From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from smtp.kernel.org (aws-us-west-2-korg-mail-1.web.codeaurora.org [10.30.226.201]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.lore.kernel.org (Postfix) with ESMTPS id 987ACCD13CF for ; Mon, 2 Sep 2024 10:16:11 +0000 (UTC) Received: by smtp.kernel.org (Postfix) id 5EDC3C4CEC6; Mon, 2 Sep 2024 10:16:11 +0000 (UTC) Received: from fout4-smtp.messagingengine.com (fout4-smtp.messagingengine.com [103.168.172.147]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by smtp.kernel.org (Postfix) with ESMTPS id 99846C4CEC2 for ; Mon, 2 Sep 2024 10:16:09 +0000 (UTC) DMARC-Filter: OpenDMARC Filter v1.4.1 smtp.kernel.org 99846C4CEC2 Authentication-Results: smtp.kernel.org; dmarc=pass (p=none dis=none) header.from=arndb.de Authentication-Results: smtp.kernel.org; spf=pass smtp.mailfrom=arndb.de Received: from phl-compute-04.internal (phl-compute-04.nyi.internal [10.202.2.44]) by mailfout.nyi.internal (Postfix) with ESMTP id C92021380366; Mon, 2 Sep 2024 06:16:08 -0400 (EDT) Received: from phl-imap-11 ([10.202.2.101]) by phl-compute-04.internal (MEProxy); Mon, 02 Sep 2024 06:16:08 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=arndb.de; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm3; t=1725272168; x=1725358568; bh=3RNolP0Fo/GSx4B9IVA751JpgSB5qu66Jzzq2ZzhW5o=; b= eswqT4+kmM9y1ZYn3In9gFzhOS2csprktMPRjMHRe/gaK25CIc6SgXNQXTjo8Wa6 jXmC2wkMn5BtLXhHHt+6xNogKhOvkO6AUAAQsOiZ5nssDIiVYzdakHa1x3rAXl22 bA6DTspqAz53Dbl3SKNjf3fhn11sxjtMBBF8qwOgJSlx6gwpf3l/00PfOudUyJOD N62jErUHi3spuhKABZyv4uKFCZBOYePT+vLDideOnSkYH+nNZOzQf8QERsYm6/6z YF7vX2u6krQg9HJA5XgZqsVLNWLBbghGXpmwlSBbjEplONaJyCuC2nYppHf3OXi4 lAANex0FtnYzPfx47tLLYg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1725272168; x= 1725358568; bh=3RNolP0Fo/GSx4B9IVA751JpgSB5qu66Jzzq2ZzhW5o=; b=e +ExLf/fMAWshxJVvPU1X5yEAdOHmK9hNB/yqQ8kxmmyTLD9dpvXsUA9mt0wMpRBR B4QmKgK8Egjn6RxhnaL9URjmo66lCeEnwLLsEHmsPXIR9lQkQZswPrb+GbLyEjuF T/AfVyywjsTrFM2lQfzFag0I4DWVjbAmEBviZeeD/1S4bL4HjqWmvpSvxnTg2JuF EdUYQvyhYVV3hAgINmXuKz44cQ4sIJoRa6lzwNVOaFk/fDzVtQypNHdmKQYbYivV cvdU2uxnoM5IrJAEqai7L6UtWdV2Ib/lph2qViDl4WnAp22ysWUbQYIqXRWkJMd5 rPYDYkIKoWfAPwGkXPK5w== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrudehfedgvdeiucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepofggfffhvfevkfgjfhfutgfgsehtqhertdertdej necuhfhrohhmpedftehrnhguuceuvghrghhmrghnnhdfuceorghrnhgusegrrhhnuggsrd guvgeqnecuggftrfgrthhtvghrnhepudeffeetfeekveffkeeuheffteevuefhvdeuteeg udfghefhffehffejhfdugeeinecuffhomhgrihhnpehgihhthhhusgdrtghomhdpkhgvrh hnvghlrdhorhhgnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhf rhhomheprghrnhgusegrrhhnuggsrdguvgdpnhgspghrtghpthhtohepjedpmhhouggvpe hsmhhtphhouhhtpdhrtghpthhtohephhgvrhhvvgdrtghoughinhgrsegsohhothhlihhn rdgtohhmpdhrtghpthhtoheptghhrhhishhtohhphhgvrdhlvghrohihsegtshhgrhhouh hprdgvuhdprhgtphhtthhopehsohgtsehkvghrnhgvlhdrohhrghdprhgtphhtthhopegs rgholhhurdhluheslhhinhhugidrihhnthgvlhdrtghomhdprhgtphhtthhopehlihhnuh igqdgrrhhmqdhkvghrnhgvlheslhhishhtshdrihhnfhhrrgguvggrugdrohhrghdprhgt phhtthhopehlihhnuhigphhptgdquggvvheslhhishhtshdrohiilhgrsghsrdhorhhgpd hrtghpthhtohepgihirgholhgvihdrfigrnhhgseifihhnughrihhvvghrrdgtohhm X-ME-Proxy: Feedback-ID: i56a14606:Fastmail Received: by mailuser.nyi.internal (Postfix, from userid 501) id 471F92220087; Mon, 2 Sep 2024 06:16:08 -0400 (EDT) X-Mailer: MessagingEngine.com Webmail Interface MIME-Version: 1.0 Date: Mon, 02 Sep 2024 10:15:34 +0000 From: "Arnd Bergmann" List-Id: To: "Christophe Leroy" , soc@kernel.org, linux-arm-kernel@lists.infradead.org, linuxppc-dev@lists.ozlabs.org Cc: "Herve Codina" , "Xiaolei Wang" , "Baolu Lu" Message-Id: In-Reply-To: References: Subject: Re: [GIT PULL] SOC FSL for 6.12 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable On Wed, Aug 28, 2024, at 13:44, Christophe Leroy wrote: > Hi Arnd, > > Please pull the following Freescale Soc Drivers changes for 6.12: > - A series from Herv=C3=A9 Codina that bring support for the newer ver= sion of=20 > QMC (QUICC Multi-channel Controller) and TSA (Time Slots Assigner) fou= nd=20 > on MPC 83xx micro-controllers. > - Misc changes for qbman freescale drivers > > There are no conflicts with latest linux-next tree. Hi Christophe, I've tried pulling this but ran into a few issues here, none of which are related to the actual patches in your branch that look totally fine to me: > The following changes since commit 5be63fc19fcaa4c236b307420483578a569= 86a37: > > Linux 6.11-rc5 (2024-08-25 19:07:11 +1200) > > are available in the Git repository at: > > https://github.com/chleroy/linux.git tags/soc_fsl-6.12-1 > > for you to fetch changes up to 1fe683bf6113da3cb694bc18ae655b2ee10ba39= 3: > > Merge branch 'support-for-quicc-engine-tsa-and-qmc' (2024-08-25=20 > 20:48:47 +0200) - There is no tag description in here, which would give me an empty changelog text for the merge commit, or force me to summarize your contents myself. Please describe the contents of your branch in a coup= le of short paragraphs, in a way that helps me and future readers of the changelog understand what kind of work is being done. Don't repeat the oneline commit messages of the individual patches though, as they show up right under your summary anyway. - You have not signed the tag, so there is no way for me to verify that you are actually the person that uploaded the branch. Ideally this should be signed with a gpg key that is on the kernel keyring, but even a brand new key is better than nothing because that way I can at least check that your next pull requests are signed by the same account as this one. Since you use a github.com account, this is even more important, as I can't easily see if you are the only person that is able to push to the github user 'chleroy'. Using a git tree on either git.kernel.org or your own domain would be ideal here, but github works if that is all you can easily do. - My branch is based on 6.11-rc4, while your tag is on top of 6.11-rc5, so pulling it into my tree would require a backmerge that I try to avoid (it shows up when Linus pulls from me). Please rebase on an earlier -rc, ideally 6.11-rc1 unless you have a reason to need something later. - Please add the linux-arm-kernel and powerpc mailing lists to cc for the pull request, so the PR gets properly archived. I saw this was missing because I could not apply it using b4 pr dfafbd92-1e61-4e80-aa5c-2bfbe1defbeb@csgroup.eu This command failed as none of the mailing list archives have your message ID. Please resend with all of the above changed. Arnd