From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from aws-us-west-2-korg-lkml-1.web.codeaurora.org (localhost.localdomain [127.0.0.1]) by smtp.lore.kernel.org (Postfix) with ESMTP id 455CBC3ABC9 for ; Tue, 13 May 2025 06:15:40 +0000 (UTC) Received: from relay6-d.mail.gandi.net (relay6-d.mail.gandi.net [217.70.183.198]) by mx.groups.io with SMTP id smtpd.web11.70046.1747116934429384329 for ; Mon, 12 May 2025 23:15:34 -0700 Authentication-Results: mx.groups.io; dkim=pass header.i=@bootlin.com header.s=gm1 header.b=bRt0NOvP; spf=pass (domain: bootlin.com, ip: 217.70.183.198, mailfrom: mathieu.dubois-briand@bootlin.com) Received: by mail.gandi.net (Postfix) with ESMTPSA id 98B3D43297; Tue, 13 May 2025 06:15:28 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1747116931; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=r3EggoVbz4MocyrHwbo4xomJd8AdMX2ehM1IRr/3oVo=; b=bRt0NOvPfPh+LgBdtKfeLg8MsNX9c3djfu178Y5NXJtBqyLYxWXkqd8Fwb/ETT1DSWQiHF gQb4Lhc/QL6ArxvIR10IBYa9U40AHUly7OAYoAorPOwoZqihR8WQczKYd1kG/3Zo3Q3mqW jAznkHYvxaHgA7/KOd/WZ6DyFo21Pc4Way3cgSisWEKnwod7Yem0e49QSXGtjdk9Qrgfto PssO9jqtdHIlp1fv8v5HpprQj3Tu6T4MSc8iS3KuP0dxOef4amGO35M/+5DyXo6HMhwXOO ozpE1sH860S2whIJiaHPnk1G5kF4qALhhes6psUyRLa+p10/n5Rpd0+Ryoj11g== Mime-Version: 1.0 Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset=UTF-8 Date: Tue, 13 May 2025 08:15:28 +0200 Message-Id: Subject: Re: [oe-core][PATCHv2 0/3] Display manager proposal for x11 and wayland Cc: , From: "Mathieu Dubois-Briand" To: , , , , , , , , , X-Mailer: aerc 0.19.0-0-gadd9e15e475d References: <20250505224801.3181046-1-rs@ti.com> In-Reply-To: <20250505224801.3181046-1-rs@ti.com> X-GND-State: clean X-GND-Score: 0 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdeftdeffeelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuifetpfffkfdpucggtfgfnhhsuhgsshgtrhhisggvnecuuegrihhlohhuthemuceftddunecunecujfgurhepggfgtgffkffuvefhvffofhgjsehtqhertdertdejnecuhfhrohhmpedfofgrthhhihgvuhcuffhusghoihhsqdeurhhirghnugdfuceomhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomheqnecuggftrfgrthhtvghrnhepgffgveevteeuteefffefhedtkedvieffffdujedvffehueekuedtkedugeekfedtnecuffhomhgrihhnpehgihhthhhusgdrtghomhdphihotghtohhprhhojhgvtghtrdhorhhgpdgsohhothhlihhnrdgtohhmnecukfhppedvrgdtudemvgdtrgemrgeiieemfedukedtmegttdgsvgemsgelrgekmegvheelvdemiegrfehfnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvdgrtddumegvtdgrmegrieeimeefudektdemtgdtsggvmegslegrkeemvgehledvmeeirgeffhdphhgvlhhopehlohgtrghlhhhoshhtpdhmrghilhhfrhhomhepmhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomhdpnhgspghrtghpthhtohepuddvpdhrtghpthhtoheprhhssehtihdrtghomhdprhgtphhtthhopehrihgthhgrrhgurdhpuhhrughivgeslhhinhhugihfo hhunhgurghtihhonhdrohhrghdprhgtphhtthhopehrohhsshdrsghurhhtohhnsegrrhhmrdgtohhmpdhrtghpthhtoheprghlvgigsehlihhnuhhtrhhonhhigidruggvpdhrtghpthhtohepohhtrghvihhosehoshhshihsthgvmhhsrdgtohhmrdgsrhdprhgtphhtthhopehkvgigihhnrdhhrghoseifihhnughrihhvvghrrdgtohhmpdhrtghpthhtoheprghfugesthhirdgtohhmpdhrtghpthhtohepuggvthhhvghrihgughgvsehtihdrtghomh X-GND-Sasl: mathieu.dubois-briand@bootlin.com List-Id: X-Webhook-Received: from li982-79.members.linode.com [45.33.32.79] by aws-us-west-2-korg-lkml-1.web.codeaurora.org with HTTPS for ; Tue, 13 May 2025 06:15:40 -0000 X-Groupsio-URL: https://lists.openembedded.org/g/openembedded-core/message/216395 On Tue May 6, 2025 at 12:47 AM CEST, rs wrote: > From: Randolph Sapp > > We've recently run into some issues with weston-init attempting to start > Weston prior to all drm devices being registered. There's not really a > good, scriptable mechanism to listen in to device registration events > that works with the existing weston-init package. Well, at least one > that doesn't involve polling files or introducing more dependency on the > init