From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from relay6-d.mail.gandi.net (relay6-d.mail.gandi.net [217.70.183.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 2F1261FFC6E; Tue, 4 Mar 2025 10:20:50 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=217.70.183.198 ARC-Seal:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1741083653; cv=none; b=srQiIjaDUiJhDqQ2tBo7fSuMgygzAgOdHNsIhnTj7hCJy89rcPVWew6DWdsJwgdBzHe/wcfcZUx080DUW8k2SeZk5jJodCfIExxBjXrzTf3ennMrrIPSpohBRGUgTV2ZPkIkiPmxHUNooPMoEdTPczW+GnBLUfYTzudVa4MxVbM= ARC-Message-Signature:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1741083653; c=relaxed/simple; bh=FqWEoKQ0ZtgLC9HHq3tGJAxPoKcHnJCve0UbW6PtAEU=; h=From:Date:Subject:MIME-Version:Content-Type:Message-Id:References: In-Reply-To:To:Cc; b=spOhgKtm30uA1KTOh0rOhQSdXnomeHurRab9rVTh5KKsv+i57D3SoJGe9rvxeli03D/ILctiyYM8/xdZKCOat0DqHbuL/5rjbfNWDth9eaG5kLysHyLoY0Im4RFRGtt/mJqJ1dAz1XxaEDzTWIQ2VQIg6cTrSRbo2poE6jNKG7c= ARC-Authentication-Results:i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com; spf=pass smtp.mailfrom=bootlin.com; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b=RSMDo4sa; arc=none smtp.client-ip=217.70.183.198 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=bootlin.com Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b="RSMDo4sa" Received: by mail.gandi.net (Postfix) with ESMTPSA id 3D99A441D1; Tue, 4 Mar 2025 10:20:48 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1741083649; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=M+yCmcK5QCEyE88y9fHPlAWOiRAS5EWdDztaLNnrHh0=; b=RSMDo4sa78og8AfMzeVpTAHaG9A4rnMKIOaLlB719KnKXgK/H26yR8xpeNLyxMcDvHPfAz oi39hgzd8FE4PAV+fiaNns0MaSFGWbdlFo3CpvRV2JziIUHbP2WgVJVOxHaWVF4iWeiz7V hdilbP45WkuOD2DFGMH8te6UhTvoNbaMgryB7ApflP/bHrfMdROjUnMlFBHsq93Ad9oAzt lQU22cou3qjtcUYjDXAGdVEPDfmtJfcjBe56n3+sebQ9c+m5X3iSej4VH2qfCskw0jKQ8t vw0RYGAVF+17iwQou6Q5W804VthxydXO9PgA/0bM4b9ho4iagRb04k09HL4yxQ== From: Kory Maincent Date: Tue, 04 Mar 2025 11:18:56 +0100 Subject: [PATCH net-next v6 07/12] net: ethtool: Add PSE new budget evaluation strategy support feature Precedence: bulk X-Mailing-List: netdev@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit Message-Id: <20250304-feature_poe_port_prio-v6-7-3dc0c5ebaf32@bootlin.com> References: <20250304-feature_poe_port_prio-v6-0-3dc0c5ebaf32@bootlin.com> In-Reply-To: <20250304-feature_poe_port_prio-v6-0-3dc0c5ebaf32@bootlin.com> To: Andrew Lunn , Oleksij Rempel , "David S. Miller" , Eric Dumazet , Jakub Kicinski , Paolo Abeni , Jonathan Corbet , Donald Hunter , Rob Herring , Andrew Lunn , Simon Horman , Heiner Kallweit , Russell King , Krzysztof Kozlowski , Conor Dooley Cc: Liam Girdwood , Mark Brown , Thomas Petazzoni , netdev@vger.kernel.org, linux-doc@vger.kernel.org, Kyle Swenson , Dent Project , kernel@pengutronix.de, Maxime Chevallier , devicetree@vger.kernel.org, linux-kernel@vger.kernel.org, "Kory Maincent (Dent Project)" X-Mailer: b4 0.15-dev-8cb71 