* incoming
@ 2007-05-02 22:02 Andrew Morton
2007-05-02 22:31 ` incoming Benjamin Herrenschmidt
` (2 more replies)
0 siblings, 3 replies; 419+ messages in thread
From: Andrew Morton @ 2007-05-02 22:02 UTC (permalink / raw)
To: Linus Torvalds
Cc: Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen,
Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel,
linux-mm
So this is what I have lined up for the first mm->2.6.22 batch. I won't be
sending it off for another 12-24 hours yet. To give people time for final
comment and to give me time to see if it actually works.
- A few serial bits.
- A few pcmcia bits.
- Some of the MM queue. Includes:
- An enhancement to /proc/pid/smaps to permit monitoring of a running
program's working set.
There's another patchset which builds on this quite a lot from Matt
Mackall, but it's not quite ready yet.
- The SLUB allocator. It's pretty green but I do want to push ahead
with this pretty aggressively with a view to replacing slab altogether.
If it ends up not working out then we should remove slub altogether
again, but I doubt if that will occur.
If SLUB isn't in good shape by 2.6.22 we should hide it in Kconfig
to prevent people from hitting known problems. It'll remain
EXPERIMENTAL.
- generic pagetable quicklist management. We have x86_64 and ia64
and sparc64 implementations, but I'll only include David's sparc64
implementation here. I'll send the x86_64 and ia64 implementations
through maintainers.
- Various random MM bits
- Benh's teach-get_unmapped_area-about-MAP_FIXED changes
- madvise(MADV_FREE)
This means I'm holding back Mel's page allocator work, and Andy's
lumpy-reclaim.
A shame in a way - I have high hopes for lumpy reclaim against the
moveable zone, but these things are not to be done lightly.
A few MM things have been held back awaiting subsystem tree merges
(probably x86 - I didn't check).
- One little security patch
- the blackfin architecture
- small h8300 update
- small alpha update
- swsusp updates
- m68k bits
- cris udpates
- Lots of UML updates
- v850, xtensa
slab-introduce-krealloc.patch
at91_cf-minor-fix.patch
add-new_id-to-pcmcia-drivers.patch
ide-cs-recognize-2gb-compactflash-from-transcend.patch
serial-driver-pmc-msp71xx.patch
rm9000-serial-driver.patch
serial-define-fixed_port-flag-for-serial_core.patch
serial-use-resource_size_t-for-serial-port-io-addresses.patch
mpsc-serial-driver-tx-locking.patch
8250_pci-fix-pci-must_checks.patch
serial-serial_core-use-pr_debug.patch
add-apply_to_page_range-which-applies-a-function-to-a-pte-range.patch
safer-nr_node_ids-and-nr_node_ids-determination-and-initial.patch
use-zvc-counters-to-establish-exact-size-of-dirtyable-pages.patch
proper-prototype-for-hugetlb_get_unmapped_area.patch
mm-remove-gcc-workaround.patch
slab-ensure-cache_alloc_refill-terminates.patch
mm-make-read_cache_page-synchronous.patch
fs-buffer-dont-pageuptodate-without-page-locked.patch
allow-oom_adj-of-saintly-processes.patch
introduce-config_has_dma.patch
mm-slabc-proper-prototypes.patch
add-pfn_valid_within-helper-for-sub-max_order-hole-detection.patch
mm-simplify-filemap_nopage.patch
add-unitialized_var-macro-for-suppressing-gcc-warnings.patch
i386-add-ptep_test_and_clear_dirtyyoung.patch
i386-use-pte_update_defer-in-ptep_test_and_clear_dirtyyoung.patch
smaps-extract-pmd-walker-from-smaps-code.patch
smaps-add-pages-referenced-count-to-smaps.patch
smaps-add-clear_refs-file-to-clear-reference.patch
readahead-improve-heuristic-detecting-sequential-reads.patch
readahead-code-cleanup.patch
slab-use-num_possible_cpus-in-enable_cpucache.patch
slab-dont-allocate-empty-shared-caches.patch
slab-numa-kmem_cache-diet.patch
do-not-disable-interrupts-when-reading-min_free_kbytes.patch
slab-mark-set_up_list3s-__init.patch
cpusets-allow-tif_memdie-threads-to-allocate-anywhere.patch
i386-use-page-allocator-to-allocate-thread_info-structure.patch
slub-core.patch
make-page-private-usable-in-compound-pages-v1.patch
optimize-compound_head-by-avoiding-a-shared-page.patch
add-virt_to_head_page-and-consolidate-code-in-slab-and-slub.patch
slub-fix-object-tracking.patch
slub-enable-tracking-of-full-slabs.patch
slub-validation-of-slabs-metadata-and-guard-zones.patch
slub-add-min_partial.patch
slub-add-ability-to-list-alloc--free-callers-per-slab.patch
slub-free-slabs-and-sort-partial-slab-lists-in-kmem_cache_shrink.patch
slub-remove-object-activities-out-of-checking-functions.patch
slub-user-documentation.patch
slub-add-slabinfo-tool.patch
quicklists-for-page-table-pages.patch
quicklist-support-for-sparc64.patch
slob-handle-slab_panic-flag.patch
include-kern_-constant-in-printk-calls-in-mm-slabc.patch
mm-madvise-avoid-exclusive-mmap_sem.patch
mm-remove-destroy_dirty_buffers-from-invalidate_bdev.patch
mm-optimize-kill_bdev.patch
mm-optimize-acorn-partition-truncate.patch
slab-allocators-remove-obsolete-slab_must_hwcache_align.patch
kmem_cache-simplify-slab-cache-creation.patch
slab-allocators-remove-multiple-alignment-specifications.patch
fault-injection-fix-failslab-with-config_numa.patch
mm-fix-handling-of-panic_on_oom-when-cpusets-are-in-use.patch
oom-fix-constraint-deadlock.patch
get_unmapped_area-handles-map_fixed-on-powerpc.patch
get_unmapped_area-handles-map_fixed-on-alpha.patch
get_unmapped_area-handles-map_fixed-on-arm.patch
get_unmapped_area-handles-map_fixed-on-frv.patch
get_unmapped_area-handles-map_fixed-on-i386.patch
get_unmapped_area-handles-map_fixed-on-ia64.patch
get_unmapped_area-handles-map_fixed-on-parisc.patch
get_unmapped_area-handles-map_fixed-on-sparc64.patch
get_unmapped_area-handles-map_fixed-on-x86_64.patch
get_unmapped_area-handles-map_fixed-in-hugetlbfs.patch
get_unmapped_area-handles-map_fixed-in-generic-code.patch
get_unmapped_area-doesnt-need-hugetlbfs-hacks-anymore.patch
slab-allocators-remove-slab_debug_initial-flag.patch
slab-allocators-remove-slab_ctor_atomic.patch
slab-allocators-remove-useless-__gfp_no_grow-flag.patch
lazy-freeing-of-memory-through-madv_free.patch
restore-madv_dontneed-to-its-original-linux-behaviour.patch
hugetlbfs-add-null-check-in-hugetlb_zero_setup.patch
slob-fix-page-order-calculation-on-not-4kb-page.patch
page-migration-only-migrate-pages-if-allocation-in-the-highest-zone-is-possible.patch
return-eperm-not-echild-on-security_task_wait-failure.patch
blackfin-arch.patch
driver_bfin_serial_core.patch
blackfin-on-chip-ethernet-mac-controller-driver.patch
blackfin-patch-add-blackfin-support-in-smc91x.patch
blackfin-on-chip-rtc-controller-driver.patch
blackfin-blackfin-on-chip-spi-controller-driver.patch
convert-h8-300-to-generic-timekeeping.patch
h8300-generic-irq.patch
h8300-add-zimage-support.patch
round_up-macro-cleanup-in-arch-alpha-kernel-osf_sysc.patch
alpha-fix-bootp-image-creation.patch
alpha-prctl-macros.patch
srmcons-fix-kmallocgfp_kernel-inside-spinlock.patch
arm26-remove-useless-config-option-generic_bust_spinlock.patch
fix-refrigerator-vs-thaw_process-race.patch
swsusp-use-inline-functions-for-changing-page-flags.patch
swsusp-do-not-use-page-flags.patch
mm-remove-unused-page-flags.patch
swsusp-fix-error-paths-in-snapshot_open.patch
swsusp-use-gfp_kernel-for-creating-basic-data-structures.patch
freezer-remove-pf_nofreeze-from-handle_initrd.patch
swsusp-use-rbtree-for-tracking-allocated-swap.patch
freezer-fix-racy-usage-of-try_to_freeze-in-kswapd.patch
remove-software_suspend.patch
power-management-change-sys-power-disk-display.patch
kconfig-mentioneds-hibernation-not-just-swsusp.patch
swsusp-fix-snapshot_release.patch
swsusp-free-more-memory.patch
remove-unused-header-file-arch-m68k-atari-atasoundh.patch
spin_lock_unlocked-cleanup-in-arch-m68k.patch
remove-unused-header-file-drivers-serial-crisv10h.patch
cris-check-for-memory-allocation.patch
cris-remove-code-related-to-pre-22-kernel.patch
uml-delete-unused-code.patch
uml-formatting-fixes.patch
uml-host_info-tidying.patch
uml-mark-tt-mode-code-for-future-removal.patch
uml-print-coredump-limits.patch
uml-handle-block-device-hotplug-errors.patch
uml-driver-formatting-fixes.patch
uml-driver-formatting-fixes-fix.patch
uml-network-interface-hotplug-error-handling.patch
array_size-check-for-type.patch
uml-move-sigio-testing-to-sigioc.patch
uml-create-archh.patch
uml-create-as-layouth.patch
uml-move-remaining-useful-contents-of-user_utilh.patch
uml-remove-user_utilh.patch
uml-add-missing-__init-declarations.patch
remove-unused-header-file-arch-um-kernel-tt-include-mode_kern-tth.patch
uml-improve-checking-and-diagnostics-of-ethernet-macs.patch
uml-eliminate-temporary-buffer-in-eth_configure.patch
uml-replace-one-element-array-with-zero-element-array.patch
uml-fix-umid-in-xterm-titles.patch
uml-speed-up-exec.patch
uml-no-locking-needed-in-tlsc.patch
uml-tidy-processc.patch
uml-remove-page_size.patch
uml-kernel_thread-shouldnt-panic.patch
uml-tidy-fault-code.patch
uml-kernel-segfaults-should-dump-proper-registers.patch
uml-comment-early-boot-locking.patch
uml-irq-locking-commentary.patch
uml-delete-host_frame_size.patch
uml-drivers-get-release-methods.patch
uml-dump-registers-on-ptrace-or-wait-failure.patch
uml-speed-up-page-table-walking.patch
uml-remove-unused-x86_64-code.patch
uml-start-fixing-os_read_file-and-os_write_file.patch
uml-tidy-libc-code.patch
uml-convert-libc-layer-to-call-read-and-write.patch
uml-batch-i-o-requests.patch
uml-send-pointers-instead-of-structures-to-i-o-thread.patch
uml-send-pointers-instead-of-structures-to-i-o-thread-fix.patch
uml-dump-core-on-panic.patch
uml-dont-try-to-handle-signals-on-initial-process-stack.patch
uml-change-remaining-callers-of-os_read_write_file.patch
uml-formatting-fixes-around-os_read_write_file-callers.patch
uml-remove-debugging-remnants.patch
uml-rename-os_read_write_file_k-back-to-os_read_write_file.patch
uml-aio-deadlock-avoidance.patch
uml-speed-page-fault-path.patch
uml-eliminate-a-piece-of-debugging-code.patch
uml-more-page-fault-path-trimming.patch
uml-only-flush-areas-covered-by-vma.patch
uml-out-of-tmpfs-space-error-clarification.patch
uml-virtualized-time-fix.patch
uml-fix-prototypes.patch
v850-generic-timekeeping-conversion.patch
xtensa-strlcpy-is-smart-enough.patch
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2007-05-02 22:02 incoming Andrew Morton
@ 2007-05-02 22:31 ` Benjamin Herrenschmidt
2007-05-03 7:55 ` incoming Russell King
2007-05-04 13:37 ` incoming Greg KH
2 siblings, 0 replies; 419+ messages in thread
From: Benjamin Herrenschmidt @ 2007-05-02 22:31 UTC (permalink / raw)
To: Andrew Morton
Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller,
Andi Kleen, Luck, Tony, Rik van Riel, linux-kernel, linux-mm
On Wed, 2007-05-02 at 15:02 -0700, Andrew Morton wrote:
> So this is what I have lined up for the first mm->2.6.22 batch. I won't be
> sending it off for another 12-24 hours yet. To give people time for final
> comment and to give me time to see if it actually works.
Thanks.
I have some powerpc bits that depend on that stuff that will go through
Paulus after these show up in git and I've rebased.
Cheers,
Ben.
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2007-05-02 22:02 incoming Andrew Morton
2007-05-02 22:31 ` incoming Benjamin Herrenschmidt
@ 2007-05-03 7:55 ` Russell King
2007-05-03 8:05 ` incoming Andrew Morton
2007-05-04 13:37 ` incoming Greg KH
2 siblings, 1 reply; 419+ messages in thread
From: Russell King @ 2007-05-03 7:55 UTC (permalink / raw)
To: Andrew Morton
Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller,
Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt,
linux-kernel, linux-mm
On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote:
> So this is what I have lined up for the first mm->2.6.22 batch. I won't be
> sending it off for another 12-24 hours yet. To give people time for final
> comment and to give me time to see if it actually works.
I assume you're going to update this list with my comments I sent
yesterday?
--
Russell King
Linux kernel 2.6 ARM Linux - http://www.arm.linux.org.uk/
maintainer of:
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2007-05-03 7:55 ` incoming Russell King
@ 2007-05-03 8:05 ` Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2007-05-03 8:05 UTC (permalink / raw)
To: Russell King
Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller,
Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt,
linux-kernel, linux-mm
On Thu, 3 May 2007 08:55:43 +0100 Russell King <rmk+lkml@arm.linux.org.uk> wrote:
> On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote:
> > So this is what I have lined up for the first mm->2.6.22 batch. I won't be
> > sending it off for another 12-24 hours yet. To give people time for final
> > comment and to give me time to see if it actually works.
>
> I assume you're going to update this list with my comments I sent
> yesterday?
>
Serial drivers? Well you saw me drop a bunch of them. I now have:
serial-driver-pmc-msp71xx.patch
rm9000-serial-driver.patch
serial-define-fixed_port-flag-for-serial_core.patch
mpsc-serial-driver-tx-locking.patch
serial-serial_core-use-pr_debug.patch
I'll also be holding off on MADV_FREE - Nick has some performance things to
share and I'm assuming they're not as good as he'd like.
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2007-05-02 22:02 incoming Andrew Morton
2007-05-02 22:31 ` incoming Benjamin Herrenschmidt
2007-05-03 7:55 ` incoming Russell King
@ 2007-05-04 13:37 ` Greg KH
2007-05-04 16:14 ` incoming Andrew Morton
2 siblings, 1 reply; 419+ messages in thread
From: Greg KH @ 2007-05-04 13:37 UTC (permalink / raw)
To: Andrew Morton
Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller,
Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt,
linux-kernel, linux-mm
On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote:
> - One little security patch
Care to cc: linux-stable with it so we can do a new 2.6.21 release with
it if needed?
thanks,
greg k-h
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2007-05-04 13:37 ` incoming Greg KH
@ 2007-05-04 16:14 ` Andrew Morton
2007-05-04 17:02 ` incoming Greg KH
2007-05-04 18:57 ` incoming Roland McGrath
0 siblings, 2 replies; 419+ messages in thread
From: Andrew Morton @ 2007-05-04 16:14 UTC (permalink / raw)
To: Greg KH
Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller,
Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt,
linux-kernel, linux-mm, Roland McGrath, Stephen Smalley
On Fri, 4 May 2007 06:37:28 -0700 Greg KH <greg@kroah.com> wrote:
> On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote:
> > - One little security patch
>
> Care to cc: linux-stable with it so we can do a new 2.6.21 release with
> it if needed?
>
Ah. The patch affects security code, but it doesn't actually address any
insecurity. I didn't think it was needed for -stable?
From: Roland McGrath <roland@redhat.com>
wait* syscalls return -ECHILD even when an individual PID of a live child
was requested explicitly, when security_task_wait denies the operation.
This means that something like a broken SELinux policy can produce an
unexpected failure that looks just like a bug with wait or ptrace or
something.
This patch makes do_wait return -EACCES (or other appropriate error returned
from security_task_wait() instead of -ECHILD if some children were ruled out
solely because security_task_wait failed.
[jmorris@namei.org: switch error code to EACCES]
Signed-off-by: Roland McGrath <roland@redhat.com>
Cc: Stephen Smalley <sds@tycho.nsa.gov>
Cc: Chris Wright <chrisw@sous-sol.org>
Cc: James Morris <jmorris@namei.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
kernel/exit.c | 17 +++++++++++++++--
1 files changed, 15 insertions(+), 2 deletions(-)
diff -puN kernel/exit.c~return-eperm-not-echild-on-security_task_wait-failure kernel/exit.c
--- a/kernel/exit.c~return-eperm-not-echild-on-security_task_wait-failure
+++ a/kernel/exit.c
@@ -1033,6 +1033,8 @@ asmlinkage void sys_exit_group(int error
static int eligible_child(pid_t pid, int options, struct task_struct *p)
{
+ int err;
+
if (pid > 0) {
if (p->pid != pid)
return 0;
@@ -1066,8 +1068,9 @@ static int eligible_child(pid_t pid, int
if (delay_group_leader(p))
return 2;
- if (security_task_wait(p))
- return 0;
+ err = security_task_wait(p);
+ if (err)
+ return err;
return 1;
}
@@ -1449,6 +1452,7 @@ static long do_wait(pid_t pid, int optio
DECLARE_WAITQUEUE(wait, current);
struct task_struct *tsk;
int flag, retval;
+ int allowed, denied;
add_wait_queue(¤t->signal->wait_chldexit,&wait);
repeat:
@@ -1457,6 +1461,7 @@ repeat:
* match our criteria, even if we are not able to reap it yet.
*/
flag = 0;
+ allowed = denied = 0;
current->state = TASK_INTERRUPTIBLE;
read_lock(&tasklist_lock);
tsk = current;
@@ -1472,6 +1477,12 @@ repeat:
if (!ret)
continue;
+ if (unlikely(ret < 0)) {
+ denied = ret;
+ continue;
+ }
+ allowed = 1;
+
switch (p->state) {
case TASK_TRACED:
/*
@@ -1570,6 +1581,8 @@ check_continued:
goto repeat;
}
retval = -ECHILD;
+ if (unlikely(denied) && !allowed)
+ retval = denied;
end:
current->state = TASK_RUNNING;
remove_wait_queue(¤t->signal->wait_chldexit,&wait);
_
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2007-05-04 16:14 ` incoming Andrew Morton
@ 2007-05-04 17:02 ` Greg KH
2007-05-04 18:57 ` incoming Roland McGrath
1 sibling, 0 replies; 419+ messages in thread
From: Greg KH @ 2007-05-04 17:02 UTC (permalink / raw)
To: Andrew Morton
Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller,
Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt,
linux-kernel, linux-mm, Roland McGrath, Stephen Smalley
On Fri, May 04, 2007 at 09:14:34AM -0700, Andrew Morton wrote:
> On Fri, 4 May 2007 06:37:28 -0700 Greg KH <greg@kroah.com> wrote:
>
> > On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote:
> > > - One little security patch
> >
> > Care to cc: linux-stable with it so we can do a new 2.6.21 release with
> > it if needed?
> >
>
> Ah. The patch affects security code, but it doesn't actually address any
> insecurity. I didn't think it was needed for -stable?
Ah, ok, I read "security" as fixing a insecure problem, my mistake :)
thanks,
greg k-h
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2007-05-04 16:14 ` incoming Andrew Morton
2007-05-04 17:02 ` incoming Greg KH
@ 2007-05-04 18:57 ` Roland McGrath
2007-05-04 19:24 ` incoming Greg KH
1 sibling, 1 reply; 419+ messages in thread
From: Roland McGrath @ 2007-05-04 18:57 UTC (permalink / raw)
To: Andrew Morton
Cc: Greg KH, Linus Torvalds, Hugh Dickins, Christoph Lameter,
David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel,
Benjamin Herrenschmidt, linux-kernel, linux-mm, Stephen Smalley
> Ah. The patch affects security code, but it doesn't actually address any
> insecurity. I didn't think it was needed for -stable?
I would not recommend it for -stable.
It is an ABI change for the case of a security refusal.
Thanks,
Roland
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2007-05-04 18:57 ` incoming Roland McGrath
@ 2007-05-04 19:24 ` Greg KH
2007-05-04 19:29 ` incoming Roland McGrath
0 siblings, 1 reply; 419+ messages in thread
From: Greg KH @ 2007-05-04 19:24 UTC (permalink / raw)
To: Roland McGrath
Cc: Andrew Morton, Linus Torvalds, Hugh Dickins, Christoph Lameter,
David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel,
Benjamin Herrenschmidt, linux-kernel, linux-mm, Stephen Smalley
On Fri, May 04, 2007 at 11:57:21AM -0700, Roland McGrath wrote:
> > Ah. The patch affects security code, but it doesn't actually address any
> > insecurity. I didn't think it was needed for -stable?
>
> I would not recommend it for -stable.
> It is an ABI change for the case of a security refusal.
ABI changes are not a problem for -stable, so don't let that stop anyone
:)
thanks,
greg k-h
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2007-05-04 19:24 ` incoming Greg KH
@ 2007-05-04 19:29 ` Roland McGrath
0 siblings, 0 replies; 419+ messages in thread
From: Roland McGrath @ 2007-05-04 19:29 UTC (permalink / raw)
To: Greg KH
Cc: Andrew Morton, Linus Torvalds, Hugh Dickins, Christoph Lameter,
David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel,
Benjamin Herrenschmidt, linux-kernel, linux-mm, Stephen Smalley
> ABI changes are not a problem for -stable, so don't let that stop anyone
> :)
In fact this is the harmless sort (changes only the error code of a
failure case) that might actually go in if there were any important
reason. But the smiley stands.
Thanks,
Roland
--
To unsubscribe, send a message with 'unsubscribe linux-mm' in
the body to majordomo@kvack.org. For more info on Linux MM,
see: http://www.linux-mm.org/ .
Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a>
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
[not found] <20190716162536.bb52b8f34a8ecf5331a86a42@linux-foundation.org>
@ 2019-07-17 8:47 ` Vlastimil Babka
2019-07-17 8:57 ` incoming Bhaskar Chowdhury
2019-07-17 16:13 ` incoming Linus Torvalds
0 siblings, 2 replies; 419+ messages in thread
From: Vlastimil Babka @ 2019-07-17 8:47 UTC (permalink / raw)
To: linux-kernel, Linus Torvalds
Cc: linux-mm, Jonathan Corbet, Thorsten Leemhuis, LKML
On 7/17/19 1:25 AM, Andrew Morton wrote:
>
> Most of the rest of MM and just about all of the rest of everything
> else.
Hi,
as I've mentioned at LSF/MM [1], I think it would be nice if mm pull
requests had summaries similar to other subsystems. I see they are now
more structured (thanks!), but they are now probably hitting the limit
of what scripting can do to produce a high-level summary for human
readers (unless patch authors themselves provide a blurb that can be
extracted later?).
So I've tried now to provide an example what I had in mind, below. Maybe
it's too concise - if there were "larger" features in this pull request,
they would probably benefit from more details. I'm CCing the known (to
me) consumers of these mails to judge :) Note I've only covered mm, and
core stuff that I think will be interesting to wide audience (change in
LIST_POISON2 value? I'm sure as hell glad to know about that one :)
Feel free to include this in the merge commit, if you find it useful.
Thanks,
Vlastimil
[1] https://lwn.net/Articles/787705/
-----
- z3fold fixes and enhancements by Henry Burns and Vitaly Wool
- more accurate reclaimed slab caches calculations by Yafang Shao
- fix MAP_UNINITIALIZED UAPI symbol to not depend on config, by
Christoph Hellwig
- !CONFIG_MMU fixes by Christoph Hellwig
- new novmcoredd parameter to omit device dumps from vmcore, by Kairui Song
- new test_meminit module for testing heap and pagealloc initialization,
by Alexander Potapenko
- ioremap improvements for huge mappings, by Anshuman Khandual
- generalize kprobe page fault handling, by Anshuman Khandual
- device-dax hotplug fixes and improvements, by Pavel Tatashin
- enable synchronous DAX fault on powerpc, by Aneesh Kumar K.V
- add pte_devmap() support for arm64, by Robin Murphy
- unify locked_vm accounting with a helper, by Daniel Jordan
- several misc fixes
core/lib
- new typeof_member() macro including some users, by Alexey Dobriyan
- make BIT() and GENMASK() available in asm, by Masahiro Yamada
- changed LIST_POISON2 on x86_64 to 0xdead000000000122 for better code
generation, by Alexey Dobriyan
- rbtree code size optimizations, by Michel Lespinasse
- convert struct pid count to refcount_t, by Joel Fernandes
get_maintainer.pl
- add --no-moderated switch to skip moderated ML's, by Joe Perches
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2019-07-17 8:47 ` incoming Vlastimil Babka
@ 2019-07-17 8:57 ` Bhaskar Chowdhury
2019-07-17 16:13 ` incoming Linus Torvalds
1 sibling, 0 replies; 419+ messages in thread
From: Bhaskar Chowdhury @ 2019-07-17 8:57 UTC (permalink / raw)
To: Vlastimil Babka
Cc: linux-kernel, Linus Torvalds, linux-mm, Jonathan Corbet,
Thorsten Leemhuis
[-- Attachment #1: Type: text/plain, Size: 2496 bytes --]
Cool !!
On 10:47 Wed 17 Jul , Vlastimil Babka wrote:
>On 7/17/19 1:25 AM, Andrew Morton wrote:
>>
>> Most of the rest of MM and just about all of the rest of everything
>> else.
>
>Hi,
>
>as I've mentioned at LSF/MM [1], I think it would be nice if mm pull
>requests had summaries similar to other subsystems. I see they are now
>more structured (thanks!), but they are now probably hitting the limit
>of what scripting can do to produce a high-level summary for human
>readers (unless patch authors themselves provide a blurb that can be
>extracted later?).
>
>So I've tried now to provide an example what I had in mind, below. Maybe
>it's too concise - if there were "larger" features in this pull request,
>they would probably benefit from more details. I'm CCing the known (to
>me) consumers of these mails to judge :) Note I've only covered mm, and
>core stuff that I think will be interesting to wide audience (change in
>LIST_POISON2 value? I'm sure as hell glad to know about that one :)
>
>Feel free to include this in the merge commit, if you find it useful.
>
>Thanks,
>Vlastimil
>
>[1] https://lwn.net/Articles/787705/
>
>-----
>
>- z3fold fixes and enhancements by Henry Burns and Vitaly Wool
>- more accurate reclaimed slab caches calculations by Yafang Shao
>- fix MAP_UNINITIALIZED UAPI symbol to not depend on config, by
>Christoph Hellwig
>- !CONFIG_MMU fixes by Christoph Hellwig
>- new novmcoredd parameter to omit device dumps from vmcore, by Kairui Song
>- new test_meminit module for testing heap and pagealloc initialization,
>by Alexander Potapenko
>- ioremap improvements for huge mappings, by Anshuman Khandual
>- generalize kprobe page fault handling, by Anshuman Khandual
>- device-dax hotplug fixes and improvements, by Pavel Tatashin
>- enable synchronous DAX fault on powerpc, by Aneesh Kumar K.V
>- add pte_devmap() support for arm64, by Robin Murphy
>- unify locked_vm accounting with a helper, by Daniel Jordan
>- several misc fixes
>
>core/lib
>- new typeof_member() macro including some users, by Alexey Dobriyan
>- make BIT() and GENMASK() available in asm, by Masahiro Yamada
>- changed LIST_POISON2 on x86_64 to 0xdead000000000122 for better code
>generation, by Alexey Dobriyan
>- rbtree code size optimizations, by Michel Lespinasse
>- convert struct pid count to refcount_t, by Joel Fernandes
>
>get_maintainer.pl
>- add --no-moderated switch to skip moderated ML's, by Joe Perches
>
>
[-- Attachment #2: signature.asc --]
[-- Type: application/pgp-signature, Size: 488 bytes --]
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2019-07-17 8:47 ` incoming Vlastimil Babka
2019-07-17 8:57 ` incoming Bhaskar Chowdhury
@ 2019-07-17 16:13 ` Linus Torvalds
2019-07-17 17:09 ` incoming Christian Brauner
2019-07-17 18:13 ` incoming Vlastimil Babka
1 sibling, 2 replies; 419+ messages in thread
From: Linus Torvalds @ 2019-07-17 16:13 UTC (permalink / raw)
To: Vlastimil Babka
Cc: Linux List Kernel Mailing, linux-mm, Jonathan Corbet,
Thorsten Leemhuis
On Wed, Jul 17, 2019 at 1:47 AM Vlastimil Babka <vbabka@suse.cz> wrote:
>
> So I've tried now to provide an example what I had in mind, below.
I'll take it as a trial. I added one-line notes about coda and the
PTRACE_GET_SYSCALL_INFO interface too.
I do hope that eventually I'll just get pull requests, and they'll
have more of a "theme" than this all (*)
Linus
(*) Although in many ways, the theme for Andrew is "falls through the
cracks otherwise" so I'm not really complaining. This has been working
for years and years.
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2019-07-17 16:13 ` incoming Linus Torvalds
@ 2019-07-17 17:09 ` Christian Brauner
2019-07-17 18:13 ` incoming Vlastimil Babka
1 sibling, 0 replies; 419+ messages in thread
From: Christian Brauner @ 2019-07-17 17:09 UTC (permalink / raw)
To: Linus Torvalds
Cc: Vlastimil Babka, Linux List Kernel Mailing, linux-mm,
Jonathan Corbet, Thorsten Leemhuis
On Wed, Jul 17, 2019 at 09:13:26AM -0700, Linus Torvalds wrote:
> On Wed, Jul 17, 2019 at 1:47 AM Vlastimil Babka <vbabka@suse.cz> wrote:
> >
> > So I've tried now to provide an example what I had in mind, below.
>
> I'll take it as a trial. I added one-line notes about coda and the
> PTRACE_GET_SYSCALL_INFO interface too.
>
> I do hope that eventually I'll just get pull requests, and they'll
> have more of a "theme" than this all (*)
>
> Linus
>
> (*) Although in many ways, the theme for Andrew is "falls through the
> cracks otherwise" so I'm not really complaining. This has been working
I put all pid{fd}/clone{3} which is mostly related to pid.c, exit.c,
fork.c into my tree and try to give it a consistent theme for the prs I
sent. And that at least from my perspective that worked and was pretty
easy to coordinate with Andrew. That should hopefully make it a little
easier to theme the -mm tree overall going forward.
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2019-07-17 16:13 ` incoming Linus Torvalds
2019-07-17 17:09 ` incoming Christian Brauner
@ 2019-07-17 18:13 ` Vlastimil Babka
1 sibling, 0 replies; 419+ messages in thread
From: Vlastimil Babka @ 2019-07-17 18:13 UTC (permalink / raw)
To: Linus Torvalds
Cc: Linux List Kernel Mailing, linux-mm, Jonathan Corbet,
Thorsten Leemhuis
On 7/17/19 6:13 PM, Linus Torvalds wrote:
> On Wed, Jul 17, 2019 at 1:47 AM Vlastimil Babka <vbabka@suse.cz> wrote:
>>
>> So I've tried now to provide an example what I had in mind, below.
>
> I'll take it as a trial. I added one-line notes about coda and the
> PTRACE_GET_SYSCALL_INFO interface too.
Thanks.
> I do hope that eventually I'll just get pull requests,
Very much agree, that was also discussed at length in the LSF/MM mm
process session I've linked.
> and they'll
> have more of a "theme" than this all (*)
I'll check if the first patch bomb would be more amenable to that, as I
plan to fill in the mm part for 5.3 on LinuxChanges wiki, but for a
merge commit it's too late.
> Linus
>
> (*) Although in many ways, the theme for Andrew is "falls through the
> cracks otherwise" so I'm not really complaining. This has been working
> for years and years.
Nevermind the misc stuff that much, but I think mm itself is more
important and deserves what other subsystems have.
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2019-08-25 0:54 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2019-08-25 0:54 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
11 fixes, based on 361469211f876e67d7ca3d3d29e6d1c3e313d0f1:
Henry Burns <henryburns@google.com>:
mm/z3fold.c: fix race between migration and destruction
David Rientjes <rientjes@google.com>:
mm, page_alloc: move_freepages should not examine struct page of reserved memory
Qian Cai <cai@lca.pw>:
parisc: fix compilation errrors
Roman Gushchin <guro@fb.com>:
mm: memcontrol: flush percpu vmstats before releasing memcg
mm: memcontrol: flush percpu vmevents before releasing memcg
Jason Xing <kerneljasonxing@linux.alibaba.com>:
psi: get poll_work to run when calling poll syscall next time
Oleg Nesterov <oleg@redhat.com>:
userfaultfd_release: always remove uffd flags and clear vm_userfaultfd_ctx
Vlastimil Babka <vbabka@suse.cz>:
mm, page_owner: handle THP splits correctly
Henry Burns <henryburns@google.com>:
mm/zsmalloc.c: migration can leave pages in ZS_EMPTY indefinitely
mm/zsmalloc.c: fix race condition in zs_destroy_pool
Andrey Ryabinin <aryabinin@virtuozzo.com>:
mm/kasan: fix false positive invalid-free reports with CONFIG_KASAN_SW_TAGS=y
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2019-08-30 23:04 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2019-08-30 23:04 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
7 fixes, based on 846d2db3e00048da3f650e0cfb0b8d67669cec3e:
Roman Gushchin <guro@fb.com>:
mm: memcontrol: flush percpu slab vmstats on kmem offlining
Andrew Morton <akpm@linux-foundation.org>:
mm/zsmalloc.c: fix build when CONFIG_COMPACTION=n
Roman Gushchin <guro@fb.com>:
mm, memcg: partially revert "mm/memcontrol.c: keep local VM counters in sync with the hierarchical ones"
"Gustavo A. R. Silva" <gustavo@embeddedor.com>:
mm/z3fold.c: fix lock/unlock imbalance in z3fold_page_isolate
Dmitry Safonov <dima@arista.com>:
mailmap: add aliases for Dmitry Safonov
Michal Hocko <mhocko@suse.com>:
mm, memcg: do not set reclaim_state on soft limit reclaim
Shakeel Butt <shakeelb@google.com>:
mm: memcontrol: fix percpu vmstats and vmevents flush
.mailmap | 3 ++
include/linux/mmzone.h | 5 ++--
mm/memcontrol.c | 53 ++++++++++++++++++++++++++++++++-----------------
mm/vmscan.c | 5 ++--
mm/z3fold.c | 1
mm/zsmalloc.c | 2 +
6 files changed, 47 insertions(+), 22 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2019-09-23 22:31 Andrew Morton
2019-09-24 0:55 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2019-09-23 22:31 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- a few hot fixes
- ocfs2 updates
- almost all of -mm, as below.
