF2ydoAZB6wCnLZUaGSpcrJ725eymTorimq2x/3JUX ss5G4xchV2sNS+1NG58DDDK+jr02md8Z9/OC9XEvOiVOGWoN3Cf5jsq2/YiR+PM5sG62 4lg1KB4a9X84fdEobAAWIenuz8+qWyReWIRXXt2b+jufl4NJW0ajQ67qYH/baw0y5k7a heAQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:date:from:to:cc:subject:message-id:references :mime-version:content-disposition:in-reply-to; bh=Vfmh10AIjKhxbv0qitn8kLvuk+Cu75U8u1UgKPRnj9Y=; b=sCrucXKDtbOmKVAy0cPAmNOZEKKt/HGL3UjKP7CnoC2NdQdKTpIrRvwvDzqx0PUxfp PgzeoAOJB3kJLytwTO8qHq2aFg/aSZKSe+GL0FWOmVjqaU5+XPpf25doEos9892RKQFB JBHmKYJH0LMef9CFtP0sSFUHPaOdwd1IhaZj4bnfXBkHyCrbbHZ6hvbALSMZV0ZVJnfG AEsoAlrPIlRKX/2qnSB38wKR2wml9wXc3mcPLGH5TE+4741zBkCpWAnow0nWiojo+VUa ZYe4AFOHYM3qnBlcDKGqbDX7D5UbskR3uXcukf/y01tfi5MKmBtv4AxYYiIIQ4ibvoPB NjEg== X-Gm-Message-State: AOAM533RUiPWV8iMDEb+Hqk0loBniVJFVN7bHL5G07xPIpte0ZY/KVQt akClKHF2Hx1vEaiD0yq7EWxmNNYgZOk= X-Google-Smtp-Source: ABdhPJw5kru0ZzWwBoz0EiP7bnB0qBsfZYqWwUQ20W1IwiFlov9NAQNt7XqQ/Us3KbHNjzsg3OKpeA== X-Received: by 2002:a05:6214:260e:b0:446:4518:7445 with SMTP id gu14-20020a056214260e00b0044645187445mr4059905qvb.101.1650177059720; Sat, 16 Apr 2022 23:30:59 -0700 (PDT) Received: from auth2-smtp.messagingengine.com (auth2-smtp.messagingengine.com. [66.111.4.228]) by smtp.gmail.com with ESMTPSA id t198-20020a3746cf000000b0069c51337badsm4857876qka.45.2022.04.16.23.30.58 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sat, 16 Apr 2022 23:30:58 -0700 (PDT) Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailauth.nyi.internal (Postfix) with ESMTP id 0106827C0054; Sun, 17 Apr 2022 02:30:57 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute4.internal (MEProxy); Sun, 17 Apr 2022 02:30:58 -0400 X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedvvddrudelkedguddutdcutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfgh necuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmd enucfjughrpeffhffvuffkfhggtggujgesghdtreertddtvdenucfhrhhomhepuehoqhhu nhcuhfgvnhhguceosghoqhhunhdrfhgvnhhgsehgmhgrihhlrdgtohhmqeenucggtffrrg htthgvrhhnpeeuveegvdfgleegjeefjeevuddtjeehtddvgfdthfdtkeevledvuedtfefh fedugeenucffohhmrghinhepthhhvgdrrghqpdhkvghrnhgvlhdrohhrghenucevlhhush htvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpegsohhquhhnodhmvghs mhhtphgruhhthhhpvghrshhonhgrlhhithihqdeiledvgeehtdeigedqudejjeekheehhe dvqdgsohhquhhnrdhfvghngheppehgmhgrihhlrdgtohhmsehfihigmhgvrdhnrghmvg X-ME-Proxy: Received: by mail.messagingengine.com (Postfix) with ESMTPA; Sun, 17 Apr 2022 02:30:54 -0400 (EDT) Date: Sun, 17 Apr 2022 14:30:50 +0800 From: Boqun Feng To: Guo Ren Cc: Andrea Parri , Daniel Lustig , "Paul E. McKenney" , Arnd Bergmann , Palmer Dabbelt , Mark Rutland , Will Deacon , Peter Zijlstra , linux-arch , Linux Kernel Mailing List , linux-riscv , Guo Ren Subject: Re: [PATCH V2 0/3] riscv: atomic: Optimize AMO instructions usage Message-ID: References: <20220412034957.1481088-1-guoren@kernel.org> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="eKl0vpmQLAWLx6Dq" Content-Disposition: inline In-Reply-To: Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org --eKl0vpmQLAWLx6Dq Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Sun, Apr 17, 2022 at 12:51:38PM +0800, Guo Ren wrote: > Hi Boqun & Andrea, >=20 > On Sun, Apr 17, 2022 at 10:26 AM Boqun Feng wrote: > > > > On Sun, Apr 17, 2022 at 12:49:44AM +0800, Guo Ren wrote: > > [...] > > > > > > If both the aq and rl bits are set, the atomic memory operation is > > > sequentially