X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddutddujeekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuifetpfffkfdpucggtfgfnhhsuhgsshgtrhhisggvnecuuegrihhlohhuthemuceftddunecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhfffugggtgffkfhgjvfevofesthejredtredtjeenucfhrhhomhepmfhorhihucforghinhgtvghnthcuoehkohhrhidrmhgrihhntggvnhhtsegsohhothhlihhnrdgtohhmqeenucggtffrrghtthgvrhhnpeevgfdvgfektefgfefggeekudfggffhtdfffedtueetheejtddvledvvdelhedtveenucfkphepledtrdekledrudeifedruddvjeenucevlhhushhtvghrufhiiigvpeehnecurfgrrhgrmhepihhnvghtpeeltddrkeelrdduieefrdduvdejpdhhvghloheplgduvdejrddtrddurddungdpmhgrihhlfhhrohhmpehkohhrhidrmhgrihhntggvnhhtsegsohhothhlihhnrdgtohhmpdhnsggprhgtphhtthhopedvjedprhgtphhtthhopehthhhomhgrshdrphgvthgriiiiohhnihessghoohhtlhhinhdrtghomhdprhgtphhtthhopehmrgigihhmvgdrtghhvghvrghllhhivghrsegsohhothhlihhnrdgtohhmpdhrtghpthhtoheptghorhgsvghtsehlfihnrdhnvghtpdhrtghpthhtoheplhhgihhrugifohhougesghhmrghilhdrtghomhdprhgtphhtthhopeguvghnthhprhhojhgvtghtsehlihhnuhigf hhouhhnuggrthhiohhnrdhorhhgpdhrtghpthhtohepkhhriihkodgutheskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepkhgvrhhnvghlsehpvghnghhuthhrohhnihigrdguvgdprhgtphhtthhopegrnhgurhgvfieslhhunhhnrdgthh X-GND-Sasl: kory.maincent@bootlin.com From: Kory Maincent (Dent Project) This patch expands the status information provided by ethtool for PSE c33 with current port priority and max port priority. It also adds a call to pse_ethtool_set_prio() to configure the PSE port priority. Signed-off-by: Kory Maincent (Dent Project) --- Change in v6: - Remove c33 standard reference from new netlink field in documentation. - Remove report of budget evaluation strategy. Change in v4: - Remove disconnection policy features. - Rename port priority to budget evaluation strategy. Change in v3: - Add disconnection policy. Change in v2: - Improve port priority documentation. - Add port priority modes. --- Documentation/netlink/specs/ethtool.yaml | 11 +++++++++++ Documentation/networking/ethtool-netlink.rst | 26 ++++++++++++++++++++++++++ include/uapi/linux/ethtool_netlink_generated.h | 2 ++ net/ethtool/pse-pd.c | 18 ++++++++++++++++++ 4 files changed, 57 insertions(+) diff --git a/Documentation/netlink/specs/ethtool.yaml b/Documentation/netlink/specs/ethtool.yaml index cad52cf43b938..830678db3081d 100644 --- a/Documentation/netlink/specs/ethtool.yaml +++ b/Documentation/netlink/specs/ethtool.yaml @@ -1370,6 +1370,14 @@ attribute-sets: name: pse-pw-d-id type: u32 name-prefix: ethtool-a- + - + name: pse-prio-max + type: u32 + name-prefix: ethtool-a- + - + name: pse-prio + type: u32 + name-prefix: ethtool-a- - name: rss attr-cnt-name: __ethtool-a-rss-cnt @@ -2190,6 +2198,8 @@ operations: - c33-pse-avail-pw-limit - c33-pse-pw-limit-ranges - pse-pw-d-id + - pse-prio-max + - pse-prio dump: *pse-get-op - name: pse-set @@ -2204,6 +2214,7 @@ operations: - podl-pse-admin-control - c33-pse-admin-control - c33-pse-avail-pw-limit + - pse-prio - name: rss-get doc: Get RSS params. diff --git a/Documentation/networking/ethtool-netlink.rst b/Documentation/networking/ethtool-netlink.rst index 49c9a0e79af56..efc410ae26c87 100644 --- a/Documentation/networking/ethtool-netlink.rst +++ b/Documentation/networking/ethtool-netlink.rst @@ -1790,6 +1790,10 @@ Kernel response contents: ``ETHTOOL_A_C33_PSE_PW_LIMIT_RANGES`` nested Supported power limit configuration ranges. ``ETHTOOL_A_PSE_PW_D_ID`` u32 Index of the PSE power domain + ``ETHTOOL_A_PSE_PRIO_MAX`` u32 Priority maximum configurable + on the PoE PSE + ``ETHTOOL_A_PSE_PRIO`` u32 Priority of the PoE PSE + currently configured ========================================== ====== ============================= When set, the optional ``ETHTOOL_A_PODL_PSE_ADMIN_STATE`` attribute identifies @@ -1866,6 +1870,12 @@ equal. The ``ETHTOOL_A_PSE_PW_D_ID`` attribute identifies the index of PSE power domain. +When set, the optional ``ETHTOOL_A_PSE_PRIO_MAX`` attribute identifies +the PSE