134 patches, based on 619e17cf75dd58905aa67ccd494a6ba5f19d6cc6:
Subsystems affected by this patch series:
hotfixes
ocfs2
slab-generic
slab
slub
kmemleak
kasan
cleanups
debug
pagecache
memcg
gup
pagemap
memory-hotplug
sparsemem
vmalloc
initialization
z3fold
compaction
mempolicy
oom-kill
hugetlb
migration
thp
mmap
madvise
shmem
zswap
zsmalloc
Subsystem: hotfixes
OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
fat: work around race with userspace's read via blockdev while mounting
Vitaly Wool <vitalywool@gmail.com>:
Revert "mm/z3fold.c: fix race between migration and destruction"
Arnd Bergmann <arnd@arndb.de>:
mm: add dummy can_do_mlock() helper
Vitaly Wool <vitalywool@gmail.com>:
z3fold: fix retry mechanism in page reclaim
Greg Thelen <gthelen@google.com>:
kbuild: clean compressed initramfs image
Subsystem: ocfs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: use jbd2_inode dirty range scoping
jbd2: remove jbd2_journal_inode_add_[write|wait]
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
ocfs2: further debugfs cleanups
Guozhonghua <guozhonghua@h3c.com>:
ocfs2: remove unused ocfs2_calc_tree_trunc_credits()
ocfs2: remove unused ocfs2_orphan_scan_exit() declaration
zhengbin <zhengbin13@huawei.com>:
fs/ocfs2/namei.c: remove set but not used variables
fs/ocfs2/file.c: remove set but not used variables
fs/ocfs2/dir.c: remove set but not used variables
Markus Elfring <elfring@users.sourceforge.net>:
ocfs2: delete unnecessary checks before brelse()
Changwei Ge <gechangwei@live.cn>:
ocfs2: wait for recovering done after direct unlock request
ocfs2: checkpoint appending truncate log transaction before flushing
Colin Ian King <colin.king@canonical.com>:
ocfs2: fix spelling mistake "ambigous" -> "ambiguous"
Subsystem: slab-generic
Waiman Long <longman@redhat.com>:
mm, slab: extend slab/shrink to shrink all memcg caches
Subsystem: slab
Waiman Long <longman@redhat.com>:
mm, slab: move memcg_cache_params structure to mm/slab.h
Subsystem: slub
Qian Cai <cai@lca.pw>:
mm/slub.c: fix -Wunused-function compiler warnings
Subsystem: kmemleak
Nicolas Boichat <drinkcat@chromium.org>:
kmemleak: increase DEBUG_KMEMLEAK_EARLY_LOG_SIZE default to 16K
Catalin Marinas <catalin.marinas@arm.com>:
Patch series "mm: kmemleak: Use a memory pool for kmemleak object:
mm: kmemleak: make the tool tolerant to struct scan_area allocation failures
mm: kmemleak: simple memory allocation pool for kmemleak objects
mm: kmemleak: use the memory pool for early allocations
Qian Cai <cai@lca.pw>:
mm/kmemleak.c: record the current memory pool size
mm/kmemleak: increase the max mem pool to 1M
Subsystem: kasan
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: add memory corruption identification for software tag-based mode
Mark Rutland <mark.rutland@arm.com>:
lib/test_kasan.c: add roundtrip tests
Subsystem: cleanups
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
mm/page_poison.c: fix a typo in a comment
YueHaibing <yuehaibing@huawei.com>:
mm/rmap.c: remove set but not used variable 'cstart'
Matthew Wilcox (Oracle) <willy@infradead.org>:
Patch series "Make working with compound pages easier", v2:
mm: introduce page_size()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: introduce page_shift()
Matthew Wilcox (Oracle) <willy@infradead.org>:
mm: introduce compound_nr()
Yu Zhao <yuzhao@google.com>:
mm: replace list_move_tail() with add_page_to_lru_list_tail()
Subsystem: debug
Vlastimil Babka <vbabka@suse.cz>:
Patch series "debug_pagealloc improvements through page_owner", v2:
mm, page_owner: record page owner for each subpage
mm, page_owner: keep owner info when freeing the page
mm, page_owner, debug_pagealloc: save and dump freeing stack trace
Subsystem: pagecache
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
mm/filemap.c: don't initiate writeback if mapping has no dirty pages
mm/filemap.c: rewrite mapping_needs_writeback in less fancy manner
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: page cache: store only head pages in i_pages
Subsystem: memcg
Chris Down <chris@chrisdown.name>:
mm, memcg: throttle allocators when failing reclaim over memory.high
Roman Gushchin <guro@fb.com>:
mm: memcontrol: switch to rcu protection in drain_all_stock()
Johannes Weiner <hannes@cmpxchg.org>:
mm: vmscan: do not share cgroup iteration between reclaimers
Subsystem: gup
[11~From: John Hubbard <jhubbard@nvidia.com>:
Patch series "mm/gup: add make_dirty arg to put_user_pages_dirty_lock()",:
mm/gup: add make_dirty arg to put_user_pages_dirty_lock()
John Hubbard <jhubbard@nvidia.com>:
drivers/gpu/drm/via: convert put_page() to put_user_page*()
net/xdp: convert put_page() to put_user_page*()
Subsystem: pagemap
Wei Yang <richardw.yang@linux.intel.com>:
mm: remove redundant assignment of entry
Minchan Kim <minchan@kernel.org>:
mm: release the spinlock on zap_pte_range
Nicholas Piggin <npiggin@gmail.com>:
Patch series "mm: remove quicklist page table caches":
mm: remove quicklist page table caches
Mike Rapoport <rppt@linux.ibm.com>:
ia64: switch to generic version of pte allocation
sh: switch to generic version of pte allocation
microblaze: switch to generic version of pte allocation
mm: consolidate pgtable_cache_init() and pgd_cache_init()
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: do not hash address in print_bad_pte()
Subsystem: memory-hotplug
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: remove move_pfn_range()
drivers/base/node.c: simplify unregister_memory_block_under_nodes()
drivers/base/memory.c: fixup documentation of removable/phys_index/block_size_bytes
driver/base/memory.c: validate memory block size early
drivers/base/memory.c: don't store end_section_nr in memory blocks
Wei Yang <richardw.yang@linux.intel.com>:
mm/memory_hotplug.c: prevent memory leak when reusing pgdat
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: online_pages() cleanups", v2:
mm/memory_hotplug.c: use PFN_UP / PFN_DOWN in walk_system_ram_range()
mm/memory_hotplug: drop PageReserved() check in online_pages_range()
mm/memory_hotplug: simplify online_pages_range()
mm/memory_hotplug: make sure the pfn is aligned to the order when onlining
mm/memory_hotplug: online_pages cannot be 0 in online_pages()
Alastair D'Silva <alastair@d-silva.org>:
Patch series "Add bounds check for Hotplugged memory", v3:
mm/memory_hotplug.c: add a bounds check to check_hotplug_memory_range()
mm/memremap.c: add a bounds check in devm_memremap_pages()
Souptick Joarder <jrdr.linux@gmail.com>:
mm/memory_hotplug.c: s/is/if
Subsystem: sparsemem
Lecopzer Chen <lecopzer.chen@mediatek.com>:
mm/sparse.c: fix memory leak of sparsemap_buf in aligned memory
mm/sparse.c: fix ALIGN() without power of 2 in sparse_buffer_alloc()
Wei Yang <richardw.yang@linux.intel.com>:
mm/sparse.c: use __nr_to_section(section_nr) to get mem_section
Alastair D'Silva <alastair@d-silva.org>:
mm/sparse.c: don't manually decrement num_poisoned_pages
"Alastair D'Silva" <alastair@d-silva.org>:
mm/sparse.c: remove NULL check in clear_hwpoisoned_pages()
Subsystem: vmalloc
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: do not keep unpurged areas in the busy tree
Pengfei Li <lpf.vector@gmail.com>:
mm/vmalloc: modify struct vmap_area to reduce its size
Austin Kim <austindh.kim@gmail.com>:
mm/vmalloc.c: move 'area->pages' after if statement
Subsystem: initialization
Mike Rapoport <rppt@linux.ibm.com>:
mm: use CPU_BITS_NONE to initialize init_mm.cpu_bitmask
Qian Cai <cai@lca.pw>:
mm: silence -Woverride-init/initializer-overrides
Subsystem: z3fold
Vitaly Wool <vitalywool@gmail.com>:
z3fold: fix memory leak in kmem cache
Subsystem: compaction
Yafang Shao <laoar.shao@gmail.com>:
mm/compaction.c: clear total_{migrate,free}_scanned before scanning a new zone
Pengfei Li <lpf.vector@gmail.com>:
mm/compaction.c: remove unnecessary zone parameter in isolate_migratepages()
Subsystem: mempolicy
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm/mempolicy.c: remove unnecessary nodemask check in kernel_migrate_pages()
Subsystem: oom-kill
Joel Savitz <jsavitz@redhat.com>:
mm/oom_kill.c: add task UID to info message on an oom kill
Tetsuo Handa <penguin-kernel@i-love.sakura.ne.jp>:
memcg, oom: don't require __GFP_FS when invoking memcg OOM killer
Edward Chron <echron@arista.com>:
mm/oom: add oom_score_adj and pgtables to Killed process message
Yi Wang <wang.yi59@zte.com.cn>:
mm/oom_kill.c: fix oom_cpuset_eligible() comment
Michal Hocko <mhocko@suse.com>:
mm, oom: consider present pages for the node size
Qian Cai <cai@lca.pw>:
mm/memcontrol.c: fix a -Wunused-function warning
Michal Hocko <mhocko@suse.com>:
memcg, kmem: deprecate kmem.limit_in_bytes
Subsystem: hugetlb
Hillf Danton <hdanton@sina.com>:
Patch series "address hugetlb page allocation stalls", v2:
mm, reclaim: make should_continue_reclaim perform dryrun detection
Vlastimil Babka <vbabka@suse.cz>:
mm, reclaim: cleanup should_continue_reclaim()
mm, compaction: raise compaction priority after it withdrawns
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlbfs: don't retry when pool page allocations start to fail
Subsystem: migration
Pingfan Liu <kernelfans@gmail.com>:
mm/migrate.c: clean up useless code in migrate_vma_collect_pmd()
Subsystem: thp
Kefeng Wang <wangkefeng.wang@huawei.com>:
thp: update split_huge_page_pmd() comment
Song Liu <songliubraving@fb.com>:
Patch series "Enable THP for text section of non-shmem files", v10;:
filemap: check compound_head(page)->mapping in filemap_fault()
filemap: check compound_head(page)->mapping in pagecache_get_page()
filemap: update offset check in filemap_fault()
mm,thp: stats for file backed THP
khugepaged: rename collapse_shmem() and khugepaged_scan_shmem()
mm,thp: add read-only THP support for (non-shmem) FS
mm,thp: avoid writes to file with THP in pagecache
Yang Shi <yang.shi@linux.alibaba.com>:
Patch series "Make deferred split shrinker memcg aware", v6:
mm: thp: extract split_queue_* into a struct
mm: move mem_cgroup_uncharge out of __page_cache_release()
mm: shrinker: make shrinker not depend on memcg kmem
mm: thp: make deferred split shrinker memcg aware
Song Liu <songliubraving@fb.com>:
Patch series "THP aware uprobe", v13:
mm: move memcmp_pages() and pages_identical()
uprobe: use original page when all uprobes are removed
mm, thp: introduce FOLL_SPLIT_PMD
uprobe: use FOLL_SPLIT_PMD instead of FOLL_SPLIT
khugepaged: enable collapse pmd for pte-mapped THP
uprobe: collapse THP pmd after removing all uprobes
Subsystem: mmap
Alexandre Ghiti <alex@ghiti.fr>:
Patch series "Provide generic top-down mmap layout functions", v6:
mm, fs: move randomize_stack_top from fs to mm
arm64: make use of is_compat_task instead of hardcoding this test
arm64: consider stack randomization for mmap base only when necessary
arm64, mm: move generic mmap layout functions to mm
arm64, mm: make randomization selected by generic topdown mmap layout
arm: properly account for stack randomization and stack guard gap
arm: use STACK_TOP when computing mmap base address
arm: use generic mmap top-down layout and brk randomization
mips: properly account for stack randomization and stack guard gap
mips: use STACK_TOP when computing mmap base address
mips: adjust brk randomization offset to fit generic version
mips: replace arch specific way to determine 32bit task with generic version
mips: use generic mmap top-down layout and brk randomization
riscv: make mmap allocation top-down by default
Wei Yang <richardw.yang@linux.intel.com>:
mm/mmap.c: refine find_vma_prev() with rb_last()
Ivan Khoronzhuk <ivan.khoronzhuk@linaro.org>:
mm: mmap: increase sockets maximum memory size pgoff for 32bits
Subsystem: madvise
Mike Rapoport <rppt@linux.ibm.com>:
mm/madvise: reduce code duplication in error handling paths
Subsystem: shmem
Miles Chen <miles.chen@mediatek.com>:
shmem: fix obsolete comment in shmem_getpage_gfp()
Subsystem: zswap
Hui Zhu <teawaterz@linux.alibaba.com>:
zpool: add malloc_support_movable to zpool_driver
zswap: use movable memory if zpool support allocate movable memory
Vitaly Wool <vitalywool@gmail.com>:
zswap: do not map same object twice
Subsystem: zsmalloc
Qian Cai <cai@lca.pw>:
mm/zsmalloc.c: fix a -Wunused-function warning
Documentation/ABI/testing/sysfs-kernel-slab | 13
Documentation/admin-guide/cgroup-v1/memory.rst | 4
Documentation/admin-guide/kernel-parameters.txt | 2
arch/Kconfig | 11
arch/alpha/include/asm/pgalloc.h | 2
arch/alpha/include/asm/pgtable.h | 5
arch/arc/include/asm/pgalloc.h | 1
arch/arc/include/asm/pgtable.h | 5
arch/arm/Kconfig | 1
arch/arm/include/asm/pgalloc.h | 2
arch/arm/include/asm/pgtable-nommu.h | 5
arch/arm/include/asm/pgtable.h | 2
arch/arm/include/asm/processor.h | 2
arch/arm/kernel/process.c | 5
arch/arm/mm/flush.c | 7
arch/arm/mm/mmap.c | 80 -----
arch/arm64/Kconfig | 2
arch/arm64/include/asm/pgalloc.h | 2
arch/arm64/include/asm/pgtable.h | 2
arch/arm64/include/asm/processor.h | 2
arch/arm64/kernel/process.c | 8
arch/arm64/mm/flush.c | 3
arch/arm64/mm/mmap.c | 84 -----
arch/arm64/mm/pgd.c | 2
arch/c6x/include/asm/pgtable.h | 5
arch/csky/include/asm/pgalloc.h | 2
arch/csky/include/asm/pgtable.h | 5
arch/h8300/include/asm/pgtable.h | 6
arch/hexagon/include/asm/pgalloc.h | 2
arch/hexagon/include/asm/pgtable.h | 3
arch/hexagon/mm/Makefile | 2
arch/hexagon/mm/pgalloc.c | 10
arch/ia64/Kconfig | 4
arch/ia64/include/asm/pgalloc.h | 64 ----
arch/ia64/include/asm/pgtable.h | 5
arch/ia64/mm/init.c | 2
arch/m68k/include/asm/pgtable_mm.h | 7
arch/m68k/include/asm/pgtable_no.h | 7
arch/microblaze/include/asm/pgalloc.h | 128 --------
arch/microblaze/include/asm/pgtable.h | 7
arch/microblaze/mm/pgtable.c | 4
arch/mips/Kconfig | 2
arch/mips/include/asm/pgalloc.h | 2
arch/mips/include/asm/pgtable.h | 5
arch/mips/include/asm/processor.h | 5
arch/mips/mm/mmap.c | 124 +-------
arch/nds32/include/asm/pgalloc.h | 2
arch/nds32/include/asm/pgtable.h | 2
arch/nios2/include/asm/pgalloc.h | 2
arch/nios2/include/asm/pgtable.h | 2
arch/openrisc/include/asm/pgalloc.h | 2
arch/openrisc/include/asm/pgtable.h | 5
arch/parisc/include/asm/pgalloc.h | 2
arch/parisc/include/asm/pgtable.h | 2
arch/powerpc/include/asm/pgalloc.h | 2
arch/powerpc/include/asm/pgtable.h | 1
arch/powerpc/mm/book3s64/hash_utils.c | 2
arch/powerpc/mm/book3s64/iommu_api.c | 7
arch/powerpc/mm/hugetlbpage.c | 2
arch/riscv/Kconfig | 12
arch/riscv/include/asm/pgalloc.h | 4
arch/riscv/include/asm/pgtable.h | 5
arch/s390/include/asm/pgtable.h | 6
arch/sh/include/asm/pgalloc.h | 56 ---
arch/sh/include/asm/pgtable.h | 5
arch/sh/mm/Kconfig | 3
arch/sh/mm/nommu.c | 4
arch/sparc/include/asm/pgalloc_32.h | 2
arch/sparc/include/asm/pgalloc_64.h | 2
arch/sparc/include/asm/pgtable_32.h | 5
arch/sparc/include/asm/pgtable_64.h | 1
arch/sparc/mm/init_32.c | 1
arch/um/include/asm/pgalloc.h | 2
arch/um/include/asm/pgtable.h | 2
arch/unicore32/include/asm/pgalloc.h | 2
arch/unicore32/include/asm/pgtable.h | 2
arch/x86/include/asm/pgtable_32.h | 2
arch/x86/include/asm/pgtable_64.h | 3
arch/x86/mm/pgtable.c | 6
arch/xtensa/include/asm/pgtable.h | 1
arch/xtensa/include/asm/tlbflush.h | 3
drivers/base/memory.c | 44 +-
drivers/base/node.c | 55 +--
drivers/crypto/chelsio/chtls/chtls_io.c | 5
drivers/gpu/drm/via/via_dmablit.c | 10
drivers/infiniband/core/umem.c | 5
drivers/infiniband/hw/hfi1/user_pages.c | 5
drivers/infiniband/hw/qib/qib_user_pages.c | 5
drivers/infiniband/hw/usnic/usnic_uiom.c | 5
drivers/infiniband/sw/siw/siw_mem.c | 10
drivers/staging/android/ion/ion_system_heap.c | 4
drivers/target/tcm_fc/tfc_io.c | 3
drivers/vfio/vfio_iommu_spapr_tce.c | 8
fs/binfmt_elf.c | 20 -
fs/fat/dir.c | 13
fs/fat/fatent.c | 3
fs/inode.c | 3
fs/io_uring.c | 2
fs/jbd2/journal.c | 2
fs/jbd2/transaction.c | 12
fs/ocfs2/alloc.c | 20 +
fs/ocfs2/aops.c | 13
fs/ocfs2/blockcheck.c | 26 -
fs/ocfs2/cluster/heartbeat.c | 109 +------
fs/ocfs2/dir.c | 3
fs/ocfs2/dlm/dlmcommon.h | 1
fs/ocfs2/dlm/dlmdebug.c | 55 ---
fs/ocfs2/dlm/dlmdebug.h | 16 -
fs/ocfs2/dlm/dlmdomain.c | 7
fs/ocfs2/dlm/dlmunlock.c | 23 +
fs/ocfs2/dlmglue.c | 29 -
fs/ocfs2/extent_map.c | 3
fs/ocfs2/file.c | 13
fs/ocfs2/inode.c | 2
fs/ocfs2/journal.h | 42 --
fs/ocfs2/namei.c | 2
fs/ocfs2/ocfs2.h | 3
fs/ocfs2/super.c | 10
fs/open.c | 8
fs/proc/meminfo.c | 8
fs/proc/task_mmu.c | 6
include/asm-generic/pgalloc.h | 5
include/asm-generic/pgtable.h | 7
include/linux/compaction.h | 22 +
include/linux/fs.h | 32 ++
include/linux/huge_mm.h | 9
include/linux/hugetlb.h | 2
include/linux/jbd2.h | 2
include/linux/khugepaged.h | 12
include/linux/memcontrol.h | 23 -
include/linux/memory.h | 7
include/linux/memory_hotplug.h | 1
include/linux/mm.h | 37 ++
include/linux/mm_types.h | 1
include/linux/mmzone.h | 14
include/linux/page_ext.h | 1
include/linux/pagemap.h | 10
include/linux/quicklist.h | 94 ------
include/linux/shrinker.h | 7
include/linux/slab.h | 62 ----
include/linux/vmalloc.h | 20 -
include/linux/zpool.h | 3
init/main.c | 6
kernel/events/uprobes.c | 81 ++++-
kernel/resource.c | 4
kernel/sched/idle.c | 1
kernel/sysctl.c | 6
lib/Kconfig.debug | 15
lib/Kconfig.kasan | 8
lib/iov_iter.c | 2
lib/show_mem.c | 5
lib/test_kasan.c | 41 ++
mm/Kconfig | 16 -
mm/Kconfig.debug | 4
mm/Makefile | 4
mm/compaction.c | 50 +--
mm/filemap.c | 168 ++++------
mm/gup.c | 125 +++-----
mm/huge_memory.c | 129 ++++++--
mm/hugetlb.c | 89 +++++
mm/hugetlb_cgroup.c | 2
mm/init-mm.c | 2
mm/kasan/common.c | 32 +-
mm/kasan/kasan.h | 14
mm/kasan/report.c | 44 ++
mm/kasan/tags_report.c | 24 +
mm/khugepaged.c | 372 ++++++++++++++++++++----
mm/kmemleak.c | 338 +++++----------------
mm/ksm.c | 18 -
mm/madvise.c | 52 +--
mm/memcontrol.c | 188 ++++++++++--
mm/memfd.c | 2
mm/memory.c | 21 +
mm/memory_hotplug.c | 120 ++++---
mm/mempolicy.c | 4
mm/memremap.c | 5
mm/migrate.c | 13
mm/mmap.c | 12
mm/mmu_gather.c | 2
mm/nommu.c | 2
mm/oom_kill.c | 30 +
mm/page_alloc.c | 27 +
mm/page_owner.c | 127 +++++---
mm/page_poison.c | 2
mm/page_vma_mapped.c | 3
mm/quicklist.c | 103 ------
mm/rmap.c | 25 -
mm/shmem.c | 12
mm/slab.h | 64 ++++
mm/slab_common.c | 37 ++
mm/slob.c | 2
mm/slub.c | 22 -
mm/sparse.c | 25 +
mm/swap.c | 16 -
mm/swap_state.c | 6
mm/util.c | 126 +++++++-
mm/vmalloc.c | 84 +++--
mm/vmscan.c | 163 ++++------
mm/vmstat.c | 2
mm/z3fold.c | 154 ++-------
mm/zpool.c | 16 +
mm/zsmalloc.c | 23 -
mm/zswap.c | 15
net/xdp/xdp_umem.c | 9
net/xdp/xsk.c | 2
usr/Makefile | 3
206 files changed, 2385 insertions(+), 2533 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2019-09-23 22:31 incoming Andrew Morton
@ 2019-09-24 0:55 ` Linus Torvalds
2019-09-24 4:31 ` incoming Andrew Morton
0 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2019-09-24 0:55 UTC (permalink / raw)
To: Andrew Morton, David Rientjes, Vlastimil Babka, Michal Hocko,
Andrea Arcangeli
Cc: mm-commits, Linux-MM
On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> - almost all of -mm, as below.
I was hoping that we could at least test the THP locality thing? Is it
in your queue at all, or am I supposed to just do it myself?
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2019-09-24 0:55 ` incoming Linus Torvalds
@ 2019-09-24 4:31 ` Andrew Morton
2019-09-24 7:48 ` incoming Michal Hocko
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2019-09-24 4:31 UTC (permalink / raw)
To: Linus Torvalds
Cc: David Rientjes, Vlastimil Babka, Michal Hocko, Andrea Arcangeli,
mm-commits, Linux-MM
On Mon, 23 Sep 2019 17:55:24 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > - almost all of -mm, as below.
>
> I was hoping that we could at least test the THP locality thing? Is it
> in your queue at all, or am I supposed to just do it myself?
>
Confused. I saw a privately emailed patch from David which nobody
seems to have tested yet. I parked that for consideration after -rc1.
Or are you referring to something else?
This thing keeps stalling. It would be nice to push this along and get
something nailed down which we can at least get into 5.4-rc, perhaps
with a backport-this tag?
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2019-09-24 4:31 ` incoming Andrew Morton
@ 2019-09-24 7:48 ` Michal Hocko
2019-09-24 15:34 ` incoming Linus Torvalds
2019-09-24 19:55 ` incoming Vlastimil Babka
0 siblings, 2 replies; 419+ messages in thread
From: Michal Hocko @ 2019-09-24 7:48 UTC (permalink / raw)
To: Andrew Morton
Cc: Linus Torvalds, David Rientjes, Vlastimil Babka, Andrea Arcangeli,
mm-commits, Linux-MM
On Mon 23-09-19 21:31:53, Andrew Morton wrote:
> On Mon, 23 Sep 2019 17:55:24 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
>
> > On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> > >
> > > - almost all of -mm, as below.
> >
> > I was hoping that we could at least test the THP locality thing? Is it
> > in your queue at all, or am I supposed to just do it myself?
> >
>
> Confused. I saw a privately emailed patch from David which nobody
> seems to have tested yet. I parked that for consideration after -rc1.
> Or are you referring to something else?
>
> This thing keeps stalling. It would be nice to push this along and get
> something nailed down which we can at least get into 5.4-rc, perhaps
> with a backport-this tag?
The patch proposed by David is really non trivial wrt. potential side
effects. I have provided my review feedback [1] and it didn't get
any reaction. I really believe that we need to debug this properly. A
reproducer would be useful for others to work on that.
There is a more fundamental problem here and we need to address it
rather than to duck tape it and whack a mole afterwards.
[1] http://lkml.kernel.org/r/20190909193020.GD2063@dhcp22.suse.cz
--
Michal Hocko
SUSE Labs
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2019-09-24 7:48 ` incoming Michal Hocko
@ 2019-09-24 15:34 ` Linus Torvalds
2019-09-25 6:36 ` incoming Michal Hocko
2019-09-24 19:55 ` incoming Vlastimil Babka
1 sibling, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2019-09-24 15:34 UTC (permalink / raw)
To: Michal Hocko
Cc: Andrew Morton, David Rientjes, Vlastimil Babka, Andrea Arcangeli,
mm-commits, Linux-MM
On Tue, Sep 24, 2019 at 12:48 AM Michal Hocko <mhocko@kernel.org> wrote:
>
> The patch proposed by David is really non trivial wrt. potential side
> effects.
The thing is, that's not an argument when we know that the current
state is garbage and has a lot of these non-trivial side effects that
are bad.
So the patch by David _fixes_ a non-trivial bad side effect.
You can't then say "there may be other non-trivial side effects that I
don't even know about" as an argument for saying it's bad. David at
least has numbers and an argument for his patch.
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2019-09-24 7:48 ` incoming Michal Hocko
2019-09-24 15:34 ` incoming Linus Torvalds
@ 2019-09-24 19:55 ` Vlastimil Babka
1 sibling, 0 replies; 419+ messages in thread
From: Vlastimil Babka @ 2019-09-24 19:55 UTC (permalink / raw)
To: Michal Hocko, Andrew Morton
Cc: Linus Torvalds, David Rientjes, Andrea Arcangeli, mm-commits,
Linux-MM
On 9/24/19 9:48 AM, Michal Hocko wrote:
> On Mon 23-09-19 21:31:53, Andrew Morton wrote:
>> On Mon, 23 Sep 2019 17:55:24 -0700 Linus Torvalds
>> <torvalds@linux-foundation.org> wrote:
>>
>>> On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton
>>> <akpm@linux-foundation.org> wrote:
>>>>
>>>> - almost all of -mm, as below.
>>>
>>> I was hoping that we could at least test the THP locality thing?
>>> Is it in your queue at all, or am I supposed to just do it
>>> myself?
>>>
>>
>> Confused. I saw a privately emailed patch from David which nobody
>> seems to have tested yet. I parked that for consideration after
>> -rc1. Or are you referring to something else?
>>
>> This thing keeps stalling. It would be nice to push this along and
>> get something nailed down which we can at least get into 5.4-rc,
>> perhaps with a backport-this tag?
>
> The patch proposed by David is really non trivial wrt. potential
> side effects. I have provided my review feedback [1] and it didn't
> get any reaction. I really believe that we need to debug this
> properly. A reproducer would be useful for others to work on that.
>
> There is a more fundamental problem here and we need to address it
> rather than to duck tape it and whack a mole afterwards.
I believe we found a problem when investigating over-reclaim in this
thread [1] where it seems madvised THP allocation attempt can result in
4MB reclaimed, if there is a small zone such as ZONE_DMA on the node. As
it happens, the patch "[patch 090/134] mm, reclaim: make
should_continue_reclaim perform dryrun detection" in Andrew's pile
should change this 4MB to 32 pages reclaimed (as a side-effect), but
that has to be tested. I'm also working on a patch to not reclaim even
those few pages. Of course there might be more fundamental issues with
reclaim/compaction interaction, but this one seems to become hopefully
clear now.
[1]
https://lore.kernel.org/linux-mm/4b4ba042-3741-7b16-2292-198c569da2aa@profihost.ag/
> [1] http://lkml.kernel.org/r/20190909193020.GD2063@dhcp22.suse.cz
>
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2019-09-24 15:34 ` incoming Linus Torvalds
@ 2019-09-25 6:36 ` Michal Hocko
0 siblings, 0 replies; 419+ messages in thread
From: Michal Hocko @ 2019-09-25 6:36 UTC (permalink / raw)
To: Linus Torvalds
Cc: Andrew Morton, David Rientjes, Vlastimil Babka, Andrea Arcangeli,
mm-commits, Linux-MM
On Tue 24-09-19 08:34:20, Linus Torvalds wrote:
> On Tue, Sep 24, 2019 at 12:48 AM Michal Hocko <mhocko@kernel.org> wrote:
> >
> > The patch proposed by David is really non trivial wrt. potential side
> > effects.
>
> The thing is, that's not an argument when we know that the current
> state is garbage and has a lot of these non-trivial side effects that
> are bad.
>
> So the patch by David _fixes_ a non-trivial bad side effect.
>
> You can't then say "there may be other non-trivial side effects that I
> don't even know about" as an argument for saying it's bad. David at
> least has numbers and an argument for his patch.
All I am saying is that I am not able to wrap my head around this patch
to provide a competent Ack. I also believe that the fix is targetting a
wrong layer of the problem as explained in my review feedback. Appart
from reclaim/compaction interaction mentioned by Vlastimil, it seems
that it is an overly eager fallback to a remote node in the fast path
that is causing a large part of the problem as well. Kcompactd is not
eager enough to keep high order allocations ready for the fast path.
This is not specific to THP we have many other high order allocations
which are going to follow the same pattern, likely not visible in any
counters but still having performance implications.
Let's discuss technical details in the respective email thread
--
Michal Hocko
SUSE Labs
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2019-09-25 23:45 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2019-09-25 23:45 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- almost all of the rest of -mm
- various other subsystems
76 patches, based on 351c8a09b00b5c51c8f58b016fffe51f87e2d820:
Subsystems affected by this patch series:
memcg
misc
core-kernel
lib
checkpatch
reiserfs
fat
fork
cpumask
kexec
uaccess
kconfig
kgdb
bug
ipc
lzo
kasan
madvise
cleanups
pagemap
Subsystem: memcg
Michal Hocko <mhocko@suse.com>:
memcg, kmem: do not fail __GFP_NOFAIL charges
Subsystem: misc
Masahiro Yamada <yamada.masahiro@socionext.com>:
linux/coff.h: add include guard
Subsystem: core-kernel
Valdis Kletnieks <valdis.kletnieks@vt.edu>:
kernel/elfcore.c: include proper prototypes
Subsystem: lib
Michel Lespinasse <walken@google.com>:
rbtree: avoid generating code twice for the cached versions (tools copy)
Patch series "make RB_DECLARE_CALLBACKS more generic", v3:
augmented rbtree: add comments for RB_DECLARE_CALLBACKS macro
augmented rbtree: add new RB_DECLARE_CALLBACKS_MAX macro
augmented rbtree: rework the RB_DECLARE_CALLBACKS macro definition
Joe Perches <joe@perches.com>:
kernel-doc: core-api: include string.h into core-api
Qian Cai <cai@lca.pw>:
include/trace/events/writeback.h: fix -Wstringop-truncation warnings
Kees Cook <keescook@chromium.org>:
strscpy: reject buffer sizes larger than INT_MAX
Valdis Kletnieks <valdis.kletnieks@vt.edu>:
lib/generic-radix-tree.c: make 2 functions static inline
lib/extable.c: add missing prototypes
Stephen Boyd <swboyd@chromium.org>:
lib/hexdump: make print_hex_dump_bytes() a nop on !DEBUG builds
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: don't interpret stack dumps as commit IDs
checkpatch: improve SPDX license checking
Matteo Croce <mcroce@redhat.com>:
checkpatch.pl: warn on invalid commit id
Brendan Jackman <brendan.jackman@bluwireless.co.uk>:
checkpatch: exclude sizeof sub-expressions from MACRO_ARG_REUSE
Joe Perches <joe@perches.com>:
checkpatch: prefer __section over __attribute__((section(...)))
checkpatch: allow consecutive close braces
Sean Christopherson <sean.j.christopherson@intel.com>:
checkpatch: remove obsolete period from "ambiguous SHA1" query
Joe Perches <joe@perches.com>:
checkpatch: make git output use LANGUAGE=en_US.utf8
Subsystem: reiserfs
Jia-Ju Bai <baijiaju1990@gmail.com>:
fs: reiserfs: remove unnecessary check of bh in remove_from_transaction()
zhengbin <zhengbin13@huawei.com>:
fs/reiserfs/journal.c: remove set but not used variables
fs/reiserfs/stree.c: remove set but not used variables
fs/reiserfs/lbalance.c: remove set but not used variables
fs/reiserfs/objectid.c: remove set but not used variables
fs/reiserfs/prints.c: remove set but not used variables
fs/reiserfs/fix_node.c: remove set but not used variables
fs/reiserfs/do_balan.c: remove set but not used variables
Jason Yan <yanaijie@huawei.com>:
fs/reiserfs/journal.c: remove set but not used variable
fs/reiserfs/do_balan.c: remove set but not used variable
Subsystem: fat
Markus Elfring <elfring@users.sourceforge.net>:
fat: delete an unnecessary check before brelse()
Subsystem: fork
Sai Praneeth Prakhya <sai.praneeth.prakhya@intel.com>:
fork: improve error message for corrupted page tables
Subsystem: cpumask
Alexey Dobriyan <adobriyan@gmail.com>:
cpumask: nicer for_each_cpumask_and() signature
Subsystem: kexec
Tetsuo Handa <penguin-kernel@I-love.SAKURA.ne.jp>:
kexec: bail out upon SIGKILL when allocating memory.
Vasily Gorbik <gor@linux.ibm.com>:
kexec: restore arch_kexec_kernel_image_probe declaration
Subsystem: uaccess
Kees Cook <keescook@chromium.org>:
uaccess: add missing __must_check attributes
Subsystem: kconfig
Masahiro Yamada <yamada.masahiro@socionext.com>:
compiler: enable CONFIG_OPTIMIZE_INLINING forcibly
Subsystem: kgdb
Douglas Anderson <dianders@chromium.org>:
kgdb: don't use a notifier to enter kgdb at panic; call directly
scripts/gdb: handle split debug
Subsystem: bug
Kees Cook <keescook@chromium.org>:
Patch series "Clean up WARN() "cut here" handling", v2:
bug: refactor away warn_slowpath_fmt_taint()
bug: rename __WARN_printf_taint() to __WARN_printf()
bug: consolidate warn_slowpath_fmt() usage
bug: lift "cut here" out of __warn()
bug: clean up helper macros to remove __WARN_TAINT()
bug: consolidate __WARN_FLAGS usage
bug: move WARN_ON() "cut here" into exception handler
Subsystem: ipc
Markus Elfring <elfring@users.sourceforge.net>:
ipc/mqueue.c: delete an unnecessary check before the macro call dev_kfree_skb()
ipc/mqueue: improve exception handling in do_mq_notify()
"Joel Fernandes (Google)" <joel@joelfernandes.org>:
ipc/sem.c: convert to use built-in RCU list checking
Subsystem: lzo
Dave Rodgman <dave.rodgman@arm.com>:
lib/lzo/lzo1x_compress.c: fix alignment bug in lzo-rle
Subsystem: kasan
Andrey Konovalov <andreyknvl@google.com>:
Patch series "arm64: untag user pointers passed to the kernel", v19:
lib: untag user pointers in strn*_user
mm: untag user pointers passed to memory syscalls
mm: untag user pointers in mm/gup.c
mm: untag user pointers in get_vaddr_frames
fs/namespace: untag user pointers in copy_mount_options
userfaultfd: untag user pointers
drm/amdgpu: untag user pointers
drm/radeon: untag user pointers in radeon_gem_userptr_ioctl
media/v4l2-core: untag user pointers in videobuf_dma_contig_user_get
tee/shm: untag user pointers in tee_shm_register
vfio/type1: untag user pointers in vaddr_get_pfn
Catalin Marinas <catalin.marinas@arm.com>:
mm: untag user pointers in mmap/munmap/mremap/brk
Subsystem: madvise
Minchan Kim <minchan@kernel.org>:
Patch series "Introduce MADV_COLD and MADV_PAGEOUT", v7:
mm: introduce MADV_COLD
mm: change PAGEREF_RECLAIM_CLEAN with PAGE_REFRECLAIM
mm: introduce MADV_PAGEOUT
mm: factor out common parts between MADV_COLD and MADV_PAGEOUT
Subsystem: cleanups
Mike Rapoport <rppt@linux.ibm.com>:
hexagon: drop empty and unused free_initrd_mem
Denis Efremov <efremov@linux.com>:
checkpatch: check for nested (un)?likely() calls
xen/events: remove unlikely() from WARN() condition
fs: remove unlikely() from WARN_ON() condition
wimax/i2400m: remove unlikely() from WARN*() condition
xfs: remove unlikely() from WARN_ON() condition
IB/hfi1: remove unlikely() from IS_ERR*() condition
ntfs: remove (un)?likely() from IS_ERR() conditions
Subsystem: pagemap
Mark Rutland <mark.rutland@arm.com>:
mm: treewide: clarify pgtable_page_{ctor,dtor}() naming
Documentation/core-api/kernel-api.rst | 3
Documentation/vm/split_page_table_lock.rst | 10
arch/alpha/include/uapi/asm/mman.h | 3
arch/arc/include/asm/pgalloc.h | 4
arch/arm/include/asm/tlb.h | 2
arch/arm/mm/mmu.c | 2
arch/arm64/include/asm/tlb.h | 2
arch/arm64/mm/mmu.c | 2
arch/csky/include/asm/pgalloc.h | 2
arch/hexagon/include/asm/pgalloc.h | 2
arch/hexagon/mm/init.c | 13
arch/m68k/include/asm/mcf_pgalloc.h | 6
arch/m68k/include/asm/motorola_pgalloc.h | 6
arch/m68k/include/asm/sun3_pgalloc.h | 2
arch/mips/include/asm/pgalloc.h | 2
arch/mips/include/uapi/asm/mman.h | 3
arch/nios2/include/asm/pgalloc.h | 2
arch/openrisc/include/asm/pgalloc.h | 6
arch/parisc/include/uapi/asm/mman.h | 3
arch/powerpc/mm/pgtable-frag.c | 6
arch/riscv/include/asm/pgalloc.h | 2
arch/s390/mm/pgalloc.c | 6
arch/sh/include/asm/pgalloc.h | 2
arch/sparc/include/asm/pgtable_64.h | 5
arch/sparc/mm/init_64.c | 4
arch/sparc/mm/srmmu.c | 4
arch/um/include/asm/pgalloc.h | 2
arch/unicore32/include/asm/tlb.h | 2
arch/x86/mm/pat_rbtree.c | 19
arch/x86/mm/pgtable.c | 2
arch/xtensa/include/asm/pgalloc.h | 4
arch/xtensa/include/uapi/asm/mman.h | 3
drivers/block/drbd/drbd_interval.c | 29 -
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gpuvm.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_gem.c | 2
drivers/gpu/drm/radeon/radeon_gem.c | 2
drivers/infiniband/hw/hfi1/verbs.c | 2
drivers/media/v4l2-core/videobuf-dma-contig.c | 9
drivers/net/wimax/i2400m/tx.c | 3
drivers/tee/tee_shm.c | 1
drivers/vfio/vfio_iommu_type1.c | 2
drivers/xen/events/events_base.c | 2
fs/fat/dir.c | 4
fs/namespace.c | 2
fs/ntfs/mft.c | 12
fs/ntfs/namei.c | 2
fs/ntfs/runlist.c | 2
fs/ntfs/super.c | 2
fs/open.c | 2
fs/reiserfs/do_balan.c | 15
fs/reiserfs/fix_node.c | 6
fs/reiserfs/journal.c | 22
fs/reiserfs/lbalance.c | 3
fs/reiserfs/objectid.c | 3
fs/reiserfs/prints.c | 3
fs/reiserfs/stree.c | 4
fs/userfaultfd.c | 22
fs/xfs/xfs_buf.c | 4
include/asm-generic/bug.h | 71 +-
include/asm-generic/pgalloc.h | 8
include/linux/cpumask.h | 14
include/linux/interval_tree_generic.h | 22
include/linux/kexec.h | 2
include/linux/kgdb.h | 2
include/linux/mm.h | 4
include/linux/mm_types_task.h | 4
include/linux/printk.h | 22
include/linux/rbtree_augmented.h | 114 +++-
include/linux/string.h | 5
include/linux/swap.h | 2
include/linux/thread_info.h | 2
include/linux/uaccess.h | 21
include/trace/events/writeback.h | 38 -
include/uapi/asm-generic/mman-common.h | 3
include/uapi/linux/coff.h | 5
ipc/mqueue.c | 22
ipc/sem.c | 3
kernel/debug/debug_core.c | 31 -
kernel/elfcore.c | 1
kernel/fork.c | 16
kernel/kexec_core.c | 2
kernel/panic.c | 48 -
lib/Kconfig.debug | 4
lib/bug.c | 11
lib/extable.c | 1
lib/generic-radix-tree.c | 4
lib/hexdump.c | 21
lib/lzo/lzo1x_compress.c | 14
lib/rbtree_test.c | 37 -
lib/string.c | 12
lib/strncpy_from_user.c | 3
lib/strnlen_user.c | 3
mm/frame_vector.c | 2
mm/gup.c | 4
mm/internal.h | 2
mm/madvise.c | 562 ++++++++++++++++-------
mm/memcontrol.c | 10
mm/mempolicy.c | 3
mm/migrate.c | 2
mm/mincore.c | 2
mm/mlock.c | 4
mm/mmap.c | 34 -
mm/mprotect.c | 2
mm/mremap.c | 13
mm/msync.c | 2
mm/oom_kill.c | 2
mm/swap.c | 42 +
mm/vmalloc.c | 5
mm/vmscan.c | 62 ++
scripts/checkpatch.pl | 69 ++
scripts/gdb/linux/symbols.py | 4
tools/include/linux/rbtree.h | 71 +-
tools/include/linux/rbtree_augmented.h | 145 +++--
tools/lib/rbtree.c | 37 -
114 files changed, 1195 insertions(+), 754 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2019-10-07 0:57 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2019-10-07 0:57 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
The usual shower of hotfixes.
Chris's memcg patches aren't actually fixes - they're mature but a few
niggling review issues were late to arrive.
The ocfs2 fixes are quite old - those took some time to get
reviewer attention.
18 patches, based on 4ea655343ce4180fe9b2c7ec8cb8ef9884a47901.
Subsystems affected by this patch series:
ocfs2
hotfixes
mm/memcg
mm/slab-generic
Subsystem: ocfs2
Jia Guo <guojia12@huawei.com>:
ocfs2: clear zero in unaligned direct IO
Jia-Ju Bai <baijiaju1990@gmail.com>:
fs: ocfs2: fix possible null-pointer dereferences in ocfs2_xa_prepare_entry()
fs: ocfs2: fix a possible null-pointer dereference in ocfs2_write_end_nolock()
fs: ocfs2: fix a possible null-pointer dereference in ocfs2_info_scan_inode_alloc()
Subsystem: hotfixes
Will Deacon <will@kernel.org>:
panic: ensure preemption is disabled during panic()
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/memremap: drop unused SECTION_SIZE and SECTION_MASK
Tejun Heo <tj@kernel.org>:
writeback: fix use-after-free in finish_writeback_work()
Yi Wang <wang.yi59@zte.com.cn>:
mm: fix -Wmissing-prototypes warnings
Baoquan He <bhe@redhat.com>:
memcg: only record foreign writebacks with dirty pages when memcg is not disabled
Michal Hocko <mhocko@suse.com>:
kernel/sysctl.c: do not override max_threads provided by userspace
Vitaly Wool <vitalywool@gmail.com>:
mm/z3fold.c: claim page in the beginning of free
Qian Cai <cai@lca.pw>:
mm/page_alloc.c: fix a crash in free_pages_prepare()
Dan Carpenter <dan.carpenter@oracle.com>:
mm/vmpressure.c: fix a signedness bug in vmpressure_register_event()
Subsystem: mm/memcg
Chris Down <chris@chrisdown.name>:
mm, memcg: proportional memory.{low,min} reclaim
mm, memcg: make memory.emin the baseline for utilisation determination
mm, memcg: make scan aggression always exclude protection
Subsystem: mm/slab-generic
Vlastimil Babka <vbabka@suse.cz>:
Patch series "guarantee natural alignment for kmalloc()", v2:
mm, sl[ou]b: improve memory accounting
mm, sl[aou]b: guarantee natural alignment for kmalloc(power-of-two)
Documentation/admin-guide/cgroup-v2.rst | 20 +-
Documentation/core-api/memory-allocation.rst | 4
fs/fs-writeback.c | 9 -
fs/ocfs2/aops.c | 25 +++
fs/ocfs2/ioctl.c | 2
fs/ocfs2/xattr.c | 56 +++----
include/linux/memcontrol.h | 67 ++++++---
include/linux/slab.h | 4
kernel/fork.c | 4
kernel/panic.c | 1
mm/memcontrol.c | 5
mm/memremap.c | 2
mm/page_alloc.c | 8 -
mm/shuffle.c | 2
mm/slab_common.c | 19 ++
mm/slob.c | 62 ++++++--
mm/slub.c | 14 +
mm/sparse.c | 2
mm/vmpressure.c | 20 +-
mm/vmscan.c | 198 +++++++++++++++++----------
mm/z3fold.c | 10 +
21 files changed, 363 insertions(+), 171 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2019-10-14 21:11 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2019-10-14 21:11 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
The usual shower of hotfixes and some followups to the recently merged
page_owner enhancements.
16 patches, based on 2abd839aa7e615f2bbc50c8ba7deb9e40d186768.
Subsystems affected by this patch series:
Vlastimil Babka <vbabka@suse.cz>:
Patch series "followups to debug_pagealloc improvements through page_owner", v3:
mm, page_owner: fix off-by-one error in __set_page_owner_handle()
mm, page_owner: decouple freeing stack trace from debug_pagealloc
mm, page_owner: rename flag indicating that page is allocated
Qian Cai <cai@lca.pw>:
mm/slub: fix a deadlock in show_slab_objects()
Eric Biggers <ebiggers@google.com>:
lib/generic-radix-tree.c: add kmemleak annotations
Alexander Potapenko <glider@google.com>:
mm/slub.c: init_on_free=1 should wipe freelist ptr for bulk allocations
lib/test_meminit: add a kmem_cache_alloc_bulk() test
David Rientjes <rientjes@google.com>:
mm, hugetlb: allow hugepage allocations to reclaim as needed
Vlastimil Babka <vbabka@suse.cz>:
mm, compaction: fix wrong pfn handling in __reset_isolation_pfn()
Randy Dunlap <rdunlap@infradead.org>:
fs/direct-io.c: fix kernel-doc warning
fs/libfs.c: fix kernel-doc warning
fs/fs-writeback.c: fix kernel-doc warning
bitmap.h: fix kernel-doc warning and typo
xarray.h: fix kernel-doc warning
mm/slab.c: fix kernel-doc warning for __ksize()
Jane Chu <jane.chu@oracle.com>:
mm/memory-failure: poison read receives SIGKILL instead of SIGBUS if mmaped more than once
Documentation/dev-tools/kasan.rst | 3 ++
fs/direct-io.c | 3 --
fs/fs-writeback.c | 2 -
fs/libfs.c | 3 --
include/linux/bitmap.h | 3 +-
include/linux/page_ext.h | 10 ++++++
include/linux/xarray.h | 4 +-
lib/generic-radix-tree.c | 32 +++++++++++++++++-----
lib/test_meminit.c | 27 ++++++++++++++++++
mm/compaction.c | 7 ++--
mm/memory-failure.c | 22 ++++++++-------
mm/page_alloc.c | 6 ++--
mm/page_ext.c | 23 ++++++---------
mm/page_owner.c | 55 +++++++++++++-------------------------
mm/slab.c | 3 ++
mm/slub.c | 35 ++++++++++++++++++------
16 files changed, 152 insertions(+), 86 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2019-10-19 3:19 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2019-10-19 3:19 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
Rather a lot of fixes, almost all affecting mm/.
26 patches, based on b9959c7a347d6adbb558fba7e36e9fef3cba3b07:
David Hildenbrand <david@redhat.com>:
drivers/base/memory.c: don't access uninitialized memmaps in soft_offline_page_store()
fs/proc/page.c: don't access uninitialized memmaps in fs/proc/page.c
mm/memory-failure.c: don't access uninitialized memmaps in memory_failure()
Joel Colledge <joel.colledge@linbit.com>:
scripts/gdb: fix lx-dmesg when CONFIG_PRINTK_CALLER is set
Qian Cai <cai@lca.pw>:
mm/page_owner: don't access uninitialized memmaps when reading /proc/pagetypeinfo
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: don't access uninitialized memmaps in shrink_pgdat_span()
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "mm/memory_hotplug: Shrink zones before removing memory", v6:
mm/memunmap: don't access uninitialized memmap in memunmap_pages()
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: fix panic in __free_slab() caused by premature memcg pointer release
Chengguang Xu <cgxu519@mykernel.net>:
ocfs2: fix error handling in ocfs2_setattr()
John Hubbard <jhubbard@nvidia.com>:
mm/gup_benchmark: add a missing "w" to getopt string
mm/gup: fix a misnamed "write" argument, and a related bug
Honglei Wang <honglei.wang@oracle.com>:
mm: memcg: get number of pages on the LRU list in memcgroup base on lru_zone_size
Mike Rapoport <rppt@linux.ibm.com>:
mm: memblock: do not enforce current limit for memblock_phys* family
David Hildenbrand <david@redhat.com>:
hugetlbfs: don't access uninitialized memmaps in pfn_range_valid_gigantic()
Yi Li <yilikernel@gmail.com>:
ocfs2: fix panic due to ocfs2_wq is null
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
mm/memcontrol: update lruvec counters in mem_cgroup_move_account
Chenwandun <chenwandun@huawei.com>:
zram: fix race between backing_dev_show and backing_dev_store
Ben Dooks <ben.dooks@codethink.co.uk>:
mm: include <linux/huge_mm.h> for is_vma_temporary_stack
mm/filemap.c: include <linux/ramfs.h> for generic_file_vm_ops definition
"Ben Dooks (Codethink)" <ben.dooks@codethink.co.uk>:
mm/init-mm.c: include <linux/mman.h> for vm_committed_as_batch
"Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
Patch series "Fixes for THP in page cache", v2:
proc/meminfo: fix output alignment
mm/thp: fix node page state in split_huge_page_to_list()
William Kucharski <william.kucharski@oracle.com>:
mm/vmscan.c: support removing arbitrary sized pages from mapping
"Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
mm/thp: allow dropping THP from page cache
Song Liu <songliubraving@fb.com>:
kernel/events/uprobes.c: only do FOLL_SPLIT_PMD for uprobe register
Ilya Leoshkevich <iii@linux.ibm.com>:
scripts/gdb: fix debugging modules on s390
drivers/base/memory.c | 3 +
drivers/block/zram/zram_drv.c | 5 +
fs/ocfs2/file.c | 2
fs/ocfs2/journal.c | 3 -
fs/ocfs2/localalloc.c | 3 -
fs/proc/meminfo.c | 4 -
fs/proc/page.c | 28 ++++++----
kernel/events/uprobes.c | 13 ++++-
mm/filemap.c | 1
mm/gup.c | 14 +++--
mm/huge_memory.c | 9 ++-
mm/hugetlb.c | 5 -
mm/init-mm.c | 1
mm/memblock.c | 6 +-
mm/memcontrol.c | 18 ++++---
mm/memory-failure.c | 14 +++--
mm/memory_hotplug.c | 74 ++++++-----------------------
mm/memremap.c | 11 ++--
mm/page_owner.c | 5 +
mm/rmap.c | 1
mm/slab_common.c | 9 +--
mm/truncate.c | 12 ++++
mm/vmscan.c | 14 ++---
scripts/gdb/linux/dmesg.py | 16 ++++--
scripts/gdb/linux/symbols.py | 8 ++-
scripts/gdb/linux/utils.py | 25 +++++----
tools/testing/selftests/vm/gup_benchmark.c | 2
27 files changed, 166 insertions(+), 140 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2019-11-06 5:16 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2019-11-06 5:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
17 fixes, based on 26bc672134241a080a83b2ab9aa8abede8d30e1c:
Shakeel Butt <shakeelb@google.com>:
mm: memcontrol: fix NULL-ptr deref in percpu stats flush
John Hubbard <jhubbard@nvidia.com>:
mm/gup_benchmark: fix MAP_HUGETLB case
Mel Gorman <mgorman@techsingularity.net>:
mm, meminit: recalculate pcpu batch and high limits after init completes
Yang Shi <yang.shi@linux.alibaba.com>:
mm: thp: handle page cache THP correctly in PageTransCompoundMap
Shuning Zhang <sunny.s.zhang@oracle.com>:
ocfs2: protect extent tree in ocfs2_prepare_inode_for_write()
Jason Gunthorpe <jgg@mellanox.com>:
mm/mmu_notifiers: use the right return code for WARN_ON
Michal Hocko <mhocko@suse.com>:
mm, vmstat: hide /proc/pagetypeinfo from normal users
mm, vmstat: reduce zone->lock holding time by /proc/pagetypeinfo
Ville Syrjälä <ville.syrjala@linux.intel.com>:
mm/khugepaged: fix might_sleep() warn with CONFIG_HIGHPTE=y
Johannes Weiner <hannes@cmpxchg.org>:
mm/page_alloc.c: ratelimit allocation failure warnings more aggressively
Vitaly Wool <vitaly.wool@konsulko.com>:
zswap: add Vitaly to the maintainers list
Kevin Hao <haokexin@gmail.com>:
dump_stack: avoid the livelock of the dump_lock
Song Liu <songliubraving@fb.com>:
MAINTAINERS: update information for "MEMORY MANAGEMENT"
Roman Gushchin <guro@fb.com>:
mm: slab: make page_cgroup_ino() to recognize non-compound slab pages properly
Ilya Leoshkevich <iii@linux.ibm.com>:
scripts/gdb: fix debugging modules compiled with hot/cold partitioning
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: fix updating the node span
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: fix network errors from failing __GFP_ATOMIC charges
MAINTAINERS | 5 +
fs/ocfs2/file.c | 125 ++++++++++++++++++++++-------
include/linux/mm.h | 5 -
include/linux/mm_types.h | 5 +
include/linux/page-flags.h | 20 ++++
lib/dump_stack.c | 7 +
mm/khugepaged.c | 7 -
mm/memcontrol.c | 23 +++--
mm/memory_hotplug.c | 8 +
mm/mmu_notifier.c | 2
mm/page_alloc.c | 17 ++-
mm/slab.h | 4
mm/vmstat.c | 25 ++++-
scripts/gdb/linux/symbols.py | 3
tools/testing/selftests/vm/gup_benchmark.c | 2
15 files changed, 197 insertions(+), 61 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2019-11-16 1:34 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2019-11-16 1:34 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
11 fixes, based on 875fef493f21e54d20d71a581687990aaa50268c:
Yang Shi <yang.shi@linux.alibaba.com>:
mm: mempolicy: fix the wrong return value and potential pages leak of mbind
zhong jiang <zhongjiang@huawei.com>:
mm: fix trying to reclaim unevictable lru page when calling madvise_pageout
Lasse Collin <lasse.collin@tukaani.org>:
lib/xz: fix XZ_DYNALLOC to avoid useless memory reallocations
Roman Gushchin <guro@fb.com>:
mm: memcg: switch to css_tryget() in get_mem_cgroup_from_mm()
mm: hugetlb: switch to css_tryget() in hugetlb_cgroup_charge_cgroup()
Laura Abbott <labbott@redhat.com>:
mm: slub: really fix slab walking for init_on_free
Song Liu <songliubraving@fb.com>:
mm,thp: recheck each page before collapsing file THP
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: fix try_offline_node()
Vinayak Menon <vinmenon@codeaurora.org>:
mm/page_io.c: do not free shared swap slots
Ralph Campbell <rcampbell@nvidia.com>:
mm/debug.c: __dump_page() prints an extra line
mm/debug.c: PageAnon() is true for PageKsm() pages
drivers/base/memory.c | 36 ++++++++++++++++++++++++++++++++++++
include/linux/memory.h | 1 +
lib/xz/xz_dec_lzma2.c | 1 +
mm/debug.c | 33 ++++++++++++++++++---------------
mm/hugetlb_cgroup.c | 2 +-
mm/khugepaged.c | 28 ++++++++++++++++------------
mm/madvise.c | 16 ++++++++++++----
mm/memcontrol.c | 2 +-
mm/memory_hotplug.c | 47 +++++++++++++++++++++++++++++------------------
mm/mempolicy.c | 14 +++++++++-----
mm/page_io.c | 6 +++---
mm/slub.c | 39 +++++++++------------------------------
12 files changed, 136 insertions(+), 89 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2019-11-22 1:53 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2019-11-22 1:53 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
4 fixes, based on 81429eb8d9ca40b0c65bb739d29fa856c5d5e958:
Vincent Whitchurch <vincent.whitchurch@axis.com>:
mm/sparse: consistently do not zero memmap
Joseph Qi <joseph.qi@linux.alibaba.com>:
Revert "fs: ocfs2: fix possible null-pointer dereferences in ocfs2_xa_prepare_entry()"
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: don't access uninitialized memmaps in shrink_zone_span()
Andrey Ryabinin <aryabinin@virtuozzo.com>:
mm/ksm.c: don't WARN if page is still mapped in remove_stable_node()
fs/ocfs2/xattr.c | 56 ++++++++++++++++++++++++++++++----------------------
mm/ksm.c | 14 ++++++-------
mm/memory_hotplug.c | 16 ++++++++++++--
mm/sparse.c | 2 -
4 files changed, 54 insertions(+), 34 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2019-12-01 1:47 Andrew Morton
2019-12-01 5:17 ` incoming James Bottomley
2019-12-01 21:07 ` incoming Linus Torvalds
0 siblings, 2 replies; 419+ messages in thread
From: Andrew Morton @ 2019-12-01 1:47 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- a small number of updates to scripts/, ocfs2 and fs/buffer.c
- most of MM. I still have quite a lot of material (mostly not MM)
staged after linux-next due to -next dependencies. I'll send thos
across next week as the preprequisites get merged up.