system being used. > > I also see there is also a lot of scripting around starting X11, > xserver-nodm-init, that (from my limited review) should experience the > same issue. > > I'd like to introduce the following display manager for oe-core, emptty > [1]. This display manager is, as described upstream, a "Dead simple CLI > Display Manager on TTY". It supports both x11 and wayland sessions, with > togglable build parameters to completely remove x11 and pam > dependencies. It's licensed MIT, which shouldn't be an issue for any > users. (It is written in Go, if you have opinions about that.) > > With this, both weston-init and the xserver-nodm-init packages can be > re-tuned to leverage this display manager and simply add a user and > emptty config for an autologin session. This can resolve the current > behavior across init systems without additional scripting, and move some > development out of this layer. > > This lists myself as a maintainer of emptty as well as xserver-nodm-init = and > xuser-account since these are currently unassigned and I've reworked them > significantly here. > > Sorry for the delay on this series. I found a few bugs in emptty that I w= anted > to address before submitting this officially. > > [1] https://github.com/tvrzna/emptty > Ok, so I tried again to merge this patch, and I believe I've got new errors: RESULTS - xorg.XorgTest.test_xorg_running: FAILED (1.43s) ... AssertionError: 1 !=3D 0 : Xorg does not appear to be running https://autobuilder.yoctoproject.org/valkyrie/#/builders/9/builds/1579 https://autobuilder.yoctoproject.org/valkyrie/#/builders/20/builds/1567 https://autobuilder.yoctoproject.org/valkyrie/#/builders/67/builds/1620 https://autobuilder.yoctoproject.org/valkyrie/#/builders/68/builds/1661 https://autobuilder.yoctoproject.org/valkyrie/#/builders/74/builds/1582 https://autobuilder.yoctoproject.org/valkyrie/#/builders/92/builds/1589 Traceback (most recent call last): File "/srv/pokybuild/yocto-worker/oe-selftest-armhost/build/meta/lib/oeqa= /core/decorator/__init__.py", line 35, in wrapped_f return func(*args, **kwargs) File "/srv/pokybuild/yocto-worker/oe-selftest-armhost/build/meta/lib/oeqa= /runtime/cases/weston.py", line 63, in test_wayland_info self.assertEqual(status, 0, msg=3D'wayland-info error: %s' % output) ~~~~~~~~~~~~~~~~^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ AssertionError: 255 !=3D 0 : wayland-info error: failed to create display: = Connection refused Traceback (most recent call last): File "/srv/pokybuild/yocto-worker/oe-selftest-armhost/build/meta/lib/oeqa= /core/decorator/__init__.py", line 35, in wrapped_f return func(*args, **kwargs) File "/srv/pokybuild/yocto-worker/oe-selftest-armhost/build/meta/lib/oeqa= /runtime/cases/weston.py", line 67, in test_weston_can_initialize_new_wayla= nd_compositor existing_wl_processes =3D self.get_processes_of('weston-desktop-shell',= 'existing') File "/srv/pokybuild/yocto-worker/oe-selftest-armhost/build/meta/lib/oeqa= /runtime/cases/weston.py", line 32, in get_processes_of self.assertEqual(status, 0, msg=3D'Retrieve %s (%s) processes error: %s= ' % (target, error_msg, output)) ~~~~~~~~~~~~~~~~^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^= ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ AssertionError: 1 !=3D 0 : Retrieve weston-desktop-shell (existing) process= es error: Traceback (most recent call last): File "/srv/pokybuild/yocto-worker/oe-selftest-armhost/build/meta/lib/oeqa= /core/decorator/__init__.py", line 35, in wrapped_f return func(*args, **kwargs) File "/srv/pokybuild/yocto-worker/oe-selftest-armhost/build/meta/lib/oeqa= /core/decorator/__init__.py", line 35, in wrapped_f return func(*args, **kwargs) File "/srv/pokybuild/yocto-worker/oe-selftest-armhost/build/meta/lib/oeqa= /runtime/cases/weston.py", line 28, in test_weston_running self.assertEqual(status, 0, msg=3Dmsg) ~~~~~~~~~~~~~~~~^^^^^^^^^^^^^^^^^^^^ AssertionError: 1 !