consistent and cannot be observed to happen before any > > > earlier memory operations or after any later memory operations in the > > > same RISC-V hart and to the same address domain. > > > "0: lr.w %[p], %[c]\n" > > > " sub %[rc], %[p], %[o]\n" > > > " bltz %[rc], 1f\n". > > > - " sc.w.rl %[rc], %[rc], %[c]\n" > > > + " sc.w.aqrl %[rc], %[rc], %[c]\n" > > > " bnez %[rc], 0b\n" > > > - " fence rw, rw\n" > > > "1:\n" > > > So .rl + fence rw, rw is over constraints, only using sc.w.aqrl is mo= re proper. > > > > > > > Can .aqrl order memory accesses before and after it (not against itself, > > against each other), i.e. act as a full memory barrier? For example, can > From the RVWMO spec description, the .aqrl annotation appends the same > effect with "fence rw, rw" to the AMO instruction, so it's RCsc. >=20 Thanks for the confirmation, btw, where can I find the RVWMO spec? > Not only .aqrl, and I think the below also could be an RCsc when > sc.w.aq is executed: > A: Pre-Access > B: lr.w.rl ADDR-0 > ... > C: sc.w.aq ADDR-0 > D: Post-Acess > Because sc.w.aq has overlap address & data dependency on lr.w.rl, the > global memory order should be A->B->C->D when sc.w.aq is executed. For > the amoswap >=20 > The purpose of the whole patchset is to reduce the usage of > independent fence rw, rw instructions, and maximize the usage of the > .aq/.rl/.aqrl aonntation of RISC-V. >=20 > __asm__ __volatile__ ( \ > "0: lr.w %0, %2\n" \ > " bne %0, %z3, 1f\n" \ > " sc.w.rl %1, %z4, %2\n" \ > " bnez %1, 0b\n" \ > " fence rw, rw\n" \ > "1:\n" \ >=20 > > we end up with u =3D=3D 1, v =3D=3D 1, r1 on P0 is 0 and r1 on P1 is 0,= for the > > following litmus test? > > > > C lr-sc-aqrl-pair-vs-full-barrier > > > > {} > > > > P0(int *x, int *y, atomic_t *u) > > { > > int r0; > > int r1; > > > > WRITE_ONCE(*x, 1); > > r0 =3D atomic_cmpxchg(u, 0, 1); > > r1 =3D READ_ONCE(*y); > > } > > > > P1(int *x, int *y, atomic_t *v) > > { > > int r0; > > int r1; > > > > WRITE_ONCE(*y, 1); > > r0 =3D atomic_cmpxchg(v, 0, 1); > > r1 =3D READ_ONCE(*x); > > } > > > > exists (u=3D1 /\ v=3D1 /\ 0:r1=3D0 /\ 1:r1=3D0) > I think my patchset won't affect the above sequence guarantee. Current > RISC-V implementation only gives RCsc when the original value is the > same at least once. So I prefer RISC-V cmpxchg should be: >=20 >=20 > - "0: lr.w %0, %2\n" \ > + "0: lr.w.rl %0, %2\n" = \ > " bne %0, %z3, 1f\n" \ > " sc.w.rl %1, %z4, %2\n" \ > " bnez %1, 0b\n" \ > - " fence rw, rw\n" \ > "1:\n" \ > + " fence w, rw\n" \ >=20 > To give an unconditional RSsc for atomic_cmpxchg. >=20 Note that Linux kernel doesn't require cmpxchg() to provide any order if cmpxchg() fails to update the memory location. So you won't need to strengthen the atomic_cmpxchg(). Regards, Boqun > > > > Regards, > > Boqun >=20 >=20 >=20 > --=20 > Best Regards > Guo Ren >=20 > ML: https://lore.kernel.org/linux-csky/ --eKl0vpmQLAWLx6Dq Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAABCAAdFiEEj5IosQTPz8XU1wRHSXnow7UH+rgFAmJbtBcACgkQSXnow7UH +rhsSgf/Yes71uP9q+qTNbrCUmjS5/wiBJPUbWlgx7JKTXgawyX72Raimw4rjlFo 9UT8KiZPQ76BEEd74fq8paTgy4GHu8XzAdtOQBPJ/CbAkfuDc0Z9/4e4ZwsXDaBc /a6krWcGbouzS+2RVi/k0G6+EXbz8cBY6ORQ//7nseylrzaDcZtA7oAEx09PpVUq 7C8p/O+JLlCRj+W/CgOew3j1yK10HZ6BGkohfIM92r6GA3ArlHvuGmgYMrO0xuzZ PZTx3HDwZbh98wiwBc3/xL+CnH8R7ffS9eTHvNO2GWebwIAiP7a/iQPbvGvyhwrf xGcVLQRVB3NzKuTCASxcpR91L+r9FA== =pKCs -----END PGP SIGNATURE----- --eKl0vpmQLAWLx6Dq--