158 patches, based on 32ef9553635ab1236c33951a8bd9b5af1c3b1646.
Subsystems affected by this patch series:
scripts
ocfs2
vfs
mm/slab
mm/slub
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/memfd
mm/memory-failure
mm/memory-hotplug
mm/sparsemem
mm/vmalloc
mm/kasan
mm/pagealloc
mm/vmscan
mm/proc
mm/z3fold
mm/mempolicy
mm/memblock
mm/hugetlbfs
mm/hugetlb
mm/migration
mm/thp
mm/cma
mm/autonuma
mm/page-poison
mm/mmap
mm/madvise
mm/userfaultfd
mm/shmem
mm/cleanups
mm/support
Subsystem: scripts
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ocfs2
Ding Xiang <dingxiang@cmss.chinamobile.com>:
ocfs2: fix passing zero to 'PTR_ERR' warning
Subsystem: vfs
Saurav Girepunje <saurav.girepunje@gmail.com>:
fs/buffer.c: fix use true/false for bool type
Ben Dooks <ben.dooks@codethink.co.uk>:
fs/buffer.c: include internal.h for missing declarations
Subsystem: mm/slab
Pengfei Li <lpf.vector@gmail.com>:
Patch series "mm, slab: Make kmalloc_info[] contain all types of names", v6:
mm, slab: make kmalloc_info[] contain all types of names
mm, slab: remove unused kmalloc_size()
mm, slab_common: use enum kmalloc_cache_type to iterate over kmalloc caches
Subsystem: mm/slub
Miles Chen <miles.chen@mediatek.com>:
mm: slub: print the offset of fault addresses
Yu Zhao <yuzhao@google.com>:
mm/slub.c: update comments
mm/slub.c: clean up validate_slab()
Subsystem: mm/pagecache
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
mm/filemap.c: remove redundant cache invalidation after async direct-io write
fs/direct-io.c: keep dio_warn_stale_pagecache() when CONFIG_BLOCK=n
mm/filemap.c: warn if stale pagecache is left after direct write
Subsystem: mm/gup
zhong jiang <zhongjiang@huawei.com>:
mm/gup.c: allow CMA migration to propagate errors back to caller
Liu Xiang <liuxiang_1999@126.com>:
mm/gup.c: fix comments of __get_user_pages() and get_user_pages_remote()
Subsystem: mm/swap
Naohiro Aota <naohiro.aota@wdc.com>:
mm, swap: disallow swapon() on zoned block devices
Fengguang Wu <fengguang.wu@intel.com>:
mm/swap.c: trivial mark_page_accessed() cleanup
Subsystem: mm/memcg
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: clean up reclaim iter array
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: remove dead code from memory_max_write()
mm: memcontrol: try harder to set a new memory.high
Hao Lee <haolee.swjtu@gmail.com>:
include/linux/memcontrol.h: fix comments based on per-node memcg
Shakeel Butt <shakeelb@google.com>:
mm: vmscan: memcontrol: remove mem_cgroup_select_victim_node()
Chris Down <chris@chrisdown.name>:
Documentation/admin-guide/cgroup-v2.rst: document why inactive_X + active_X may not equal X
Subsystem: mm/pagemap
Johannes Weiner <hannes@cmpxchg.org>:
mm: drop mmap_sem before calling balance_dirty_pages() in write fault
"Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
shmem: pin the file in shmem_fault() if mmap_sem is dropped
"Joel Fernandes (Google)" <joel@joelfernandes.org>:
mm: emit tracepoint when RSS changes
rss_stat: add support to detect RSS updates of external mm
Wei Yang <richardw.yang@linux.intel.com>:
mm/mmap.c: remove a never-triggered warning in __vma_adjust()
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
mm/swap.c: piggyback lru_add_drain_all() calls
Wei Yang <richardw.yang@linux.intel.com>:
mm/mmap.c: prev could be retrieved from vma->vm_prev
mm/mmap.c: __vma_unlink_prev() is not necessary now
mm/mmap.c: extract __vma_unlink_list() as counterpart for __vma_link_list()
mm/mmap.c: rb_parent is not necessary in __vma_link_list()
mm/rmap.c: don't reuse anon_vma if we just want a copy
mm/rmap.c: reuse mergeable anon_vma as parent when fork
Gaowei Pu <pugaowei@gmail.com>:
mm/mmap.c: use IS_ERR_VALUE to check return value of get_unmapped_area
Vineet Gupta <Vineet.Gupta1@synopsys.com>:
Patch series "elide extraneous generated code for folded p4d/pud/pmd", v3:
ARC: mm: remove __ARCH_USE_5LEVEL_HACK
asm-generic/tlb: stub out pud_free_tlb() if nopud ...
asm-generic/tlb: stub out p4d_free_tlb() if nop4d ...
asm-generic/tlb: stub out pmd_free_tlb() if nopmd
asm-generic/mm: stub out p{4,u}d_clear_bad() if __PAGETABLE_P{4,U}D_FOLDED
Miles Chen <miles.chen@mediatek.com>:
mm/rmap.c: fix outdated comment in page_get_anon_vma()
Yang Shi <yang.shi@linux.alibaba.com>:
mm/rmap.c: use VM_BUG_ON_PAGE() in __page_check_anon_rmap()
Thomas Hellstrom <thellstrom@vmware.com>:
mm: move the backup x_devmap() functions to asm-generic/pgtable.h
mm/memory.c: fix a huge pud insertion race during faulting
Steven Price <steven.price@arm.com>:
Patch series "Generic page walk and ptdump", v15:
mm: add generic p?d_leaf() macros
arc: mm: add p?d_leaf() definitions
arm: mm: add p?d_leaf() definitions
arm64: mm: add p?d_leaf() definitions
mips: mm: add p?d_leaf() definitions
powerpc: mm: add p?d_leaf() definitions
riscv: mm: add p?d_leaf() definitions
s390: mm: add p?d_leaf() definitions
sparc: mm: add p?d_leaf() definitions
x86: mm: add p?d_leaf() definitions
mm: pagewalk: add p4d_entry() and pgd_entry()
mm: pagewalk: allow walking without vma
mm: pagewalk: add test_p?d callbacks
mm: pagewalk: add 'depth' parameter to pte_hole
x86: mm: point to struct seq_file from struct pg_state
x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct
x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct
x86: mm: convert ptdump_walk_pgd_level_core() to take an mm_struct
mm: add generic ptdump
x86: mm: convert dump_pagetables to use walk_page_range
arm64: mm: convert mm/dump.c to use walk_page_range()
arm64: mm: display non-present entries in ptdump
mm: ptdump: reduce level numbers by 1 in note_page()
Subsystem: mm/memfd
Nicolas Geoffray <ngeoffray@google.com>:
mm, memfd: fix COW issue on MAP_PRIVATE and F_SEAL_FUTURE_WRITE mappings
"Joel Fernandes (Google)" <joel@joelfernandes.org>:
memfd: add test for COW on MAP_PRIVATE and F_SEAL_FUTURE_WRITE mappings
Subsystem: mm/memory-failure
Jane Chu <jane.chu@oracle.com>:
mm/memory-failure.c clean up around tk pre-allocation
Naoya Horiguchi <nao.horiguchi@gmail.com>:
mm, soft-offline: convert parameter to pfn
Yunfeng Ye <yeyunfeng@huawei.com>:
mm/memory-failure.c: use page_shift() in add_to_kill()
Subsystem: mm/memory-hotplug
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/hotplug: reorder memblock_[free|remove]() calls in try_remove_memory()
Alastair D'Silva <alastair@d-silva.org>:
mm/memory_hotplug.c: add a bounds check to __add_pages()
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: Export generic_online_page()":
mm/memory_hotplug: export generic_online_page()
hv_balloon: use generic_online_page()
mm/memory_hotplug: remove __online_page_free() and __online_page_increment_counters()
Patch series "mm: Memory offlining + page isolation cleanups", v2:
mm/page_alloc.c: don't set pages PageReserved() when offlining
mm/page_isolation.c: convert SKIP_HWPOISON to MEMORY_OFFLINE
"Ben Dooks (Codethink)" <ben.dooks@codethink.co.uk>:
include/linux/memory_hotplug.h: move definitions of {set,clear}_zone_contiguous
David Hildenbrand <david@redhat.com>:
drivers/base/memory.c: drop the mem_sysfs_mutex
mm/memory_hotplug.c: don't allow to online/offline memory blocks with holes
Subsystem: mm/sparsemem
Vincent Whitchurch <vincent.whitchurch@axis.com>:
mm/sparse: consistently do not zero memmap
Ilya Leoshkevich <iii@linux.ibm.com>:
mm/sparse.c: mark populate_section_memmap as __meminit
Michal Hocko <mhocko@suse.com>:
mm/sparse.c: do not waste pre allocated memmap space
Subsystem: mm/vmalloc
Liu Xiang <liuxiang_1999@126.com>:
mm/vmalloc.c: remove unnecessary highmem_mask from parameter of gfpflags_allow_blocking()
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: remove preempt_disable/enable when doing preloading
mm/vmalloc: respect passed gfp_mask when doing preloading
mm/vmalloc: add more comments to the adjust_va_to_fit_type()
Anders Roxell <anders.roxell@linaro.org>:
selftests: vm: add fragment CONFIG_TEST_VMALLOC
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: rework vmap_area_lock
Subsystem: mm/kasan
Daniel Axtens <dja@axtens.net>:
Patch series "kasan: support backing vmalloc space with real shadow:
kasan: support backing vmalloc space with real shadow memory
kasan: add test for vmalloc
fork: support VMAP_STACK with KASAN_VMALLOC
x86/kasan: support KASAN_VMALLOC
Subsystem: mm/pagealloc
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/page_alloc: add alloc_contig_pages()
Mel Gorman <mgorman@techsingularity.net>:
mm, pcp: share common code between memory hotplug and percpu sysctl handler
mm, pcpu: make zone pcp updates and reset internal to the mm
Hao Lee <haolee.swjtu@gmail.com>:
include/linux/mmzone.h: fix comment for ISOLATE_UNMAPPED macro
lijiazi <jqqlijiazi@gmail.com>:
mm/page_alloc.c: print reserved_highatomic info
Subsystem: mm/vmscan
Andrey Ryabinin <aryabinin@virtuozzo.com>:
mm/vmscan: remove unused lru_pages argument
Yang Shi <yang.shi@linux.alibaba.com>:
mm/vmscan.c: remove unused scan_control parameter from pageout()
Johannes Weiner <hannes@cmpxchg.org>:
Patch series "mm: vmscan: cgroup-related cleanups":
mm: vmscan: simplify lruvec_lru_size()
mm: clean up and clarify lruvec lookup procedure
mm: vmscan: move inactive_list_is_low() swap check to the caller
mm: vmscan: naming fixes: global_reclaim() and sane_reclaim()
mm: vmscan: replace shrink_node() loop with a retry jump
mm: vmscan: turn shrink_node_memcg() into shrink_lruvec()
mm: vmscan: split shrink_node() into node part and memcgs part
mm: vmscan: harmonize writeback congestion tracking for nodes & memcgs
Patch series "mm: fix page aging across multiple cgroups":
mm: vmscan: move file exhaustion detection to the node level
mm: vmscan: detect file thrashing at the reclaim root
mm: vmscan: enforce inactive:active ratio at the reclaim root
Xianting Tian <xianting_tian@126.com>:
mm/vmscan.c: fix typo in comment
Subsystem: mm/proc
Johannes Weiner <hannes@cmpxchg.org>:
kernel: sysctl: make drop_caches write-only
Subsystem: mm/z3fold
Vitaly Wool <vitaly.wool@konsulko.com>:
mm/z3fold.c: add inter-page compaction
Subsystem: mm/mempolicy
Li Xinhai <lixinhai.lxh@gmail.com>:
Patch series "mm: Fix checking unmapped holes for mbind", v4:
mm/mempolicy.c: check range first in queue_pages_test_walk
mm/mempolicy.c: fix checking unmapped holes for mbind
Subsystem: mm/memblock
Cao jin <caoj.fnst@cn.fujitsu.com>:
mm/memblock.c: cleanup doc
mm/memblock: correct doc for function
Yunfeng Ye <yeyunfeng@huawei.com>:
mm: support memblock alloc on the exact node for sparse_buffer_init()
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlbfs: hugetlb_fault_mutex_hash() cleanup
mm/hugetlbfs: fix error handling when setting up mounts
Patch series "hugetlbfs: convert macros to static inline, fix sparse warning":
powerpc/mm: remove pmd_huge/pud_huge stubs and include hugetlb.h
hugetlbfs: convert macros to static inline, fix sparse warning
Piotr Sarna <p.sarna@tlen.pl>:
hugetlbfs: add O_TMPFILE support
Waiman Long <longman@redhat.com>:
hugetlbfs: take read_lock on i_mmap for PMD sharing
Subsystem: mm/hugetlb
Mina Almasry <almasrymina@google.com>:
hugetlb: region_chg provides only cache entry
hugetlb: remove duplicated code
Wei Yang <richardw.yang@linux.intel.com>:
hugetlb: remove unused hstate in hugetlb_fault_mutex_hash()
Zhigang Lu <tonnylu@tencent.com>:
mm/hugetlb: avoid looping to the same hugepage if !pages and !vmas
zhong jiang <zhongjiang@huawei.com>:
mm/huge_memory.c: split_huge_pages_fops should be defined with DEFINE_DEBUGFS_ATTRIBUTE
Subsystem: mm/migration
Yang Shi <yang.shi@linux.alibaba.com>:
mm/migrate.c: handle freed page at the first place
Subsystem: mm/thp
"Kirill A. Shutemov" <kirill@shutemov.name>:
mm, thp: do not queue fully unmapped pages for deferred split
Song Liu <songliubraving@fb.com>:
mm/thp: flush file for !is_shmem PageDirty() case in collapse_file()
Subsystem: mm/cma
Yunfeng Ye <yeyunfeng@huawei.com>:
mm/cma.c: switch to bitmap_zalloc() for cma bitmap allocation
zhong jiang <zhongjiang@huawei.com>:
mm/cma_debug.c: use DEFINE_DEBUGFS_ATTRIBUTE to define debugfs fops
Subsystem: mm/autonuma
Huang Ying <ying.huang@intel.com>:
autonuma: fix watermark checking in migrate_balanced_pgdat()
autonuma: reduce cache footprint when scanning page tables
Subsystem: mm/page-poison
zhong jiang <zhongjiang@huawei.com>:
mm/hwpoison-inject: use DEFINE_DEBUGFS_ATTRIBUTE to define debugfs fops
Subsystem: mm/mmap
Wei Yang <richardw.yang@linux.intel.com>:
mm/mmap.c: make vma_merge() comment more easy to understand
Subsystem: mm/madvise
Yunfeng Ye <yeyunfeng@huawei.com>:
mm/madvise.c: replace with page_size() in madvise_inject_error()
Wei Yang <richardw.yang@linux.intel.com>:
mm/madvise.c: use PAGE_ALIGN[ED] for range checking
Subsystem: mm/userfaultfd
Wei Yang <richardw.yang@linux.intel.com>:
userfaultfd: use vma_pagesize for all huge page size calculation
userfaultfd: remove unnecessary WARN_ON() in __mcopy_atomic_hugetlb()
userfaultfd: wrap the common dst_vma check into an inlined function
Andrea Arcangeli <aarcange@redhat.com>:
fs/userfaultfd.c: wp: clear VM_UFFD_MISSING or VM_UFFD_WP during userfaultfd_register()
Mike Rapoport <rppt@linux.ibm.com>:
userfaultfd: require CAP_SYS_PTRACE for UFFD_FEATURE_EVENT_FORK
Subsystem: mm/shmem
Colin Ian King <colin.king@canonical.com>:
mm/shmem.c: make array 'values' static const, makes object smaller
Yang Shi <yang.shi@linux.alibaba.com>:
mm: shmem: use proper gfp flags for shmem_writepage()
Chen Jun <chenjun102@huawei.com>:
mm/shmem.c: cast the type of unmap_start to u64
Subsystem: mm/cleanups
Hao Lee <haolee.swjtu@gmail.com>:
mm: fix struct member name in function comments
Wei Yang <richardw.yang@linux.intel.com>:
mm: fix typos in comments when calling __SetPageUptodate()
Souptick Joarder <jrdr.linux@gmail.com>:
mm/memory_hotplug.c: remove __online_page_set_limits()
Krzysztof Kozlowski <krzk@kernel.org>:
mm/Kconfig: fix indentation
Randy Dunlap <rdunlap@infradead.org>:
mm/Kconfig: fix trivial help text punctuation
Subsystem: mm/support
Minchan Kim <minchan@google.com>:
mm/page_io.c: annotate refault stalls from swap_readpage
Documentation/admin-guide/cgroup-v2.rst | 7
Documentation/dev-tools/kasan.rst | 63 +
arch/Kconfig | 9
arch/arc/include/asm/pgtable.h | 2
arch/arc/mm/fault.c | 10
arch/arc/mm/highmem.c | 4
arch/arm/include/asm/pgtable-2level.h | 1
arch/arm/include/asm/pgtable-3level.h | 1
arch/arm64/Kconfig | 1
arch/arm64/Kconfig.debug | 19
arch/arm64/include/asm/pgtable.h | 2
arch/arm64/include/asm/ptdump.h | 8
arch/arm64/mm/Makefile | 4
arch/arm64/mm/dump.c | 148 +---
arch/arm64/mm/mmu.c | 4
arch/arm64/mm/ptdump_debugfs.c | 2
arch/mips/include/asm/pgtable.h | 5
arch/powerpc/include/asm/book3s/64/pgtable-4k.h | 3
arch/powerpc/include/asm/book3s/64/pgtable-64k.h | 3
arch/powerpc/include/asm/book3s/64/pgtable.h | 30
arch/powerpc/mm/book3s64/radix_pgtable.c | 1
arch/riscv/include/asm/pgtable-64.h | 7
arch/riscv/include/asm/pgtable.h | 7
arch/s390/include/asm/pgtable.h | 2
arch/sparc/include/asm/pgtable_64.h | 2
arch/x86/Kconfig | 2
arch/x86/Kconfig.debug | 20
arch/x86/include/asm/pgtable.h | 10
arch/x86/mm/Makefile | 4
arch/x86/mm/debug_pagetables.c | 8
arch/x86/mm/dump_pagetables.c | 431 +++---------
arch/x86/mm/kasan_init_64.c | 61 +
arch/x86/platform/efi/efi_32.c | 2
arch/x86/platform/efi/efi_64.c | 4
drivers/base/memory.c | 40 -
drivers/firmware/efi/arm-runtime.c | 2
drivers/hv/hv_balloon.c | 4
drivers/xen/balloon.c | 1
fs/buffer.c | 6
fs/direct-io.c | 21
fs/hugetlbfs/inode.c | 67 +
fs/ocfs2/acl.c | 4
fs/proc/task_mmu.c | 4
fs/userfaultfd.c | 21
include/asm-generic/4level-fixup.h | 1
include/asm-generic/5level-fixup.h | 1
include/asm-generic/pgtable-nop4d.h | 2
include/asm-generic/pgtable-nopmd.h | 2
include/asm-generic/pgtable-nopud.h | 2
include/asm-generic/pgtable.h | 71 ++
include/asm-generic/tlb.h | 4
include/linux/fs.h | 6
include/linux/gfp.h | 2
include/linux/hugetlb.h | 142 +++-
include/linux/kasan.h | 31
include/linux/memblock.h | 3
include/linux/memcontrol.h | 51 -
include/linux/memory_hotplug.h | 11
include/linux/mm.h | 42 -
include/linux/mmzone.h | 34
include/linux/moduleloader.h | 2
include/linux/page-isolation.h | 4
include/linux/pagewalk.h | 42 -
include/linux/ptdump.h | 22
include/linux/slab.h | 20
include/linux/string.h | 2
include/linux/swap.h | 2
include/linux/vmalloc.h | 12
include/trace/events/kmem.h | 53 +
kernel/events/uprobes.c | 2
kernel/fork.c | 4
kernel/sysctl.c | 2
lib/Kconfig.kasan | 16
lib/test_kasan.c | 26
lib/vsprintf.c | 40 -
mm/Kconfig | 40 -
mm/Kconfig.debug | 21
mm/Makefile | 1
mm/cma.c | 6
mm/cma_debug.c | 10
mm/filemap.c | 56 -
mm/gup.c | 40 -
mm/hmm.c | 8
mm/huge_memory.c | 2
mm/hugetlb.c | 298 ++------
mm/hwpoison-inject.c | 4
mm/internal.h | 27
mm/kasan/common.c | 233 ++++++
mm/kasan/generic_report.c | 3
mm/kasan/kasan.h | 1
mm/khugepaged.c | 18
mm/madvise.c | 14
mm/memblock.c | 113 ++-
mm/memcontrol.c | 167 ----
mm/memory-failure.c | 61 -
mm/memory.c | 56 +
mm/memory_hotplug.c | 86 +-
mm/mempolicy.c | 59 +
mm/migrate.c | 21
mm/mincore.c | 1
mm/mmap.c | 75 --
mm/mprotect.c | 8
mm/mremap.c | 4
mm/nommu.c | 10
mm/page_alloc.c | 137 +++
mm/page_io.c | 15
mm/page_isolation.c | 12
mm/pagewalk.c | 126 ++-
mm/pgtable-generic.c | 9
mm/ptdump.c | 167 ++++
mm/rmap.c | 65 +
mm/shmem.c | 29
mm/slab.c | 7
mm/slab.h | 6
mm/slab_common.c | 101 +-
mm/slub.c | 36 -
mm/sparse.c | 22
mm/swap.c | 29
mm/swapfile.c | 7
mm/userfaultfd.c | 77 +-
mm/util.c | 22
mm/vmalloc.c | 196 +++--
mm/vmscan.c | 798 +++++++++++------------
mm/workingset.c | 75 +-
mm/z3fold.c | 375 ++++++++--
scripts/spelling.txt | 28
tools/testing/selftests/memfd/memfd_test.c | 36 +
tools/testing/selftests/vm/config | 1
128 files changed, 3409 insertions(+), 2121 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2019-12-01 1:47 incoming Andrew Morton
@ 2019-12-01 5:17 ` James Bottomley
2019-12-01 21:07 ` incoming Linus Torvalds
1 sibling, 0 replies; 419+ messages in thread
From: James Bottomley @ 2019-12-01 5:17 UTC (permalink / raw)
To: Andrew Morton, Linus Torvalds; +Cc: mm-commits, linux-mm
On Sat, 2019-11-30 at 17:47 -0800, Andrew Morton wrote:
> - a small number of updates to scripts/, ocfs2 and fs/buffer.c
>
> - most of MM. I still have quite a lot of material (mostly not MM)
> staged after linux-next due to -next dependencies. I'll send thos
> across next week as the preprequisites get merged up.
>
> 158 patches, based on 32ef9553635ab1236c33951a8bd9b5af1c3b1646.
Hey, Andrew, would it be at all possible for you to thread these
patches under something like this incoming message? The selfish reason
I'm asking is so I can mark the thread as read instead of having to do
it individually for 158 messages ... my thumb would thank you for this.
Regards,
James
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2019-12-01 1:47 incoming Andrew Morton
2019-12-01 5:17 ` incoming James Bottomley
@ 2019-12-01 21:07 ` Linus Torvalds
2019-12-02 8:21 ` incoming Steven Price
1 sibling, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2019-12-01 21:07 UTC (permalink / raw)
To: Andrew Morton, Steven Price; +Cc: mm-commits, Linux-MM
On Sat, Nov 30, 2019 at 5:47 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> Steven Price <steven.price@arm.com>:
> Patch series "Generic page walk and ptdump", v15:
> mm: add generic p?d_leaf() macros
> arc: mm: add p?d_leaf() definitions
> arm: mm: add p?d_leaf() definitions
> arm64: mm: add p?d_leaf() definitions
> mips: mm: add p?d_leaf() definitions
> powerpc: mm: add p?d_leaf() definitions
> riscv: mm: add p?d_leaf() definitions
> s390: mm: add p?d_leaf() definitions
> sparc: mm: add p?d_leaf() definitions
> x86: mm: add p?d_leaf() definitions
> mm: pagewalk: add p4d_entry() and pgd_entry()
> mm: pagewalk: allow walking without vma
> mm: pagewalk: add test_p?d callbacks
> mm: pagewalk: add 'depth' parameter to pte_hole
> x86: mm: point to struct seq_file from struct pg_state
> x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct
> x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct
> x86: mm: convert ptdump_walk_pgd_level_core() to take an mm_struct
> mm: add generic ptdump
> x86: mm: convert dump_pagetables to use walk_page_range
> arm64: mm: convert mm/dump.c to use walk_page_range()
> arm64: mm: display non-present entries in ptdump
> mm: ptdump: reduce level numbers by 1 in note_page()
I've dropped these, and since they clearly weren't ready I don't want
to see them re-sent for 5.5.
If somebody figures out the bug, trying again for 5.6 sounds fine.
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2019-12-01 21:07 ` incoming Linus Torvalds
@ 2019-12-02 8:21 ` Steven Price
0 siblings, 0 replies; 419+ messages in thread
From: Steven Price @ 2019-12-02 8:21 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Andrew Morton, mm-commits@vger.kernel.org, Linux-MM
On Sun, Dec 01, 2019 at 09:07:47PM +0000, Linus Torvalds wrote:
> On Sat, Nov 30, 2019 at 5:47 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > Steven Price <steven.price@arm.com>:
> > Patch series "Generic page walk and ptdump", v15:
> > mm: add generic p?d_leaf() macros
> > arc: mm: add p?d_leaf() definitions
> > arm: mm: add p?d_leaf() definitions
> > arm64: mm: add p?d_leaf() definitions
> > mips: mm: add p?d_leaf() definitions
> > powerpc: mm: add p?d_leaf() definitions
> > riscv: mm: add p?d_leaf() definitions
> > s390: mm: add p?d_leaf() definitions
> > sparc: mm: add p?d_leaf() definitions
> > x86: mm: add p?d_leaf() definitions
> > mm: pagewalk: add p4d_entry() and pgd_entry()
> > mm: pagewalk: allow walking without vma
> > mm: pagewalk: add test_p?d callbacks
> > mm: pagewalk: add 'depth' parameter to pte_hole
> > x86: mm: point to struct seq_file from struct pg_state
> > x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct
> > x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct
> > x86: mm: convert ptdump_walk_pgd_level_core() to take an mm_struct
> > mm: add generic ptdump
> > x86: mm: convert dump_pagetables to use walk_page_range
> > arm64: mm: convert mm/dump.c to use walk_page_range()
> > arm64: mm: display non-present entries in ptdump
> > mm: ptdump: reduce level numbers by 1 in note_page()
>
> I've dropped these, and since they clearly weren't ready I don't want
> to see them re-sent for 5.5.
Sorry about this, I'll try to track down the cause of this and hopefully
resubmit for 5.6.
Thanks,
Steve
> If somebody figures out the bug, trying again for 5.6 sounds fine.
>
> Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2019-12-05 0:48 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2019-12-05 0:48 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
Most of the rest of MM and various other things. Some Kconfig rework
still awaits merges of dependent trees from linux-next.
86 patches, based on 63de37476ebd1e9bab6a9e17186dc5aa1da9ea99.
Subsystems affected by this patch series:
mm/hotfixes
mm/memcg
mm/vmstat
mm/thp
procfs
sysctl
misc
notifiers
core-kernel
bitops
lib
checkpatch
epoll
binfmt
init
rapidio
uaccess
kcov
ubsan
ipc
bitmap
mm/pagemap
Subsystem: mm/hotfixes
zhong jiang <zhongjiang@huawei.com>:
mm/kasan/common.c: fix compile error
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: wait for !root kmem_cache refcnt killing on root kmem_cache destruction
Subsystem: mm/vmstat
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
mm/vmstat: add helpers to get vmstat item names for each enum type
mm/memcontrol: use vmstat names for printing statistics
Subsystem: mm/thp
Yu Zhao <yuzhao@google.com>:
mm/memory.c: replace is_zero_pfn with is_huge_zero_pmd for thp
Subsystem: procfs
Alexey Dobriyan <adobriyan@gmail.com>:
proc: change ->nlink under proc_subdir_lock
fs/proc/generic.c: delete useless "len" variable
fs/proc/internal.h: shuffle "struct pde_opener"
Miaohe Lin <linmiaohe@huawei.com>:
include/linux/proc_fs.h: fix confusing macro arg name
Krzysztof Kozlowski <krzk@kernel.org>:
fs/proc/Kconfig: fix indentation
Subsystem: sysctl
Alessio Balsini <balsini@android.com>:
include/linux/sysctl.h: inline braces for ctl_table and ctl_table_header
Subsystem: misc
Stephen Boyd <swboyd@chromium.org>:
.gitattributes: use 'dts' diff driver for dts files
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
linux/build_bug.h: change type to int
Masahiro Yamada <yamada.masahiro@socionext.com>:
linux/scc.h: make uapi linux/scc.h self-contained
Krzysztof Kozlowski <krzk@kernel.org>:
arch/Kconfig: fix indentation
Joe Perches <joe@perches.com>:
scripts/get_maintainer.pl: add signatures from Fixes: <badcommit> lines in commit message
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: update comment about simple_strto<foo>() functions
auxdisplay: charlcd: deduplicate simple_strtoul()
Subsystem: notifiers
Xiaoming Ni <nixiaoming@huawei.com>:
kernel/notifier.c: intercept duplicate registrations to avoid infinite loops
kernel/notifier.c: remove notifier_chain_cond_register()
kernel/notifier.c: remove blocking_notifier_chain_cond_register()
Subsystem: core-kernel
Nathan Chancellor <natechancellor@gmail.com>:
kernel/profile.c: use cpumask_available to check for NULL cpumask
Joe Perches <joe@perches.com>:
kernel/sys.c: avoid copying possible padding bytes in copy_to_user
Subsystem: bitops
William Breathitt Gray <vilhelm.gray@gmail.com>:
bitops: introduce the for_each_set_clump8 macro
lib/test_bitmap.c: add for_each_set_clump8 test cases
gpio: 104-dio-48e: utilize for_each_set_clump8 macro
gpio: 104-idi-48: utilize for_each_set_clump8 macro
gpio: gpio-mm: utilize for_each_set_clump8 macro
gpio: ws16c48: utilize for_each_set_clump8 macro
gpio: pci-idio-16: utilize for_each_set_clump8 macro
gpio: pcie-idio-24: utilize for_each_set_clump8 macro
gpio: uniphier: utilize for_each_set_clump8 macro
gpio: 74x164: utilize the for_each_set_clump8 macro
thermal: intel: intel_soc_dts_iosf: Utilize for_each_set_clump8 macro
gpio: pisosr: utilize the for_each_set_clump8 macro
gpio: max3191x: utilize the for_each_set_clump8 macro
gpio: pca953x: utilize the for_each_set_clump8 macro
Subsystem: lib
Wei Yang <richardw.yang@linux.intel.com>:
lib/rbtree: set successor's parent unconditionally
lib/rbtree: get successor's color directly
Laura Abbott <labbott@redhat.com>:
lib/test_meminit.c: add bulk alloc/free tests
Trent Piepho <tpiepho@gmail.com>:
lib/math/rational.c: fix possible incorrect result from rational fractions helper
Huang Shijie <sjhuang@iluvatar.ai>:
lib/genalloc.c: export symbol addr_in_gen_pool
lib/genalloc.c: rename addr_in_gen_pool to gen_pool_has_addr
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: improve ignoring CamelCase SI style variants like mA
checkpatch: reduce is_maintained_obsolete lookup runtime
Subsystem: epoll
Jason Baron <jbaron@akamai.com>:
epoll: simplify ep_poll_safewake() for CONFIG_DEBUG_LOCK_ALLOC
Heiher <r@hev.cc>:
fs/epoll: remove unnecessary wakeups of nested epoll
selftests: add epoll selftests
Subsystem: binfmt
Alexey Dobriyan <adobriyan@gmail.com>:
fs/binfmt_elf.c: delete unused "interp_map_addr" argument
fs/binfmt_elf.c: extract elf_read() function
Subsystem: init
Krzysztof Kozlowski <krzk@kernel.org>:
init/Kconfig: fix indentation
Subsystem: rapidio
"Ben Dooks (Codethink)" <ben.dooks@codethink.co.uk>:
drivers/rapidio/rio-driver.c: fix missing include of <linux/rio_drv.h>
drivers/rapidio/rio-access.c: fix missing include of <linux/rio_drv.h>
Subsystem: uaccess
Daniel Vetter <daniel.vetter@ffwll.ch>:
drm: limit to INT_MAX in create_blob ioctl
Kees Cook <keescook@chromium.org>:
uaccess: disallow > INT_MAX copy sizes
Subsystem: kcov
Andrey Konovalov <andreyknvl@google.com>:
Patch series " kcov: collect coverage from usb and vhost", v3:
kcov: remote coverage support
usb, kcov: collect coverage from hub_event
vhost, kcov: collect coverage from vhost_worker
Subsystem: ubsan
Julien Grall <julien.grall@arm.com>:
lib/ubsan: don't serialize UBSAN report
Subsystem: ipc
Masahiro Yamada <yamada.masahiro@socionext.com>:
arch: ipcbuf.h: make uapi asm/ipcbuf.h self-contained
arch: msgbuf.h: make uapi asm/msgbuf.h self-contained
arch: sembuf.h: make uapi asm/sembuf.h self-contained
Subsystem: bitmap
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
Patch series "gpio: pca953x: Convert to bitmap (extended) API", v2:
lib/test_bitmap: force argument of bitmap_parselist_user() to proper address space
lib/test_bitmap: undefine macros after use
lib/test_bitmap: name EXP_BYTES properly
lib/test_bitmap: rename exp to exp1 to avoid ambiguous name
lib/test_bitmap: move exp1 and exp2 upper for others to use
lib/test_bitmap: fix comment about this file
lib/bitmap: introduce bitmap_replace() helper
gpio: pca953x: remove redundant variable and check in IRQ handler
gpio: pca953x: use input from regs structure in pca953x_irq_pending()
gpio: pca953x: convert to use bitmap API
gpio: pca953x: tighten up indentation
Subsystem: mm/pagemap
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: remove __ARCH_HAS_4LEVEL_HACK", v13:
alpha: use pgtable-nopud instead of 4level-fixup
arm: nommu: use pgtable-nopud instead of 4level-fixup
c6x: use pgtable-nopud instead of 4level-fixup
m68k: nommu: use pgtable-nopud instead of 4level-fixup
m68k: mm: use pgtable-nopXd instead of 4level-fixup
microblaze: use pgtable-nopmd instead of 4level-fixup
nds32: use pgtable-nopmd instead of 4level-fixup
parisc: use pgtable-nopXd instead of 4level-fixup
Helge Deller <deller@gmx.de>:
parisc/hugetlb: use pgtable-nopXd instead of 4level-fixup
Mike Rapoport <rppt@linux.ibm.com>:
sparc32: use pgtable-nopud instead of 4level-fixup
um: remove unused pxx_offset_proc() and addr_pte() functions
um: add support for folded p4d page tables
mm: remove __ARCH_HAS_4LEVEL_HACK and include/asm-generic/4level-fixup.h
.gitattributes | 2
Documentation/core-api/genalloc.rst | 2
Documentation/dev-tools/kcov.rst | 129
arch/Kconfig | 22
arch/alpha/include/asm/mmzone.h | 1
arch/alpha/include/asm/pgalloc.h | 4
arch/alpha/include/asm/pgtable.h | 24
arch/alpha/mm/init.c | 12
arch/arm/include/asm/pgtable.h | 2
arch/arm/mm/dma-mapping.c | 2
arch/c6x/include/asm/pgtable.h | 2
arch/m68k/include/asm/mcf_pgalloc.h | 7
arch/m68k/include/asm/mcf_pgtable.h | 28
arch/m68k/include/asm/mmu_context.h | 12
arch/m68k/include/asm/motorola_pgalloc.h | 4
arch/m68k/include/asm/motorola_pgtable.h | 32
arch/m68k/include/asm/page.h | 9
arch/m68k/include/asm/pgtable_mm.h | 11
arch/m68k/include/asm/pgtable_no.h | 2
arch/m68k/include/asm/sun3_pgalloc.h | 5
arch/m68k/include/asm/sun3_pgtable.h | 18
arch/m68k/kernel/sys_m68k.c | 10
arch/m68k/mm/init.c | 6
arch/m68k/mm/kmap.c | 39
arch/m68k/mm/mcfmmu.c | 16
arch/m68k/mm/motorola.c | 17
arch/m68k/sun3x/dvma.c | 7
arch/microblaze/include/asm/page.h | 3
arch/microblaze/include/asm/pgalloc.h | 16
arch/microblaze/include/asm/pgtable.h | 32
arch/microblaze/kernel/signal.c | 10
arch/microblaze/mm/init.c | 7
arch/microblaze/mm/pgtable.c | 13
arch/mips/include/uapi/asm/msgbuf.h | 1
arch/mips/include/uapi/asm/sembuf.h | 2
arch/nds32/include/asm/page.h | 3
arch/nds32/include/asm/pgalloc.h | 3
arch/nds32/include/asm/pgtable.h | 12
arch/nds32/include/asm/tlb.h | 1
arch/nds32/kernel/pm.c | 4
arch/nds32/mm/fault.c | 16
arch/nds32/mm/init.c | 11
arch/nds32/mm/mm-nds32.c | 6
arch/nds32/mm/proc.c | 26
arch/parisc/include/asm/page.h | 30
arch/parisc/include/asm/pgalloc.h | 41
arch/parisc/include/asm/pgtable.h | 52
arch/parisc/include/asm/tlb.h | 2
arch/parisc/include/uapi/asm/msgbuf.h | 1
arch/parisc/include/uapi/asm/sembuf.h | 1
arch/parisc/kernel/cache.c | 13
arch/parisc/kernel/pci-dma.c | 9
arch/parisc/mm/fixmap.c | 10
arch/parisc/mm/hugetlbpage.c | 18
arch/powerpc/include/uapi/asm/msgbuf.h | 2
arch/powerpc/include/uapi/asm/sembuf.h | 2
arch/s390/include/uapi/asm/ipcbuf.h | 2
arch/sparc/include/asm/pgalloc_32.h | 6
arch/sparc/include/asm/pgtable_32.h | 28
arch/sparc/include/uapi/asm/ipcbuf.h | 2
arch/sparc/include/uapi/asm/msgbuf.h | 2
arch/sparc/include/uapi/asm/sembuf.h | 2
arch/sparc/mm/fault_32.c | 11
arch/sparc/mm/highmem.c | 6
arch/sparc/mm/io-unit.c | 6
arch/sparc/mm/iommu.c | 6
arch/sparc/mm/srmmu.c | 51
arch/um/include/asm/pgtable-2level.h | 1
arch/um/include/asm/pgtable-3level.h | 1
arch/um/include/asm/pgtable.h | 3
arch/um/kernel/mem.c | 8
arch/um/kernel/skas/mmu.c | 12
arch/um/kernel/skas/uaccess.c | 7
arch/um/kernel/tlb.c | 85
arch/um/kernel/trap.c | 4
arch/x86/include/uapi/asm/msgbuf.h | 3
arch/x86/include/uapi/asm/sembuf.h | 2
arch/xtensa/include/uapi/asm/ipcbuf.h | 2
arch/xtensa/include/uapi/asm/msgbuf.h | 2
arch/xtensa/include/uapi/asm/sembuf.h | 1
drivers/auxdisplay/charlcd.c | 34
drivers/base/node.c | 9
drivers/gpio/gpio-104-dio-48e.c | 75
drivers/gpio/gpio-104-idi-48.c | 36
drivers/gpio/gpio-74x164.c | 19
drivers/gpio/gpio-gpio-mm.c | 75
drivers/gpio/gpio-max3191x.c | 19
drivers/gpio/gpio-pca953x.c | 209
drivers/gpio/gpio-pci-idio-16.c | 75
drivers/gpio/gpio-pcie-idio-24.c | 111
drivers/gpio/gpio-pisosr.c | 12
drivers/gpio/gpio-uniphier.c | 13
drivers/gpio/gpio-ws16c48.c | 73
drivers/gpu/drm/drm_property.c | 2
drivers/misc/sram-exec.c | 2
drivers/rapidio/rio-access.c | 2
drivers/rapidio/rio-driver.c | 1
drivers/thermal/intel/intel_soc_dts_iosf.c | 31
drivers/thermal/intel/intel_soc_dts_iosf.h | 2
drivers/usb/core/hub.c | 5
drivers/vhost/vhost.c | 6
drivers/vhost/vhost.h | 1
fs/binfmt_elf.c | 56
fs/eventpoll.c | 52
fs/proc/Kconfig | 8
fs/proc/generic.c | 37
fs/proc/internal.h | 2
include/asm-generic/4level-fixup.h | 39
include/asm-generic/bitops/find.h | 17
include/linux/bitmap.h | 51
include/linux/bitops.h | 12
include/linux/build_bug.h | 4
include/linux/genalloc.h | 2
include/linux/kcov.h | 23
include/linux/kernel.h | 19
include/linux/mm.h | 10
include/linux/notifier.h | 4
include/linux/proc_fs.h | 4
include/linux/rbtree_augmented.h | 6
include/linux/sched.h | 8
include/linux/sysctl.h | 6
include/linux/thread_info.h | 2
include/linux/vmstat.h | 54
include/uapi/asm-generic/ipcbuf.h | 2
include/uapi/asm-generic/msgbuf.h | 2
include/uapi/asm-generic/sembuf.h | 1
include/uapi/linux/kcov.h | 28
include/uapi/linux/scc.h | 1
init/Kconfig | 78
kernel/dma/remap.c | 2
kernel/kcov.c | 547 +
kernel/notifier.c | 45
kernel/profile.c | 6
kernel/sys.c | 4
lib/bitmap.c | 12
lib/find_bit.c | 14
lib/genalloc.c | 7
lib/math/rational.c | 63
lib/test_bitmap.c | 206
lib/test_meminit.c | 20
lib/ubsan.c | 64
mm/kasan/common.c | 1
mm/memcontrol.c | 52
mm/memory.c | 10
mm/slab_common.c | 12
mm/vmstat.c | 60
net/sunrpc/rpc_pipe.c | 2
scripts/checkpatch.pl | 13
scripts/get_maintainer.pl | 38
tools/testing/selftests/Makefile | 1
tools/testing/selftests/filesystems/epoll/.gitignore | 1
tools/testing/selftests/filesystems/epoll/Makefile | 7
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 3074 ++++++++++
usr/include/Makefile | 4
154 files changed, 5270 insertions(+), 1360 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2019-12-18 4:50 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2019-12-18 4:50 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
6 fixes based on 2187f215ebaac73ddbd814696d7c7fa34f0c3de0:
Andrey Ryabinin <aryabinin@virtuozzo.com>:
kasan: fix crashes on access to memory mapped by vm_map_ram()
Daniel Axtens <dja@axtens.net>:
mm/memory.c: add apply_to_existing_page_range() helper
kasan: use apply_to_existing_page_range() for releasing vmalloc shadow
kasan: don't assume percpu shadow allocations will succeed
Yang Shi <yang.shi@linux.alibaba.com>:
mm: vmscan: protect shrinker idr replace with CONFIG_MEMCG
Changbin Du <changbin.du@gmail.com>:
lib/Kconfig.debug: fix some messed up configurations
include/linux/kasan.h | 15 +++--
include/linux/mm.h | 3 +
lib/Kconfig.debug | 100 ++++++++++++++++++------------------
mm/kasan/common.c | 36 ++++++++-----
mm/memory.c | 136 ++++++++++++++++++++++++++++++++++----------------
mm/vmalloc.c | 133 ++++++++++++++++++++++++++++--------------------
mm/vmscan.c | 2
7 files changed, 260 insertions(+), 165 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-01-04 20:55 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-01-04 20:55 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
17 fixes, base on 5613970af3f5f8372c596b138bd64f3918513515:
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: shrink zones when offlining memory
Chanho Min <chanho.min@lge.com>:
mm/zsmalloc.c: fix the migrated zspage statistics.