=3D 0 : Weston does not appear to be running PID USER = VSZ STAT COMMAND Traceback (most recent call last): File "/srv/pokybuild/yocto-worker/oe-selftest-armhost/build/meta/lib/oeqa= /core/decorator/__init__.py", line 35, in wrapped_f return func(*args, **kwargs) File "/srv/pokybuild/yocto-worker/oe-selftest-armhost/build/meta/lib/oeqa= /core/decorator/__init__.py", line 35, in wrapped_f return func(*args, **kwargs) File "/srv/pokybuild/yocto-worker/oe-selftest-armhost/build/meta/lib/oeqa= /runtime/cases/weston.py", line 89, in test_weston_supports_xwayland self.assertEqual(status, 0, msg=3Dmsg) ~~~~~~~~~~~~~~~~^^^^^^^^^^^^^^^^^^^^ AssertionError: 1 !=3D 0 : xwayland does not appear to be running ... RESULTS - weston.WestonTest.test_wayland_info: FAILED (0.51s) RESULTS - weston.WestonTest.test_weston_can_initialize_new_wayland_composit= or: FAILED (0.30s) RESULTS - weston.WestonTest.test_weston_running: FAILED (0.78s) RESULTS - weston.WestonTest.test_weston_supports_xwayland: FAILED (0.49s) https://autobuilder.yoctoproject.org/valkyrie/#/builders/23/builds/1661 https://autobuilder.yoctoproject.org/valkyrie/#/builders/75/builds/1514 Traceback (most recent call last): File "/srv/pokybuild/yocto-worker/no-x11/build/meta/lib/oeqa/core/decorat= or/__init__.py", line 35, in wrapped_f return func(*args, **kwargs) File "/srv/pokybuild/yocto-worker/no-x11/build/meta/lib/oeqa/runtime/case= s/weston.py", line 63, in test_wayland_info self.assertEqual(status, 0, msg=3D'wayland-info error: %s' % output) AssertionError: 255 !=3D 0 : wayland-info error: failed to create display: = No such file or directory ... RESULTS - weston.WestonTest.test_wayland_info: FAILED (0.52s) https://autobuilder.yoctoproject.org/valkyrie/#/builders/25/builds/1596 https://autobuilder.yoctoproject.org/valkyrie/#/builders/35/builds/1545 https://autobuilder.yoctoproject.org/valkyrie/api/v2/logs/2356168/raw_inlin= e 2025-05-12 21:09:25,962 - oe-selftest - INFO - ERROR: Nothing RPROVID= ES 'weston-init' (but /srv/pokybuild/yocto-worker/reproducible/build/meta/r= ecipes-graphics/wayland/weston_14.0.1.bb, /srv/pokybuild/yocto-worker/repro= ducible/build/meta/recipes-graphics/packagegroups/packagegroup-core-weston.= bb RDEPENDS on or otherwise requires it) 2025-05-12 21:09:25,962 - oe-selftest - INFO - weston-init was skippe= d: Recipe weston-init, package weston-init: system groupname "nopasswdlogin= " does not have a static ID defined. Add nopasswdlogin to one of these file= s: /srv/pokybuild/yocto-worker/reproducible/build/build-st/meta-selftest/fi= les/static-group ... 2025-05-12 21:09:25,963 - oe-selftest - INFO - ERROR: Nothing RPROVID= ES 'weston-dev' (but /srv/pokybuild/yocto-worker/reproducible/build/meta/re= cipes-graphics/wayland/weston_14.0.1.bb RDEPENDS on or otherwise requires i= t) ... 2025-05-12 21:09:25,963 - oe-selftest - INFO - ERROR: Nothing RPROVID= ES 'weston' (but /srv/pokybuild/yocto-worker/reproducible/build/meta/recipe= s-graphics/wayland/weston_14.0.1.bb, /srv/pokybuild/yocto-worker/reproducib= le/build/meta/recipes-graphics/packagegroups/packagegroup-core-weston.bb RD= EPENDS on or otherwise requires it) ... 2025-05-12 21:09:25,963 - oe-selftest - INFO - ERROR: Nothing RPROVID= ES 'weston-examples' (but /srv/pokybuild/yocto-worker/reproducible/build/me= ta/recipes-graphics/packagegroups/packagegroup-core-weston.bb RDEPENDS on o= r otherwise requires it) ... https://autobuilder.yoctoproject.org/valkyrie/#/builders/37/builds/1642 --=20 Mathieu Dubois-Briand, Bootlin Embedded Linux and Kernel engineering https://bootlin.com