maximum priority value. +When set, the optional ``ETHTOOL_A_PSE_PRIO`` attributes is used to +identifies the currently configured PSE priority. +For a description of PSE priority attributes, see ``PSE_SET``. + PSE_SET ======= @@ -1879,6 +1889,8 @@ Request contents: ``ETHTOOL_A_C33_PSE_ADMIN_CONTROL`` u32 Control PSE Admin state ``ETHTOOL_A_C33_PSE_AVAIL_PWR_LIMIT`` u32 Control PoE PSE available power limit + ``ETHTOOL_A_PSE_PRIO`` u32 Control priority of the + PoE PSE ====================================== ====== ============================= When set, the optional ``ETHTOOL_A_PODL_PSE_ADMIN_CONTROL`` attribute is used @@ -1901,6 +1913,20 @@ various existing products that document power consumption in watts rather than classes. If power limit configuration based on classes is needed, the conversion can be done in user space, for example by ethtool. +When set, the optional ``ETHTOOL_A_PSE_PRIO`` attributes is used to +control the PSE priority. Allowed priority value are between zero and +the value of ``ETHTOOL_A_PSE_PRIO_MAX`` attribute. + +A lower value indicates a higher priority, meaning that a priority value +of 0 corresponds to the highest port priority. +Port priority serves two functions: + + - Power-up Order: After a reset, ports are powered up in order of their + priority from highest to lowest. Ports with higher priority + (lower values) power up first. + - Shutdown Order: When the power budget is exceeded, ports with lower + priority (higher values) are turned off first. + PSE_NTF ======= diff --git a/include/uapi/linux/ethtool_netlink_generated.h b/include/uapi/linux/ethtool_netlink_generated.h index ccd7ab3bf1b11..0220cd83728ab 100644 --- a/include/uapi/linux/ethtool_netlink_generated.h +++ b/include/uapi/linux/ethtool_netlink_generated.h @@ -634,6 +634,8 @@ enum { ETHTOOL_A_C33_PSE_AVAIL_PW_LIMIT, ETHTOOL_A_C33_PSE_PW_LIMIT_RANGES, ETHTOOL_A_PSE_PW_D_ID, + ETHTOOL_A_PSE_PRIO_MAX, + ETHTOOL_A_PSE_PRIO, __ETHTOOL_A_PSE_CNT, ETHTOOL_A_PSE_MAX = (__ETHTOOL_A_PSE_CNT - 1) diff --git a/net/ethtool/pse-pd.c b/net/ethtool/pse-pd.c index 950c1d4ef4e06..bc6f582645778 100644 --- a/net/ethtool/pse-pd.c +++ b/net/ethtool/pse-pd.c @@ -112,6 +112,9 @@ static int pse_reply_size(const struct ethnl_req_info *req_base, len += st->c33_pw_limit_nb_ranges * (nla_total_size(0) + nla_total_size(sizeof(u32)) * 2); + if (st->prio_max) + /* _PSE_PRIO_MAX + _PSE_PRIO */ + len += nla_total_size(sizeof(u32)) * 2; return len; } @@ -206,6 +209,11 @@ static int pse_fill_reply(struct sk_buff *skb, pse_put_pw_limit_ranges(skb, st)) return -EMSGSIZE; + if (st->prio_max > 0 && + (nla_put_u32(skb, ETHTOOL_A_PSE_PRIO_MAX, st->prio_max) || + nla_put_u32(skb, ETHTOOL_A_PSE_PRIO, st->prio))) + return -EMSGSIZE; + return 0; } @@ -227,6 +235,7 @@ const struct nla_policy ethnl_pse_set_policy[ETHTOOL_A_PSE_MAX + 1] = { NLA_POLICY_RANGE(NLA_U32, ETHTOOL_C33_PSE_ADMIN_STATE_DISABLED, ETHTOOL_C33_PSE_ADMIN_STATE_ENABLED), [ETHTOOL_A_C33_PSE_AVAIL_PW_LIMIT] = { .type = NLA_U32 }, + [ETHTOOL_A_PSE_PRIO] = { .type = NLA_U32 }, }; static int @@ -275,6 +284,15 @@ ethnl_set_pse(struct ethnl_req_info *req_info, struct genl_info *info) if (ret) return ret; + if (tb[ETHTOOL_A_PSE_PRIO]) { + unsigned int prio; + + prio = nla_get_u32(tb[ETHTOOL_A_PSE_PRIO]); + ret = pse_ethtool_set_prio(phydev->psec, info->extack, prio); + if (ret) + return ret; + } + if (tb[ETHTOOL_A_C33_PSE_AVAIL_PW_LIMIT]) { unsigned int pw_limit; -- 2.34.1