Andrey Konovalov <andreyknvl@google.com>:
kcov: fix struct layout for kcov_remote_arg
Shakeel Butt <shakeelb@google.com>:
memcg: account security cred as well to kmemcg
Yang Shi <yang.shi@linux.alibaba.com>:
mm: move_pages: return valid node id in status if the page is already on the target node
Eric Biggers <ebiggers@google.com>:
fs/direct-io.c: include fs/internal.h for missing prototype
fs/nsfs.c: include headers for missing declarations
fs/namespace.c: make to_mnt_ns() static
Nick Desaulniers <ndesaulniers@google.com>:
hexagon: parenthesize registers in asm predicates
hexagon: work around compiler crash
Randy Dunlap <rdunlap@infradead.org>:
fs/posix_acl.c: fix kernel-doc warnings
Ilya Dryomov <idryomov@gmail.com>:
mm/oom: fix pgtables units mismatch in Killed process message
Navid Emamdoost <navid.emamdoost@gmail.com>:
mm/gup: fix memory leak in __gup_benchmark_ioctl
Waiman Long <longman@redhat.com>:
mm/hugetlb: defer freeing of huge pages if in non-task context
Kai Li <li.kai4@h3c.com>:
ocfs2: call journal flush to mark journal as empty after journal recovery when mount
Gang He <GHe@suse.com>:
ocfs2: fix the crash due to call ocfs2_get_dlm_debug once less
Nick Desaulniers <ndesaulniers@google.com>:
hexagon: define ioremap_uc
Documentation/dev-tools/kcov.rst | 10 +++----
arch/arm64/mm/mmu.c | 4 --
arch/hexagon/include/asm/atomic.h | 8 ++---
arch/hexagon/include/asm/bitops.h | 8 ++---
arch/hexagon/include/asm/cmpxchg.h | 2 -
arch/hexagon/include/asm/futex.h | 6 ++--
arch/hexagon/include/asm/io.h | 1
arch/hexagon/include/asm/spinlock.h | 20 +++++++-------
arch/hexagon/kernel/stacktrace.c | 4 --
arch/hexagon/kernel/vm_entry.S | 2 -
arch/ia64/mm/init.c | 4 --
arch/powerpc/mm/mem.c | 3 --
arch/s390/mm/init.c | 4 --
arch/sh/mm/init.c | 4 --
arch/x86/mm/init_32.c | 4 --
arch/x86/mm/init_64.c | 4 --
fs/direct-io.c | 2 +
fs/namespace.c | 2 -
fs/nsfs.c | 3 ++
fs/ocfs2/dlmglue.c | 1
fs/ocfs2/journal.c | 8 +++++
fs/posix_acl.c | 7 +++-
include/linux/memory_hotplug.h | 7 +++-
include/uapi/linux/kcov.h | 10 +++----
kernel/cred.c | 6 ++--
mm/gup_benchmark.c | 8 ++++-
mm/hugetlb.c | 51 +++++++++++++++++++++++++++++++++++-
mm/memory_hotplug.c | 31 +++++++++++----------
mm/memremap.c | 2 -
mm/migrate.c | 23 ++++++++++++----
mm/oom_kill.c | 2 -
mm/zsmalloc.c | 5 +++
32 files changed, 166 insertions(+), 90 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-01-14 0:28 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-01-14 0:28 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
11 MM fixes, based on b3a987b0264d3ddbb24293ebff10eddfc472f653:
Vlastimil Babka <vbabka@suse.cz>:
mm, thp: tweak reclaim/compaction effort of local-only and all-node allocations
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: don't free usage map when removing a re-added early section
"Kirill A. Shutemov" <kirill@shutemov.name>:
Patch series "Fix two above-47bit hint address vs. THP bugs":
mm/huge_memory.c: thp: fix conflict of above-47bit hint address and PMD alignment
mm/shmem.c: thp, shmem: fix conflict of above-47bit hint address and PMD alignment
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: fix percpu slab vmstats flushing
Vlastimil Babka <vbabka@suse.cz>:
mm, debug_pagealloc: don't rely on static keys too early
Wen Yang <wenyang@linux.alibaba.com>:
Patch series "use div64_ul() instead of div_u64() if the divisor is:
mm/page-writeback.c: avoid potential division by zero in wb_min_max_ratio()
mm/page-writeback.c: use div64_ul() for u64-by-unsigned-long divide
mm/page-writeback.c: improve arithmetic divisions
Adrian Huang <ahuang12@lenovo.com>:
mm: memcg/slab: call flush_memcg_workqueue() only if memcg workqueue is valid
Yang Shi <yang.shi@linux.alibaba.com>:
mm: khugepaged: add trace status description for SCAN_PAGE_HAS_PRIVATE
include/linux/mm.h | 18 +++++++++-
include/linux/mmzone.h | 5 +--
include/trace/events/huge_memory.h | 3 +
init/main.c | 1
mm/huge_memory.c | 38 ++++++++++++++---------
mm/memcontrol.c | 37 +++++-----------------
mm/mempolicy.c | 10 ++++--
mm/page-writeback.c | 10 +++---
mm/page_alloc.c | 61 ++++++++++---------------------------
mm/shmem.c | 7 ++--
mm/slab.c | 4 +-
mm/slab_common.c | 3 +
mm/slub.c | 2 -
mm/sparse.c | 9 ++++-
mm/vmalloc.c | 4 +-
15 files changed, 102 insertions(+), 110 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-01-31 6:10 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-01-31 6:10 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
Most of -mm and quite a number of other subsystems.
MM is fairly quiet this time. Holidays, I assume.
119 patches, based on 39bed42de2e7d74686a2d5a45638d6a5d7e7d473:
Subsystems affected by this patch series:
hotfixes
scripts
ocfs2
mm/slub
mm/kmemleak
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/tracing
mm/kasan
mm/initialization
mm/pagealloc
mm/vmscan
mm/tools
mm/memblock
mm/oom-kill
mm/hugetlb
mm/migration
mm/mmap
mm/memory-hotplug
mm/zswap
mm/cleanups
mm/zram
misc
lib
binfmt
init
reiserfs
exec
dma-mapping
kcov
Subsystem: hotfixes
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
lib/test_bitmap: correct test data offsets for 32-bit
"Theodore Ts'o" <tytso@mit.edu>:
memcg: fix a crash in wb_workfn when a device disappears
Dan Carpenter <dan.carpenter@oracle.com>:
mm/mempolicy.c: fix out of bounds write in mpol_parse_str()
Pingfan Liu <kernelfans@gmail.com>:
mm/sparse.c: reset section's mem_map when fully deactivated
Wei Yang <richardw.yang@linux.intel.com>:
mm/migrate.c: also overwrite error when it is bigger than zero
Dan Williams <dan.j.williams@intel.com>:
mm/memory_hotplug: fix remove_memory() lockdep splat
Wei Yang <richardw.yang@linux.intel.com>:
mm: thp: don't need care deferred split queue in memcg charge move path
Yang Shi <yang.shi@linux.alibaba.com>:
mm: move_pages: report the number of non-attempted pages
Subsystem: scripts
Xiong <xndchn@gmail.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Luca Ceresoli <luca@lucaceresoli.net>:
scripts/spelling.txt: add "issus" typo
Subsystem: ocfs2
Aditya Pakki <pakki001@umn.edu>:
fs: ocfs: remove unnecessary assertion in dlm_migrate_lockres
zhengbin <zhengbin13@huawei.com>:
ocfs2: remove unneeded semicolons
Masahiro Yamada <masahiroy@kernel.org>:
ocfs2: make local header paths relative to C files
Colin Ian King <colin.king@canonical.com>:
ocfs2/dlm: remove redundant assignment to ret
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
ocfs2/dlm: move BITS_TO_BYTES() to bitops.h for wider use
wangyan <wangyan122@huawei.com>:
ocfs2: fix a NULL pointer dereference when call ocfs2_update_inode_fsync_trans()
ocfs2: use ocfs2_update_inode_fsync_trans() to access t_tid in handle->h_transaction
Subsystem: mm/slub
Yu Zhao <yuzhao@google.com>:
mm/slub.c: avoid slub allocation while holding list_lock
Subsystem: mm/kmemleak
He Zhe <zhe.he@windriver.com>:
mm/kmemleak: turn kmemleak_lock and object->lock to raw_spinlock_t
Subsystem: mm/debug
Vlastimil Babka <vbabka@suse.cz>:
mm/debug.c: always print flags in dump_page()
Subsystem: mm/pagecache
Ira Weiny <ira.weiny@intel.com>:
mm/filemap.c: clean up filemap_write_and_wait()
Subsystem: mm/gup
Qiujun Huang <hqjagain@gmail.com>:
mm: fix gup_pud_range
Wei Yang <richardw.yang@linux.intel.com>:
mm/gup.c: use is_vm_hugetlb_page() to check whether to follow huge
John Hubbard <jhubbard@nvidia.com>:
Patch series "mm/gup: prereqs to track dma-pinned pages: FOLL_PIN", v12:
mm/gup: factor out duplicate code from four routines
mm/gup: move try_get_compound_head() to top, fix minor issues
Dan Williams <dan.j.williams@intel.com>:
mm: Cleanup __put_devmap_managed_page() vs ->page_free()
John Hubbard <jhubbard@nvidia.com>:
mm: devmap: refactor 1-based refcounting for ZONE_DEVICE pages
goldish_pipe: rename local pin_user_pages() routine
mm: fix get_user_pages_remote()'s handling of FOLL_LONGTERM
vfio: fix FOLL_LONGTERM use, simplify get_user_pages_remote() call
mm/gup: allow FOLL_FORCE for get_user_pages_fast()
IB/umem: use get_user_pages_fast() to pin DMA pages
media/v4l2-core: set pages dirty upon releasing DMA buffers
mm/gup: introduce pin_user_pages*() and FOLL_PIN
goldish_pipe: convert to pin_user_pages() and put_user_page()
IB/{core,hw,umem}: set FOLL_PIN via pin_user_pages*(), fix up ODP
mm/process_vm_access: set FOLL_PIN via pin_user_pages_remote()
drm/via: set FOLL_PIN via pin_user_pages_fast()
fs/io_uring: set FOLL_PIN via pin_user_pages()
net/xdp: set FOLL_PIN via pin_user_pages()
media/v4l2-core: pin_user_pages (FOLL_PIN) and put_user_page() conversion
vfio, mm: pin_user_pages (FOLL_PIN) and put_user_page() conversion
powerpc: book3s64: convert to pin_user_pages() and put_user_page()
mm/gup_benchmark: use proper FOLL_WRITE flags instead of hard-coding "1"
mm, tree-wide: rename put_user_page*() to unpin_user_page*()
Subsystem: mm/swap
Vasily Averin <vvs@virtuozzo.com>:
mm/swapfile.c: swap_next should increase position index
Subsystem: mm/memcg
Kaitao Cheng <pilgrimtao@gmail.com>:
mm/memcontrol.c: cleanup some useless code
Subsystem: mm/pagemap
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/page_vma_mapped.c: explicitly compare pfn for normal, hugetlbfs and THP page
Subsystem: mm/tracing
Junyong Sun <sunjy516@gmail.com>:
mm, tracing: print symbol name for kmem_alloc_node call_site events
Subsystem: mm/kasan
"Gustavo A. R. Silva" <gustavo@embeddedor.com>:
lib/test_kasan.c: fix memory leak in kmalloc_oob_krealloc_more()
Subsystem: mm/initialization
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
mm/early_ioremap.c: use %pa to print resource_size_t variables
Subsystem: mm/pagealloc
"Kirill A. Shutemov" <kirill@shutemov.name>:
mm/page_alloc: skip non present sections on zone initialization
David Hildenbrand <david@redhat.com>:
mm: remove the memory isolate notifier
mm: remove "count" parameter from has_unmovable_pages()
Subsystem: mm/vmscan
Liu Song <liu.song11@zte.com.cn>:
mm/vmscan.c: remove unused return value of shrink_node
Alex Shi <alex.shi@linux.alibaba.com>:
mm/vmscan: remove prefetch_prev_lru_page
mm/vmscan: remove unused RECLAIM_OFF/RECLAIM_ZONE
Subsystem: mm/tools
Daniel Wagner <dwagner@suse.de>:
tools/vm/slabinfo: fix sanity checks enabling
Subsystem: mm/memblock
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/memblock: define memblock_physmem_add()
memblock: Use __func__ in remaining memblock_dbg() call sites
Subsystem: mm/oom-kill
David Rientjes <rientjes@google.com>:
mm, oom: dump stack of victim when reaping failed
Subsystem: mm/hugetlb
Wei Yang <richardw.yang@linux.intel.com>:
mm/huge_memory.c: use head to check huge zero page
mm/huge_memory.c: use head to emphasize the purpose of page
mm/huge_memory.c: reduce critical section protected by split_queue_lock
Subsystem: mm/migration
Ralph Campbell <rcampbell@nvidia.com>:
mm/migrate: remove useless mask of start address
mm/migrate: clean up some minor coding style
mm/migrate: add stable check in migrate_vma_insert_page()
David Rientjes <rientjes@google.com>:
mm, thp: fix defrag setting if newline is not used
Subsystem: mm/mmap
Miaohe Lin <linmiaohe@huawei.com>:
mm/mmap.c: get rid of odd jump labels in find_mergeable_anon_vma()
Subsystem: mm/memory-hotplug
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: pass in nid to online_pages()":
mm/memory_hotplug: pass in nid to online_pages()
Qian Cai <cai@lca.pw>:
mm/hotplug: silence a lockdep splat with printk()
mm/page_isolation: fix potential warning from user
Subsystem: mm/zswap
Vitaly Wool <vitaly.wool@konsulko.com>:
mm/zswap.c: add allocation hysteresis if pool limit is hit
Dan Carpenter <dan.carpenter@oracle.com>:
zswap: potential NULL dereference on error in init_zswap()
Subsystem: mm/cleanups
Yu Zhao <yuzhao@google.com>:
include/linux/mm.h: clean up obsolete check on space in page->flags
Wei Yang <richardw.yang@linux.intel.com>:
include/linux/mm.h: remove dead code totalram_pages_set()
Anshuman Khandual <anshuman.khandual@arm.com>:
include/linux/memory.h: drop fields 'hw' and 'phys_callback' from struct memory_block
Hao Lee <haolee.swjtu@gmail.com>:
mm: fix comments related to node reclaim
Subsystem: mm/zram
Taejoon Song <taejoon.song@lge.com>:
zram: try to avoid worst-case scenario on same element pages
Colin Ian King <colin.king@canonical.com>:
drivers/block/zram/zram_drv.c: fix error return codes not being returned in writeback_store
Subsystem: misc
Akinobu Mita <akinobu.mita@gmail.com>:
Patch series "add header file for kelvin to/from Celsius conversion:
include/linux/units.h: add helpers for kelvin to/from Celsius conversion
ACPI: thermal: switch to use <linux/units.h> helpers
platform/x86: asus-wmi: switch to use <linux/units.h> helpers
platform/x86: intel_menlow: switch to use <linux/units.h> helpers
thermal: int340x: switch to use <linux/units.h> helpers
thermal: intel_pch: switch to use <linux/units.h> helpers
nvme: hwmon: switch to use <linux/units.h> helpers
thermal: remove kelvin to/from Celsius conversion helpers from <linux/thermal.h>
iwlegacy: use <linux/units.h> helpers
iwlwifi: use <linux/units.h> helpers
thermal: armada: remove unused TO_MCELSIUS macro
iio: adc: qcom-vadc-common: use <linux/units.h> helpers
Subsystem: lib
Mikhail Zaslonko <zaslonko@linux.ibm.com>:
Patch series "S390 hardware support for kernel zlib", v3:
lib/zlib: add s390 hardware support for kernel zlib_deflate
s390/boot: rename HEAP_SIZE due to name collision
lib/zlib: add s390 hardware support for kernel zlib_inflate
s390/boot: add dfltcc= kernel command line parameter
lib/zlib: add zlib_deflate_dfltcc_enabled() function
btrfs: use larger zlib buffer for s390 hardware compression
Nathan Chancellor <natechancellor@gmail.com>:
lib/scatterlist.c: adjust indentation in __sg_alloc_table
Yury Norov <yury.norov@gmail.com>:
uapi: rename ext2_swab() to swab() and share globally in swab.h
lib/find_bit.c: join _find_next_bit{_le}
lib/find_bit.c: uninline helper _find_next_bit()
Subsystem: binfmt
Alexey Dobriyan <adobriyan@gmail.com>:
fs/binfmt_elf.c: smaller code generation around auxv vector fill
fs/binfmt_elf.c: fix ->start_code calculation
fs/binfmt_elf.c: don't copy ELF header around
fs/binfmt_elf.c: better codegen around current->mm
fs/binfmt_elf.c: make BAD_ADDR() unlikely
fs/binfmt_elf.c: coredump: allocate core ELF header on stack
fs/binfmt_elf.c: coredump: delete duplicated overflow check
fs/binfmt_elf.c: coredump: allow process with empty address space to coredump
Subsystem: init
Arvind Sankar <nivedita@alum.mit.edu>:
init/main.c: log arguments and environment passed to init
init/main.c: remove unnecessary repair_env_string in do_initcall_level
Patch series "init/main.c: minor cleanup/bugfix of envvar handling", v2:
init/main.c: fix quoted value handling in unknown_bootoption
Christophe Leroy <christophe.leroy@c-s.fr>:
init/main.c: fix misleading "This architecture does not have kernel memory protection" message
Subsystem: reiserfs
Yunfeng Ye <yeyunfeng@huawei.com>:
reiserfs: prevent NULL pointer dereference in reiserfs_insert_item()
Subsystem: exec
Alexey Dobriyan <adobriyan@gmail.com>:
execve: warn if process starts with executable stack
Subsystem: dma-mapping
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
include/linux/io-mapping.h-mapping: use PHYS_PFN() macro in io_mapping_map_atomic_wc()
Subsystem: kcov
Dmitry Vyukov <dvyukov@google.com>:
kcov: ignore fault-inject and stacktrace
Documentation/admin-guide/kernel-parameters.txt | 12
Documentation/core-api/index.rst | 1
Documentation/core-api/pin_user_pages.rst | 234 +++++
Documentation/vm/zswap.rst | 13
arch/powerpc/mm/book3s64/iommu_api.c | 14
arch/s390/boot/compressed/decompressor.c | 8
arch/s390/boot/ipl_parm.c | 14
arch/s390/include/asm/setup.h | 7
arch/s390/kernel/setup.c | 14
drivers/acpi/thermal.c | 34
drivers/base/memory.c | 25
drivers/block/zram/zram_drv.c | 10
drivers/gpu/drm/via/via_dmablit.c | 6
drivers/iio/adc/qcom-vadc-common.c | 6
drivers/iio/adc/qcom-vadc-common.h | 1
drivers/infiniband/core/umem.c | 21
drivers/infiniband/core/umem_odp.c | 13
drivers/infiniband/hw/hfi1/user_pages.c | 4
drivers/infiniband/hw/mthca/mthca_memfree.c | 8
drivers/infiniband/hw/qib/qib_user_pages.c | 4
drivers/infiniband/hw/qib/qib_user_sdma.c | 8
drivers/infiniband/hw/usnic/usnic_uiom.c | 4
drivers/infiniband/sw/siw/siw_mem.c | 4
drivers/media/v4l2-core/videobuf-dma-sg.c | 20
drivers/net/ethernet/broadcom/bnx2x/bnx2x_init.h | 1
drivers/net/wireless/intel/iwlegacy/4965-mac.c | 3
drivers/net/wireless/intel/iwlegacy/4965.c | 17
drivers/net/wireless/intel/iwlegacy/common.h | 3
drivers/net/wireless/intel/iwlwifi/dvm/dev.h | 5
drivers/net/wireless/intel/iwlwifi/dvm/devices.c | 6
drivers/nvdimm/pmem.c | 6
drivers/nvme/host/hwmon.c | 13
drivers/platform/goldfish/goldfish_pipe.c | 39
drivers/platform/x86/asus-wmi.c | 7
drivers/platform/x86/intel_menlow.c | 9
drivers/thermal/armada_thermal.c | 2
drivers/thermal/intel/int340x_thermal/int340x_thermal_zone.c | 7
drivers/thermal/intel/intel_pch_thermal.c | 3
drivers/vfio/vfio_iommu_type1.c | 39
fs/binfmt_elf.c | 154 +--
fs/btrfs/compression.c | 2
fs/btrfs/zlib.c | 135 ++
fs/exec.c | 5
fs/fs-writeback.c | 2
fs/io_uring.c | 6
fs/ocfs2/cluster/quorum.c | 2
fs/ocfs2/dlm/Makefile | 2
fs/ocfs2/dlm/dlmast.c | 8
fs/ocfs2/dlm/dlmcommon.h | 4
fs/ocfs2/dlm/dlmconvert.c | 8
fs/ocfs2/dlm/dlmdebug.c | 8
fs/ocfs2/dlm/dlmdomain.c | 8
fs/ocfs2/dlm/dlmlock.c | 8
fs/ocfs2/dlm/dlmmaster.c | 10
fs/ocfs2/dlm/dlmrecovery.c | 10
fs/ocfs2/dlm/dlmthread.c | 8
fs/ocfs2/dlm/dlmunlock.c | 8
fs/ocfs2/dlmfs/Makefile | 2
fs/ocfs2/dlmfs/dlmfs.c | 4
fs/ocfs2/dlmfs/userdlm.c | 6
fs/ocfs2/dlmglue.c | 2
fs/ocfs2/journal.h | 8
fs/ocfs2/namei.c | 3
fs/reiserfs/stree.c | 3
include/linux/backing-dev.h | 10
include/linux/bitops.h | 1
include/linux/fs.h | 6
include/linux/io-mapping.h | 5
include/linux/memblock.h | 7
include/linux/memory.h | 29
include/linux/memory_hotplug.h | 3
include/linux/mm.h | 116 +-
include/linux/mmzone.h | 2
include/linux/page-isolation.h | 8
include/linux/swab.h | 1
include/linux/thermal.h | 11
include/linux/units.h | 84 +
include/linux/zlib.h | 6
include/trace/events/kmem.h | 4
include/trace/events/writeback.h | 37
include/uapi/linux/swab.h | 10
include/uapi/linux/sysctl.h | 2
init/main.c | 36
kernel/Makefile | 1
lib/Kconfig | 7
lib/Makefile | 2
lib/decompress_inflate.c | 13
lib/find_bit.c | 82 -
lib/scatterlist.c | 2
lib/test_bitmap.c | 9
lib/test_kasan.c | 1
lib/zlib_deflate/deflate.c | 85 +
lib/zlib_deflate/deflate_syms.c | 1
lib/zlib_deflate/deftree.c | 54 -
lib/zlib_deflate/defutil.h | 134 ++
lib/zlib_dfltcc/Makefile | 13
lib/zlib_dfltcc/dfltcc.c | 57 +
lib/zlib_dfltcc/dfltcc.h | 155 +++
lib/zlib_dfltcc/dfltcc_deflate.c | 280 ++++++
lib/zlib_dfltcc/dfltcc_inflate.c | 149 +++
lib/zlib_dfltcc/dfltcc_syms.c | 17
lib/zlib_dfltcc/dfltcc_util.h | 123 ++
lib/zlib_inflate/inflate.c | 32
lib/zlib_inflate/inflate.h | 8
lib/zlib_inflate/infutil.h | 18
mm/Makefile | 1
mm/backing-dev.c | 1
mm/debug.c | 18
mm/early_ioremap.c | 8
mm/filemap.c | 34
mm/gup.c | 503 ++++++-----
mm/gup_benchmark.c | 9
mm/huge_memory.c | 44
mm/kmemleak.c | 112 +-
mm/memblock.c | 22
mm/memcontrol.c | 25
mm/memory_hotplug.c | 24
mm/mempolicy.c | 6
mm/memremap.c | 95 --
mm/migrate.c | 77 +
mm/mmap.c | 30
mm/oom_kill.c | 2
mm/page_alloc.c | 83 +
mm/page_isolation.c | 69 -
mm/page_vma_mapped.c | 12
mm/process_vm_access.c | 32
mm/slub.c | 88 +
mm/sparse.c | 2
mm/swap.c | 27
mm/swapfile.c | 2
mm/vmscan.c | 24
mm/zswap.c | 88 +
net/xdp/xdp_umem.c | 4
scripts/spelling.txt | 14
tools/testing/selftests/vm/gup_benchmark.c | 6
tools/vm/slabinfo.c | 4
136 files changed, 2790 insertions(+), 1358 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-02-04 1:33 Andrew Morton
2020-02-04 2:27 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-02-04 1:33 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
The rest of MM and the rest of everything else.
Subsystems affected by this patch series:
hotfixes
mm/pagealloc
mm/memory-hotplug
ipc
misc
mm/cleanups
mm/pagemap
procfs
lib
cleanups
arm
Subsystem: hotfixes
Gang He <GHe@suse.com>:
ocfs2: fix oops when writing cloned file
David Hildenbrand <david@redhat.com>:
Patch series "mm: fix max_pfn not falling on section boundary", v2:
mm/page_alloc.c: fix uninitialized memmaps on a partially populated last section
fs/proc/page.c: allow inspection of last section and fix end detection
mm/page_alloc.c: initialize memmap of unavailable memory directly
Subsystem: mm/pagealloc
David Hildenbrand <david@redhat.com>:
mm/page_alloc: fix and rework pfn handling in memmap_init_zone()
mm: factor out next_present_section_nr()
Subsystem: mm/memory-hotplug
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "mm/memory_hotplug: Shrink zones before removing memory", v6:
mm/memmap_init: update variable name in memmap_init_zone
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: poison memmap in remove_pfn_range_from_zone()
mm/memory_hotplug: we always have a zone in find_(smallest|biggest)_section_pfn
mm/memory_hotplug: don't check for "all holes" in shrink_zone_span()
mm/memory_hotplug: drop local variables in shrink_zone_span()
mm/memory_hotplug: cleanup __remove_pages()
mm/memory_hotplug: drop valid_start/valid_end from test_pages_in_a_zone()
Subsystem: ipc
Manfred Spraul <manfred@colorfullife.com>:
smp_mb__{before,after}_atomic(): update Documentation
Davidlohr Bueso <dave@stgolabs.net>:
ipc/mqueue.c: remove duplicated code
Manfred Spraul <manfred@colorfullife.com>:
ipc/mqueue.c: update/document memory barriers
ipc/msg.c: update and document memory barriers
ipc/sem.c: document and update memory barriers
Lu Shuaibing <shuaibinglu@126.com>:
ipc/msg.c: consolidate all xxxctl_down() functions
drivers/block/null_blk_main.c: fix layout
Subsystem: misc
Andrew Morton <akpm@linux-foundation.org>:
drivers/block/null_blk_main.c: fix layout
drivers/block/null_blk_main.c: fix uninitialized var warnings
Randy Dunlap <rdunlap@infradead.org>:
pinctrl: fix pxa2xx.c build warnings
Subsystem: mm/cleanups
Florian Westphal <fw@strlen.de>:
mm: remove __krealloc
Subsystem: mm/pagemap
Steven Price <steven.price@arm.com>:
Patch series "Generic page walk and ptdump", v17:
mm: add generic p?d_leaf() macros
arc: mm: add p?d_leaf() definitions
arm: mm: add p?d_leaf() definitions
arm64: mm: add p?d_leaf() definitions
mips: mm: add p?d_leaf() definitions
powerpc: mm: add p?d_leaf() definitions
riscv: mm: add p?d_leaf() definitions
s390: mm: add p?d_leaf() definitions
sparc: mm: add p?d_leaf() definitions
x86: mm: add p?d_leaf() definitions
mm: pagewalk: add p4d_entry() and pgd_entry()
mm: pagewalk: allow walking without vma
mm: pagewalk: don't lock PTEs for walk_page_range_novma()
mm: pagewalk: fix termination condition in walk_pte_range()
mm: pagewalk: add 'depth' parameter to pte_hole
x86: mm: point to struct seq_file from struct pg_state
x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct
x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct
mm: add generic ptdump
x86: mm: convert dump_pagetables to use walk_page_range
arm64: mm: convert mm/dump.c to use walk_page_range()
arm64: mm: display non-present entries in ptdump
mm: ptdump: reduce level numbers by 1 in note_page()
x86: mm: avoid allocating struct mm_struct on the stack
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "Fixup page directory freeing", v4:
powerpc/mmu_gather: enable RCU_TABLE_FREE even for !SMP case
Peter Zijlstra <peterz@infradead.org>:
mm/mmu_gather: invalidate TLB correctly on batch allocation failure and flush
asm-generic/tlb: avoid potential double flush
asm-gemeric/tlb: remove stray function declarations
asm-generic/tlb: add missing CONFIG symbol
asm-generic/tlb: rename HAVE_RCU_TABLE_FREE
asm-generic/tlb: rename HAVE_MMU_GATHER_PAGE_SIZE
asm-generic/tlb: rename HAVE_MMU_GATHER_NO_GATHER
asm-generic/tlb: provide MMU_GATHER_TABLE_FREE
Subsystem: procfs
Alexey Dobriyan <adobriyan@gmail.com>:
proc: decouple proc from VFS with "struct proc_ops"
proc: convert everything to "struct proc_ops"
Subsystem: lib
Yury Norov <yury.norov@gmail.com>:
Patch series "lib: rework bitmap_parse", v5:
lib/string: add strnchrnul()
bitops: more BITS_TO_* macros
lib: add test for bitmap_parse()
lib: make bitmap_parse_user a wrapper on bitmap_parse
lib: rework bitmap_parse()
lib: new testcases for bitmap_parse{_user}
include/linux/cpumask.h: don't calculate length of the input string
Subsystem: cleanups
Masahiro Yamada <masahiroy@kernel.org>:
treewide: remove redundant IS_ERR() before error code check
Subsystem: arm
Chen-Yu Tsai <wens@csie.org>:
ARM: dma-api: fix max_pfn off-by-one error in __dma_supported()
Documentation/memory-barriers.txt | 14
arch/Kconfig | 17
arch/alpha/kernel/srm_env.c | 17
arch/arc/include/asm/pgtable.h | 1
arch/arm/Kconfig | 2
arch/arm/include/asm/pgtable-2level.h | 1
arch/arm/include/asm/pgtable-3level.h | 1
arch/arm/include/asm/tlb.h | 6
arch/arm/kernel/atags_proc.c | 8
arch/arm/mm/alignment.c | 14
arch/arm/mm/dma-mapping.c | 2
arch/arm64/Kconfig | 3
arch/arm64/Kconfig.debug | 19
arch/arm64/include/asm/pgtable.h | 2
arch/arm64/include/asm/ptdump.h | 8
arch/arm64/mm/Makefile | 4
arch/arm64/mm/dump.c | 152 ++----
arch/arm64/mm/mmu.c | 4
arch/arm64/mm/ptdump_debugfs.c | 2
arch/ia64/kernel/salinfo.c | 24 -
arch/m68k/kernel/bootinfo_proc.c | 8
arch/mips/include/asm/pgtable.h | 5
arch/mips/lasat/picvue_proc.c | 31 -
arch/powerpc/Kconfig | 7
arch/powerpc/include/asm/book3s/32/pgalloc.h | 8
arch/powerpc/include/asm/book3s/64/pgalloc.h | 2
arch/powerpc/include/asm/book3s/64/pgtable.h | 3
arch/powerpc/include/asm/nohash/pgalloc.h | 8
arch/powerpc/include/asm/tlb.h | 11
arch/powerpc/kernel/proc_powerpc.c | 10
arch/powerpc/kernel/rtas-proc.c | 70 +--
arch/powerpc/kernel/rtas_flash.c | 34 -
arch/powerpc/kernel/rtasd.c | 14
arch/powerpc/mm/book3s64/pgtable.c | 7
arch/powerpc/mm/numa.c | 12
arch/powerpc/platforms/pseries/lpar.c | 24 -
arch/powerpc/platforms/pseries/lparcfg.c | 14
arch/powerpc/platforms/pseries/reconfig.c | 8
arch/powerpc/platforms/pseries/scanlog.c | 15
arch/riscv/include/asm/pgtable-64.h | 7
arch/riscv/include/asm/pgtable.h | 7
arch/s390/Kconfig | 4
arch/s390/include/asm/pgtable.h | 2
arch/sh/mm/alignment.c | 17
arch/sparc/Kconfig | 3
arch/sparc/include/asm/pgtable_64.h | 2
arch/sparc/include/asm/tlb_64.h | 11
arch/sparc/kernel/led.c | 15
arch/um/drivers/mconsole_kern.c | 9
arch/um/kernel/exitcode.c | 15
arch/um/kernel/process.c | 15
arch/x86/Kconfig | 3
arch/x86/Kconfig.debug | 20
arch/x86/include/asm/pgtable.h | 10
arch/x86/include/asm/tlb.h | 4
arch/x86/kernel/cpu/mtrr/if.c | 21
arch/x86/mm/Makefile | 4
arch/x86/mm/debug_pagetables.c | 18
arch/x86/mm/dump_pagetables.c | 418 +++++-------------
arch/x86/platform/efi/efi_32.c | 2
arch/x86/platform/efi/efi_64.c | 4
arch/x86/platform/uv/tlb_uv.c | 14
arch/xtensa/platforms/iss/simdisk.c | 10
crypto/af_alg.c | 2
drivers/acpi/battery.c | 15
drivers/acpi/proc.c | 15
drivers/acpi/scan.c | 2
drivers/base/memory.c | 9
drivers/block/null_blk_main.c | 58 +-
drivers/char/hw_random/bcm2835-rng.c | 2
drivers/char/hw_random/omap-rng.c | 4
drivers/clk/clk.c | 2
drivers/dma/mv_xor_v2.c | 2
drivers/firmware/efi/arm-runtime.c | 2
drivers/gpio/gpiolib-devres.c | 2
drivers/gpio/gpiolib-of.c | 8
drivers/gpio/gpiolib.c | 2
drivers/hwmon/dell-smm-hwmon.c | 15
drivers/i2c/busses/i2c-mv64xxx.c | 5
drivers/i2c/busses/i2c-synquacer.c | 2
drivers/ide/ide-proc.c | 19
drivers/input/input.c | 28 -
drivers/isdn/capi/kcapi_proc.c | 6
drivers/macintosh/via-pmu.c | 17
drivers/md/md.c | 15
drivers/misc/sgi-gru/gruprocfs.c | 42 -
drivers/mtd/ubi/build.c | 2
drivers/net/wireless/cisco/airo.c | 126 ++---
drivers/net/wireless/intel/ipw2x00/libipw_module.c | 15
drivers/net/wireless/intersil/hostap/hostap_hw.c | 4
drivers/net/wireless/intersil/hostap/hostap_proc.c | 14
drivers/net/wireless/intersil/hostap/hostap_wlan.h | 2
drivers/net/wireless/ray_cs.c | 20
drivers/of/device.c | 2
drivers/parisc/led.c | 17
drivers/pci/controller/pci-tegra.c | 2
drivers/pci/proc.c | 25 -
drivers/phy/phy-core.c | 4
drivers/pinctrl/pxa/pinctrl-pxa2xx.c | 1
drivers/platform/x86/thinkpad_acpi.c | 15
drivers/platform/x86/toshiba_acpi.c | 60 +-
drivers/pnp/isapnp/proc.c | 9
drivers/pnp/pnpbios/proc.c | 17
drivers/s390/block/dasd_proc.c | 15
drivers/s390/cio/blacklist.c | 14
drivers/s390/cio/css.c | 11
drivers/scsi/esas2r/esas2r_main.c | 9
drivers/scsi/scsi_devinfo.c | 15
drivers/scsi/scsi_proc.c | 29 -
drivers/scsi/sg.c | 30 -
drivers/spi/spi-orion.c | 3
drivers/staging/rtl8192u/ieee80211/ieee80211_module.c | 14
drivers/tty/sysrq.c | 8
drivers/usb/gadget/function/rndis.c | 17
drivers/video/fbdev/imxfb.c | 2
drivers/video/fbdev/via/viafbdev.c | 105 ++--
drivers/zorro/proc.c | 9
fs/cifs/cifs_debug.c | 108 ++--
fs/cifs/dfs_cache.c | 13
fs/cifs/dfs_cache.h | 2
fs/ext4/super.c | 2
fs/f2fs/node.c | 2
fs/fscache/internal.h | 2
fs/fscache/object-list.c | 11
fs/fscache/proc.c | 2
fs/jbd2/journal.c | 13
fs/jfs/jfs_debug.c | 14
fs/lockd/procfs.c | 12
fs/nfsd/nfsctl.c | 13
fs/nfsd/stats.c | 12
fs/ocfs2/file.c | 14
fs/ocfs2/suballoc.c | 2
fs/proc/cpuinfo.c | 12
fs/proc/generic.c | 38 -
fs/proc/inode.c | 76 +--
fs/proc/internal.h | 5
fs/proc/kcore.c | 13
fs/proc/kmsg.c | 14
fs/proc/page.c | 54 +-
fs/proc/proc_net.c | 32 -
fs/proc/proc_sysctl.c | 2
fs/proc/root.c | 2
fs/proc/stat.c | 12
fs/proc/task_mmu.c | 4
fs/proc/vmcore.c | 10
fs/sysfs/group.c | 2
include/asm-generic/pgtable.h | 20
include/asm-generic/tlb.h | 138 +++--
include/linux/bitmap.h | 8
include/linux/bitops.h | 4
include/linux/cpumask.h | 4
include/linux/memory_hotplug.h | 4
include/linux/mm.h | 6
include/linux/mmzone.h | 10
include/linux/pagewalk.h | 49 +-
include/linux/proc_fs.h | 23
include/linux/ptdump.h | 24 -
include/linux/seq_file.h | 13
include/linux/slab.h | 1
include/linux/string.h | 1
include/linux/sunrpc/stats.h | 4
ipc/mqueue.c | 123 ++++-
ipc/msg.c | 62 +-
ipc/sem.c | 66 +-
ipc/util.c | 14
kernel/configs.c | 9
kernel/irq/proc.c | 42 -
kernel/kallsyms.c | 12
kernel/latencytop.c | 14
kernel/locking/lockdep_proc.c | 15
kernel/module.c | 12
kernel/profile.c | 24 -
kernel/sched/psi.c | 48 +-
lib/bitmap.c | 195 ++++----
lib/string.c | 17
lib/test_bitmap.c | 105 ++++
mm/Kconfig.debug | 21
mm/Makefile | 1
mm/gup.c | 2
mm/hmm.c | 66 +-
mm/memory_hotplug.c | 104 +---
mm/memremap.c | 2
mm/migrate.c | 5
mm/mincore.c | 1
mm/mmu_gather.c | 158 ++++--
mm/page_alloc.c | 75 +--
mm/pagewalk.c | 167 +++++--
mm/ptdump.c | 159 ++++++
mm/slab_common.c | 37 -
mm/sparse.c | 10
mm/swapfile.c | 14
net/atm/mpoa_proc.c | 17
net/atm/proc.c | 8
net/core/dev.c | 2
net/core/filter.c | 2
net/core/pktgen.c | 44 -
net/ipv4/ipconfig.c | 10
net/ipv4/netfilter/ipt_CLUSTERIP.c | 16
net/ipv4/route.c | 24 -
net/netfilter/xt_recent.c | 17
net/sunrpc/auth_gss/svcauth_gss.c | 10
net/sunrpc/cache.c | 45 -
net/sunrpc/stats.c | 21
net/xfrm/xfrm_policy.c | 2
samples/kfifo/bytestream-example.c | 11
samples/kfifo/inttype-example.c | 11
samples/kfifo/record-example.c | 11
scripts/coccinelle/free/devm_free.cocci | 4
sound/core/info.c | 34 -
sound/soc/codecs/ak4104.c | 3
sound/soc/codecs/cs4270.c | 3
sound/soc/codecs/tlv320aic32x4.c | 6
sound/soc/sunxi/sun4i-spdif.c | 2
tools/include/linux/bitops.h | 9
214 files changed, 2589 insertions(+), 2227 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-02-04 1:33 incoming Andrew Morton
@ 2020-02-04 2:27 ` Linus Torvalds
2020-02-04 2:46 ` incoming Andrew Morton
0 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2020-02-04 2:27 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Tue, Feb 4, 2020 at 1:33 AM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> The rest of MM and the rest of everything else.
What's the base? You've changed your scripts or something, and that
information is no longer in your cover letter..
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-02-04 2:27 ` incoming Linus Torvalds
@ 2020-02-04 2:46 ` Andrew Morton
2020-02-04 3:11 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-02-04 2:46 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, Linux-MM
On Tue, 4 Feb 2020 02:27:48 +0000 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Tue, Feb 4, 2020 at 1:33 AM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > The rest of MM and the rest of everything else.
>
> What's the base? You've changed your scripts or something, and that
> information is no longer in your cover letter..
>
Crap, sorry, geriatric.
d4e9056daedca3891414fe3c91de3449a5dad0f2
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-02-04 2:46 ` incoming Andrew Morton
@ 2020-02-04 3:11 ` Linus Torvalds
0 siblings, 0 replies; 419+ messages in thread
From: Linus Torvalds @ 2020-02-04 3:11 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Tue, Feb 4, 2020 at 2:46 AM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> On Tue, 4 Feb 2020 02:27:48 +0000 Linus Torvalds <torvalds@linux-foundation.org> wrote:
>
> > What's the base? You've changed your scripts or something, and that
> > information is no longer in your cover letter..
>
> Crap, sorry, geriatric.
>
> d4e9056daedca3891414fe3c91de3449a5dad0f2
Ok, I've tentatively applied it with the MIME decoding fixes I found,
and I'll guess I'll let it build and sit for a while before merging it
into my tree.
I didn't find anything else odd in there. But...
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-02-21 4:00 Andrew Morton
2020-02-21 4:03 ` incoming Andrew Morton
2020-02-21 18:21 ` incoming Linus Torvalds
0 siblings, 2 replies; 419+ messages in thread
From: Andrew Morton @ 2020-02-21 4:00 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
- A few y2038 fixes which missed the merge window whiole dependencies
in NFS were being sorted out.
- A bunch of fixes. Some minor, some not.
Subsystems affected by this patch series:
Arnd Bergmann <arnd@arndb.de>:
y2038: remove ktime to/from timespec/timeval conversion
y2038: remove unused time32 interfaces
y2038: hide timeval/timespec/itimerval/itimerspec types
Ioanna Alifieraki <ioanna-maria.alifieraki@canonical.com>:
Revert "ipc,sem: remove uneeded sem_undo_list lock usage in exit_sem()"
Christian Borntraeger <borntraeger@de.ibm.com>:
include/uapi/linux/swab.h: fix userspace breakage, use __BITS_PER_LONG for swap
SeongJae Park <sjpark@amazon.de>:
selftests/vm: add missed tests in run_vmtests
Joe Perches <joe@perches.com>:
get_maintainer: remove uses of P: for maintainer name
Douglas Anderson <dianders@chromium.org>:
scripts/get_maintainer.pl: deprioritize old Fixes: addresses
Christoph Hellwig <hch@lst.de>:
mm/swapfile.c: fix a comment in sys_swapon()
Vasily Averin <vvs@virtuozzo.com>:
mm/memcontrol.c: lost css_put in memcg_expand_shrinker_maps()
Alexandru Ardelean <alexandru.ardelean@analog.com>:
lib/string.c: update match_string() doc-strings with correct behavior
Gavin Shan <gshan@redhat.com>:
mm/vmscan.c: don't round up scan size for online memory cgroup
Wei Yang <richardw.yang@linux.intel.com>:
mm/sparsemem: pfn_to_page is not valid yet on SPARSEMEM
Alexander Potapenko <glider@google.com>:
lib/stackdepot.c: fix global out-of-bounds in stack_slabs
Randy Dunlap <rdunlap@infradead.org>:
MAINTAINERS: use tabs for SAFESETID
MAINTAINERS | 8 -
include/linux/compat.h | 29 ------
include/linux/ktime.h | 37 -------
include/linux/time32.h | 154 ---------------------------------
include/linux/timekeeping32.h | 32 ------
include/linux/types.h | 5 -
include/uapi/asm-generic/posix_types.h | 2
include/uapi/linux/swab.h | 4
include/uapi/linux/time.h | 22 ++--
ipc/sem.c | 6 -
kernel/compat.c | 64 -------------
kernel/time/time.c | 43 ---------
lib/stackdepot.c | 8 +
lib/string.c | 16 +++
mm/memcontrol.c | 4
mm/sparse.c | 2
mm/swapfile.c | 2
mm/vmscan.c | 9 +
scripts/get_maintainer.pl | 32 ------
tools/testing/selftests/vm/run_vmtests | 33 +++++++
20 files changed, 93 insertions(+), 419 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-02-21 4:00 incoming Andrew Morton
@ 2020-02-21 4:03 ` Andrew Morton
2020-02-21 18:21 ` incoming Linus Torvalds
1 sibling, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-02-21 4:03 UTC (permalink / raw)
To: Linus Torvalds, linux-mm, mm-commits
On Thu, 20 Feb 2020 20:00:30 -0800 Andrew Morton <akpm@linux-foundation.org> wrote:
> - A few y2038 fixes which missed the merge window whiole dependencies
> in NFS were being sorted out.
>
> - A bunch of fixes. Some minor, some not.
15 patches, based on ca7e1fd1026c5af6a533b4b5447e1d2f153e28f2
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-02-21 4:00 incoming Andrew Morton
2020-02-21 4:03 ` incoming Andrew Morton
@ 2020-02-21 18:21 ` Linus Torvalds
2020-02-21 18:32 ` incoming Konstantin Ryabitsev
2020-02-21 19:33 ` incoming Linus Torvalds
1 sibling, 2 replies; 419+ messages in thread
From: Linus Torvalds @ 2020-02-21 18:21 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits
On Thu, Feb 20, 2020 at 8:00 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> - A few y2038 fixes which missed the merge window whiole dependencies
> in NFS were being sorted out.
>
> - A bunch of fixes. Some minor, some not.
Hmm. Konstantin's nice lore script _used_ to pick up your patches, but
now they don't.
I'm not sure what changed. It worked with your big series of 118 patches.
It doesn't work with this smaller series of fixes.
I think the difference is that you've done something bad to your patch
sending. That big series was properly threaded with each of the
patches being a reply to the 'incoming' message.
This series is not.
Please, Andrew, can you make your email flow more consistent so that I
can actually use the nice new tool to download a patch series?
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-02-21 18:21 ` incoming Linus Torvalds
@ 2020-02-21 18:32 ` Konstantin Ryabitsev
2020-02-27 9:59 ` incoming Vlastimil Babka
2020-02-21 19:33 ` incoming Linus Torvalds
1 sibling, 1 reply; 419+ messages in thread
From: Konstantin Ryabitsev @ 2020-02-21 18:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits
On Fri, Feb 21, 2020 at 10:21:19AM -0800, Linus Torvalds wrote:
> On Thu, Feb 20, 2020 at 8:00 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > - A few y2038 fixes which missed the merge window whiole dependencies
> > in NFS were being sorted out.
> >
> > - A bunch of fixes. Some minor, some not.
>
> Hmm. Konstantin's nice lore script _used_ to pick up your patches, but
> now they don't.
>
> I'm not sure what changed. It worked with your big series of 118 patches.
>
> It doesn't work with this smaller series of fixes.
>
> I think the difference is that you've done something bad to your patch
> sending. That big series was properly threaded with each of the
> patches being a reply to the 'incoming' message.
>
> This series is not.
This is correct -- each patch is posted without an in-reply-to, so
public-inbox doesn't group them into a thread.
E.g.:
https://lore.kernel.org/linux-mm/20200221040350.84HaG%25akpm@linux-foundation.org/
>
> Please, Andrew, can you make your email flow more consistent so that I
> can actually use the nice new tool to download a patch series?
Andrew, I'll be happy to provide you with a helper tool if you can
describe me your workflow. E.g. if you have a quilt directory of patches
plus a series file, it could easily be a tiny wrapper like:
send-patches --base-commit 1234abcd --cover cover.txt patchdir/series
-K
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-02-21 18:21 ` incoming Linus Torvalds
2020-02-21 18:32 ` incoming Konstantin Ryabitsev
@ 2020-02-21 19:33 ` Linus Torvalds
1 sibling, 0 replies; 419+ messages in thread
From: Linus Torvalds @ 2020-02-21 19:33 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits
Side note: I've obviously picked it up the old-fashioned way, but I
had been looking forward to seeing if I could just automate this more.
Linus
On Fri, Feb 21, 2020 at 10:21 AM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Please, Andrew, can you make your email flow more consistent so that I
> can actually use the nice new tool to download a patch series?
>
> Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-02-21 18:32 ` incoming Konstantin Ryabitsev
@ 2020-02-27 9:59 ` Vlastimil Babka
0 siblings, 0 replies; 419+ messages in thread
From: Vlastimil Babka @ 2020-02-27 9:59 UTC (permalink / raw)
To: Konstantin Ryabitsev, Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits
On 2/21/20 7:32 PM, Konstantin Ryabitsev wrote:
> On Fri, Feb 21, 2020 at 10:21:19AM -0800, Linus Torvalds wrote:
>> On Thu, Feb 20, 2020 at 8:00 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>> >
>> > - A few y2038 fixes which missed the merge window whiole dependencies
>> > in NFS were being sorted out.
>> >
>> > - A bunch of fixes. Some minor, some not.
>>
>> Hmm. Konstantin's nice lore script _used_ to pick up your patches, but
>> now they don't.
>>
>> I'm not sure what changed. It worked with your big series of 118 patches.
>>
>> It doesn't work with this smaller series of fixes.
>>
>> I think the difference is that you've done something bad to your patch
>> sending. That big series was properly threaded with each of the
>> patches being a reply to the 'incoming' message.
>>
>> This series is not.
>
> This is correct -- each patch is posted without an in-reply-to, so
> public-inbox doesn't group them into a thread.
>
> E.g.:
> https://lore.kernel.org/linux-mm/20200221040350.84HaG%25akpm@linux-foundation.org/
>
>>
>> Please, Andrew, can you make your email flow more consistent so that I
>> can actually use the nice new tool to download a patch series?
>
> Andrew, I'll be happy to provide you with a helper tool if you can
> describe me your workflow. E.g. if you have a quilt directory of patches
> plus a series file, it could easily be a tiny wrapper like:
>
> send-patches --base-commit 1234abcd --cover cover.txt patchdir/series
Once/if there is such tool, could it perhaps instead of mass e-mailing create
git commits, push them to korg repo and send a pull request?
Thanks,
Vlastimil
> -K
>
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-03-06 6:27 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-03-06 6:27 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
7 fixes, based on 9f65ed5fe41ce08ed1cb1f6a950f9ec694c142ad:
Mel Gorman <mgorman@techsingularity.net>:
mm, numa: fix bad pmd by atomically check for pmd_trans_huge when marking page tables prot_numa
Huang Ying <ying.huang@intel.com>:
mm: fix possible PMD dirty bit lost in set_pmd_migration_entry()
"Kirill A. Shutemov" <kirill@shutemov.name>:
mm: avoid data corruption on CoW fault into PFN-mapped VMA
OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
fat: fix uninit-memory access for partial initialized inode
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/z3fold.c: do not include rwlock.h directly
Vlastimil Babka <vbabka@suse.cz>:
mm, hotplug: fix page online with DEBUG_PAGEALLOC compiled but not enabled
Miroslav Benes <mbenes@suse.cz>:
arch/Kconfig: update HAVE_RELIABLE_STACKTRACE description
arch/Kconfig | 5 +++--
fs/fat/inode.c | 19 +++++++------------
include/linux/mm.h | 4 ++++
mm/huge_memory.c | 3 +--
mm/memory.c | 35 +++++++++++++++++++++++++++--------
mm/memory_hotplug.c | 8 +++++++-
mm/mprotect.c | 38 ++++++++++++++++++++++++++++++++++++--
mm/z3fold.c | 1 -
8 files changed, 85 insertions(+), 28 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-03-22 1:19 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-03-22 1:19 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
10 fixes, based on c63c50fc2ec9afc4de21ef9ead2eac64b178cce1:
Chunguang Xu <brookxu@tencent.com>:
memcg: fix NULL pointer dereference in __mem_cgroup_usage_unregister_event
Baoquan He <bhe@redhat.com>:
mm/hotplug: fix hot remove failure in SPARSEMEM|!VMEMMAP case
Qian Cai <cai@lca.pw>:
page-flags: fix a crash at SetPageError(THP_SWAP)
Chris Down <chris@chrisdown.name>:
mm, memcg: fix corruption on 64-bit divisor in memory.high throttling
mm, memcg: throttle allocators based on ancestral memory.high
Michal Hocko <mhocko@suse.com>:
mm: do not allow MADV_PAGEOUT for CoW pages
Roman Penyaev <rpenyaev@suse.de>:
epoll: fix possible lost wakeup on epoll_ctl() path
Qian Cai <cai@lca.pw>:
mm/mmu_notifier: silence PROVE_RCU_LIST warnings
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: prevent kmalloc_node crashes and memory leaks
Joerg Roedel <jroedel@suse.de>:
x86/mm: split vmalloc_sync_all()
arch/x86/mm/fault.c | 26 ++++++++++-
drivers/acpi/apei/ghes.c | 2
fs/eventpoll.c | 8 +--
include/linux/page-flags.h | 2
include/linux/vmalloc.h | 5 +-
kernel/notifier.c | 2
mm/madvise.c | 12 +++--
mm/memcontrol.c | 105 ++++++++++++++++++++++++++++-----------------
mm/mmu_notifier.c | 27 +++++++----
mm/nommu.c | 10 +++-
mm/slub.c | 26 +++++++----
mm/sparse.c | 8 ++-
mm/vmalloc.c | 11 +++-
13 files changed, 165 insertions(+), 79 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-03-29 2:14 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-03-29 2:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
5 fixes, based on 83fd69c93340177dcd66fd26ce6441fb581c1dbf:
Naohiro Aota <naohiro.aota@wdc.com>:
mm/swapfile.c: move inode_lock out of claim_swapfile
David Hildenbrand <david@redhat.com>:
drivers/base/memory.c: indicate all memory blocks as removable
Mina Almasry <almasrymina@google.com>:
hugetlb_cgroup: fix illegal access to memory
Roman Gushchin <guro@fb.com>:
mm: fork: fix kernel_stack memcg stats for various stack implementations
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/sparse: fix kernel crash with pfn_section_valid check
drivers/base/memory.c | 23 +++--------------------
include/linux/memcontrol.h | 12 ++++++++++++
kernel/fork.c | 4 ++--
mm/hugetlb_cgroup.c | 3 +--
mm/memcontrol.c | 38 ++++++++++++++++++++++++++++++++++++++
mm/sparse.c | 6 ++++++
mm/swapfile.c | 41 ++++++++++++++++++++---------------------
7 files changed, 82 insertions(+), 45 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-04-02 4:01 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-04-02 4:01 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
A large amount of MM, plenty more to come.
155 patches, based on GIT 1a323ea5356edbb3073dc59d51b9e6b86908857d
Subsystems affected by this patch series:
tools
kthread
kbuild
scripts
ocfs2
vfs
mm/slub
mm/kmemleak
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/mremap
mm/sparsemem
mm/kasan
mm/pagealloc
mm/vmscan
mm/compaction
mm/mempolicy
mm/hugetlbfs
mm/hugetlb
Subsystem: tools
David Ahern <dsahern@kernel.org>:
tools/accounting/getdelays.c: fix netlink attribute length
Subsystem: kthread
Petr Mladek <pmladek@suse.com>:
kthread: mark timer used by delayed kthread works as IRQ safe
Subsystem: kbuild
Masahiro Yamada <masahiroy@kernel.org>:
asm-generic: make more kernel-space headers mandatory
Subsystem: scripts
Jonathan Neuschäfer <j.neuschaefer@gmx.net>:
scripts/spelling.txt: add syfs/sysfs pattern
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ocfs2
Alex Shi <alex.shi@linux.alibaba.com>:
ocfs2: remove FS_OCFS2_NM
ocfs2: remove unused macros
ocfs2: use OCFS2_SEC_BITS in macro
ocfs2: remove dlm_lock_is_remote
wangyan <wangyan122@huawei.com>:
ocfs2: there is no need to log twice in several functions
ocfs2: correct annotation from "l_next_rec" to "l_next_free_rec"
Alex Shi <alex.shi@linux.alibaba.com>:
ocfs2: remove useless err
Jules Irenge <jbi.octave@gmail.com>:
ocfs2: Add missing annotations for ocfs2_refcount_cache_lock() and ocfs2_refcount_cache_unlock()
"Gustavo A. R. Silva" <gustavo@embeddedor.com>:
ocfs2: replace zero-length array with flexible-array member
ocfs2: cluster: replace zero-length array with flexible-array member
ocfs2: dlm: replace zero-length array with flexible-array member
ocfs2: ocfs2_fs.h: replace zero-length array with flexible-array member
wangjian <wangjian161@huawei.com>:
ocfs2: roll back the reference count modification of the parent directory if an error occurs
Takashi Iwai <tiwai@suse.de>:
ocfs2: use scnprintf() for avoiding potential buffer overflow
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
ocfs2: use memalloc_nofs_save instead of memalloc_noio_save
Subsystem: vfs
Kees Cook <keescook@chromium.org>:
fs_parse: Remove pr_notice() about each validation
Subsystem: mm/slub
chenqiwu <chenqiwu@xiaomi.com>:
mm/slub.c: replace cpu_slab->partial with wrapped APIs
mm/slub.c: replace kmem_cache->cpu_partial with wrapped APIs
Kees Cook <keescook@chromium.org>:
slub: improve bit diffusion for freelist ptr obfuscation
slub: relocate freelist pointer to middle of object
Vlastimil Babka <vbabka@suse.cz>:
Revert "topology: add support for node_to_mem_node() to determine the fallback node"
Subsystem: mm/kmemleak
Nathan Chancellor <natechancellor@gmail.com>:
mm/kmemleak.c: use address-of operator on section symbols
Qian Cai <cai@lca.pw>:
mm/Makefile: disable KCSAN for kmemleak
Subsystem: mm/pagecache
Jan Kara <jack@suse.cz>:
mm/filemap.c: don't bother dropping mmap_sem for zero size readahead
Mauricio Faria de Oliveira <mfo@canonical.com>:
mm/page-writeback.c: write_cache_pages(): deduplicate identical checks
Xianting Tian <xianting_tian@126.com>:
mm/filemap.c: clear page error before actual read
Souptick Joarder <jrdr.linux@gmail.com>:
mm/filemap.c: remove unused argument from shrink_readahead_size_eio()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap.c: use vm_fault error code directly
include/linux/pagemap.h: rename arguments to find_subpage
mm/page-writeback.c: use VM_BUG_ON_PAGE in clear_page_dirty_for_io
mm/filemap.c: unexport find_get_entry
mm/filemap.c: rewrite pagecache_get_page documentation
Subsystem: mm/gup
John Hubbard <jhubbard@nvidia.com>:
Patch series "mm/gup: track FOLL_PIN pages", v6:
mm/gup: split get_user_pages_remote() into two routines
mm/gup: pass a flags arg to __gup_device_* functions
mm: introduce page_ref_sub_return()
mm/gup: pass gup flags to two more routines
mm/gup: require FOLL_GET for get_user_pages_fast()
mm/gup: track FOLL_PIN pages
mm/gup: page->hpage_pinned_refcount: exact pin counts for huge pages
mm/gup: /proc/vmstat: pin_user_pages (FOLL_PIN) reporting
mm/gup_benchmark: support pin_user_pages() and related calls
selftests/vm: run_vmtests: invoke gup_benchmark with basic FOLL_PIN coverage
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: improve dump_page() for compound pages
John Hubbard <jhubbard@nvidia.com>:
mm: dump_page(): additional diagnostics for huge pinned pages
Claudio Imbrenda <imbrenda@linux.ibm.com>:
mm/gup/writeback: add callbacks for inaccessible pages
Pingfan Liu <kernelfans@gmail.com>:
mm/gup: rename nr as nr_pinned in get_user_pages_fast()
mm/gup: fix omission of check on FOLL_LONGTERM in gup fast path
Subsystem: mm/swap
Chen Wandun <chenwandun@huawei.com>:
mm/swapfile.c: fix comments for swapcache_prepare
Wei Yang <richardw.yang@linux.intel.com>:
mm/swap.c: not necessary to export __pagevec_lru_add()
Qian Cai <cai@lca.pw>:
mm/swapfile: fix data races in try_to_unuse()
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/swap_slots.c: assign|reset cache slot by value directly
Yang Shi <yang.shi@linux.alibaba.com>:
mm: swap: make page_evictable() inline
mm: swap: use smp_mb__after_atomic() to order LRU bit set
Wei Yang <richard.weiyang@gmail.com>:
mm/swap_state.c: use the same way to count page in [add_to|delete_from]_swap_cache
Subsystem: mm/memcg
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: fix build error around the usage of kmem_caches
Kirill Tkhai <ktkhai@virtuozzo.com>:
mm/memcontrol.c: allocate shrinker_map on appropriate NUMA node
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: use mem_cgroup_from_obj()
Patch series "mm: memcg: kmem API cleanup", v2:
mm: kmem: cleanup (__)memcg_kmem_charge_memcg() arguments
mm: kmem: cleanup memcg_kmem_uncharge_memcg() arguments
mm: kmem: rename memcg_kmem_(un)charge() into memcg_kmem_(un)charge_page()
mm: kmem: switch to nr_pages in (__)memcg_kmem_charge_memcg()
mm: memcg/slab: cache page number in memcg_(un)charge_slab()
mm: kmem: rename (__)memcg_kmem_(un)charge_memcg() to __memcg_kmem_(un)charge()
Johannes Weiner <hannes@cmpxchg.org>:
Patch series "mm: memcontrol: recursive memory.low protection", v3:
mm: memcontrol: fix memory.low proportional distribution
mm: memcontrol: clean up and document effective low/min calculations
mm: memcontrol: recursive memory.low protection
Shakeel Butt <shakeelb@google.com>:
memcg: css_tryget_online cleanups
Vincenzo Frascino <vincenzo.frascino@arm.com>:
mm/memcontrol.c: make mem_cgroup_id_get_many() __maybe_unused
Chris Down <chris@chrisdown.name>:
mm, memcg: prevent memory.high load/store tearing
mm, memcg: prevent memory.max load tearing
mm, memcg: prevent memory.low load/store tearing
mm, memcg: prevent memory.min load/store tearing
mm, memcg: prevent memory.swap.max load tearing
mm, memcg: prevent mem_cgroup_protected store tearing
Roman Gushchin <guro@fb.com>:
mm: memcg: make memory.oom.group tolerable to task migration
Subsystem: mm/pagemap
Thomas Hellstrom <thellstrom@vmware.com>:
mm/mapping_dirty_helpers: Update huge page-table entry callbacks
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/vma: some more minor changes", v2:
mm/vma: move VM_NO_KHUGEPAGED into generic header
mm/vma: make vma_is_foreign() available for general use
mm/vma: make is_vma_temporary_stack() available for general use
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: add pagemap.h to the fine documentation
Peter Xu <peterx@redhat.com>:
Patch series "mm: Page fault enhancements", v6:
mm/gup: rename "nonblocking" to "locked" where proper
mm/gup: fix __get_user_pages() on fault retry of hugetlb
mm: introduce fault_signal_pending()
x86/mm: use helper fault_signal_pending()
arc/mm: use helper fault_signal_pending()
arm64/mm: use helper fault_signal_pending()
powerpc/mm: use helper fault_signal_pending()
sh/mm: use helper fault_signal_pending()
mm: return faster for non-fatal signals in user mode faults
userfaultfd: don't retake mmap_sem to emulate NOPAGE
mm: introduce FAULT_FLAG_DEFAULT
mm: introduce FAULT_FLAG_INTERRUPTIBLE
mm: allow VM_FAULT_RETRY for multiple times
mm/gup: allow VM_FAULT_RETRY for multiple times
mm/gup: allow to react to fatal signals
mm/userfaultfd: honor FAULT_FLAG_KILLABLE in fault path
WANG Wenhu <wenhu.wang@vivo.com>:
mm: clarify a confusing comment for remap_pfn_range()
Wang Wenhu <wenhu.wang@vivo.com>:
mm/memory.c: clarify a confusing comment for vm_iomap_memory
Jaewon Kim <jaewon31.kim@samsung.com>:
Patch series "mm: mmap: add mmap trace point", v3:
mmap: remove inline of vm_unmapped_area
mm: mmap: add trace point of vm_unmapped_area
Subsystem: mm/mremap
Brian Geffon <bgeffon@google.com>:
mm/mremap: add MREMAP_DONTUNMAP to mremap()
selftests: add MREMAP_DONTUNMAP selftest
Subsystem: mm/sparsemem
Wei Yang <richardw.yang@linux.intel.com>:
mm/sparsemem: get address to page struct instead of address to pfn
Pingfan Liu <kernelfans@gmail.com>:
mm/sparse: rename pfn_present() to pfn_in_present_section()
Baoquan He <bhe@redhat.com>:
mm/sparse.c: use kvmalloc/kvfree to alloc/free memmap for the classic sparse
mm/sparse.c: allocate memmap preferring the given node
Subsystem: mm/kasan
Walter Wu <walter-zh.wu@mediatek.com>:
Patch series "fix the missing underflow in memory operation function", v4:
kasan: detect negative size in memory operation function
kasan: add test for invalid size in memmove
Subsystem: mm/pagealloc
Joel Savitz <jsavitz@redhat.com>:
mm/page_alloc: increase default min_free_kbytes bound
Mateusz Nosek <mateusznosek0@gmail.com>:
mm, pagealloc: micro-optimisation: save two branches on hot page allocation path
chenqiwu <chenqiwu@xiaomi.com>:
mm/page_alloc.c: use free_area_empty() instead of open-coding
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/page_alloc.c: micro-optimisation Remove unnecessary branch
chenqiwu <chenqiwu@xiaomi.com>:
mm/page_alloc: simplify page_is_buddy() for better code readability
Subsystem: mm/vmscan
Yang Shi <yang.shi@linux.alibaba.com>:
mm: vmpressure: don't need call kfree if kstrndup fails
mm: vmpressure: use mem_cgroup_is_root API
mm: vmscan: replace open codings to NUMA_NO_NODE
Wei Yang <richardw.yang@linux.intel.com>:
mm/vmscan.c: remove cpu online notification for now
Qian Cai <cai@lca.pw>:
mm/vmscan.c: fix data races using kswapd_classzone_idx
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/vmscan.c: Clean code by removing unnecessary assignment
Kirill Tkhai <ktkhai@virtuozzo.com>:
mm/vmscan.c: make may_enter_fs bool in shrink_page_list()
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/vmscan.c: do_try_to_free_pages(): clean code by removing unnecessary assignment
Michal Hocko <mhocko@suse.com>:
selftests: vm: drop dependencies on page flags from mlock2 tests
Subsystem: mm/compaction
Rik van Riel <riel@surriel.com>:
Patch series "fix THP migration for CMA allocations", v2:
mm,compaction,cma: add alloc_contig flag to compact_control
mm,thp,compaction,cma: allow THP migration for CMA allocations
Vlastimil Babka <vbabka@suse.cz>:
mm, compaction: fully assume capture is not NULL in compact_zone_order()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/compaction: really limit compact_unevictable_allowed to 0 and 1
mm/compaction: Disable compact_unevictable_allowed on RT
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/compaction.c: clean code by removing unnecessary assignment
Subsystem: mm/mempolicy
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/mempolicy: support MPOL_MF_STRICT for huge page mapping
mm/mempolicy: check hugepage migration is supported by arch in vma_migratable()
Yang Shi <yang.shi@linux.alibaba.com>:
mm: mempolicy: use VM_BUG_ON_VMA in queue_pages_test_walk()
Randy Dunlap <rdunlap@infradead.org>:
mm: mempolicy: require at least one nodeid for MPOL_PREFERRED
Colin Ian King <colin.king@canonical.com>:
mm/memblock.c: remove redundant assignment to variable max_addr
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "hugetlbfs: use i_mmap_rwsem for more synchronization", v2:
hugetlbfs: use i_mmap_rwsem for more pmd sharing synchronization
hugetlbfs: Use i_mmap_rwsem to address page fault/truncate race
Subsystem: mm/hugetlb
Mina Almasry <almasrymina@google.com>:
hugetlb_cgroup: add hugetlb_cgroup reservation counter
hugetlb_cgroup: add interface for charge/uncharge hugetlb reservations
mm/hugetlb_cgroup: fix hugetlb_cgroup migration
hugetlb_cgroup: add reservation accounting for private mappings
hugetlb: disable region_add file_region coalescing
hugetlb_cgroup: add accounting for shared mappings
hugetlb_cgroup: support noreserve mappings
hugetlb: support file_region coalescing again
hugetlb_cgroup: add hugetlb_cgroup reservation tests
hugetlb_cgroup: add hugetlb_cgroup reservation docs
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/hugetlb.c: clean code by removing unnecessary initialization
Vlastimil Babka <vbabka@suse.cz>:
mm/hugetlb: remove unnecessary memory fetch in PageHeadHuge()
Christophe Leroy <christophe.leroy@c-s.fr>:
selftests/vm: fix map_hugetlb length used for testing read and write
mm/hugetlb: fix build failure with HUGETLB_PAGE but not HUGEBTLBFS
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
include/linux/huge_mm.h: check PageTail in hpage_nr_pages even when !THP
Documentation/admin-guide/cgroup-v1/hugetlb.rst | 103 +-
Documentation/admin-guide/cgroup-v2.rst | 11
Documentation/admin-guide/sysctl/vm.rst | 3
Documentation/core-api/mm-api.rst | 3
Documentation/core-api/pin_user_pages.rst | 86 +
arch/alpha/include/asm/Kbuild | 11
arch/alpha/mm/fault.c | 6
arch/arc/include/asm/Kbuild | 21
arch/arc/mm/fault.c | 37
arch/arm/include/asm/Kbuild | 12
arch/arm/mm/fault.c | 7
arch/arm64/include/asm/Kbuild | 18
arch/arm64/mm/fault.c | 26
arch/c6x/include/asm/Kbuild | 37
arch/csky/include/asm/Kbuild | 36
arch/h8300/include/asm/Kbuild | 46
arch/hexagon/include/asm/Kbuild | 33
arch/hexagon/mm/vm_fault.c | 5
arch/ia64/include/asm/Kbuild | 7
arch/ia64/mm/fault.c | 5
arch/m68k/include/asm/Kbuild | 24
arch/m68k/mm/fault.c | 7
arch/microblaze/include/asm/Kbuild | 29
arch/microblaze/mm/fault.c | 5
arch/mips/include/asm/Kbuild | 13
arch/mips/mm/fault.c | 5
arch/nds32/include/asm/Kbuild | 37
arch/nds32/mm/fault.c | 5
arch/nios2/include/asm/Kbuild | 38
arch/nios2/mm/fault.c | 7
arch/openrisc/include/asm/Kbuild | 36
arch/openrisc/mm/fault.c | 5
arch/parisc/include/asm/Kbuild | 18
arch/parisc/mm/fault.c | 8
arch/powerpc/include/asm/Kbuild | 4
arch/powerpc/mm/book3s64/pkeys.c | 12
arch/powerpc/mm/fault.c | 20
arch/powerpc/platforms/pseries/hotplug-memory.c | 2
arch/riscv/include/asm/Kbuild | 28
arch/riscv/mm/fault.c | 9
arch/s390/include/asm/Kbuild | 15
arch/s390/mm/fault.c | 10
arch/sh/include/asm/Kbuild | 16
arch/sh/mm/fault.c | 13
arch/sparc/include/asm/Kbuild | 14
arch/sparc/mm/fault_32.c | 5
arch/sparc/mm/fault_64.c | 5
arch/um/kernel/trap.c | 3
arch/unicore32/include/asm/Kbuild | 34
arch/unicore32/mm/fault.c | 8
arch/x86/include/asm/Kbuild | 2
arch/x86/include/asm/mmu_context.h | 15
arch/x86/mm/fault.c | 32
arch/xtensa/include/asm/Kbuild | 26
arch/xtensa/mm/fault.c | 5
drivers/base/node.c | 2
drivers/gpu/drm/ttm/ttm_bo_vm.c | 12
fs/fs_parser.c | 2
fs/hugetlbfs/inode.c | 30
fs/ocfs2/alloc.c | 3
fs/ocfs2/cluster/heartbeat.c | 12
fs/ocfs2/cluster/netdebug.c | 4
fs/ocfs2/cluster/tcp.c | 27
fs/ocfs2/cluster/tcp.h | 2
fs/ocfs2/dir.c | 4
fs/ocfs2/dlm/dlmcommon.h | 8
fs/ocfs2/dlm/dlmdebug.c | 100 -
fs/ocfs2/dlm/dlmmaster.c | 2
fs/ocfs2/dlm/dlmthread.c | 3
fs/ocfs2/dlmglue.c | 2
fs/ocfs2/journal.c | 2
fs/ocfs2/namei.c | 15
fs/ocfs2/ocfs2_fs.h | 18
fs/ocfs2/refcounttree.c | 2
fs/ocfs2/reservations.c | 3
fs/ocfs2/stackglue.c | 2
fs/ocfs2/suballoc.c | 5
fs/ocfs2/super.c | 46
fs/pipe.c | 2
fs/userfaultfd.c | 64 -
include/asm-generic/Kbuild | 52 +
include/linux/cgroup-defs.h | 5
include/linux/fs.h | 5
include/linux/gfp.h | 6
include/linux/huge_mm.h | 10
include/linux/hugetlb.h | 76 +
include/linux/hugetlb_cgroup.h | 175 +++
include/linux/kasan.h | 2
include/linux/kthread.h | 3
include/linux/memcontrol.h | 66 -
include/linux/mempolicy.h | 29
include/linux/mm.h | 243 +++-
include/linux/mm_types.h | 7
include/linux/mmzone.h | 6
include/linux/page_ref.h | 9
include/linux/pagemap.h | 29
include/linux/sched/signal.h | 18
include/linux/swap.h | 1
include/linux/topology.h | 17
include/trace/events/mmap.h | 48
include/uapi/linux/mman.h | 5
kernel/cgroup/cgroup.c | 17
kernel/fork.c | 9
kernel/sysctl.c | 31
lib/test_kasan.c | 19
mm/Makefile | 1
mm/compaction.c | 31
mm/debug.c | 54 -
mm/filemap.c | 77 -
mm/gup.c | 682 ++++++++++---
mm/gup_benchmark.c | 71 +
mm/huge_memory.c | 29
mm/hugetlb.c | 866 ++++++++++++-----
mm/hugetlb_cgroup.c | 347 +++++-
mm/internal.h | 32
mm/kasan/common.c | 26
mm/kasan/generic.c | 9
mm/kasan/generic_report.c | 11
mm/kasan/kasan.h | 2
mm/kasan/report.c | 5
mm/kasan/tags.c | 9
mm/kasan/tags_report.c | 11
mm/khugepaged.c | 4
mm/kmemleak.c | 2
mm/list_lru.c | 12
mm/mapping_dirty_helpers.c | 42
mm/memblock.c | 2
mm/memcontrol.c | 378 ++++---
mm/memory-failure.c | 29
mm/memory.c | 4
mm/mempolicy.c | 73 +
mm/migrate.c | 25
mm/mmap.c | 32
mm/mremap.c | 92 +
mm/page-writeback.c | 19
mm/page_alloc.c | 82 -
mm/page_counter.c | 29
mm/page_ext.c | 2
mm/rmap.c | 39
mm/shuffle.c | 2
mm/slab.h | 32
mm/slab_common.c | 2
mm/slub.c | 27
mm/sparse.c | 33
mm/swap.c | 5
mm/swap_slots.c | 12
mm/swap_state.c | 2
mm/swapfile.c | 10
mm/userfaultfd.c | 11
mm/vmpressure.c | 8
mm/vmscan.c | 111 --
mm/vmstat.c | 2
scripts/spelling.txt | 21
tools/accounting/getdelays.c | 2
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 2
tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 575 +++++++++++
tools/testing/selftests/vm/gup_benchmark.c | 15
tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 244 ++++
tools/testing/selftests/vm/map_hugetlb.c | 14
tools/testing/selftests/vm/mlock2-tests.c | 233 ----
tools/testing/selftests/vm/mremap_dontunmap.c | 313 ++++++
tools/testing/selftests/vm/run_vmtests | 37
tools/testing/selftests/vm/write_hugetlb_memory.sh | 23
tools/testing/selftests/vm/write_to_hugetlbfs.c | 242 ++++
165 files changed, 5020 insertions(+), 2376 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-04-07 3:02 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-04-07 3:02 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
- a lot more of MM, quite a bit more yet to come.
- various other subsystems
166 patches based on 7e63420847ae5f1036e4f7c42f0b3282e73efbc2.
Subsystems affected by this patch series:
mm/memcg
mm/pagemap
mm/vmalloc
mm/pagealloc
mm/migration
mm/thp
mm/ksm
mm/madvise
mm/virtio
mm/userfaultfd
mm/memory-hotplug
mm/shmem
mm/rmap
mm/zswap
mm/zsmalloc
mm/cleanups
procfs
misc
MAINTAINERS
bitops
lib
checkpatch
epoll
binfmt
kallsyms
reiserfs
kmod
gcov
kconfig
kcov
ubsan
fault-injection
ipc
Subsystem: mm/memcg
Chris Down <chris@chrisdown.name>:
mm, memcg: bypass high reclaim iteration for cgroup hierarchy root
Subsystem: mm/pagemap
Li Xinhai <lixinhai.lxh@gmail.com>:
Patch series "mm: Fix misuse of parent anon_vma in dup_mmap path":
mm: don't prepare anon_vma if vma has VM_WIPEONFORK
Revert "mm/rmap.c: reuse mergeable anon_vma as parent when fork"
mm: set vm_next and vm_prev to NULL in vm_area_dup()
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/vma: Use all available wrappers when possible", v2:
mm/vma: add missing VMA flag readable name for VM_SYNC
mm/vma: make vma_is_accessible() available for general use
mm/vma: replace all remaining open encodings with is_vm_hugetlb_page()
mm/vma: replace all remaining open encodings with vma_is_anonymous()
mm/vma: append unlikely() while testing VMA access permissions
Subsystem: mm/vmalloc
Qiujun Huang <hqjagain@gmail.com>:
mm/vmalloc: fix a typo in comment
Subsystem: mm/pagealloc
Michal Hocko <mhocko@suse.com>:
mm: make it clear that gfp reclaim modifiers are valid only for sleepable allocations
Subsystem: mm/migration
Wei Yang <richardw.yang@linux.intel.com>:
Patch series "cleanup on do_pages_move()", v5:
mm/migrate.c: no need to check for i > start in do_pages_move()
mm/migrate.c: wrap do_move_pages_to_node() and store_status()
mm/migrate.c: check pagelist in move_pages_and_store_status()
mm/migrate.c: unify "not queued for migration" handling in do_pages_move()
Yang Shi <yang.shi@linux.alibaba.com>:
mm/migrate.c: migrate PG_readahead flag
Subsystem: mm/thp
David Rientjes <rientjes@google.com>:
mm, shmem: add vmstat for hugepage fallback
mm, thp: track fallbacks due to failed memcg charges separately
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
include/linux/pagemap.h: optimise find_subpage for !THP
mm: remove CONFIG_TRANSPARENT_HUGE_PAGECACHE
Subsystem: mm/ksm
Li Chen <chenli@uniontech.com>:
mm/ksm.c: update get_user_pages() argument in comment
Subsystem: mm/madvise
Huang Ying <ying.huang@intel.com>:
mm: code cleanup for MADV_FREE
Subsystem: mm/virtio
Alexander Duyck <alexander.h.duyck@linux.intel.com>:
Patch series "mm / virtio: Provide support for free page reporting", v17:
mm: adjust shuffle code to allow for future coalescing
mm: use zone and order instead of free area in free_list manipulators
mm: add function __putback_isolated_page
mm: introduce Reported pages
virtio-balloon: pull page poisoning config out of free page hinting
virtio-balloon: add support for providing free page reports to host
mm/page_reporting: rotate reported pages to the tail of the list
mm/page_reporting: add budget limit on how many pages can be reported per pass
mm/page_reporting: add free page reporting documentation
David Hildenbrand <david@redhat.com>:
virtio-balloon: switch back to OOM handler for VIRTIO_BALLOON_F_DEFLATE_ON_OOM
Subsystem: mm/userfaultfd
Shaohua Li <shli@fb.com>:
Patch series "userfaultfd: write protection support", v6:
userfaultfd: wp: add helper for writeprotect check
Andrea Arcangeli <aarcange@redhat.com>:
userfaultfd: wp: hook userfault handler to write protection fault
userfaultfd: wp: add WP pagetable tracking to x86
userfaultfd: wp: userfaultfd_pte/huge_pmd_wp() helpers
userfaultfd: wp: add UFFDIO_COPY_MODE_WP
Peter Xu <peterx@redhat.com>:
mm: merge parameters for change_protection()
userfaultfd: wp: apply _PAGE_UFFD_WP bit
userfaultfd: wp: drop _PAGE_UFFD_WP properly when fork
userfaultfd: wp: add pmd_swp_*uffd_wp() helpers
userfaultfd: wp: support swap and page migration
khugepaged: skip collapse if uffd-wp detected
Shaohua Li <shli@fb.com>:
userfaultfd: wp: support write protection for userfault vma range
Andrea Arcangeli <aarcange@redhat.com>:
userfaultfd: wp: add the writeprotect API to userfaultfd ioctl
Shaohua Li <shli@fb.com>:
userfaultfd: wp: enabled write protection in userfaultfd API
Peter Xu <peterx@redhat.com>:
userfaultfd: wp: don't wake up when doing write protect
Martin Cracauer <cracauer@cons.org>:
userfaultfd: wp: UFFDIO_REGISTER_MODE_WP documentation update
Peter Xu <peterx@redhat.com>:
userfaultfd: wp: declare _UFFDIO_WRITEPROTECT conditionally
userfaultfd: selftests: refactor statistics
userfaultfd: selftests: add write-protect test
Subsystem: mm/memory-hotplug
David Hildenbrand <david@redhat.com>:
Patch series "mm: drop superfluous section checks when onlining/offlining":
drivers/base/memory.c: drop section_count
drivers/base/memory.c: drop pages_correctly_probed()
mm/page_ext.c: drop pfn_present() check when onlining
Baoquan He <bhe@redhat.com>:
mm/memory_hotplug.c: only respect mem= parameter during boot stage
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug.c: simplify calculation of number of pages in __remove_pages()
mm/memory_hotplug.c: cleanup __add_pages()
Baoquan He <bhe@redhat.com>:
Patch series "mm/hotplug: Only use subsection map for VMEMMAP", v4:
mm/sparse.c: introduce new function fill_subsection_map()
mm/sparse.c: introduce a new function clear_subsection_map()
mm/sparse.c: only use subsection map in VMEMMAP case
mm/sparse.c: add note about only VMEMMAP supporting sub-section hotplug
mm/sparse.c: move subsection_map related functions together
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: allow to specify a default online_type", v3:
drivers/base/memory: rename MMOP_ONLINE_KEEP to MMOP_ONLINE
drivers/base/memory: map MMOP_OFFLINE to 0
drivers/base/memory: store mapping between MMOP_* and string in an array
powernv/memtrace: always online added memory blocks
hv_balloon: don't check for memhp_auto_online manually
mm/memory_hotplug: unexport memhp_auto_online
mm/memory_hotplug: convert memhp_auto_online to store an online_type
mm/memory_hotplug: allow to specify a default online_type
chenqiwu <chenqiwu@xiaomi.com>:
mm/memory_hotplug.c: use __pfn_to_section() instead of open-coding
Subsystem: mm/shmem
Kees Cook <keescook@chromium.org>:
mm/shmem.c: distribute switch variables for initialization
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/shmem.c: clean code by removing unnecessary assignment
Hugh Dickins <hughd@google.com>:
mm: huge tmpfs: try to split_huge_page() when punching hole
Subsystem: mm/rmap
Palmer Dabbelt <palmerdabbelt@google.com>:
mm: prevent a warning when casting void* -> enum
Subsystem: mm/zswap
"Maciej S. Szmigiero" <mail@maciej.szmigiero.name>:
mm/zswap: allow setting default status, compressor and allocator in Kconfig
Subsystem: mm/zsmalloc
Subsystem: mm/cleanups
Jules Irenge <jbi.octave@gmail.com>:
mm/compaction: add missing annotation for compact_lock_irqsave
mm/hugetlb: add missing annotation for gather_surplus_pages()
mm/mempolicy: add missing annotation for queue_pages_pmd()
mm/slub: add missing annotation for get_map()
mm/slub: add missing annotation for put_map()
mm/zsmalloc: add missing annotation for migrate_read_lock()
mm/zsmalloc: add missing annotation for migrate_read_unlock()
mm/zsmalloc: add missing annotation for pin_tag()
mm/zsmalloc: add missing annotation for unpin_tag()
chenqiwu <chenqiwu@xiaomi.com>:
mm: fix ambiguous comments for better code readability
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/mm_init.c: clean code. Use BUILD_BUG_ON when comparing compile time constant
Joe Perches <joe@perches.com>:
mm: use fallthrough;
Steven Price <steven.price@arm.com>:
include/linux/swapops.h: correct guards for non_swap_entry()
Ira Weiny <ira.weiny@intel.com>:
include/linux/memremap.h: remove stale comments
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/dmapool.c: micro-optimisation remove unnecessary branch
Waiman Long <longman@redhat.com>:
mm: remove dummy struct bootmem_data/bootmem_data_t
Subsystem: procfs
Jules Irenge <jbi.octave@gmail.com>:
fs/proc/inode.c: annotate close_pdeo() for sparse
Alexey Dobriyan <adobriyan@gmail.com>:
proc: faster open/read/close with "permanent" files
proc: speed up /proc/*/statm
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
proc: inline vma_stop into m_stop
proc: remove m_cache_vma
proc: use ppos instead of m->version
seq_file: remove m->version
proc: inline m_next_vma into m_next
Subsystem: misc
Michal Simek <michal.simek@xilinx.com>:
asm-generic: fix unistd_32.h generation format
Nathan Chancellor <natechancellor@gmail.com>:
kernel/extable.c: use address-of operator on section symbols
Masahiro Yamada <masahiroy@kernel.org>:
sparc,x86: vdso: remove meaningless undefining CONFIG_OPTIMIZE_INLINING
compiler: remove CONFIG_OPTIMIZE_INLINING entirely
Vegard Nossum <vegard.nossum@oracle.com>:
compiler.h: fix error in BUILD_BUG_ON() reporting
Subsystem: MAINTAINERS
Joe Perches <joe@perches.com>:
MAINTAINERS: list the section entries in the preferred order
Subsystem: bitops
Josh Poimboeuf <jpoimboe@redhat.com>:
bitops: always inline sign extension helpers
Subsystem: lib
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
lib/test_lockup: test module to generate lockups
Colin Ian King <colin.king@canonical.com>:
lib/test_lockup.c: fix spelling mistake "iteraions" -> "iterations"
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
lib/test_lockup.c: add parameters for locking generic vfs locks
"Gustavo A. R. Silva" <gustavo@embeddedor.com>:
lib/bch.c: replace zero-length array with flexible-array member
lib/ts_bm.c: replace zero-length array with flexible-array member
lib/ts_fsm.c: replace zero-length array with flexible-array member
lib/ts_kmp.c: replace zero-length array with flexible-array member
Geert Uytterhoeven <geert+renesas@glider.be>:
lib/scatterlist: fix sg_copy_buffer() kerneldoc
Kees Cook <keescook@chromium.org>:
lib: test_stackinit.c: XFAIL switch variable init tests
Alexander Potapenko <glider@google.com>:
lib/stackdepot.c: check depot_index before accessing the stack slab
lib/stackdepot.c: fix a condition in stack_depot_fetch()
lib/stackdepot.c: build with -fno-builtin
kasan: stackdepot: move filter_irq_stacks() to stackdepot.c
Qian Cai <cai@lca.pw>:
percpu_counter: fix a data race at vm_committed_as
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
lib/test_bitmap.c: make use of EXP2_IN_BITS
chenqiwu <chenqiwu@xiaomi.com>:
lib/rbtree: fix coding style of assignments
Dan Carpenter <dan.carpenter@oracle.com>:
lib/test_kmod.c: remove a NULL test
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
linux/bits.h: add compile time sanity check of GENMASK inputs
Chris Wilson <chris@chris-wilson.co.uk>:
lib/list: prevent compiler reloads inside 'safe' list iteration
Nathan Chancellor <natechancellor@gmail.com>:
lib/dynamic_debug.c: use address-of operator on section symbols
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: remove email address comment from email address comparisons
Lubomir Rintel <lkundrak@v3.sk>:
checkpatch: check SPDX tags in YAML files
John Hubbard <jhubbard@nvidia.com>:
checkpatch: support "base-commit:" format
Joe Perches <joe@perches.com>:
checkpatch: prefer fallthrough; over fallthrough comments
Antonio Borneo <borneo.antonio@gmail.com>:
checkpatch: fix minor typo and mixed space+tab in indentation
checkpatch: fix multiple const * types
checkpatch: add command-line option for TAB size
Joe Perches <joe@perches.com>:
checkpatch: improve Gerrit Change-Id: test
Lubomir Rintel <lkundrak@v3.sk>:
checkpatch: check proper licensing of Devicetree bindings
Joe Perches <joe@perches.com>:
checkpatch: avoid warning about uninitialized_var()
Subsystem: epoll
Roman Penyaev <rpenyaev@suse.de>:
kselftest: introduce new epoll test case
Jason Baron <jbaron@akamai.com>:
fs/epoll: make nesting accounting safe for -rt kernel
Subsystem: binfmt
Alexey Dobriyan <adobriyan@gmail.com>:
fs/binfmt_elf.c: delete "loc" variable
fs/binfmt_elf.c: allocate less for static executable
fs/binfmt_elf.c: don't free interpreter's ELF pheaders on common path
Subsystem: kallsyms
Will Deacon <will@kernel.org>:
Patch series "Unexport kallsyms_lookup_name() and kallsyms_on_each_symbol()":
samples/hw_breakpoint: drop HW_BREAKPOINT_R when reporting writes
samples/hw_breakpoint: drop use of kallsyms_lookup_name()
kallsyms: unexport kallsyms_lookup_name() and kallsyms_on_each_symbol()
Subsystem: reiserfs
Colin Ian King <colin.king@canonical.com>:
reiserfs: clean up several indentation issues
Subsystem: kmod
Qiujun Huang <hqjagain@gmail.com>:
kernel/kmod.c: fix a typo "assuems" -> "assumes"
Subsystem: gcov
"Gustavo A. R. Silva" <gustavo@embeddedor.com>:
gcov: gcc_4_7: replace zero-length array with flexible-array member
gcov: gcc_3_4: replace zero-length array with flexible-array member
kernel/gcov/fs.c: replace zero-length array with flexible-array member
Subsystem: kconfig
Krzysztof Kozlowski <krzk@kernel.org>:
init/Kconfig: clean up ANON_INODES and old IO schedulers options
Subsystem: kcov
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kcov: collect coverage from usb soft interrupts", v4:
kcov: cleanup debug messages
kcov: fix potential use-after-free in kcov_remote_start
kcov: move t->kcov assignments into kcov_start/stop
kcov: move t->kcov_sequence assignment
kcov: use t->kcov_mode as enabled indicator
kcov: collect coverage from interrupts
usb: core: kcov: collect coverage from usb complete callback
Subsystem: ubsan
Kees Cook <keescook@chromium.org>:
Patch series "ubsan: Split out bounds checker", v5:
ubsan: add trap instrumentation option
ubsan: split "bounds" checker from other options
drivers/misc/lkdtm/bugs.c: add arithmetic overflow and array bounds checks
ubsan: check panic_on_warn
kasan: unset panic_on_warn before calling panic()
ubsan: include bug type in report header
Subsystem: fault-injection
Qiujun Huang <hqjagain@gmail.com>:
lib/Kconfig.debug: fix a typo "capabilitiy" -> "capability"
Subsystem: ipc
Somala Swaraj <somalaswaraj@gmail.com>:
ipc/mqueue.c: fix a brace coding style issue
Jason Yan <yanaijie@huawei.com>:
ipc/shm.c: make compat_ksys_shmctl() static
Documentation/admin-guide/kernel-parameters.txt | 13
Documentation/admin-guide/mm/transhuge.rst | 14
Documentation/admin-guide/mm/userfaultfd.rst | 51
Documentation/dev-tools/kcov.rst | 17
Documentation/vm/free_page_reporting.rst | 41
Documentation/vm/zswap.rst | 20
MAINTAINERS | 35
arch/alpha/include/asm/mmzone.h | 2
arch/alpha/kernel/syscalls/syscallhdr.sh | 2
arch/csky/mm/fault.c | 4
arch/ia64/kernel/syscalls/syscallhdr.sh | 2
arch/ia64/kernel/vmlinux.lds.S | 2
arch/m68k/mm/fault.c | 4
arch/microblaze/kernel/syscalls/syscallhdr.sh | 2
arch/mips/kernel/syscalls/syscallhdr.sh | 3
arch/mips/mm/fault.c | 4
arch/nds32/kernel/vmlinux.lds.S | 1
arch/parisc/kernel/syscalls/syscallhdr.sh | 2
arch/powerpc/kernel/syscalls/syscallhdr.sh | 3
arch/powerpc/kvm/e500_mmu_host.c | 2
arch/powerpc/mm/fault.c | 2
arch/powerpc/platforms/powernv/memtrace.c | 14
arch/sh/kernel/syscalls/syscallhdr.sh | 2
arch/sh/mm/fault.c | 2
arch/sparc/kernel/syscalls/syscallhdr.sh | 2
arch/sparc/vdso/vdso32/vclock_gettime.c | 4
arch/x86/Kconfig | 1
arch/x86/configs/i386_defconfig | 1
arch/x86/configs/x86_64_defconfig | 1
arch/x86/entry/vdso/vdso32/vclock_gettime.c | 4
arch/x86/include/asm/pgtable.h | 67 +
arch/x86/include/asm/pgtable_64.h | 8
arch/x86/include/asm/pgtable_types.h | 12
arch/x86/mm/fault.c | 2
arch/xtensa/kernel/syscalls/syscallhdr.sh | 2
drivers/base/memory.c | 138 --
drivers/hv/hv_balloon.c | 25
drivers/misc/lkdtm/bugs.c | 75 +
drivers/misc/lkdtm/core.c | 3
drivers/misc/lkdtm/lkdtm.h | 3
drivers/usb/core/hcd.c | 3
drivers/virtio/Kconfig | 1
drivers/virtio/virtio_balloon.c | 190 ++-
fs/binfmt_elf.c | 56
fs/eventpoll.c | 64 -
fs/proc/array.c | 39
fs/proc/cpuinfo.c | 1
fs/proc/generic.c | 31
fs/proc/inode.c | 188 ++-
fs/proc/internal.h | 6
fs/proc/kmsg.c | 1
fs/proc/stat.c | 1
fs/proc/task_mmu.c | 97 -
fs/reiserfs/do_balan.c | 2
fs/reiserfs/ioctl.c | 11
fs/reiserfs/namei.c | 10
fs/seq_file.c | 28
fs/userfaultfd.c | 116 +
include/asm-generic/pgtable.h | 1
include/asm-generic/pgtable_uffd.h | 66 +
include/asm-generic/tlb.h | 3
include/linux/bitops.h | 4
include/linux/bits.h | 22
include/linux/compiler.h | 2
include/linux/compiler_types.h | 11
include/linux/gfp.h | 2
include/linux/huge_mm.h | 2
include/linux/list.h | 50
include/linux/memory.h | 1
include/linux/memory_hotplug.h | 13
include/linux/memremap.h | 2
include/linux/mm.h | 25
include/linux/mm_inline.h | 15
include/linux/mm_types.h | 4
include/linux/mmzone.h | 47
include/linux/page-flags.h | 16
include/linux/page_reporting.h | 26
include/linux/pagemap.h | 4
include/linux/percpu_counter.h | 4
include/linux/proc_fs.h | 17
include/linux/sched.h | 3
include/linux/seq_file.h | 1
include/linux/shmem_fs.h | 10
include/linux/stackdepot.h | 2
include/linux/swapops.h | 5
include/linux/userfaultfd_k.h | 42
include/linux/vm_event_item.h | 5
include/trace/events/huge_memory.h | 1
include/trace/events/mmflags.h | 1
include/trace/events/vmscan.h | 2
include/uapi/linux/userfaultfd.h | 40
include/uapi/linux/virtio_balloon.h | 1
init/Kconfig | 8
ipc/mqueue.c | 5
ipc/shm.c | 2
ipc/util.c | 1
kernel/configs/tiny.config | 1
kernel/events/core.c | 3
kernel/extable.c | 3
kernel/fork.c | 10
kernel/gcov/fs.c | 2
kernel/gcov/gcc_3_4.c | 6
kernel/gcov/gcc_4_7.c | 2
kernel/kallsyms.c | 2
kernel/kcov.c | 282 +++-
kernel/kmod.c | 2
kernel/module.c | 1
kernel/sched/fair.c | 2
lib/Kconfig.debug | 35
lib/Kconfig.ubsan | 51
lib/Makefile | 8
lib/bch.c | 2
lib/dynamic_debug.c | 2
lib/rbtree.c | 4
lib/scatterlist.c | 2
lib/stackdepot.c | 39
lib/test_bitmap.c | 2
lib/test_kmod.c | 2
lib/test_lockup.c | 601 +++++++++-
lib/test_stackinit.c | 28
lib/ts_bm.c | 2
lib/ts_fsm.c | 2
lib/ts_kmp.c | 2
lib/ubsan.c | 47
mm/Kconfig | 135 ++
mm/Makefile | 1
mm/compaction.c | 3
mm/dmapool.c | 4
mm/filemap.c | 14
mm/gup.c | 9
mm/huge_memory.c | 36
mm/hugetlb.c | 1
mm/hugetlb_cgroup.c | 6
mm/internal.h | 2
mm/kasan/common.c | 23
mm/kasan/report.c | 10
mm/khugepaged.c | 39
mm/ksm.c | 5
mm/list_lru.c | 2
mm/memcontrol.c | 5
mm/memory-failure.c | 2
mm/memory.c | 42
mm/memory_hotplug.c | 53
mm/mempolicy.c | 11
mm/migrate.c | 122 +-
mm/mm_init.c | 2
mm/mmap.c | 10
mm/mprotect.c | 76 -
mm/page_alloc.c | 174 ++
mm/page_ext.c | 5
mm/page_isolation.c | 6
mm/page_reporting.c | 384 ++++++
mm/page_reporting.h | 54
mm/rmap.c | 23
mm/shmem.c | 168 +-
mm/shuffle.c | 12
mm/shuffle.h | 6
mm/slab_common.c | 1
mm/slub.c | 3
mm/sparse.c | 236 ++-
mm/swap.c | 20
mm/swapfile.c | 1
mm/userfaultfd.c | 98 +
mm/vmalloc.c | 2
mm/vmscan.c | 12
mm/vmstat.c | 3
mm/zsmalloc.c | 10
mm/zswap.c | 24
samples/hw_breakpoint/data_breakpoint.c | 11
scripts/Makefile.ubsan | 16
scripts/checkpatch.pl | 155 +-
tools/lib/rbtree.c | 4
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 67 +
tools/testing/selftests/vm/userfaultfd.c | 233 +++
174 files changed, 3990 insertions(+), 1399 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-04-10 21:30 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-04-10 21:30 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
Almost all of the rest of MM. Various other things.
35 patches, based on c0cc271173b2e1c2d8d0ceaef14e4dfa79eefc0d.
Subsystems affected by this patch series:
hfs
mm/memcg
mm/slab-generic
mm/slab
mm/pagealloc
mm/gup
ocfs2
mm/hugetlb
mm/pagemap
mm/memremap
kmod
misc
seqfile
Subsystem: hfs
Simon Gander <simon@tuxera.com>:
hfsplus: fix crash and filesystem corruption when deleting files
Subsystem: mm/memcg
Jakub Kicinski <kuba@kernel.org>:
mm, memcg: do not high throttle allocators based on wraparound
Subsystem: mm/slab-generic
Qiujun Huang <hqjagain@gmail.com>:
mm, slab_common: fix a typo in comment "eariler"->"earlier"
Subsystem: mm/slab
Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
docs: mm: slab.h: fix a broken cross-reference
Subsystem: mm/pagealloc
Randy Dunlap <rdunlap@infradead.org>:
mm/page_alloc.c: fix kernel-doc warning
Jason Yan <yanaijie@huawei.com>:
mm/page_alloc: make pcpu_drain_mutex and pcpu_drain static
Subsystem: mm/gup
Miles Chen <miles.chen@mediatek.com>:
mm/gup: fix null pointer dereference detected by coverity
Subsystem: ocfs2
Changwei Ge <chge@linux.alibaba.com>:
ocfs2: no need try to truncate file beyond i_size
Subsystem: mm/hugetlb
Aslan Bakirov <aslan@fb.com>:
mm: cma: NUMA node interface
Roman Gushchin <guro@fb.com>:
mm: hugetlb: optionally allocate gigantic hugepages using cma
Subsystem: mm/pagemap
Jaewon Kim <jaewon31.kim@samsung.com>:
mm/mmap.c: initialize align_offset explicitly for vm_unmapped_area
Arjun Roy <arjunroy@google.com>:
mm/memory.c: refactor insert_page to prepare for batched-lock insert
mm: bring sparc pte_index() semantics inline with other platforms
mm: define pte_index as macro for x86
mm/memory.c: add vm_insert_pages()
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/vma: define a default value for VM_DATA_DEFAULT_FLAGS
mm/vma: introduce VM_ACCESS_FLAGS
mm/special: create generic fallbacks for pte_special() and pte_mkspecial()
Subsystem: mm/memremap
Logan Gunthorpe <logang@deltatee.com>:
Patch series "Allow setting caching mode in arch_add_memory() for P2PDMA", v4:
mm/memory_hotplug: drop the flags field from struct mhp_restrictions
mm/memory_hotplug: rename mhp_restrictions to mhp_params
x86/mm: thread pgprot_t through init_memory_mapping()
x86/mm: introduce __set_memory_prot()
powerpc/mm: thread pgprot_t through create_section_mapping()
mm/memory_hotplug: add pgprot_t to mhp_params
mm/memremap: set caching mode for PCI P2PDMA memory to WC
Subsystem: kmod
Eric Biggers <ebiggers@google.com>:
Patch series "module autoloading fixes and cleanups", v5:
kmod: make request_module() return an error when autoloading is disabled
fs/filesystems.c: downgrade user-reachable WARN_ONCE() to pr_warn_once()
docs: admin-guide: document the kernel.modprobe sysctl
selftests: kmod: fix handling test numbers above 9
selftests: kmod: test disabling module autoloading
Subsystem: misc
Pali Rohár <pali@kernel.org>:
change email address for Pali Rohár
kbuild test robot <lkp@intel.com>:
drivers/dma/tegra20-apb-dma.c: fix platform_get_irq.cocci warnings
Subsystem: seqfile
Vasily Averin <vvs@virtuozzo.com>:
Patch series "seq_file .next functions should increase position index":
fs/seq_file.c: seq_read(): add info message about buggy .next functions
kernel/gcov/fs.c: gcov_seq_next() should increase position index
ipc/util.c: sysvipc_find_ipc() should increase position index
Documentation/ABI/testing/sysfs-platform-dell-laptop | 8
Documentation/admin-guide/kernel-parameters.txt | 8
Documentation/admin-guide/sysctl/kernel.rst | 21 ++
MAINTAINERS | 16 -
arch/alpha/include/asm/page.h | 3
arch/alpha/include/asm/pgtable.h | 2
arch/arc/include/asm/page.h | 2
arch/arm/include/asm/page.h | 4
arch/arm/include/asm/pgtable-2level.h | 2
arch/arm/include/asm/pgtable.h | 15 -
arch/arm/mach-omap2/omap-secure.c | 2
arch/arm/mach-omap2/omap-secure.h | 2
arch/arm/mach-omap2/omap-smc.S | 2
arch/arm/mm/fault.c | 2
arch/arm/mm/mmu.c | 14 +
arch/arm64/include/asm/page.h | 4
arch/arm64/mm/fault.c | 2
arch/arm64/mm/init.c | 6
arch/arm64/mm/mmu.c | 7
arch/c6x/include/asm/page.h | 5
arch/csky/include/asm/page.h | 3
arch/csky/include/asm/pgtable.h | 3
arch/h8300/include/asm/page.h | 2
arch/hexagon/include/asm/page.h | 3
arch/hexagon/include/asm/pgtable.h | 2
arch/ia64/include/asm/page.h | 5
arch/ia64/include/asm/pgtable.h | 2
arch/ia64/mm/init.c | 7
arch/m68k/include/asm/mcf_pgtable.h | 10 -
arch/m68k/include/asm/motorola_pgtable.h | 2
arch/m68k/include/asm/page.h | 3
arch/m68k/include/asm/sun3_pgtable.h | 2
arch/microblaze/include/asm/page.h | 2
arch/microblaze/include/asm/pgtable.h | 4
arch/mips/include/asm/page.h | 5
arch/mips/include/asm/pgtable.h | 44 +++-
arch/nds32/include/asm/page.h | 3
arch/nds32/include/asm/pgtable.h | 9 -
arch/nds32/mm/fault.c | 2
arch/nios2/include/asm/page.h | 3
arch/nios2/include/asm/pgtable.h | 3
arch/openrisc/include/asm/page.h | 5
arch/openrisc/include/asm/pgtable.h | 2
arch/parisc/include/asm/page.h | 3
arch/parisc/include/asm/pgtable.h | 2
arch/powerpc/include/asm/book3s/64/hash.h | 3
arch/powerpc/include/asm/book3s/64/radix.h | 3
arch/powerpc/include/asm/page.h | 9 -
arch/powerpc/include/asm/page_64.h | 7
arch/powerpc/include/asm/sparsemem.h | 3
arch/powerpc/mm/book3s64/hash_utils.c | 5
arch/powerpc/mm/book3s64/pgtable.c | 7
arch/powerpc/mm/book3s64/pkeys.c | 2
arch/powerpc/mm/book3s64/radix_pgtable.c | 18 +-
arch/powerpc/mm/mem.c | 12 -
arch/riscv/include/asm/page.h | 3
arch/s390/include/asm/page.h | 3
arch/s390/mm/fault.c | 2
arch/s390/mm/init.c | 9 -
arch/sh/include/asm/page.h | 3
arch/sh/mm/init.c | 7
arch/sparc/include/asm/page_32.h | 3
arch/sparc/include/asm/page_64.h | 3
arch/sparc/include/asm/pgtable_32.h | 7
arch/sparc/include/asm/pgtable_64.h | 10 -
arch/um/include/asm/pgtable.h | 10 -
arch/unicore32/include/asm/page.h | 3
arch/unicore32/include/asm/pgtable.h | 3
arch/unicore32/mm/fault.c | 2
arch/x86/include/asm/page_types.h | 7
arch/x86/include/asm/pgtable.h | 6
arch/x86/include/asm/set_memory.h | 1
arch/x86/kernel/amd_gart_64.c | 3
arch/x86/kernel/setup.c | 4
arch/x86/mm/init.c | 9 -
arch/x86/mm/init_32.c | 19 +-
arch/x86/mm/init_64.c | 42 ++--
arch/x86/mm/mm_internal.h | 3
arch/x86/mm/pat/set_memory.c | 13 +
arch/x86/mm/pkeys.c | 2
arch/x86/platform/uv/bios_uv.c | 3
arch/x86/um/asm/vm-flags.h | 10 -
arch/xtensa/include/asm/page.h | 3
arch/xtensa/include/asm/pgtable.h | 3
drivers/char/hw_random/omap3-rom-rng.c | 4
drivers/dma/tegra20-apb-dma.c | 1
drivers/hwmon/dell-smm-hwmon.c | 4
drivers/platform/x86/dell-laptop.c | 4
drivers/platform/x86/dell-rbtn.c | 4
drivers/platform/x86/dell-rbtn.h | 2
drivers/platform/x86/dell-smbios-base.c | 4
drivers/platform/x86/dell-smbios-smm.c | 2
drivers/platform/x86/dell-smbios.h | 2
drivers/platform/x86/dell-smo8800.c | 2
drivers/platform/x86/dell-wmi.c | 4
drivers/power/supply/bq2415x_charger.c | 4
drivers/power/supply/bq27xxx_battery.c | 2
drivers/power/supply/isp1704_charger.c | 2
drivers/power/supply/rx51_battery.c | 4
drivers/staging/gasket/gasket_core.c | 2
fs/filesystems.c | 4
fs/hfsplus/attributes.c | 4
fs/ocfs2/alloc.c | 4
fs/seq_file.c | 7
fs/udf/ecma_167.h | 2
fs/udf/osta_udf.h | 2
include/linux/cma.h | 14 +
include/linux/hugetlb.h | 12 +
include/linux/memblock.h | 3
include/linux/memory_hotplug.h | 21 +-
include/linux/mm.h | 34 +++
include/linux/power/bq2415x_charger.h | 2
include/linux/slab.h | 2
ipc/util.c | 2
kernel/gcov/fs.c | 2
kernel/kmod.c | 4
mm/cma.c | 16 +
mm/gup.c | 3
mm/hugetlb.c | 109 ++++++++++++
mm/memblock.c | 2
mm/memcontrol.c | 3
mm/memory.c | 168 +++++++++++++++++--
mm/memory_hotplug.c | 13 -
mm/memremap.c | 17 +
mm/mmap.c | 4
mm/mprotect.c | 4
mm/page_alloc.c | 5
mm/slab_common.c | 2
tools/laptop/freefall/freefall.c | 2
tools/testing/selftests/kmod/kmod.sh | 43 ++++
130 files changed, 710 insertions(+), 370 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-04-12 7:41 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-04-12 7:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
A straggler. This patch caused a lot of build errors on a lot of
architectures for a long time, but Anshuman believes it's all fixed up
now.
1 patch, based on GIT b032227c62939b5481bcd45442b36dfa263f4a7c.
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/debug: add tests validating architecture page table helpers
Documentation/features/debug/debug-vm-pgtable/arch-support.txt | 34
arch/arc/Kconfig | 1
arch/arm64/Kconfig | 1
arch/powerpc/Kconfig | 1
arch/s390/Kconfig | 1
arch/x86/Kconfig | 1
arch/x86/include/asm/pgtable_64.h | 6
include/linux/mmdebug.h | 5
init/main.c | 2
lib/Kconfig.debug | 26
mm/Makefile | 1
mm/debug_vm_pgtable.c | 392 ++++++++++
12 files changed, 471 insertions(+)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-04-21 1:13 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-04-21 1:13 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
15 fixes, based on ae83d0b416db002fe95601e7f97f64b59514d936:
Masahiro Yamada <masahiroy@kernel.org>:
sh: fix build error in mm/init.c
Kees Cook <keescook@chromium.org>:
slub: avoid redzone when choosing freepointer location
Peter Xu <peterx@redhat.com>:
mm/userfaultfd: disable userfaultfd-wp on x86_32
Bartosz Golaszewski <bgolaszewski@baylibre.com>:
MAINTAINERS: add an entry for kfifo
Longpeng <longpeng2@huawei.com>:
mm/hugetlb: fix a addressing exception caused by huge_pte_offset
Michal Hocko <mhocko@suse.com>:
mm, gup: return EINTR when gup is interrupted by fatal signals
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
checkpatch: fix a typo in the regex for $allocFunctions
George Burgess IV <gbiv@google.com>:
tools/build: tweak unused value workaround
Muchun Song <songmuchun@bytedance.com>:
mm/ksm: fix NULL pointer dereference when KSM zero page is enabled
Hugh Dickins <hughd@google.com>:
mm/shmem: fix build without THP
Jann Horn <jannh@google.com>:
vmalloc: fix remap_vmalloc_range() bounds checks
Hugh Dickins <hughd@google.com>:
shmem: fix possible deadlocks on shmlock_user_lock
Yang Shi <yang.shi@linux.alibaba.com>:
mm: shmem: disable interrupt when acquiring info->lock in userfaultfd_copy path
Sudip Mukherjee <sudipm.mukherjee@gmail.com>:
coredump: fix null pointer dereference on coredump
Lucas Stach <l.stach@pengutronix.de>:
tools/vm: fix cross-compile build
MAINTAINERS | 7 +++++++
arch/sh/mm/init.c | 2 +-
arch/x86/Kconfig | 2 +-
fs/coredump.c | 2 ++
fs/proc/vmcore.c | 5 +++--
include/linux/vmalloc.h | 2 +-
mm/gup.c | 2 +-
mm/hugetlb.c | 14 ++++++++------
mm/ksm.c | 12 ++++++++++--
mm/shmem.c | 13 ++++++++-----
mm/slub.c | 12 ++++++++++--
mm/vmalloc.c | 16 +++++++++++++---
samples/vfio-mdev/mdpy.c | 2 +-
scripts/checkpatch.pl | 2 +-
tools/build/feature/test-sync-compare-and-swap.c | 2 +-
tools/vm/Makefile | 2 ++
16 files changed, 70 insertions(+), 27 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-05-08 1:35 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-05-08 1:35 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
14 fixes and one selftest to verify the ipc fixes herein.
15 patches, based on a811c1fa0a02c062555b54651065899437bacdbe:
Oleg Nesterov <oleg@redhat.com>:
ipc/mqueue.c: change __do_notify() to bypass check_kill_permission()
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: fix error return value of mem_cgroup_css_alloc()
David Hildenbrand <david@redhat.com>:
mm/page_alloc: fix watchdog soft lockups during set_zone_contiguous()
Maciej Grochowski <maciej.grochowski@pm.me>:
kernel/kcov.c: fix typos in kcov_remote_start documentation
Ivan Delalande <colona@arista.com>:
scripts/decodecode: fix trapping instruction formatting
Janakarajan Natarajan <Janakarajan.Natarajan@amd.com>:
arch/x86/kvm/svm/sev.c: change flag passed to GUP fast in sev_pin_memory()
Khazhismel Kumykov <khazhy@google.com>:
eventpoll: fix missing wakeup for ovflist in ep_poll_callback
Aymeric Agon-Rambosson <aymeric.agon@yandex.com>:
scripts/gdb: repair rb_first() and rb_last()
Waiman Long <longman@redhat.com>:
mm/slub: fix incorrect interpretation of s->offset
Filipe Manana <fdmanana@suse.com>:
percpu: make pcpu_alloc() aware of current gfp context
Roman Penyaev <rpenyaev@suse.de>:
kselftests: introduce new epoll60 testcase for catching lost wakeups
epoll: atomically remove wait entry on wake up
Qiwu Chen <qiwuchen55@gmail.com>:
mm/vmscan: remove unnecessary argument description of isolate_lru_pages()
Kees Cook <keescook@chromium.org>:
ubsan: disable UBSAN_ALIGNMENT under COMPILE_TEST
Henry Willard <henry.willard@oracle.com>:
mm: limit boost_watermark on small zones
arch/x86/kvm/svm/sev.c | 2
fs/eventpoll.c | 61 ++--
ipc/mqueue.c | 34 +-
kernel/kcov.c | 4
lib/Kconfig.ubsan | 15 -
mm/memcontrol.c | 15 -
mm/page_alloc.c | 9
mm/percpu.c | 14
mm/slub.c | 45 ++-
mm/vmscan.c | 1
scripts/decodecode | 2
scripts/gdb/linux/rbtree.py | 4
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 146 ++++++++++
tools/testing/selftests/wireguard/qemu/debug.config | 1
14 files changed, 275 insertions(+), 78 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-05-14 0:50 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-05-14 0:50 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
7 fixes, based on 24085f70a6e1b0cb647ec92623284641d8270637:
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: fix inconsistent oom event behavior
Roman Penyaev <rpenyaev@suse.de>:
epoll: call final ep_events_available() check under the lock
Peter Xu <peterx@redhat.com>:
mm/gup: fix fixup_user_fault() on multiple retries
Brian Geffon <bgeffon@google.com>:
userfaultfd: fix remap event with MREMAP_DONTUNMAP
Vasily Averin <vvs@virtuozzo.com>:
ipc/util.c: sysvipc_find_ipc() incorrectly updates position index
Andrey Konovalov <andreyknvl@google.com>:
kasan: consistently disable debugging features
kasan: add missing functions declarations to kasan.h
fs/eventpoll.c | 48 ++++++++++++++++++++++++++-------------------
include/linux/memcontrol.h | 2 +
ipc/util.c | 12 +++++------
mm/gup.c | 12 ++++++-----
mm/kasan/Makefile | 15 +++++++++-----
mm/kasan/kasan.h | 34 ++++++++++++++++++++++++++++++-
mm/mremap.c | 2 -
7 files changed, 86 insertions(+), 39 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-05-23 5:22 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-05-23 5:22 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
11 fixes, based on 444565650a5fe9c63ddf153e6198e31705dedeb2:
David Hildenbrand <david@redhat.com>:
device-dax: don't leak kernel memory to user space after unloading kmem
Nick Desaulniers <ndesaulniers@google.com>:
x86: bitops: fix build regression
John Hubbard <jhubbard@nvidia.com>:
rapidio: fix an error in get_user_pages_fast() error handling
selftests/vm/.gitignore: add mremap_dontunmap
selftests/vm/write_to_hugetlbfs.c: fix unused variable warning
Marco Elver <elver@google.com>:
kasan: disable branch tracing for core runtime
Arnd Bergmann <arnd@arndb.de>:
sh: include linux/time_types.h for sockios
Naoya Horiguchi <n-horiguchi@ah.jp.nec.com>:
MAINTAINERS: update email address for Naoya Horiguchi
Mike Rapoport <rppt@linux.ibm.com>:
sparc32: use PUD rather than PGD to get PMD in srmmu_nocache_init()
Uladzislau Rezki <uladzislau.rezki@sony.com>:
z3fold: fix use-after-free when freeing handles
Baoquan He <bhe@redhat.com>:
MAINTAINERS: add files related to kdump
MAINTAINERS | 7 ++++++-
arch/sh/include/uapi/asm/sockios.h | 2 ++
arch/sparc/mm/srmmu.c | 2 +-
arch/x86/include/asm/bitops.h | 12 ++++++------
drivers/dax/kmem.c | 14 +++++++++++---
drivers/rapidio/devices/rio_mport_cdev.c | 5 +++++
mm/kasan/Makefile | 16 ++++++++--------
mm/kasan/generic.c | 1 -
mm/kasan/tags.c | 1 -
mm/z3fold.c | 11 ++++++-----
tools/testing/selftests/vm/.gitignore | 1 +
tools/testing/selftests/vm/write_to_hugetlbfs.c | 2 --
12 files changed, 46 insertions(+), 28 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-05-28 5:20 Andrew Morton
2020-05-28 20:10 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-05-28 5:20 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
5 fixes, based on 444fc5cde64330661bf59944c43844e7d4c2ccd8:
Qian Cai <cai@lca.pw>:
mm/z3fold: silence kmemleak false positives of slots
Hugh Dickins <hughd@google.com>:
mm,thp: stop leaking unreleased file pages
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
mm: remove VM_BUG_ON(PageSlab()) from page_mapcount()
Alexander Potapenko <glider@google.com>:
fs/binfmt_elf.c: allocate initialized memory in fill_thread_core_info()
Arnd Bergmann <arnd@arndb.de>:
include/asm-generic/topology.h: guard cpumask_of_node() macro argument
fs/binfmt_elf.c | 2 +-
include/asm-generic/topology.h | 2 +-
include/linux/mm.h | 19 +++++++++++++++----
mm/khugepaged.c | 1 +
mm/z3fold.c | 3 +++
5 files changed, 21 insertions(+), 6 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-05-28 5:20 incoming Andrew Morton
@ 2020-05-28 20:10 ` Linus Torvalds
2020-05-29 20:31 ` incoming Andrew Morton
0 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2020-05-28 20:10 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
Hmm..
On Wed, May 27, 2020 at 10:20 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> fs/binfmt_elf.c | 2 +-
> include/asm-generic/topology.h | 2 +-
> include/linux/mm.h | 19 +++++++++++++++----
> mm/khugepaged.c | 1 +
> mm/z3fold.c | 3 +++
> 5 files changed, 21 insertions(+), 6 deletions(-)
I wonder how you generate that diffstat.
The change to <linux/mm.h> simply doesn't match what you sent me. The
patch you sent me that changed mm.h had this:
include/linux/mm.h | 15 +++++++++++++--
1 file changed, 13 insertions(+), 2 deletions(-)
(note 15 lines changed: it's +13 and -2) but now suddenly in your
overall diffstat you have that
include/linux/mm.h | 19 +++++++++++++++----
with +15/-4.
So your diffstat simply doesn't match what you are sending. What's going on?
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-05-28 20:10 ` incoming Linus Torvalds
@ 2020-05-29 20:31 ` Andrew Morton
2020-05-29 20:38 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-05-29 20:31 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, Linux-MM
On Thu, 28 May 2020 13:10:18 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> Hmm..
>
> On Wed, May 27, 2020 at 10:20 PM Andrew Morton
> <akpm@linux-foundation.org> wrote:
> >
> > fs/binfmt_elf.c | 2 +-
> > include/asm-generic/topology.h | 2 +-
> > include/linux/mm.h | 19 +++++++++++++++----
> > mm/khugepaged.c | 1 +
> > mm/z3fold.c | 3 +++
> > 5 files changed, 21 insertions(+), 6 deletions(-)
>
> I wonder how you generate that diffstat.
>
> The change to <linux/mm.h> simply doesn't match what you sent me. The
> patch you sent me that changed mm.h had this:
>
> include/linux/mm.h | 15 +++++++++++++--
> 1 file changed, 13 insertions(+), 2 deletions(-)
>
> (note 15 lines changed: it's +13 and -2) but now suddenly in your
> overall diffstat you have that
>
> include/linux/mm.h | 19 +++++++++++++++----
>
> with +15/-4.
>
> So your diffstat simply doesn't match what you are sending. What's going on?
>
Bah. I got lazy (didn't want to interrupt an ongoing build) so I
generated the diffstat prior to folding two patches into a single one.
Evidently diffstat isn't as smart as I had assumed!
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-05-29 20:31 ` incoming Andrew Morton
@ 2020-05-29 20:38 ` Linus Torvalds
2020-05-29 21:12 ` incoming Andrew Morton
0 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2020-05-29 20:38 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Fri, May 29, 2020 at 1:31 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> Bah. I got lazy (didn't want to interrupt an ongoing build) so I
> generated the diffstat prior to folding two patches into a single one.
> Evidently diffstat isn't as smart as I had assumed!
Ahh. Yes - given two patches, diffstat just adds up the line number
counts for the individual diffs, it doesn't count some kind of
"combined diff result" line counts.
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-05-29 20:38 ` incoming Linus Torvalds
@ 2020-05-29 21:12 ` Andrew Morton
2020-05-29 21:20 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-05-29 21:12 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, Linux-MM
On Fri, 29 May 2020 13:38:35 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Fri, May 29, 2020 at 1:31 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > Bah. I got lazy (didn't want to interrupt an ongoing build) so I
> > generated the diffstat prior to folding two patches into a single one.
> > Evidently diffstat isn't as smart as I had assumed!
>
> Ahh. Yes - given two patches, diffstat just adds up the line number
> counts for the individual diffs, it doesn't count some kind of
> "combined diff result" line counts.
Stupid diffstat. Means that basically all my diffstats are very wrong.
Thanks for spotting it.
I can fix that...
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-05-29 21:12 ` incoming Andrew Morton
@ 2020-05-29 21:20 ` Linus Torvalds
0 siblings, 0 replies; 419+ messages in thread
From: Linus Torvalds @ 2020-05-29 21:20 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Fri, May 29, 2020 at 2:12 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> Stupid diffstat. Means that basically all my diffstats are very wrong.
I'm actually used to diffstats not matching 100%/
Usually it's not due to this issue - a "git diff --stat" *will* give
the stat from the actual combined diff result - but with git diffstats
the issue is that I might have gotten a patch from another source.
So the diffstat I see after-the-merge is possibly different from the
pre-merge diffstat simply due to merge issues.
So then I usually take a look at "ok, why did that diffstat differ"
and go "Ahh".
In your case, when I looked at the diffstat, I couldn't for the life
of me see how you would have gotten the diffstat you did, since I only
saw a single patch with no merge issues.
> Thanks for spotting it.
>
> I can fix that...
I can also just live with it, knowing what your workflow is. The
diffstat matching exactly just isn't that important - in fact,
different versions of "diff" can give slightly different output anyway
depending on diff algorithms even when they are looking at the exact
same before/after state. There's not necessarily always only one way
to generate a valid diff.
So to me, the diffstat is more of a guide than a hard thing, and I
want to see the rough outline,
In fact, one reason I want to see it in pull requests is actually just
that I want to get a feel for what changes even before I do the pull
or merge, so it's not just a "match against what I get" thing.
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-06-02 4:44 Andrew Morton
2020-06-02 20:08 ` incoming Andrew Morton
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-06-02 4:44 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
A few little subsystems and a start of a lot of MM patches.
128 patches, based on 9bf9511e3d9f328c03f6f79bfb741c3d18f2f2c0:
Subsystems affected by this patch series:
squashfs
ocfs2
parisc
vfs
mm/slab-generic
mm/slub
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/memory-failure
mm/vmalloc
mm/kasan
Subsystem: squashfs
Philippe Liard <pliard@google.com>:
squashfs: migrate from ll_rw_block usage to BIO
Subsystem: ocfs2
Jules Irenge <jbi.octave@gmail.com>:
ocfs2: add missing annotation for dlm_empty_lockres()
Gang He <ghe@suse.com>:
ocfs2: mount shared volume without ha stack
Subsystem: parisc
Andrew Morton <akpm@linux-foundation.org>:
arch/parisc/include/asm/pgtable.h: remove unused `old_pte'
Subsystem: vfs
Jeff Layton <jlayton@redhat.com>:
Patch series "vfs: have syncfs() return error when there are writeback:
vfs: track per-sb writeback errors and report them to syncfs
fs/buffer.c: record blockdev write errors in super_block that it backs
Subsystem: mm/slab-generic
Vlastimil Babka <vbabka@suse.cz>:
usercopy: mark dma-kmalloc caches as usercopy caches
Subsystem: mm/slub
Dongli Zhang <dongli.zhang@oracle.com>:
mm/slub.c: fix corrupted freechain in deactivate_slab()
Christoph Lameter <cl@linux.com>:
slub: Remove userspace notifier for cache add/remove
Christopher Lameter <cl@linux.com>:
slub: remove kmalloc under list_lock from list_slab_objects() V2
Qian Cai <cai@lca.pw>:
mm/slub: fix stack overruns with SLUB_STATS
Andrew Morton <akpm@linux-foundation.org>:
Documentation/vm/slub.rst: s/Toggle/Enable/
Subsystem: mm/debug
Vlastimil Babka <vbabka@suse.cz>:
mm, dump_page(): do not crash with invalid mapping pointer
Subsystem: mm/pagecache
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Change readahead API", v11:
mm: move readahead prototypes from mm.h
mm: return void from various readahead functions
mm: ignore return value of ->readpages
mm: move readahead nr_pages check into read_pages
mm: add new readahead_control API
mm: use readahead_control to pass arguments
mm: rename various 'offset' parameters to 'index'
mm: rename readahead loop variable to 'i'
mm: remove 'page_offset' from readahead loop
mm: put readahead pages in cache earlier
mm: add readahead address space operation
mm: move end_index check out of readahead loop
mm: add page_cache_readahead_unbounded
mm: document why we don't set PageReadahead
mm: use memalloc_nofs_save in readahead path
fs: convert mpage_readpages to mpage_readahead
btrfs: convert from readpages to readahead
erofs: convert uncompressed files from readpages to readahead
erofs: convert compressed files from readpages to readahead
ext4: convert from readpages to readahead
ext4: pass the inode to ext4_mpage_readpages
f2fs: convert from readpages to readahead
f2fs: pass the inode to f2fs_mpage_readpages
fuse: convert from readpages to readahead
iomap: convert from readpages to readahead
Guoqing Jiang <guoqing.jiang@cloud.ionos.com>:
Patch series "Introduce attach/detach_page_private to cleanup code":
include/linux/pagemap.h: introduce attach/detach_page_private
md: remove __clear_page_buffers and use attach/detach_page_private
btrfs: use attach/detach_page_private
fs/buffer.c: use attach/detach_page_private
f2fs: use attach/detach_page_private
iomap: use attach/detach_page_private
ntfs: replace attach_page_buffers with attach_page_private
orangefs: use attach/detach_page_private
buffer_head.h: remove attach_page_buffers
mm/migrate.c: call detach_page_private to cleanup code
mm_types.h: change set_page_private to inline function
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap.c: remove misleading comment
Chao Yu <yuchao0@huawei.com>:
mm/page-writeback.c: remove unused variable
NeilBrown <neilb@suse.de>:
mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE
mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead
Subsystem: mm/gup
Souptick Joarder <jrdr.linux@gmail.com>:
mm/gup.c: update the documentation
John Hubbard <jhubbard@nvidia.com>:
mm/gup: introduce pin_user_pages_unlocked
ivtv: convert get_user_pages() --> pin_user_pages()
Miles Chen <miles.chen@mediatek.com>:
mm/gup.c: further document vma_permits_fault()
Subsystem: mm/swap
chenqiwu <chenqiwu@xiaomi.com>:
mm/swapfile: use list_{prev,next}_entry() instead of open-coding
Qian Cai <cai@lca.pw>:
mm/swap_state: fix a data race in swapin_nr_pages
Andrea Righi <andrea.righi@canonical.com>:
mm: swap: properly update readahead statistics in unuse_pte_range()
Wei Yang <richard.weiyang@gmail.com>:
mm/swapfile.c: offset is only used when there is more slots
mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive
mm/swapfile.c: remove the unnecessary goto for SSD case
mm/swapfile.c: simplify the calculation of n_goal
mm/swapfile.c: remove the extra check in scan_swap_map_slots()
mm/swapfile.c: found_free could be represented by (tmp < max)
mm/swapfile.c: tmp is always smaller than max
mm/swapfile.c: omit a duplicate code by compare tmp and max first
Huang Ying <ying.huang@intel.com>:
swap: try to scan more free slots even when fragmented
Wei Yang <richard.weiyang@gmail.com>:
mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable
mm/swapfile.c: __swap_entry_free() always free 1 entry
Huang Ying <ying.huang@intel.com>:
mm/swapfile.c: use prandom_u32_max()
swap: reduce lock contention on swap cache from swap slots allocation
Randy Dunlap <rdunlap@infradead.org>:
mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment
Miaohe Lin <linmiaohe@huawei.com>:
include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration
Subsystem: mm/memcg
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: add workingset_restore in memory.stat
Kaixu Xia <kaixuxia@tencent.com>:
mm: memcontrol: simplify value comparison between count and limit
Shakeel Butt <shakeelb@google.com>:
memcg: expose root cgroup's memory.stat
Jakub Kicinski <kuba@kernel.org>:
Patch series "memcg: Slow down swap allocation as the available space gets:
mm/memcg: prepare for swap over-high accounting and penalty calculation
mm/memcg: move penalty delay clamping out of calculate_high_delay()
mm/memcg: move cgroup high memory limit setting into struct page_counter
mm/memcg: automatically penalize tasks with high swap use
Zefan Li <lizefan@huawei.com>:
memcg: fix memcg_kmem_bypass() for remote memcg charging
Subsystem: mm/pagemap
Steven Price <steven.price@arm.com>:
Patch series "Fix W+X debug feature on x86":
x86: mm: ptdump: calculate effective permissions correctly
mm: ptdump: expand type of 'val' in note_page()
Huang Ying <ying.huang@intel.com>:
/proc/PID/smaps: Add PMD migration entry parsing
chenqiwu <chenqiwu@xiaomi.com>:
mm/memory: remove unnecessary pte_devmap case in copy_one_pte()
Subsystem: mm/memory-failure
Wetp Zhang <wetp.zy@linux.alibaba.com>:
mm, memory_failure: don't send BUS_MCEERR_AO for action required error
Subsystem: mm/vmalloc
Christoph Hellwig <hch@lst.de>:
Patch series "decruft the vmalloc API", v2:
x86/hyperv: use vmalloc_exec for the hypercall page
x86: fix vmap arguments in map_irq_stack
staging: android: ion: use vmap instead of vm_map_ram
staging: media: ipu3: use vmap instead of reimplementing it
dma-mapping: use vmap insted of reimplementing it
powerpc: add an ioremap_phb helper
powerpc: remove __ioremap_at and __iounmap_at
mm: remove __get_vm_area
mm: unexport unmap_kernel_range_noflush
mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING
mm: only allow page table mappings for built-in zsmalloc
mm: pass addr as unsigned long to vb_free
mm: remove vmap_page_range_noflush and vunmap_page_range
mm: rename vmap_page_range to map_kernel_range
mm: don't return the number of pages from map_kernel_range{,_noflush}
mm: remove map_vm_range
mm: remove unmap_vmap_area
mm: remove the prot argument from vm_map_ram
mm: enforce that vmap can't map pages executable
gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc
mm: remove the pgprot argument to __vmalloc
mm: remove the prot argument to __vmalloc_node
mm: remove both instances of __vmalloc_node_flags
mm: remove __vmalloc_node_flags_caller
mm: switch the test_vmalloc module to use __vmalloc_node
mm: remove vmalloc_user_node_flags
arm64: use __vmalloc_node in arch_alloc_vmap_stack
powerpc: use __vmalloc_node in alloc_vm_stack
s390: use __vmalloc_node in stack_alloc
Joerg Roedel <jroedel@suse.de>:
Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3:
mm: add functions to track page directory modifications
mm/vmalloc: track which page-table levels were modified
mm/ioremap: track which page-table levels were modified
x86/mm/64: implement arch_sync_kernel_mappings()
x86/mm/32: implement arch_sync_kernel_mappings()
mm: remove vmalloc_sync_(un)mappings()
x86/mm: remove vmalloc faulting
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix clang compilation warning due to stack protector
Kees Cook <keescook@chromium.org>:
ubsan: entirely disable alignment checks under UBSAN_TRAP
Jing Xia <jing.xia@unisoc.com>:
mm/mm_init.c: report kasan-tag information stored in page->flags
Andrey Konovalov <andreyknvl@google.com>:
kasan: move kasan_report() into report.c
Documentation/admin-guide/cgroup-v2.rst | 24 +
Documentation/core-api/cachetlb.rst | 2
Documentation/filesystems/locking.rst | 6
Documentation/filesystems/proc.rst | 4
Documentation/filesystems/vfs.rst | 15
Documentation/vm/slub.rst | 2
arch/arm/configs/omap2plus_defconfig | 2
arch/arm64/include/asm/pgtable.h | 3
arch/arm64/include/asm/vmap_stack.h | 6
arch/arm64/mm/dump.c | 2
arch/parisc/include/asm/pgtable.h | 2
arch/powerpc/include/asm/io.h | 10
arch/powerpc/include/asm/pci-bridge.h | 2
arch/powerpc/kernel/irq.c | 5
arch/powerpc/kernel/isa-bridge.c | 28 +
arch/powerpc/kernel/pci_64.c | 56 +-
arch/powerpc/mm/ioremap_64.c | 50 --
arch/riscv/include/asm/pgtable.h | 4
arch/riscv/mm/ptdump.c | 2
arch/s390/kernel/setup.c | 9
arch/sh/kernel/cpu/sh4/sq.c | 3
arch/x86/hyperv/hv_init.c | 5
arch/x86/include/asm/kvm_host.h | 3
arch/x86/include/asm/pgtable-2level_types.h | 2
arch/x86/include/asm/pgtable-3level_types.h | 2
arch/x86/include/asm/pgtable_64_types.h | 2
arch/x86/include/asm/pgtable_types.h | 8
arch/x86/include/asm/switch_to.h | 23 -
arch/x86/kernel/irq_64.c | 2
arch/x86/kernel/setup_percpu.c | 6
arch/x86/kvm/svm/sev.c | 3
arch/x86/mm/dump_pagetables.c | 35 +
arch/x86/mm/fault.c | 196 ----------
arch/x86/mm/init_64.c | 5
arch/x86/mm/pti.c | 8
arch/x86/mm/tlb.c | 37 -
block/blk-core.c | 1
drivers/acpi/apei/ghes.c | 6
drivers/base/node.c | 2
drivers/block/drbd/drbd_bitmap.c | 4
drivers/block/loop.c | 2
drivers/dax/device.c | 1
drivers/gpu/drm/drm_scatter.c | 11
drivers/gpu/drm/etnaviv/etnaviv_dump.c | 4
drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c | 2
drivers/lightnvm/pblk-init.c | 5
drivers/md/dm-bufio.c | 4
drivers/md/md-bitmap.c | 12
drivers/media/common/videobuf2/videobuf2-dma-sg.c | 3
drivers/media/common/videobuf2/videobuf2-vmalloc.c | 3
drivers/media/pci/ivtv/ivtv-udma.c | 19 -
drivers/media/pci/ivtv/ivtv-yuv.c | 17
drivers/media/pci/ivtv/ivtvfb.c | 4
drivers/mtd/ubi/io.c | 4
drivers/pcmcia/electra_cf.c | 45 --
drivers/scsi/sd_zbc.c | 3
drivers/staging/android/ion/ion_heap.c | 4
drivers/staging/media/ipu3/ipu3-css-pool.h | 4
drivers/staging/media/ipu3/ipu3-dmamap.c | 30 -
fs/block_dev.c | 7
fs/btrfs/disk-io.c | 4
fs/btrfs/extent_io.c | 64 ---
fs/btrfs/extent_io.h | 3
fs/btrfs/inode.c | 39 --
fs/buffer.c | 23 -
fs/erofs/data.c | 41 --
fs/erofs/decompressor.c | 2
fs/erofs/zdata.c | 31 -
fs/exfat/inode.c | 7
fs/ext2/inode.c | 10
fs/ext4/ext4.h | 5
fs/ext4/inode.c | 25 -
fs/ext4/readpage.c | 25 -
fs/ext4/verity.c | 35 -
fs/f2fs/data.c | 56 +-
fs/f2fs/f2fs.h | 14
fs/f2fs/verity.c | 35 -
fs/fat/inode.c | 7
fs/file_table.c | 1
fs/fs-writeback.c | 1
fs/fuse/file.c | 100 +----
fs/gfs2/aops.c | 23 -
fs/gfs2/dir.c | 9
fs/gfs2/quota.c | 2
fs/hpfs/file.c | 7
fs/iomap/buffered-io.c | 113 +----
fs/iomap/trace.h | 2
fs/isofs/inode.c | 7
fs/jfs/inode.c | 7
fs/mpage.c | 38 --
fs/nfs/blocklayout/extent_tree.c | 2
fs/nfs/internal.h | 10
fs/nfs/write.c | 4
fs/nfsd/vfs.c | 9
fs/nilfs2/inode.c | 15
fs/ntfs/aops.c | 2
fs/ntfs/malloc.h | 2
fs/ntfs/mft.c | 2
fs/ocfs2/aops.c | 34 -
fs/ocfs2/dlm/dlmmaster.c | 1
fs/ocfs2/ocfs2.h | 4
fs/ocfs2/slot_map.c | 46 +-
fs/ocfs2/super.c | 21 +
fs/omfs/file.c | 7
fs/open.c | 3
fs/orangefs/inode.c | 32 -
fs/proc/meminfo.c | 3
fs/proc/task_mmu.c | 16
fs/qnx6/inode.c | 7
fs/reiserfs/inode.c | 8
fs/squashfs/block.c | 273 +++++++-------
fs/squashfs/decompressor.h | 5
fs/squashfs/decompressor_multi.c | 9
fs/squashfs/decompressor_multi_percpu.c | 17
fs/squashfs/decompressor_single.c | 9
fs/squashfs/lz4_wrapper.c | 17
fs/squashfs/lzo_wrapper.c | 17
fs/squashfs/squashfs.h | 4
fs/squashfs/xz_wrapper.c | 51 +-
fs/squashfs/zlib_wrapper.c | 63 +--
fs/squashfs/zstd_wrapper.c | 62 +--
fs/sync.c | 6
fs/ubifs/debug.c | 2
fs/ubifs/lprops.c | 2
fs/ubifs/lpt_commit.c | 4
fs/ubifs/orphan.c | 2
fs/udf/inode.c | 7
fs/xfs/kmem.c | 2
fs/xfs/xfs_aops.c | 13
fs/xfs/xfs_buf.c | 2
fs/zonefs/super.c | 7
include/asm-generic/5level-fixup.h | 5
include/asm-generic/pgtable.h | 27 +
include/linux/buffer_head.h | 8
include/linux/fs.h | 18
include/linux/iomap.h | 3
include/linux/memcontrol.h | 4
include/linux/mm.h | 67 ++-
include/linux/mm_types.h | 6
include/linux/mmzone.h | 1
include/linux/mpage.h | 4
include/linux/page_counter.h | 8
include/linux/pagemap.h | 193 ++++++++++
include/linux/ptdump.h | 3
include/linux/sched.h | 3
include/linux/swap.h | 17
include/linux/vmalloc.h | 49 +-
include/linux/zsmalloc.h | 2
include/trace/events/erofs.h | 6
include/trace/events/f2fs.h | 6
include/trace/events/writeback.h | 5
kernel/bpf/core.c | 6
kernel/bpf/syscall.c | 29 -
kernel/dma/remap.c | 48 --
kernel/groups.c | 2
kernel/module.c | 3
kernel/notifier.c | 1
kernel/sys.c | 2
kernel/trace/trace.c | 12
lib/Kconfig.ubsan | 2
lib/ioremap.c | 46 +-
lib/test_vmalloc.c | 26 -
mm/Kconfig | 4
mm/debug.c | 56 ++
mm/fadvise.c | 6
mm/filemap.c | 1
mm/gup.c | 77 +++-
mm/internal.h | 14
mm/kasan/Makefile | 21 -
mm/kasan/common.c | 19 -
mm/kasan/report.c | 22 +
mm/memcontrol.c | 198 +++++++---
mm/memory-failure.c | 15
mm/memory.c | 2
mm/migrate.c | 9
mm/mm_init.c | 16
mm/nommu.c | 52 +-
mm/page-writeback.c | 62 ++-
mm/page_alloc.c | 7
mm/percpu.c | 2
mm/ptdump.c | 17
mm/readahead.c | 349 ++++++++++--------
mm/slab_common.c | 3
mm/slub.c | 67 ++-
mm/swap_state.c | 5
mm/swapfile.c | 194 ++++++----
mm/util.c | 2
mm/vmalloc.c | 399 ++++++++-------------
mm/vmscan.c | 4
mm/vmstat.c | 11
mm/zsmalloc.c | 12
net/bridge/netfilter/ebtables.c | 6
net/ceph/ceph_common.c | 3
sound/core/memalloc.c | 2
sound/core/pcm_memory.c | 2
195 files changed, 2292 insertions(+), 2288 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-06-02 4:44 incoming Andrew Morton
@ 2020-06-02 20:08 ` Andrew Morton
2020-06-02 20:45 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-06-02 20:08 UTC (permalink / raw)
To: Linus Torvalds, mm-commits, linux-mm
The local_lock merge made rather a mess of all of this. I'm
cooking up a full resend of the same material.
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-06-02 20:09 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-06-02 20:09 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
A few little subsystems and a start of a lot of MM patches.
128 patches, based on f359287765c04711ff54fbd11645271d8e5ff763:
Subsystems affected by this patch series:
squashfs
ocfs2
parisc
vfs
mm/slab-generic
mm/slub
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/memory-failure
mm/vmalloc
mm/kasan
Subsystem: squashfs
Philippe Liard <pliard@google.com>:
squashfs: migrate from ll_rw_block usage to BIO
Subsystem: ocfs2
Jules Irenge <jbi.octave@gmail.com>:
ocfs2: add missing annotation for dlm_empty_lockres()
Gang He <ghe@suse.com>:
ocfs2: mount shared volume without ha stack
Subsystem: parisc
Andrew Morton <akpm@linux-foundation.org>:
arch/parisc/include/asm/pgtable.h: remove unused `old_pte'
Subsystem: vfs
Jeff Layton <jlayton@redhat.com>:
Patch series "vfs: have syncfs() return error when there are writeback:
vfs: track per-sb writeback errors and report them to syncfs
fs/buffer.c: record blockdev write errors in super_block that it backs
Subsystem: mm/slab-generic
Vlastimil Babka <vbabka@suse.cz>:
usercopy: mark dma-kmalloc caches as usercopy caches
Subsystem: mm/slub
Dongli Zhang <dongli.zhang@oracle.com>:
mm/slub.c: fix corrupted freechain in deactivate_slab()
Christoph Lameter <cl@linux.com>:
slub: Remove userspace notifier for cache add/remove
Christopher Lameter <cl@linux.com>:
slub: remove kmalloc under list_lock from list_slab_objects() V2
Qian Cai <cai@lca.pw>:
mm/slub: fix stack overruns with SLUB_STATS
Andrew Morton <akpm@linux-foundation.org>:
Documentation/vm/slub.rst: s/Toggle/Enable/
Subsystem: mm/debug
Vlastimil Babka <vbabka@suse.cz>:
mm, dump_page(): do not crash with invalid mapping pointer
Subsystem: mm/pagecache
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Change readahead API", v11:
mm: move readahead prototypes from mm.h
mm: return void from various readahead functions
mm: ignore return value of ->readpages
mm: move readahead nr_pages check into read_pages
mm: add new readahead_control API
mm: use readahead_control to pass arguments
mm: rename various 'offset' parameters to 'index'
mm: rename readahead loop variable to 'i'
mm: remove 'page_offset' from readahead loop
mm: put readahead pages in cache earlier
mm: add readahead address space operation
mm: move end_index check out of readahead loop
mm: add page_cache_readahead_unbounded
mm: document why we don't set PageReadahead
mm: use memalloc_nofs_save in readahead path
fs: convert mpage_readpages to mpage_readahead
btrfs: convert from readpages to readahead
erofs: convert uncompressed files from readpages to readahead
erofs: convert compressed files from readpages to readahead
ext4: convert from readpages to readahead
ext4: pass the inode to ext4_mpage_readpages
f2fs: convert from readpages to readahead
f2fs: pass the inode to f2fs_mpage_readpages
fuse: convert from readpages to readahead
iomap: convert from readpages to readahead
Guoqing Jiang <guoqing.jiang@cloud.ionos.com>:
Patch series "Introduce attach/detach_page_private to cleanup code":
include/linux/pagemap.h: introduce attach/detach_page_private
md: remove __clear_page_buffers and use attach/detach_page_private
btrfs: use attach/detach_page_private
fs/buffer.c: use attach/detach_page_private
f2fs: use attach/detach_page_private
iomap: use attach/detach_page_private
ntfs: replace attach_page_buffers with attach_page_private
orangefs: use attach/detach_page_private
buffer_head.h: remove attach_page_buffers
mm/migrate.c: call detach_page_private to cleanup code
mm_types.h: change set_page_private to inline function
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap.c: remove misleading comment
Chao Yu <yuchao0@huawei.com>:
mm/page-writeback.c: remove unused variable
NeilBrown <neilb@suse.de>:
mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE
mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead
Subsystem: mm/gup
Souptick Joarder <jrdr.linux@gmail.com>:
mm/gup.c: update the documentation
John Hubbard <jhubbard@nvidia.com>:
mm/gup: introduce pin_user_pages_unlocked
ivtv: convert get_user_pages() --> pin_user_pages()
Miles Chen <miles.chen@mediatek.com>:
mm/gup.c: further document vma_permits_fault()
Subsystem: mm/swap
chenqiwu <chenqiwu@xiaomi.com>:
mm/swapfile: use list_{prev,next}_entry() instead of open-coding
Qian Cai <cai@lca.pw>:
mm/swap_state: fix a data race in swapin_nr_pages
Andrea Righi <andrea.righi@canonical.com>:
mm: swap: properly update readahead statistics in unuse_pte_range()
Wei Yang <richard.weiyang@gmail.com>:
mm/swapfile.c: offset is only used when there is more slots
mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive
mm/swapfile.c: remove the unnecessary goto for SSD case
mm/swapfile.c: simplify the calculation of n_goal
mm/swapfile.c: remove the extra check in scan_swap_map_slots()
mm/swapfile.c: found_free could be represented by (tmp < max)
mm/swapfile.c: tmp is always smaller than max
mm/swapfile.c: omit a duplicate code by compare tmp and max first
Huang Ying <ying.huang@intel.com>:
swap: try to scan more free slots even when fragmented
Wei Yang <richard.weiyang@gmail.com>:
mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable
mm/swapfile.c: __swap_entry_free() always free 1 entry
Huang Ying <ying.huang@intel.com>:
mm/swapfile.c: use prandom_u32_max()
swap: reduce lock contention on swap cache from swap slots allocation
Randy Dunlap <rdunlap@infradead.org>:
mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment
Miaohe Lin <linmiaohe@huawei.com>:
include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration
Subsystem: mm/memcg
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: add workingset_restore in memory.stat
Kaixu Xia <kaixuxia@tencent.com>:
mm: memcontrol: simplify value comparison between count and limit
Shakeel Butt <shakeelb@google.com>:
memcg: expose root cgroup's memory.stat
Jakub Kicinski <kuba@kernel.org>:
Patch series "memcg: Slow down swap allocation as the available space gets:
mm/memcg: prepare for swap over-high accounting and penalty calculation
mm/memcg: move penalty delay clamping out of calculate_high_delay()
mm/memcg: move cgroup high memory limit setting into struct page_counter
mm/memcg: automatically penalize tasks with high swap use
Zefan Li <lizefan@huawei.com>:
memcg: fix memcg_kmem_bypass() for remote memcg charging
Subsystem: mm/pagemap
Steven Price <steven.price@arm.com>:
Patch series "Fix W+X debug feature on x86":
x86: mm: ptdump: calculate effective permissions correctly
mm: ptdump: expand type of 'val' in note_page()
Huang Ying <ying.huang@intel.com>:
/proc/PID/smaps: Add PMD migration entry parsing
chenqiwu <chenqiwu@xiaomi.com>:
mm/memory: remove unnecessary pte_devmap case in copy_one_pte()
Subsystem: mm/memory-failure
Wetp Zhang <wetp.zy@linux.alibaba.com>:
mm, memory_failure: don't send BUS_MCEERR_AO for action required error
Subsystem: mm/vmalloc
Christoph Hellwig <hch@lst.de>:
Patch series "decruft the vmalloc API", v2:
x86/hyperv: use vmalloc_exec for the hypercall page
x86: fix vmap arguments in map_irq_stack
staging: android: ion: use vmap instead of vm_map_ram
staging: media: ipu3: use vmap instead of reimplementing it
dma-mapping: use vmap insted of reimplementing it
powerpc: add an ioremap_phb helper
powerpc: remove __ioremap_at and __iounmap_at
mm: remove __get_vm_area
mm: unexport unmap_kernel_range_noflush
mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING
mm: only allow page table mappings for built-in zsmalloc
mm: pass addr as unsigned long to vb_free
mm: remove vmap_page_range_noflush and vunmap_page_range
mm: rename vmap_page_range to map_kernel_range
mm: don't return the number of pages from map_kernel_range{,_noflush}
mm: remove map_vm_range
mm: remove unmap_vmap_area
mm: remove the prot argument from vm_map_ram
mm: enforce that vmap can't map pages executable
gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc
mm: remove the pgprot argument to __vmalloc
mm: remove the prot argument to __vmalloc_node
mm: remove both instances of __vmalloc_node_flags
mm: remove __vmalloc_node_flags_caller
mm: switch the test_vmalloc module to use __vmalloc_node
mm: remove vmalloc_user_node_flags
arm64: use __vmalloc_node in arch_alloc_vmap_stack
powerpc: use __vmalloc_node in alloc_vm_stack
s390: use __vmalloc_node in stack_alloc
Joerg Roedel <jroedel@suse.de>:
Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3:
mm: add functions to track page directory modifications
mm/vmalloc: track which page-table levels were modified
mm/ioremap: track which page-table levels were modified
x86/mm/64: implement arch_sync_kernel_mappings()
x86/mm/32: implement arch_sync_kernel_mappings()
mm: remove vmalloc_sync_(un)mappings()
x86/mm: remove vmalloc faulting
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix clang compilation warning due to stack protector
Kees Cook <keescook@chromium.org>:
ubsan: entirely disable alignment checks under UBSAN_TRAP
Jing Xia <jing.xia@unisoc.com>:
mm/mm_init.c: report kasan-tag information stored in page->flags
Andrey Konovalov <andreyknvl@google.com>:
kasan: move kasan_report() into report.c
Documentation/admin-guide/cgroup-v2.rst | 24 +
Documentation/core-api/cachetlb.rst | 2
Documentation/filesystems/locking.rst | 6
Documentation/filesystems/proc.rst | 4
Documentation/filesystems/vfs.rst | 15
Documentation/vm/slub.rst | 2
arch/arm/configs/omap2plus_defconfig | 2
arch/arm64/include/asm/pgtable.h | 3
arch/arm64/include/asm/vmap_stack.h | 6
arch/arm64/mm/dump.c | 2
arch/parisc/include/asm/pgtable.h | 2
arch/powerpc/include/asm/io.h | 10
arch/powerpc/include/asm/pci-bridge.h | 2
arch/powerpc/kernel/irq.c | 5
arch/powerpc/kernel/isa-bridge.c | 28 +
arch/powerpc/kernel/pci_64.c | 56 +-
arch/powerpc/mm/ioremap_64.c | 50 --
arch/riscv/include/asm/pgtable.h | 4
arch/riscv/mm/ptdump.c | 2
arch/s390/kernel/setup.c | 9
arch/sh/kernel/cpu/sh4/sq.c | 3
arch/x86/hyperv/hv_init.c | 5
arch/x86/include/asm/kvm_host.h | 3
arch/x86/include/asm/pgtable-2level_types.h | 2
arch/x86/include/asm/pgtable-3level_types.h | 2
arch/x86/include/asm/pgtable_64_types.h | 2
arch/x86/include/asm/pgtable_types.h | 8
arch/x86/include/asm/switch_to.h | 23 -
arch/x86/kernel/irq_64.c | 2
arch/x86/kernel/setup_percpu.c | 6
arch/x86/kvm/svm/sev.c | 3
arch/x86/mm/dump_pagetables.c | 35 +
arch/x86/mm/fault.c | 196 ----------
arch/x86/mm/init_64.c | 5
arch/x86/mm/pti.c | 8
arch/x86/mm/tlb.c | 37 -
block/blk-core.c | 1
drivers/acpi/apei/ghes.c | 6
drivers/base/node.c | 2
drivers/block/drbd/drbd_bitmap.c | 4
drivers/block/loop.c | 2
drivers/dax/device.c | 1
drivers/gpu/drm/drm_scatter.c | 11
drivers/gpu/drm/etnaviv/etnaviv_dump.c | 4
drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c | 2
drivers/lightnvm/pblk-init.c | 5
drivers/md/dm-bufio.c | 4
drivers/md/md-bitmap.c | 12
drivers/media/common/videobuf2/videobuf2-dma-sg.c | 3
drivers/media/common/videobuf2/videobuf2-vmalloc.c | 3
drivers/media/pci/ivtv/ivtv-udma.c | 19 -
drivers/media/pci/ivtv/ivtv-yuv.c | 17
drivers/media/pci/ivtv/ivtvfb.c | 4
drivers/mtd/ubi/io.c | 4
drivers/pcmcia/electra_cf.c | 45 --
drivers/scsi/sd_zbc.c | 3
drivers/staging/android/ion/ion_heap.c | 4
drivers/staging/media/ipu3/ipu3-css-pool.h | 4
drivers/staging/media/ipu3/ipu3-dmamap.c | 30 -
fs/block_dev.c | 7
fs/btrfs/disk-io.c | 4
fs/btrfs/extent_io.c | 64 ---
fs/btrfs/extent_io.h | 3
fs/btrfs/inode.c | 39 --
fs/buffer.c | 23 -
fs/erofs/data.c | 41 --
fs/erofs/decompressor.c | 2
fs/erofs/zdata.c | 31 -
fs/exfat/inode.c | 7
fs/ext2/inode.c | 10
fs/ext4/ext4.h | 5
fs/ext4/inode.c | 25 -
fs/ext4/readpage.c | 25 -
fs/ext4/verity.c | 35 -
fs/f2fs/data.c | 56 +-
fs/f2fs/f2fs.h | 14
fs/f2fs/verity.c | 35 -
fs/fat/inode.c | 7
fs/file_table.c | 1
fs/fs-writeback.c | 1
fs/fuse/file.c | 100 +----
fs/gfs2/aops.c | 23 -
fs/gfs2/dir.c | 9
fs/gfs2/quota.c | 2
fs/hpfs/file.c | 7
fs/iomap/buffered-io.c | 113 +----
fs/iomap/trace.h | 2
fs/isofs/inode.c | 7
fs/jfs/inode.c | 7
fs/mpage.c | 38 --
fs/nfs/blocklayout/extent_tree.c | 2
fs/nfs/internal.h | 10
fs/nfs/write.c | 4
fs/nfsd/vfs.c | 9
fs/nilfs2/inode.c | 15
fs/ntfs/aops.c | 2
fs/ntfs/malloc.h | 2
fs/ntfs/mft.c | 2
fs/ocfs2/aops.c | 34 -
fs/ocfs2/dlm/dlmmaster.c | 1
fs/ocfs2/ocfs2.h | 4
fs/ocfs2/slot_map.c | 46 +-
fs/ocfs2/super.c | 21 +
fs/omfs/file.c | 7
fs/open.c | 3
fs/orangefs/inode.c | 32 -
fs/proc/meminfo.c | 3
fs/proc/task_mmu.c | 16
fs/qnx6/inode.c | 7
fs/reiserfs/inode.c | 8
fs/squashfs/block.c | 273 +++++++-------
fs/squashfs/decompressor.h | 5
fs/squashfs/decompressor_multi.c | 9
fs/squashfs/decompressor_multi_percpu.c | 17
fs/squashfs/decompressor_single.c | 9
fs/squashfs/lz4_wrapper.c | 17
fs/squashfs/lzo_wrapper.c | 17
fs/squashfs/squashfs.h | 4
fs/squashfs/xz_wrapper.c | 51 +-
fs/squashfs/zlib_wrapper.c | 63 +--
fs/squashfs/zstd_wrapper.c | 62 +--
fs/sync.c | 6
fs/ubifs/debug.c | 2
fs/ubifs/lprops.c | 2
fs/ubifs/lpt_commit.c | 4
fs/ubifs/orphan.c | 2
fs/udf/inode.c | 7
fs/xfs/kmem.c | 2
fs/xfs/xfs_aops.c | 13
fs/xfs/xfs_buf.c | 2
fs/zonefs/super.c | 7
include/asm-generic/5level-fixup.h | 5
include/asm-generic/pgtable.h | 27 +
include/linux/buffer_head.h | 8
include/linux/fs.h | 18
include/linux/iomap.h | 3
include/linux/memcontrol.h | 4
include/linux/mm.h | 67 ++-
include/linux/mm_types.h | 6
include/linux/mmzone.h | 1
include/linux/mpage.h | 4
include/linux/page_counter.h | 8
include/linux/pagemap.h | 193 ++++++++++
include/linux/ptdump.h | 3
include/linux/sched.h | 3
include/linux/swap.h | 17
include/linux/vmalloc.h | 49 +-
include/linux/zsmalloc.h | 2
include/trace/events/erofs.h | 6
include/trace/events/f2fs.h | 6
include/trace/events/writeback.h | 5
kernel/bpf/core.c | 6
kernel/bpf/syscall.c | 29 -
kernel/dma/remap.c | 48 --
kernel/groups.c | 2
kernel/module.c | 3
kernel/notifier.c | 1
kernel/sys.c | 2
kernel/trace/trace.c | 12
lib/Kconfig.ubsan | 2
lib/ioremap.c | 46 +-
lib/test_vmalloc.c | 26 -
mm/Kconfig | 4
mm/debug.c | 56 ++
mm/fadvise.c | 6
mm/filemap.c | 1
mm/gup.c | 77 +++-
mm/internal.h | 14
mm/kasan/Makefile | 21 -
mm/kasan/common.c | 19 -
mm/kasan/report.c | 22 +
mm/memcontrol.c | 198 +++++++---
mm/memory-failure.c | 15
mm/memory.c | 2
mm/migrate.c | 9
mm/mm_init.c | 16
mm/nommu.c | 52 +-
mm/page-writeback.c | 62 ++-
mm/page_alloc.c | 7
mm/percpu.c | 2
mm/ptdump.c | 17
mm/readahead.c | 349 ++++++++++--------
mm/slab_common.c | 3
mm/slub.c | 67 ++-
mm/swap_state.c | 5
mm/swapfile.c | 194 ++++++----
mm/util.c | 2
mm/vmalloc.c | 399 ++++++++-------------
mm/vmscan.c | 4
mm/vmstat.c | 11
mm/zsmalloc.c | 12
net/bridge/netfilter/ebtables.c | 6
net/ceph/ceph_common.c | 3
sound/core/memalloc.c | 2
sound/core/pcm_memory.c | 2
195 files changed, 2292 insertions(+), 2288 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-06-02 20:08 ` incoming Andrew Morton
@ 2020-06-02 20:45 ` Linus Torvalds
2020-06-02 21:38 ` incoming Andrew Morton
0 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2020-06-02 20:45 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Tue, Jun 2, 2020 at 1:08 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> The local_lock merge made rather a mess of all of this. I'm
> cooking up a full resend of the same material.
Hmm. I have no issues with conflicts, and already took your previous series.
I've pushed it out now - does my tree match what you expect?
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-06-02 20:45 ` incoming Linus Torvalds
@ 2020-06-02 21:38 ` Andrew Morton
2020-06-02 22:18 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-06-02 21:38 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, Linux-MM
On Tue, 2 Jun 2020 13:45:49 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Tue, Jun 2, 2020 at 1:08 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > The local_lock merge made rather a mess of all of this. I'm
> > cooking up a full resend of the same material.
>
> Hmm. I have no issues with conflicts, and already took your previous series.
Well that's odd.
> I've pushed it out now - does my tree match what you expect?
Yup, thanks.
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-06-02 21:38 ` incoming Andrew Morton
@ 2020-06-02 22:18 ` Linus Torvalds
0 siblings, 0 replies; 419+ messages in thread
From: Linus Torvalds @ 2020-06-02 22:18 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Tue, Jun 2, 2020 at 2:38 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> On Tue, 2 Jun 2020 13:45:49 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> >
> > Hmm. I have no issues with conflicts, and already took your previous series.
>
> Well that's odd.
I meant "I saw the conflicts and had no issue with them". Nothing odd.
And I actually much prefer seeing conflicts from your series (against
other pulls I've done) over having you delay your patch bombs because
of any fear for them.
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-06-03 22:55 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-06-03 22:55 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
More mm/ work, plenty more to come.
131 patches, based on d6f9469a03d832dcd17041ed67774ffb5f3e73b3.
Subsystems affected by this patch series:
mm/slub
mm/memcg
mm/gup
mm/kasan
mm/pagealloc
mm/hugetlb
mm/vmscan
mm/tools
mm/mempolicy
mm/memblock
mm/hugetlbfs
mm/thp
mm/mmap
mm/kconfig
Subsystem: mm/slub
Wang Hai <wanghai38@huawei.com>:
mm/slub: fix a memory leak in sysfs_slab_add()
Subsystem: mm/memcg
Shakeel Butt <shakeelb@google.com>:
mm/memcg: optimize memory.numa_stat like memory.stat
Subsystem: mm/gup
John Hubbard <jhubbard@nvidia.com>:
Patch series "mm/gup, drm/i915: refactor gup_fast, convert to pin_user_pages()", v2:
mm/gup: move __get_user_pages_fast() down a few lines in gup.c
mm/gup: refactor and de-duplicate gup_fast() code
mm/gup: introduce pin_user_pages_fast_only()
drm/i915: convert get_user_pages() --> pin_user_pages()
mm/gup: might_lock_read(mmap_sem) in get_user_pages_fast()
Subsystem: mm/kasan
Daniel Axtens <dja@axtens.net>:
Patch series "Fix some incompatibilites between KASAN and FORTIFY_SOURCE", v4:
kasan: stop tests being eliminated as dead code with FORTIFY_SOURCE
string.h: fix incompatibility between FORTIFY_SOURCE and KASAN
Subsystem: mm/pagealloc
Michal Hocko <mhocko@suse.com>:
mm: clarify __GFP_MEMALLOC usage
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: rework free_area_init*() funcitons":
mm: memblock: replace dereferences of memblock_region.nid with API calls
mm: make early_pfn_to_nid() and related defintions close to each other
mm: remove CONFIG_HAVE_MEMBLOCK_NODE_MAP option
mm: free_area_init: use maximal zone PFNs rather than zone sizes
mm: use free_area_init() instead of free_area_init_nodes()
alpha: simplify detection of memory zone boundaries
arm: simplify detection of memory zone boundaries
arm64: simplify detection of memory zone boundaries for UMA configs
csky: simplify detection of memory zone boundaries
m68k: mm: simplify detection of memory zone boundaries
parisc: simplify detection of memory zone boundaries
sparc32: simplify detection of memory zone boundaries
unicore32: simplify detection of memory zone boundaries
xtensa: simplify detection of memory zone boundaries
Baoquan He <bhe@redhat.com>:
mm: memmap_init: iterate over memblock regions rather that check each PFN
Mike Rapoport <rppt@linux.ibm.com>:
mm: remove early_pfn_in_nid() and CONFIG_NODES_SPAN_OTHER_NODES
mm: free_area_init: allow defining max_zone_pfn in descending order
mm: rename free_area_init_node() to free_area_init_memoryless_node()
mm: clean up free_area_init_node() and its helpers
mm: simplify find_min_pfn_with_active_regions()
docs/vm: update memory-models documentation
Wei Yang <richard.weiyang@gmail.com>:
Patch series "mm/page_alloc.c: cleanup on check page", v3:
mm/page_alloc.c: bad_[reason|flags] is not necessary when PageHWPoison
mm/page_alloc.c: bad_flags is not necessary for bad_page()
mm/page_alloc.c: rename free_pages_check_bad() to check_free_page_bad()
mm/page_alloc.c: rename free_pages_check() to check_free_page()
mm/page_alloc.c: extract check_[new|free]_page_bad() common part to page_bad_reason()
Roman Gushchin <guro@fb.com>:
mm,page_alloc,cma: conditionally prefer cma pageblocks for movable allocations
Baoquan He <bhe@redhat.com>:
mm/page_alloc.c: remove unused free_bootmem_with_active_regions
Patch series "improvements about lowmem_reserve and /proc/zoneinfo", v2:
mm/page_alloc.c: only tune sysctl_lowmem_reserve_ratio value once when changing it
mm/page_alloc.c: clear out zone->lowmem_reserve[] if the zone is empty
mm/vmstat.c: do not show lowmem reserve protection information of empty zone
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
Patch series "integrate classzone_idx and high_zoneidx", v5:
mm/page_alloc: use ac->high_zoneidx for classzone_idx
mm/page_alloc: integrate classzone_idx and high_zoneidx
Wei Yang <richard.weiyang@gmail.com>:
mm/page_alloc.c: use NODE_MASK_NONE in build_zonelists()
mm: rename gfpflags_to_migratetype to gfp_migratetype for same convention
Sandipan Das <sandipan@linux.ibm.com>:
mm/page_alloc.c: reset numa stats for boot pagesets
Charan Teja Reddy <charante@codeaurora.org>:
mm, page_alloc: reset the zone->watermark_boost early
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/page_alloc: restrict and formalize compound_page_dtors[]
Daniel Jordan <daniel.m.jordan@oracle.com>:
Patch series "initialize deferred pages with interrupts enabled", v4:
mm/pagealloc.c: call touch_nmi_watchdog() on max order boundaries in deferred init
Pavel Tatashin <pasha.tatashin@soleen.com>:
mm: initialize deferred pages with interrupts enabled
mm: call cond_resched() from deferred_init_memmap()
Daniel Jordan <daniel.m.jordan@oracle.com>:
Patch series "padata: parallelize deferred page init", v3:
padata: remove exit routine
padata: initialize earlier
padata: allocate work structures for parallel jobs from a pool
padata: add basic support for multithreaded jobs
mm: don't track number of pages during deferred initialization
mm: parallelize deferred_init_memmap()
mm: make deferred init's max threads arch-specific
padata: document multithreaded jobs
Chen Tao <chentao107@huawei.com>:
mm/page_alloc.c: add missing newline
Subsystem: mm/hugetlb
"Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
Patch series "thp/khugepaged improvements and CoW semantics", v4:
khugepaged: add self test
khugepaged: do not stop collapse if less than half PTEs are referenced
khugepaged: drain all LRU caches before scanning pages
khugepaged: drain LRU add pagevec after swapin
khugepaged: allow to collapse a page shared across fork
khugepaged: allow to collapse PTE-mapped compound pages
thp: change CoW semantics for anon-THP
khugepaged: introduce 'max_ptes_shared' tunable
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "Clean up hugetlb boot command line processing", v4:
hugetlbfs: add arch_hugetlb_valid_size
hugetlbfs: move hugepagesz= parsing to arch independent code
hugetlbfs: remove hugetlb_add_hstate() warning for existing hstate
hugetlbfs: clean up command line processing
hugetlbfs: fix changes to command line processing
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/hugetlb: avoid unnecessary check on pud and pmd entry in huge_pte_offset
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/hugetlb: Add some new generic fallbacks", v3:
arm64/mm: drop __HAVE_ARCH_HUGE_PTEP_GET
mm/hugetlb: define a generic fallback for is_hugepage_only_range()
mm/hugetlb: define a generic fallback for arch_clear_hugepage_flags()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: simplify calling a compound page destructor
Subsystem: mm/vmscan
Wei Yang <richard.weiyang@gmail.com>:
mm/vmscan.c: use update_lru_size() in update_lru_sizes()
Jaewon Kim <jaewon31.kim@samsung.com>:
mm/vmscan: count layzfree pages and fix nr_isolated_* mismatch
Maninder Singh <maninder1.s@samsung.com>:
mm/vmscan.c: change prototype for shrink_page_list
Qiwu Chen <qiwuchen55@gmail.com>:
mm/vmscan: update the comment of should_continue_reclaim()
Johannes Weiner <hannes@cmpxchg.org>:
Patch series "mm: memcontrol: charge swapin pages on instantiation", v2:
mm: fix NUMA node file count error in replace_page_cache()
mm: memcontrol: fix stat-corrupting race in charge moving
mm: memcontrol: drop @compound parameter from memcg charging API
mm: shmem: remove rare optimization when swapin races with hole punching
mm: memcontrol: move out cgroup swaprate throttling
mm: memcontrol: convert page cache to a new mem_cgroup_charge() API
mm: memcontrol: prepare uncharging for removal of private page type counters
mm: memcontrol: prepare move_account for removal of private page type counters
mm: memcontrol: prepare cgroup vmstat infrastructure for native anon counters
mm: memcontrol: switch to native NR_FILE_PAGES and NR_SHMEM counters
mm: memcontrol: switch to native NR_ANON_MAPPED counter
mm: memcontrol: switch to native NR_ANON_THPS counter
mm: memcontrol: convert anon and file-thp to new mem_cgroup_charge() API
mm: memcontrol: drop unused try/commit/cancel charge API
mm: memcontrol: prepare swap controller setup for integration
mm: memcontrol: make swap tracking an integral part of memory control
mm: memcontrol: charge swapin pages on instantiation
Alex Shi <alex.shi@linux.alibaba.com>:
mm: memcontrol: document the new swap control behavior
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: delete unused lrucare handling
mm: memcontrol: update page->mem_cgroup stability rules
mm: fix LRU balancing effect of new transparent huge pages
mm: keep separate anon and file statistics on page reclaim activity
mm: allow swappiness that prefers reclaiming anon over the file workingset
mm: fold and remove lru_cache_add_anon() and lru_cache_add_file()
mm: workingset: let cache workingset challenge anon
mm: remove use-once cache bias from LRU balancing
mm: vmscan: drop unnecessary div0 avoidance rounding in get_scan_count()
mm: base LRU balancing on an explicit cost model
mm: deactivations shouldn't bias the LRU balance
mm: only count actual rotations as LRU reclaim cost
mm: balance LRU lists based on relative thrashing
mm: vmscan: determine anon/file pressure balance at the reclaim root
mm: vmscan: reclaim writepage is IO cost
mm: vmscan: limit the range of LRU type balancing
Shakeel Butt <shakeelb@google.com>:
mm: swap: fix vmstats for huge pages
mm: swap: memcg: fix memcg stats for huge pages
Subsystem: mm/tools
Changhee Han <ch0.han@lge.com>:
tools/vm/page_owner_sort.c: filter out unneeded line
Subsystem: mm/mempolicy
Michal Hocko <mhocko@suse.com>:
mm, mempolicy: fix up gup usage in lookup_node
Subsystem: mm/memblock
chenqiwu <chenqiwu@xiaomi.com>:
include/linux/memblock.h: fix minor typo and unclear comment
Mike Rapoport <rppt@linux.ibm.com>:
sparc32: register memory occupied by kernel as memblock.memory
Subsystem: mm/hugetlbfs
Shijie Hu <hushijie3@huawei.com>:
hugetlbfs: get unmapped area below TASK_UNMAPPED_BASE for hugetlbfs
Subsystem: mm/thp
Yang Shi <yang.shi@linux.alibaba.com>:
mm: thp: don't need to drain lru cache when splitting and mlocking THP
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/thp: Rename pmd_mknotpresent() as pmd_mknotvalid()", v2:
powerpc/mm: drop platform defined pmd_mknotpresent()
mm/thp: rename pmd_mknotpresent() as pmd_mkinvalid()
Subsystem: mm/mmap
Scott Cheloha <cheloha@linux.vnet.ibm.com>:
drivers/base/memory.c: cache memory blocks in xarray to accelerate lookup
Subsystem: mm/kconfig
Zong Li <zong.li@sifive.com>:
Patch series "Extract DEBUG_WX to shared use":
mm: add DEBUG_WX support
riscv: support DEBUG_WX
x86: mm: use ARCH_HAS_DEBUG_WX instead of arch defined
arm64: mm: use ARCH_HAS_DEBUG_WX instead of arch defined
Documentation/admin-guide/cgroup-v1/memory.rst | 19
Documentation/admin-guide/kernel-parameters.txt | 40
Documentation/admin-guide/mm/hugetlbpage.rst | 35
Documentation/admin-guide/mm/transhuge.rst | 7
Documentation/admin-guide/sysctl/vm.rst | 23
Documentation/core-api/padata.rst | 41
Documentation/features/vm/numa-memblock/arch-support.txt | 34
Documentation/vm/memory-model.rst | 9
Documentation/vm/page_owner.rst | 3
arch/alpha/mm/init.c | 16
arch/alpha/mm/numa.c | 22
arch/arc/include/asm/hugepage.h | 2
arch/arc/mm/init.c | 41
arch/arm/include/asm/hugetlb.h | 7
arch/arm/include/asm/pgtable-3level.h | 2
arch/arm/mm/init.c | 66
arch/arm64/Kconfig | 2
arch/arm64/Kconfig.debug | 29
arch/arm64/include/asm/hugetlb.h | 13
arch/arm64/include/asm/pgtable.h | 2
arch/arm64/mm/hugetlbpage.c | 48
arch/arm64/mm/init.c | 56
arch/arm64/mm/numa.c | 9
arch/c6x/mm/init.c | 8
arch/csky/kernel/setup.c | 26
arch/h8300/mm/init.c | 6
arch/hexagon/mm/init.c | 6
arch/ia64/Kconfig | 1
arch/ia64/include/asm/hugetlb.h | 5
arch/ia64/mm/contig.c | 2
arch/ia64/mm/discontig.c | 2
arch/m68k/mm/init.c | 6
arch/m68k/mm/mcfmmu.c | 9
arch/m68k/mm/motorola.c | 15
arch/m68k/mm/sun3mmu.c | 10
arch/microblaze/Kconfig | 1
arch/microblaze/mm/init.c | 2
arch/mips/Kconfig | 1
arch/mips/include/asm/hugetlb.h | 11
arch/mips/include/asm/pgtable.h | 2
arch/mips/loongson64/numa.c | 2
arch/mips/mm/init.c | 2
arch/mips/sgi-ip27/ip27-memory.c | 2
arch/nds32/mm/init.c | 11
arch/nios2/mm/init.c | 8
arch/openrisc/mm/init.c | 9
arch/parisc/include/asm/hugetlb.h | 10
arch/parisc/mm/init.c | 22
arch/powerpc/Kconfig | 10
arch/powerpc/include/asm/book3s/64/pgtable.h | 4
arch/powerpc/include/asm/hugetlb.h | 5
arch/powerpc/mm/hugetlbpage.c | 38
arch/powerpc/mm/mem.c | 2
arch/riscv/Kconfig | 2
arch/riscv/include/asm/hugetlb.h | 10
arch/riscv/include/asm/ptdump.h | 11
arch/riscv/mm/hugetlbpage.c | 44
arch/riscv/mm/init.c | 5
arch/s390/Kconfig | 1
arch/s390/include/asm/hugetlb.h | 8
arch/s390/mm/hugetlbpage.c | 34
arch/s390/mm/init.c | 2
arch/sh/Kconfig | 1
arch/sh/include/asm/hugetlb.h | 7
arch/sh/mm/init.c | 2
arch/sparc/Kconfig | 10
arch/sparc/include/asm/hugetlb.h | 10
arch/sparc/mm/init_32.c | 1
arch/sparc/mm/init_64.c | 67
arch/sparc/mm/srmmu.c | 21
arch/um/kernel/mem.c | 12
arch/unicore32/include/asm/memory.h | 2
arch/unicore32/include/mach/memory.h | 6
arch/unicore32/kernel/pci.c | 14
arch/unicore32/mm/init.c | 43
arch/x86/Kconfig | 11
arch/x86/Kconfig.debug | 27
arch/x86/include/asm/hugetlb.h | 10
arch/x86/include/asm/pgtable.h | 2
arch/x86/mm/hugetlbpage.c | 35
arch/x86/mm/init.c | 2
arch/x86/mm/init_64.c | 12
arch/x86/mm/kmmio.c | 2
arch/x86/mm/numa.c | 11
arch/xtensa/mm/init.c | 8
drivers/base/memory.c | 44
drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 22
fs/cifs/file.c | 10
fs/fuse/dev.c | 2
fs/hugetlbfs/inode.c | 67
include/asm-generic/hugetlb.h | 2
include/linux/compaction.h | 9
include/linux/gfp.h | 7
include/linux/hugetlb.h | 16
include/linux/memblock.h | 15
include/linux/memcontrol.h | 102 -
include/linux/mm.h | 52
include/linux/mmzone.h | 46
include/linux/padata.h | 43
include/linux/string.h | 60
include/linux/swap.h | 17
include/linux/vm_event_item.h | 4
include/linux/vmstat.h | 2
include/trace/events/compaction.h | 22
include/trace/events/huge_memory.h | 3
include/trace/events/vmscan.h | 14
init/Kconfig | 17
init/main.c | 2
kernel/events/uprobes.c | 22
kernel/padata.c | 293 +++-
kernel/sysctl.c | 3
lib/test_kasan.c | 29
mm/Kconfig | 9
mm/Kconfig.debug | 32
mm/compaction.c | 70 -
mm/filemap.c | 55
mm/gup.c | 237 ++-
mm/huge_memory.c | 282 ----
mm/hugetlb.c | 260 ++-
mm/internal.h | 25
mm/khugepaged.c | 316 ++--
mm/memblock.c | 19
mm/memcontrol.c | 642 +++------
mm/memory.c | 103 -
mm/memory_hotplug.c | 10
mm/mempolicy.c | 5
mm/migrate.c | 30
mm/oom_kill.c | 4
mm/page_alloc.c | 735 ++++------
mm/page_owner.c | 7
mm/pgtable-generic.c | 2
mm/rmap.c | 53
mm/shmem.c | 156 --
mm/slab.c | 4
mm/slub.c | 8
mm/swap.c | 199 +-
mm/swap_cgroup.c | 10
mm/swap_state.c | 110 -
mm/swapfile.c | 39
mm/userfaultfd.c | 15
mm/vmscan.c | 344 ++--
mm/vmstat.c | 16
mm/workingset.c | 23
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 1
tools/testing/selftests/vm/khugepaged.c | 1035 +++++++++++++++
tools/vm/page_owner_sort.c | 5
147 files changed, 3876 insertions(+), 3108 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-06-04 23:45 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-06-04 23:45 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
- More MM work. 100ish more to go. Mike's "mm: remove
__ARCH_HAS_5LEVEL_HACK" series should fix the current ppc issue.
- Various other little subsystems
127 patches, based on 6929f71e46bdddbf1c4d67c2728648176c67c555.
Subsystems affected by this patch series:
kcov
mm/pagemap
mm/vmalloc
mm/kmap
mm/util
mm/memory-hotplug
mm/cleanups
mm/zram
procfs
core-kernel
get_maintainer
lib
bitops
checkpatch
binfmt
init
fat
seq_file
exec
rapidio
relay
selftests
ubsan
Subsystem: kcov
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kcov: collect coverage from usb soft interrupts", v4:
kcov: cleanup debug messages
kcov: fix potential use-after-free in kcov_remote_start
kcov: move t->kcov assignments into kcov_start/stop
kcov: move t->kcov_sequence assignment
kcov: use t->kcov_mode as enabled indicator
kcov: collect coverage from interrupts
usb: core: kcov: collect coverage from usb complete callback
Subsystem: mm/pagemap
Feng Tang <feng.tang@intel.com>:
mm/util.c: remove the VM_WARN_ONCE for vm_committed_as underflow check
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: remove __ARCH_HAS_5LEVEL_HACK", v4:
h8300: remove usage of __ARCH_USE_5LEVEL_HACK
arm: add support for folded p4d page tables
arm64: add support for folded p4d page tables
hexagon: remove __ARCH_USE_5LEVEL_HACK
ia64: add support for folded p4d page tables
nios2: add support for folded p4d page tables
openrisc: add support for folded p4d page tables
powerpc: add support for folded p4d page tables
Geert Uytterhoeven <geert+renesas@glider.be>:
sh: fault: modernize printing of kernel messages
Mike Rapoport <rppt@linux.ibm.com>:
sh: drop __pXd_offset() macros that duplicate pXd_index() ones
sh: add support for folded p4d page tables
unicore32: remove __ARCH_USE_5LEVEL_HACK
asm-generic: remove pgtable-nop4d-hack.h
mm: remove __ARCH_HAS_5LEVEL_HACK and include/asm-generic/5level-fixup.h
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/debug: Add tests validating architecture page table:
x86/mm: define mm_p4d_folded()
mm/debug: add tests validating architecture page table helpers
Subsystem: mm/vmalloc
Jeongtae Park <jtp.park@samsung.com>:
mm/vmalloc: fix a typo in comment
Subsystem: mm/kmap
Ira Weiny <ira.weiny@intel.com>:
Patch series "Remove duplicated kmap code", v3:
arch/kmap: remove BUG_ON()
arch/xtensa: move kmap build bug out of the way
arch/kmap: remove redundant arch specific kmaps
arch/kunmap: remove duplicate kunmap implementations
{x86,powerpc,microblaze}/kmap: move preempt disable
arch/kmap_atomic: consolidate duplicate code
arch/kunmap_atomic: consolidate duplicate code
arch/kmap: ensure kmap_prot visibility
arch/kmap: don't hard code kmap_prot values
arch/kmap: define kmap_atomic_prot() for all arch's
drm: remove drm specific kmap_atomic code
kmap: remove kmap_atomic_to_page()
parisc/kmap: remove duplicate kmap code
sparc: remove unnecessary includes
kmap: consolidate kmap_prot definitions
Subsystem: mm/util
Waiman Long <longman@redhat.com>:
mm: add kvfree_sensitive() for freeing sensitive data objects
Subsystem: mm/memory-hotplug
Vishal Verma <vishal.l.verma@intel.com>:
mm/memory_hotplug: refrain from adding memory into an impossible node
David Hildenbrand <david@redhat.com>:
powerpc/pseries/hotplug-memory: stop checking is_mem_section_removable()
mm/memory_hotplug: remove is_mem_section_removable()
Patch series "mm/memory_hotplug: handle memblocks only with:
mm/memory_hotplug: set node_start_pfn of hotadded pgdat to 0
mm/memory_hotplug: handle memblocks only with CONFIG_ARCH_KEEP_MEMBLOCK
Patch series "mm/memory_hotplug: Interface to add driver-managed system:
mm/memory_hotplug: introduce add_memory_driver_managed()
kexec_file: don't place kexec images on IORESOURCE_MEM_DRIVER_MANAGED
device-dax: add memory via add_memory_driver_managed()
Michal Hocko <mhocko@kernel.org>:
mm/memory_hotplug: disable the functionality for 32b
Subsystem: mm/cleanups
chenqiwu <chenqiwu@xiaomi.com>:
mm: replace zero-length array with flexible-array member
Ethon Paul <ethp@qq.com>:
mm/memory_hotplug: fix a typo in comment "recoreded"->"recorded"
mm: ksm: fix a typo in comment "alreaady"->"already"
mm: mmap: fix a typo in comment "compatbility"->"compatibility"
mm/hugetlb: fix a typos in comments
mm/vmsan: fix some typos in comment
mm/compaction: fix a typo in comment "pessemistic"->"pessimistic"
mm/memblock: fix a typo in comment "implict"->"implicit"
mm/list_lru: fix a typo in comment "numbesr"->"numbers"
mm/filemap: fix a typo in comment "unneccssary"->"unnecessary"
mm/frontswap: fix some typos in frontswap.c
mm, memcg: fix some typos in memcontrol.c
mm: fix a typo in comment "strucure"->"structure"
mm/slub: fix a typo in comment "disambiguiation"->"disambiguation"
mm/sparse: fix a typo in comment "convienence"->"convenience"
mm/page-writeback: fix a typo in comment "effictive"->"effective"
mm/memory: fix a typo in comment "attampt"->"attempt"
Zou Wei <zou_wei@huawei.com>:
mm: use false for bool variable
Jason Yan <yanaijie@huawei.com>:
include/linux/mm.h: return true in cpupid_pid_unset()
Subsystem: mm/zram
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
zcomp: Use ARRAY_SIZE() for backends list
Subsystem: procfs
Alexey Dobriyan <adobriyan@gmail.com>:
proc: rename "catch" function argument
Subsystem: core-kernel
Jason Yan <yanaijie@huawei.com>:
user.c: make uidhash_table static
Subsystem: get_maintainer
Joe Perches <joe@perches.com>:
get_maintainer: add email addresses from .yaml files
get_maintainer: fix unexpected behavior for path/to//file (double slashes)
Subsystem: lib
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
lib/math: avoid trailing newline hidden in pr_fmt()
KP Singh <kpsingh@chromium.org>:
lib: Add might_fault() to strncpy_from_user.
Jason Yan <yanaijie@huawei.com>:
lib/test_lockup.c: make test_inode static
Jann Horn <jannh@google.com>:
lib/zlib: remove outdated and incorrect pre-increment optimization
Joe Perches <joe@perches.com>:
lib/percpu-refcount.c: use a more common logging style
Tan Hu <tan.hu@zte.com.cn>:
lib/flex_proportions.c: cleanup __fprop_inc_percpu_max
Jesse Brandeburg <jesse.brandeburg@intel.com>:
lib: make a test module with set/clear bit
Subsystem: bitops
Arnd Bergmann <arnd@arndb.de>:
include/linux/bitops.h: avoid clang shift-count-overflow warnings
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: additional MAINTAINER section entry ordering checks
checkpatch: look for c99 comments in ctx_locate_comment
checkpatch: disallow --git and --file/--fix
Geert Uytterhoeven <geert+renesas@glider.be>:
checkpatch: use patch subject when reading from stdin
Subsystem: binfmt
Anthony Iliopoulos <ailiop@suse.com>:
fs/binfmt_elf: remove redundant elf_map ifndef
Nick Desaulniers <ndesaulniers@google.com>:
elfnote: mark all .note sections SHF_ALLOC
Subsystem: init
Chris Down <chris@chrisdown.name>:
init: allow distribution configuration of default init
Subsystem: fat
OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
fat: don't allow to mount if the FAT length == 0
fat: improve the readahead for FAT entries
Subsystem: seq_file
Joe Perches <joe@perches.com>:
fs/seq_file.c: seq_read: Update pr_info_ratelimited
Kefeng Wang <wangkefeng.wang@huawei.com>:
Patch series "seq_file: Introduce DEFINE_SEQ_ATTRIBUTE() helper macro":
include/linux/seq_file.h: introduce DEFINE_SEQ_ATTRIBUTE() helper macro
mm/vmstat.c: convert to use DEFINE_SEQ_ATTRIBUTE macro
kernel/kprobes.c: convert to use DEFINE_SEQ_ATTRIBUTE macro
Subsystem: exec
Christoph Hellwig <hch@lst.de>:
exec: simplify the copy_strings_kernel calling convention
exec: open code copy_string_kernel
Subsystem: rapidio
Madhuparna Bhowmik <madhuparnabhowmik10@gmail.com>:
rapidio: avoid data race between file operation callbacks and mport_cdev_add().
John Hubbard <jhubbard@nvidia.com>:
rapidio: convert get_user_pages() --> pin_user_pages()
Subsystem: relay
Daniel Axtens <dja@axtens.net>:
kernel/relay.c: handle alloc_percpu returning NULL in relay_open
Pengcheng Yang <yangpc@wangsu.com>:
kernel/relay.c: fix read_pos error when multiple readers
Subsystem: selftests
Ram Pai <linuxram@us.ibm.com>:
Patch series "selftests, powerpc, x86: Memory Protection Keys", v19:
selftests/x86/pkeys: move selftests to arch-neutral directory
selftests/vm/pkeys: rename all references to pkru to a generic name
selftests/vm/pkeys: move generic definitions to header file
Thiago Jung Bauermann <bauerman@linux.ibm.com>:
selftests/vm/pkeys: move some definitions to arch-specific header
selftests/vm/pkeys: make gcc check arguments of sigsafe_printf()
Sandipan Das <sandipan@linux.ibm.com>:
selftests: vm: pkeys: Use sane types for pkey register
selftests: vm: pkeys: add helpers for pkey bits
Ram Pai <linuxram@us.ibm.com>:
selftests/vm/pkeys: fix pkey_disable_clear()
selftests/vm/pkeys: fix assertion in pkey_disable_set/clear()
selftests/vm/pkeys: fix alloc_random_pkey() to make it really random
Sandipan Das <sandipan@linux.ibm.com>:
selftests: vm: pkeys: use the correct huge page size
Ram Pai <linuxram@us.ibm.com>:
selftests/vm/pkeys: introduce generic pkey abstractions
selftests/vm/pkeys: introduce powerpc support
"Desnes A. Nunes do Rosario" <desnesn@linux.vnet.ibm.com>:
selftests/vm/pkeys: fix number of reserved powerpc pkeys
Ram Pai <linuxram@us.ibm.com>:
selftests/vm/pkeys: fix assertion in test_pkey_alloc_exhaust()
selftests/vm/pkeys: improve checks to determine pkey support
selftests/vm/pkeys: associate key on a mapped page and detect access violation
selftests/vm/pkeys: associate key on a mapped page and detect write violation
selftests/vm/pkeys: detect write violation on a mapped access-denied-key page
selftests/vm/pkeys: introduce a sub-page allocator
selftests/vm/pkeys: test correct behaviour of pkey-0
selftests/vm/pkeys: override access right definitions on powerpc
Sandipan Das <sandipan@linux.ibm.com>:
selftests: vm: pkeys: use the correct page size on powerpc
selftests: vm: pkeys: fix multilib builds for x86
Jagadeesh Pagadala <jagdsh.linux@gmail.com>:
tools/testing/selftests/vm: remove duplicate headers
Subsystem: ubsan
Arnd Bergmann <arnd@arndb.de>:
lib/ubsan.c: fix gcc-10 warnings
Documentation/dev-tools/kcov.rst | 17
Documentation/features/debug/debug-vm-pgtable/arch-support.txt | 34
arch/arc/Kconfig | 1
arch/arc/include/asm/highmem.h | 20
arch/arc/mm/highmem.c | 34
arch/arm/include/asm/highmem.h | 9
arch/arm/include/asm/pgtable.h | 1
arch/arm/lib/uaccess_with_memcpy.c | 7
arch/arm/mach-sa1100/assabet.c | 2
arch/arm/mm/dump.c | 29
arch/arm/mm/fault-armv.c | 7
arch/arm/mm/fault.c | 22
arch/arm/mm/highmem.c | 41
arch/arm/mm/idmap.c | 3
arch/arm/mm/init.c | 2
arch/arm/mm/ioremap.c | 12
arch/arm/mm/mm.h | 2
arch/arm/mm/mmu.c | 35
arch/arm/mm/pgd.c | 40
arch/arm64/Kconfig | 1
arch/arm64/include/asm/kvm_mmu.h | 10
arch/arm64/include/asm/pgalloc.h | 10
arch/arm64/include/asm/pgtable-types.h | 5
arch/arm64/include/asm/pgtable.h | 37
arch/arm64/include/asm/stage2_pgtable.h | 48
arch/arm64/kernel/hibernate.c | 44
arch/arm64/kvm/mmu.c | 209
arch/arm64/mm/fault.c | 9
arch/arm64/mm/hugetlbpage.c | 15
arch/arm64/mm/kasan_init.c | 26
arch/arm64/mm/mmu.c | 52
arch/arm64/mm/pageattr.c | 7
arch/csky/include/asm/highmem.h | 12
arch/csky/mm/highmem.c | 64
arch/h8300/include/asm/pgtable.h | 1
arch/hexagon/include/asm/fixmap.h | 4
arch/hexagon/include/asm/pgtable.h | 1
arch/ia64/include/asm/pgalloc.h | 4
arch/ia64/include/asm/pgtable.h | 17
arch/ia64/mm/fault.c | 7
arch/ia64/mm/hugetlbpage.c | 18
arch/ia64/mm/init.c | 28
arch/microblaze/include/asm/highmem.h | 55
arch/microblaze/mm/highmem.c | 21
arch/microblaze/mm/init.c | 3
arch/mips/include/asm/highmem.h | 11
arch/mips/mm/cache.c | 6
arch/mips/mm/highmem.c | 62
arch/nds32/include/asm/highmem.h | 9
arch/nds32/mm/highmem.c | 49
arch/nios2/include/asm/pgtable.h | 3
arch/nios2/mm/fault.c | 9
arch/nios2/mm/ioremap.c | 6
arch/openrisc/include/asm/pgtable.h | 1
arch/openrisc/mm/fault.c | 10
arch/openrisc/mm/init.c | 4
arch/parisc/include/asm/cacheflush.h | 32
arch/powerpc/Kconfig | 1
arch/powerpc/include/asm/book3s/32/pgtable.h | 1
arch/powerpc/include/asm/book3s/64/hash.h | 4
arch/powerpc/include/asm/book3s/64/pgalloc.h | 4
arch/powerpc/include/asm/book3s/64/pgtable.h | 60
arch/powerpc/include/asm/book3s/64/radix.h | 6
arch/powerpc/include/asm/highmem.h | 56
arch/powerpc/include/asm/nohash/32/pgtable.h | 1
arch/powerpc/include/asm/nohash/64/pgalloc.h | 2
arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 32
arch/powerpc/include/asm/nohash/64/pgtable.h | 6
arch/powerpc/include/asm/pgtable.h | 10
arch/powerpc/kvm/book3s_64_mmu_radix.c | 32
arch/powerpc/lib/code-patching.c | 7
arch/powerpc/mm/book3s64/hash_pgtable.c | 4
arch/powerpc/mm/book3s64/radix_pgtable.c | 26
arch/powerpc/mm/book3s64/subpage_prot.c | 6
arch/powerpc/mm/highmem.c | 26
arch/powerpc/mm/hugetlbpage.c | 28
arch/powerpc/mm/kasan/kasan_init_32.c | 2
arch/powerpc/mm/mem.c | 3
arch/powerpc/mm/nohash/book3e_pgtable.c | 15
arch/powerpc/mm/pgtable.c | 30
arch/powerpc/mm/pgtable_64.c | 10
arch/powerpc/mm/ptdump/hashpagetable.c | 20
arch/powerpc/mm/ptdump/ptdump.c | 12
arch/powerpc/platforms/pseries/hotplug-memory.c | 26
arch/powerpc/xmon/xmon.c | 27
arch/s390/Kconfig | 1
arch/sh/include/asm/pgtable-2level.h | 1
arch/sh/include/asm/pgtable-3level.h | 1
arch/sh/include/asm/pgtable_32.h | 5
arch/sh/include/asm/pgtable_64.h | 5
arch/sh/kernel/io_trapped.c | 7
arch/sh/mm/cache-sh4.c | 4
arch/sh/mm/cache-sh5.c | 7
arch/sh/mm/fault.c | 64
arch/sh/mm/hugetlbpage.c | 28
arch/sh/mm/init.c | 15
arch/sh/mm/kmap.c | 2
arch/sh/mm/tlbex_32.c | 6
arch/sh/mm/tlbex_64.c | 7
arch/sparc/include/asm/highmem.h | 29
arch/sparc/mm/highmem.c | 31
arch/sparc/mm/io-unit.c | 1
arch/sparc/mm/iommu.c | 1
arch/unicore32/include/asm/pgtable.h | 1
arch/unicore32/kernel/hibernate.c | 4
arch/x86/Kconfig | 1
arch/x86/include/asm/fixmap.h | 1
arch/x86/include/asm/highmem.h | 37
arch/x86/include/asm/pgtable_64.h | 6
arch/x86/mm/highmem_32.c | 52
arch/xtensa/include/asm/highmem.h | 31
arch/xtensa/mm/highmem.c | 28
drivers/block/zram/zcomp.c | 7
drivers/dax/dax-private.h | 1
drivers/dax/kmem.c | 28
drivers/gpu/drm/ttm/ttm_bo_util.c | 56
drivers/gpu/drm/vmwgfx/vmwgfx_blit.c | 17
drivers/rapidio/devices/rio_mport_cdev.c | 27
drivers/usb/core/hcd.c | 3
fs/binfmt_elf.c | 4
fs/binfmt_em86.c | 6
fs/binfmt_misc.c | 4
fs/binfmt_script.c | 6
fs/exec.c | 58
fs/fat/fatent.c | 103
fs/fat/inode.c | 6
fs/proc/array.c | 8
fs/seq_file.c | 7
include/asm-generic/5level-fixup.h | 59
include/asm-generic/pgtable-nop4d-hack.h | 64
include/asm-generic/pgtable-nopud.h | 4
include/drm/ttm/ttm_bo_api.h | 4
include/linux/binfmts.h | 3
include/linux/bitops.h | 2
include/linux/elfnote.h | 2
include/linux/highmem.h | 89
include/linux/ioport.h | 1
include/linux/memory_hotplug.h | 9
include/linux/mm.h | 12
include/linux/sched.h | 3
include/linux/seq_file.h | 19
init/Kconfig | 10
init/main.c | 10
kernel/kcov.c | 282 -
kernel/kexec_file.c | 5
kernel/kprobes.c | 34
kernel/relay.c | 22
kernel/user.c | 2
lib/Kconfig.debug | 44
lib/Makefile | 2
lib/flex_proportions.c | 7
lib/math/prime_numbers.c | 10
lib/percpu-refcount.c | 6
lib/strncpy_from_user.c | 1
lib/test_bitops.c | 60
lib/test_lockup.c | 2
lib/ubsan.c | 33
lib/zlib_inflate/inffast.c | 91
mm/Kconfig | 4
mm/Makefile | 1
mm/compaction.c | 2
mm/debug_vm_pgtable.c | 382 +
mm/filemap.c | 2
mm/frontswap.c | 6
mm/huge_memory.c | 2
mm/hugetlb.c | 16
mm/internal.h | 2
mm/kasan/init.c | 11
mm/ksm.c | 10
mm/list_lru.c | 2
mm/memblock.c | 2
mm/memcontrol.c | 4
mm/memory.c | 10
mm/memory_hotplug.c | 179
mm/mmap.c | 2
mm/mremap.c | 2
mm/page-writeback.c | 2
mm/slub.c | 2
mm/sparse.c | 2
mm/util.c | 22
mm/vmalloc.c | 2
mm/vmscan.c | 6
mm/vmstat.c | 32
mm/zbud.c | 2
scripts/checkpatch.pl | 62
scripts/get_maintainer.pl | 46
security/keys/internal.h | 11
security/keys/keyctl.c | 16
tools/testing/selftests/lib/config | 1
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 75
tools/testing/selftests/vm/mremap_dontunmap.c | 1
tools/testing/selftests/vm/pkey-helpers.h | 557 +-
tools/testing/selftests/vm/pkey-powerpc.h | 153
tools/testing/selftests/vm/pkey-x86.h | 191
tools/testing/selftests/vm/protection_keys.c | 2370 ++++++++--
tools/testing/selftests/x86/.gitignore | 1
tools/testing/selftests/x86/Makefile | 2
tools/testing/selftests/x86/pkey-helpers.h | 219
tools/testing/selftests/x86/protection_keys.c | 1506 ------
200 files changed, 5182 insertions(+), 4033 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-06-08 4:35 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-06-08 4:35 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
Various trees. Mainly those parts of MM whose linux-next dependents
are now merged. I'm still sitting on ~160 patches which await merges
from -next.
54 patches, based on 9aa900c8094dba7a60dc805ecec1e9f720744ba1.
Subsystems affected by this patch series:
mm/proc
ipc
dynamic-debug
panic
lib
sysctl
mm/gup
mm/pagemap
Subsystem: mm/proc
SeongJae Park <sjpark@amazon.de>:
mm/page_idle.c: skip offline pages
Subsystem: ipc
Jules Irenge <jbi.octave@gmail.com>:
ipc/msg: add missing annotation for freeque()
Giuseppe Scrivano <gscrivan@redhat.com>:
ipc/namespace.c: use a work queue to free_ipc
Subsystem: dynamic-debug
Orson Zhai <orson.zhai@unisoc.com>:
dynamic_debug: add an option to enable dynamic debug for modules only
Subsystem: panic
Rafael Aquini <aquini@redhat.com>:
kernel: add panic_on_taint
Subsystem: lib
Manfred Spraul <manfred@colorfullife.com>:
xarray.h: correct return code documentation for xa_store_{bh,irq}()
Subsystem: sysctl
Vlastimil Babka <vbabka@suse.cz>:
Patch series "support setting sysctl parameters from kernel command line", v3:
kernel/sysctl: support setting sysctl parameters from kernel command line
kernel/sysctl: support handling command line aliases
kernel/hung_task convert hung_task_panic boot parameter to sysctl
tools/testing/selftests/sysctl/sysctl.sh: support CONFIG_TEST_SYSCTL=y
lib/test_sysctl: support testing of sysctl. boot parameter
"Guilherme G. Piccoli" <gpiccoli@canonical.com>:
kernel/watchdog.c: convert {soft/hard}lockup boot parameters to sysctl aliases
kernel/hung_task.c: introduce sysctl to print all traces when a hung task is detected
panic: add sysctl to dump all CPUs backtraces on oops event
Rafael Aquini <aquini@redhat.com>:
kernel/sysctl.c: ignore out-of-range taint bits introduced via kernel.tainted
Subsystem: mm/gup
Souptick Joarder <jrdr.linux@gmail.com>:
mm/gup.c: convert to use get_user_{page|pages}_fast_only()
John Hubbard <jhubbard@nvidia.com>:
mm/gup: update pin_user_pages.rst for "case 3" (mmu notifiers)
Patch series "mm/gup: introduce pin_user_pages_locked(), use it in frame_vector.c", v2:
mm/gup: introduce pin_user_pages_locked()
mm/gup: frame_vector: convert get_user_pages() --> pin_user_pages()
mm/gup: documentation fix for pin_user_pages*() APIs
Patch series "vhost, docs: convert to pin_user_pages(), new "case 5"":
docs: mm/gup: pin_user_pages.rst: add a "case 5"
vhost: convert get_user_pages() --> pin_user_pages()
Subsystem: mm/pagemap
Alexander Gordeev <agordeev@linux.ibm.com>:
mm/mmap.c: add more sanity checks to get_unmapped_area()
mm/mmap.c: do not allow mappings outside of allowed limits
Christoph Hellwig <hch@lst.de>:
Patch series "sort out the flush_icache_range mess", v2:
arm: fix the flush_icache_range arguments in set_fiq_handler
nds32: unexport flush_icache_page
powerpc: unexport flush_icache_user_range
unicore32: remove flush_cache_user_range
asm-generic: fix the inclusion guards for cacheflush.h
asm-generic: don't include <linux/mm.h> in cacheflush.h
asm-generic: improve the flush_dcache_page stub
alpha: use asm-generic/cacheflush.h
arm64: use asm-generic/cacheflush.h
c6x: use asm-generic/cacheflush.h
hexagon: use asm-generic/cacheflush.h
ia64: use asm-generic/cacheflush.h
microblaze: use asm-generic/cacheflush.h
m68knommu: use asm-generic/cacheflush.h
openrisc: use asm-generic/cacheflush.h
powerpc: use asm-generic/cacheflush.h
riscv: use asm-generic/cacheflush.h
arm,sparc,unicore32: remove flush_icache_user_range
mm: rename flush_icache_user_range to flush_icache_user_page
asm-generic: add a flush_icache_user_range stub
sh: implement flush_icache_user_range
xtensa: implement flush_icache_user_range
arm: rename flush_cache_user_range to flush_icache_user_range
m68k: implement flush_icache_user_range
exec: only build read_code when needed
exec: use flush_icache_user_range in read_code
binfmt_flat: use flush_icache_user_range
nommu: use flush_icache_user_range in brk and mmap
module: move the set_fs hack for flush_icache_range to m68k
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
doc: cgroup: update note about conditions when oom killer is invoked
Documentation/admin-guide/cgroup-v2.rst | 17 +-
Documentation/admin-guide/dynamic-debug-howto.rst | 5
Documentation/admin-guide/kdump/kdump.rst | 8 +
Documentation/admin-guide/kernel-parameters.txt | 34 +++-
Documentation/admin-guide/sysctl/kernel.rst | 37 ++++
Documentation/core-api/pin_user_pages.rst | 47 ++++--
arch/alpha/include/asm/cacheflush.h | 38 +----
arch/alpha/kernel/smp.c | 2
arch/arm/include/asm/cacheflush.h | 7
arch/arm/kernel/fiq.c | 4
arch/arm/kernel/traps.c | 2
arch/arm64/include/asm/cacheflush.h | 46 ------
arch/c6x/include/asm/cacheflush.h | 19 --
arch/hexagon/include/asm/cacheflush.h | 19 --
arch/ia64/include/asm/cacheflush.h | 30 ----
arch/m68k/include/asm/cacheflush_mm.h | 6
arch/m68k/include/asm/cacheflush_no.h | 19 --
arch/m68k/mm/cache.c | 13 +
arch/microblaze/include/asm/cacheflush.h | 29 ---
arch/nds32/include/asm/cacheflush.h | 4
arch/nds32/mm/cacheflush.c | 3
arch/openrisc/include/asm/cacheflush.h | 33 ----
arch/powerpc/include/asm/cacheflush.h | 46 +-----
arch/powerpc/kvm/book3s_64_mmu_hv.c | 2
arch/powerpc/kvm/book3s_64_mmu_radix.c | 2
arch/powerpc/mm/mem.c | 3
arch/powerpc/perf/callchain_64.c | 4
arch/riscv/include/asm/cacheflush.h | 65 --------
arch/sh/include/asm/cacheflush.h | 1
arch/sparc/include/asm/cacheflush_32.h | 2
arch/sparc/include/asm/cacheflush_64.h | 1
arch/um/include/asm/tlb.h | 2
arch/unicore32/include/asm/cacheflush.h | 11 -
arch/x86/include/asm/cacheflush.h | 2
arch/xtensa/include/asm/cacheflush.h | 2
drivers/media/platform/omap3isp/ispvideo.c | 2
drivers/nvdimm/pmem.c | 3
drivers/vhost/vhost.c | 5
fs/binfmt_flat.c | 2
fs/exec.c | 5
fs/proc/proc_sysctl.c | 163 ++++++++++++++++++++--
include/asm-generic/cacheflush.h | 25 +--
include/linux/dev_printk.h | 6
include/linux/dynamic_debug.h | 2
include/linux/ipc_namespace.h | 2
include/linux/kernel.h | 9 +
include/linux/mm.h | 12 +
include/linux/net.h | 3
include/linux/netdevice.h | 6
include/linux/printk.h | 9 -
include/linux/sched/sysctl.h | 7
include/linux/sysctl.h | 4
include/linux/xarray.h | 4
include/rdma/ib_verbs.h | 6
init/main.c | 2
ipc/msg.c | 2
ipc/namespace.c | 24 ++-
kernel/events/core.c | 4
kernel/events/uprobes.c | 2
kernel/hung_task.c | 30 ++--
kernel/module.c | 8 -
kernel/panic.c | 45 ++++++
kernel/sysctl.c | 38 ++++-
kernel/watchdog.c | 37 +---
lib/Kconfig.debug | 12 +
lib/Makefile | 2
lib/dynamic_debug.c | 9 -
lib/test_sysctl.c | 13 +
mm/frame_vector.c | 7
mm/gup.c | 74 +++++++--
mm/mmap.c | 28 ++-
mm/nommu.c | 4
mm/page_alloc.c | 9 -
mm/page_idle.c | 7
tools/testing/selftests/sysctl/sysctl.sh | 44 +++++
virt/kvm/kvm_main.c | 8 -
76 files changed, 732 insertions(+), 517 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-06-09 4:29 Andrew Morton
2020-06-09 16:58 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-06-09 4:29 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- a kernel-wide sweep of show_stack()
- pagetable cleanups
- abstract out accesses to mmap_sem - prep for mmap_sem scalability work
- hch's user acess work
93 patches, based on abfbb29297c27e3f101f348dc9e467b0fe70f919:
Subsystems affected by this patch series:
debug
mm/pagemap
mm/maccess
mm/documentation
Subsystem: debug
Dmitry Safonov <dima@arista.com>:
Patch series "Add log level to show_stack()", v3:
kallsyms/printk: add loglvl to print_ip_sym()
alpha: add show_stack_loglvl()
arc: add show_stack_loglvl()
arm/asm: add loglvl to c_backtrace()
arm: add loglvl to unwind_backtrace()
arm: add loglvl to dump_backtrace()
arm: wire up dump_backtrace_{entry,stm}
arm: add show_stack_loglvl()
arm64: add loglvl to dump_backtrace()
arm64: add show_stack_loglvl()
c6x: add show_stack_loglvl()
csky: add show_stack_loglvl()
h8300: add show_stack_loglvl()
hexagon: add show_stack_loglvl()
ia64: pass log level as arg into ia64_do_show_stack()
ia64: add show_stack_loglvl()
m68k: add show_stack_loglvl()
microblaze: add loglvl to microblaze_unwind_inner()
microblaze: add loglvl to microblaze_unwind()
microblaze: add show_stack_loglvl()
mips: add show_stack_loglvl()
nds32: add show_stack_loglvl()
nios2: add show_stack_loglvl()
openrisc: add show_stack_loglvl()
parisc: add show_stack_loglvl()
powerpc: add show_stack_loglvl()
riscv: add show_stack_loglvl()
s390: add show_stack_loglvl()
sh: add loglvl to dump_mem()
sh: remove needless printk()
sh: add loglvl to printk_address()
sh: add loglvl to show_trace()
sh: add show_stack_loglvl()
sparc: add show_stack_loglvl()
um/sysrq: remove needless variable sp
um: add show_stack_loglvl()
unicore32: remove unused pmode argument in c_backtrace()
unicore32: add loglvl to c_backtrace()
unicore32: add show_stack_loglvl()
x86: add missing const qualifiers for log_lvl
x86: add show_stack_loglvl()
xtensa: add loglvl to show_trace()
xtensa: add show_stack_loglvl()
sysrq: use show_stack_loglvl()
x86/amd_gart: print stacktrace for a leak with KERN_ERR
power: use show_stack_loglvl()
kdb: don't play with console_loglevel
sched: print stack trace with KERN_INFO
kernel: use show_stack_loglvl()
kernel: rename show_stack_loglvl() => show_stack()
Subsystem: mm/pagemap
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: consolidate definitions of page table accessors", v2:
mm: don't include asm/pgtable.h if linux/mm.h is already included
mm: introduce include/linux/pgtable.h
mm: reorder includes after introduction of linux/pgtable.h
csky: replace definitions of __pXd_offset() with pXd_index()
m68k/mm/motorola: move comment about page table allocation funcitons
m68k/mm: move {cache,nocahe}_page() definitions close to their user
x86/mm: simplify init_trampoline() and surrounding logic
mm: pgtable: add shortcuts for accessing kernel PMD and PTE
mm: consolidate pte_index() and pte_offset_*() definitions
Michel Lespinasse <walken@google.com>:
mmap locking API: initial implementation as rwsem wrappers
MMU notifier: use the new mmap locking API
DMA reservations: use the new mmap locking API
mmap locking API: use coccinelle to convert mmap_sem rwsem call sites
mmap locking API: convert mmap_sem call sites missed by coccinelle
mmap locking API: convert nested write lock sites
mmap locking API: add mmap_read_trylock_non_owner()
mmap locking API: add MMAP_LOCK_INITIALIZER
mmap locking API: add mmap_assert_locked() and mmap_assert_write_locked()
mmap locking API: rename mmap_sem to mmap_lock
mmap locking API: convert mmap_sem API comments
mmap locking API: convert mmap_sem comments
Subsystem: mm/maccess
Christoph Hellwig <hch@lst.de>:
Patch series "clean up and streamline probe_kernel_* and friends", v4:
maccess: unexport probe_kernel_write()
maccess: remove various unused weak aliases
maccess: remove duplicate kerneldoc comments
maccess: clarify kerneldoc comments
maccess: update the top of file comment
maccess: rename strncpy_from_unsafe_user to strncpy_from_user_nofault
maccess: rename strncpy_from_unsafe_strict to strncpy_from_kernel_nofault
maccess: rename strnlen_unsafe_user to strnlen_user_nofault
maccess: remove probe_read_common and probe_write_common
maccess: unify the probe kernel arch hooks
bpf: factor out a bpf_trace_copy_string helper
bpf: handle the compat string in bpf_trace_copy_string better
Andrew Morton <akpm@linux-foundation.org>:
bpf:bpf_seq_printf(): handle potentially unsafe format string better
Christoph Hellwig <hch@lst.de>:
bpf: rework the compat kernel probe handling
tracing/kprobes: handle mixed kernel/userspace probes better
maccess: remove strncpy_from_unsafe
maccess: always use strict semantics for probe_kernel_read
maccess: move user access routines together
maccess: allow architectures to provide kernel probing directly
x86: use non-set_fs based maccess routines
maccess: return -ERANGE when probe_kernel_read() fails
Subsystem: mm/documentation
Luis Chamberlain <mcgrof@kernel.org>:
include/linux/cache.h: expand documentation over __read_mostly
Documentation/admin-guide/mm/numa_memory_policy.rst | 10
Documentation/admin-guide/mm/userfaultfd.rst | 2
Documentation/filesystems/locking.rst | 2
Documentation/vm/hmm.rst | 6
Documentation/vm/transhuge.rst | 4
arch/alpha/boot/bootp.c | 1
arch/alpha/boot/bootpz.c | 1
arch/alpha/boot/main.c | 1
arch/alpha/include/asm/io.h | 1
arch/alpha/include/asm/pgtable.h | 16
arch/alpha/kernel/process.c | 1
arch/alpha/kernel/proto.h | 4
arch/alpha/kernel/ptrace.c | 1
arch/alpha/kernel/setup.c | 1
arch/alpha/kernel/smp.c | 1
arch/alpha/kernel/sys_alcor.c | 1
arch/alpha/kernel/sys_cabriolet.c | 1
arch/alpha/kernel/sys_dp264.c | 1
arch/alpha/kernel/sys_eb64p.c | 1
arch/alpha/kernel/sys_eiger.c | 1
arch/alpha/kernel/sys_jensen.c | 1
arch/alpha/kernel/sys_marvel.c | 1
arch/alpha/kernel/sys_miata.c | 1
arch/alpha/kernel/sys_mikasa.c | 1
arch/alpha/kernel/sys_nautilus.c | 1
arch/alpha/kernel/sys_noritake.c | 1
arch/alpha/kernel/sys_rawhide.c | 1
arch/alpha/kernel/sys_ruffian.c | 1
arch/alpha/kernel/sys_rx164.c | 1
arch/alpha/kernel/sys_sable.c | 1
arch/alpha/kernel/sys_sio.c | 1
arch/alpha/kernel/sys_sx164.c | 1
arch/alpha/kernel/sys_takara.c | 1
arch/alpha/kernel/sys_titan.c | 1
arch/alpha/kernel/sys_wildfire.c | 1
arch/alpha/kernel/traps.c | 40
arch/alpha/mm/fault.c | 12
arch/alpha/mm/init.c | 1
arch/arc/include/asm/bug.h | 3
arch/arc/include/asm/pgtable.h | 24
arch/arc/kernel/process.c | 4
arch/arc/kernel/stacktrace.c | 29
arch/arc/kernel/troubleshoot.c | 6
arch/arc/mm/fault.c | 6
arch/arc/mm/highmem.c | 14
arch/arc/mm/tlbex.S | 4
arch/arm/include/asm/bug.h | 3
arch/arm/include/asm/efi.h | 3
arch/arm/include/asm/fixmap.h | 4
arch/arm/include/asm/idmap.h | 2
arch/arm/include/asm/pgtable-2level.h | 1
arch/arm/include/asm/pgtable-3level.h | 7
arch/arm/include/asm/pgtable-nommu.h | 3
arch/arm/include/asm/pgtable.h | 25
arch/arm/include/asm/traps.h | 3
arch/arm/include/asm/unwind.h | 3
arch/arm/kernel/head.S | 4
arch/arm/kernel/machine_kexec.c | 1
arch/arm/kernel/module.c | 1
arch/arm/kernel/process.c | 4
arch/arm/kernel/ptrace.c | 1
arch/arm/kernel/smp.c | 1
arch/arm/kernel/suspend.c | 4
arch/arm/kernel/swp_emulate.c | 4
arch/arm/kernel/traps.c | 61
arch/arm/kernel/unwind.c | 7
arch/arm/kernel/vdso.c | 2
arch/arm/kernel/vmlinux.lds.S | 4
arch/arm/lib/backtrace-clang.S | 9
arch/arm/lib/backtrace.S | 14
arch/arm/lib/uaccess_with_memcpy.c | 16
arch/arm/mach-ebsa110/core.c | 1
arch/arm/mach-footbridge/common.c | 1
arch/arm/mach-imx/mm-imx21.c | 1
arch/arm/mach-imx/mm-imx27.c | 1
arch/arm/mach-imx/mm-imx3.c | 1
arch/arm/mach-integrator/core.c | 4
arch/arm/mach-iop32x/i2c.c | 1
arch/arm/mach-iop32x/iq31244.c | 1
arch/arm/mach-iop32x/iq80321.c | 1
arch/arm/mach-iop32x/n2100.c | 1
arch/arm/mach-ixp4xx/common.c | 1
arch/arm/mach-keystone/platsmp.c | 4
arch/arm/mach-sa1100/assabet.c | 3
arch/arm/mach-sa1100/hackkit.c | 4
arch/arm/mach-tegra/iomap.h | 2
arch/arm/mach-zynq/common.c | 4
arch/arm/mm/copypage-v4mc.c | 1
arch/arm/mm/copypage-v6.c | 1
arch/arm/mm/copypage-xscale.c | 1
arch/arm/mm/dump.c | 1
arch/arm/mm/fault-armv.c | 1
arch/arm/mm/fault.c | 9
arch/arm/mm/highmem.c | 4
arch/arm/mm/idmap.c | 4
arch/arm/mm/ioremap.c | 31
arch/arm/mm/mm.h | 8
arch/arm/mm/mmu.c | 7
arch/arm/mm/pageattr.c | 1
arch/arm/mm/proc-arm1020.S | 4
arch/arm/mm/proc-arm1020e.S | 4
arch/arm/mm/proc-arm1022.S | 4
arch/arm/mm/proc-arm1026.S | 4
arch/arm/mm/proc-arm720.S | 4
arch/arm/mm/proc-arm740.S | 4
arch/arm/mm/proc-arm7tdmi.S | 4
arch/arm/mm/proc-arm920.S | 4
arch/arm/mm/proc-arm922.S | 4
arch/arm/mm/proc-arm925.S | 4
arch/arm/mm/proc-arm926.S | 4
arch/arm/mm/proc-arm940.S | 4
arch/arm/mm/proc-arm946.S | 4
arch/arm/mm/proc-arm9tdmi.S | 4
arch/arm/mm/proc-fa526.S | 4
arch/arm/mm/proc-feroceon.S | 4
arch/arm/mm/proc-mohawk.S | 4
arch/arm/mm/proc-sa110.S | 4
arch/arm/mm/proc-sa1100.S | 4
arch/arm/mm/proc-v6.S | 4
arch/arm/mm/proc-v7.S | 4
arch/arm/mm/proc-xsc3.S | 4
arch/arm/mm/proc-xscale.S | 4
arch/arm/mm/pv-fixup-asm.S | 4
arch/arm64/include/asm/io.h | 4
arch/arm64/include/asm/kernel-pgtable.h | 2
arch/arm64/include/asm/kvm_mmu.h | 4
arch/arm64/include/asm/mmu_context.h | 4
arch/arm64/include/asm/pgtable.h | 40
arch/arm64/include/asm/stacktrace.h | 3
arch/arm64/include/asm/stage2_pgtable.h | 2
arch/arm64/include/asm/vmap_stack.h | 4
arch/arm64/kernel/acpi.c | 4
arch/arm64/kernel/head.S | 4
arch/arm64/kernel/hibernate.c | 5
arch/arm64/kernel/kaslr.c | 4
arch/arm64/kernel/process.c | 2
arch/arm64/kernel/ptrace.c | 1
arch/arm64/kernel/smp.c | 1
arch/arm64/kernel/suspend.c | 4
arch/arm64/kernel/traps.c | 37
arch/arm64/kernel/vdso.c | 8
arch/arm64/kernel/vmlinux.lds.S | 3
arch/arm64/kvm/mmu.c | 14
arch/arm64/mm/dump.c | 1
arch/arm64/mm/fault.c | 9
arch/arm64/mm/kasan_init.c | 3
arch/arm64/mm/mmu.c | 8
arch/arm64/mm/pageattr.c | 1
arch/arm64/mm/proc.S | 4
arch/c6x/include/asm/pgtable.h | 3
arch/c6x/kernel/traps.c | 28
arch/csky/include/asm/io.h | 2
arch/csky/include/asm/pgtable.h | 37
arch/csky/kernel/module.c | 1
arch/csky/kernel/ptrace.c | 5
arch/csky/kernel/stacktrace.c | 20
arch/csky/kernel/vdso.c | 4
arch/csky/mm/fault.c | 10
arch/csky/mm/highmem.c | 2
arch/csky/mm/init.c | 7
arch/csky/mm/tlb.c | 1
arch/h8300/include/asm/pgtable.h | 1
arch/h8300/kernel/process.c | 1
arch/h8300/kernel/setup.c | 1
arch/h8300/kernel/signal.c | 1
arch/h8300/kernel/traps.c | 26
arch/h8300/mm/fault.c | 1
arch/h8300/mm/init.c | 1
arch/h8300/mm/memory.c | 1
arch/hexagon/include/asm/fixmap.h | 4
arch/hexagon/include/asm/pgtable.h | 55
arch/hexagon/kernel/traps.c | 39
arch/hexagon/kernel/vdso.c | 4
arch/hexagon/mm/uaccess.c | 2
arch/hexagon/mm/vm_fault.c | 9
arch/ia64/include/asm/pgtable.h | 34
arch/ia64/include/asm/ptrace.h | 1
arch/ia64/include/asm/uaccess.h | 2
arch/ia64/kernel/efi.c | 1
arch/ia64/kernel/entry.S | 4
arch/ia64/kernel/head.S | 5
arch/ia64/kernel/irq_ia64.c | 4
arch/ia64/kernel/ivt.S | 4
arch/ia64/kernel/kprobes.c | 4
arch/ia64/kernel/mca.c | 2
arch/ia64/kernel/mca_asm.S | 4
arch/ia64/kernel/perfmon.c | 8
arch/ia64/kernel/process.c | 37
arch/ia64/kernel/ptrace.c | 1
arch/ia64/kernel/relocate_kernel.S | 6
arch/ia64/kernel/setup.c | 4
arch/ia64/kernel/smp.c | 1
arch/ia64/kernel/smpboot.c | 1
arch/ia64/kernel/uncached.c | 4
arch/ia64/kernel/vmlinux.lds.S | 4
arch/ia64/mm/contig.c | 1
arch/ia64/mm/fault.c | 17
arch/ia64/mm/init.c | 12
arch/m68k/68000/m68EZ328.c | 2
arch/m68k/68000/m68VZ328.c | 4
arch/m68k/68000/timers.c | 1
arch/m68k/amiga/config.c | 1
arch/m68k/apollo/config.c | 1
arch/m68k/atari/atasound.c | 1
arch/m68k/atari/stram.c | 1
arch/m68k/bvme6000/config.c | 1
arch/m68k/include/asm/mcf_pgtable.h | 63
arch/m68k/include/asm/motorola_pgalloc.h | 8
arch/m68k/include/asm/motorola_pgtable.h | 84 -
arch/m68k/include/asm/pgtable_mm.h | 1
arch/m68k/include/asm/pgtable_no.h | 2
arch/m68k/include/asm/sun3_pgtable.h | 24
arch/m68k/include/asm/sun3xflop.h | 4
arch/m68k/kernel/head.S | 4
arch/m68k/kernel/process.c | 1
arch/m68k/kernel/ptrace.c | 1
arch/m68k/kernel/setup_no.c | 1
arch/m68k/kernel/signal.c | 1
arch/m68k/kernel/sys_m68k.c | 14
arch/m68k/kernel/traps.c | 27
arch/m68k/kernel/uboot.c | 1
arch/m68k/mac/config.c | 1
arch/m68k/mm/fault.c | 10
arch/m68k/mm/init.c | 2
arch/m68k/mm/mcfmmu.c | 1
arch/m68k/mm/motorola.c | 65
arch/m68k/mm/sun3kmap.c | 1
arch/m68k/mm/sun3mmu.c | 1
arch/m68k/mvme147/config.c | 1
arch/m68k/mvme16x/config.c | 1
arch/m68k/q40/config.c | 1
arch/m68k/sun3/config.c | 1
arch/m68k/sun3/dvma.c | 1
arch/m68k/sun3/mmu_emu.c | 1
arch/m68k/sun3/sun3dvma.c | 1
arch/m68k/sun3x/dvma.c | 1
arch/m68k/sun3x/prom.c | 1
arch/microblaze/include/asm/pgalloc.h | 4
arch/microblaze/include/asm/pgtable.h | 23
arch/microblaze/include/asm/uaccess.h | 2
arch/microblaze/include/asm/unwind.h | 3
arch/microblaze/kernel/hw_exception_handler.S | 4
arch/microblaze/kernel/module.c | 4
arch/microblaze/kernel/setup.c | 4
arch/microblaze/kernel/signal.c | 9
arch/microblaze/kernel/stacktrace.c | 4
arch/microblaze/kernel/traps.c | 28
arch/microblaze/kernel/unwind.c | 46
arch/microblaze/mm/fault.c | 17
arch/microblaze/mm/init.c | 9
arch/microblaze/mm/pgtable.c | 4
arch/mips/fw/arc/memory.c | 1
arch/mips/include/asm/fixmap.h | 3
arch/mips/include/asm/mach-generic/floppy.h | 1
arch/mips/include/asm/mach-jazz/floppy.h | 1
arch/mips/include/asm/pgtable-32.h | 22
arch/mips/include/asm/pgtable-64.h | 32
arch/mips/include/asm/pgtable.h | 2
arch/mips/jazz/irq.c | 4
arch/mips/jazz/jazzdma.c | 1
arch/mips/jazz/setup.c | 4
arch/mips/kernel/module.c | 1
arch/mips/kernel/process.c | 1
arch/mips/kernel/ptrace.c | 1
arch/mips/kernel/ptrace32.c | 1
arch/mips/kernel/smp-bmips.c | 1
arch/mips/kernel/traps.c | 58
arch/mips/kernel/vdso.c | 4
arch/mips/kvm/mips.c | 4
arch/mips/kvm/mmu.c | 20
arch/mips/kvm/tlb.c | 1
arch/mips/kvm/trap_emul.c | 2
arch/mips/lib/dump_tlb.c | 1
arch/mips/lib/r3k_dump_tlb.c | 1
arch/mips/mm/c-octeon.c | 1
arch/mips/mm/c-r3k.c | 11
arch/mips/mm/c-r4k.c | 11
arch/mips/mm/c-tx39.c | 11
arch/mips/mm/fault.c | 12
arch/mips/mm/highmem.c | 2
arch/mips/mm/init.c | 1
arch/mips/mm/page.c | 1
arch/mips/mm/pgtable-32.c | 1
arch/mips/mm/pgtable-64.c | 1
arch/mips/mm/sc-ip22.c | 1
arch/mips/mm/sc-mips.c | 1
arch/mips/mm/sc-r5k.c | 1
arch/mips/mm/tlb-r3k.c | 1
arch/mips/mm/tlb-r4k.c | 1
arch/mips/mm/tlbex.c | 4
arch/mips/sgi-ip27/ip27-init.c | 1
arch/mips/sgi-ip27/ip27-timer.c | 1
arch/mips/sgi-ip32/ip32-memory.c | 1
arch/nds32/include/asm/highmem.h | 3
arch/nds32/include/asm/pgtable.h | 22
arch/nds32/kernel/head.S | 4
arch/nds32/kernel/module.c | 2
arch/nds32/kernel/traps.c | 33
arch/nds32/kernel/vdso.c | 6
arch/nds32/mm/fault.c | 17
arch/nds32/mm/init.c | 13
arch/nds32/mm/proc.c | 7
arch/nios2/include/asm/pgtable.h | 24
arch/nios2/kernel/module.c | 1
arch/nios2/kernel/nios2_ksyms.c | 4
arch/nios2/kernel/traps.c | 35
arch/nios2/mm/fault.c | 14
arch/nios2/mm/init.c | 5
arch/nios2/mm/pgtable.c | 1
arch/nios2/mm/tlb.c | 1
arch/openrisc/include/asm/io.h | 3
arch/openrisc/include/asm/pgtable.h | 33
arch/openrisc/include/asm/tlbflush.h | 1
arch/openrisc/kernel/asm-offsets.c | 1
arch/openrisc/kernel/entry.S | 4
arch/openrisc/kernel/head.S | 4
arch/openrisc/kernel/or32_ksyms.c | 4
arch/openrisc/kernel/process.c | 1
arch/openrisc/kernel/ptrace.c | 1
arch/openrisc/kernel/setup.c | 1
arch/openrisc/kernel/traps.c | 27
arch/openrisc/mm/fault.c | 12
arch/openrisc/mm/init.c | 1
arch/openrisc/mm/ioremap.c | 4
arch/openrisc/mm/tlb.c | 1
arch/parisc/include/asm/io.h | 2
arch/parisc/include/asm/mmu_context.h | 1
arch/parisc/include/asm/pgtable.h | 33
arch/parisc/kernel/asm-offsets.c | 4
arch/parisc/kernel/entry.S | 4
arch/parisc/kernel/head.S | 4
arch/parisc/kernel/module.c | 1
arch/parisc/kernel/pacache.S | 4
arch/parisc/kernel/pci-dma.c | 2
arch/parisc/kernel/pdt.c | 4
arch/parisc/kernel/ptrace.c | 1
arch/parisc/kernel/smp.c | 1
arch/parisc/kernel/traps.c | 42
arch/parisc/lib/memcpy.c | 14
arch/parisc/mm/fault.c | 10
arch/parisc/mm/fixmap.c | 6
arch/parisc/mm/init.c | 1
arch/powerpc/include/asm/book3s/32/pgtable.h | 20
arch/powerpc/include/asm/book3s/64/pgtable.h | 43
arch/powerpc/include/asm/fixmap.h | 4
arch/powerpc/include/asm/io.h | 1
arch/powerpc/include/asm/kup.h | 2
arch/powerpc/include/asm/nohash/32/pgtable.h | 17
arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 4
arch/powerpc/include/asm/nohash/64/pgtable.h | 22
arch/powerpc/include/asm/nohash/pgtable.h | 2
arch/powerpc/include/asm/pgtable.h | 28
arch/powerpc/include/asm/pkeys.h | 2
arch/powerpc/include/asm/tlb.h | 2
arch/powerpc/kernel/asm-offsets.c | 1
arch/powerpc/kernel/btext.c | 4
arch/powerpc/kernel/fpu.S | 3
arch/powerpc/kernel/head_32.S | 4
arch/powerpc/kernel/head_40x.S | 4
arch/powerpc/kernel/head_44x.S | 4
arch/powerpc/kernel/head_8xx.S | 4
arch/powerpc/kernel/head_fsl_booke.S | 4
arch/powerpc/kernel/io-workarounds.c | 4
arch/powerpc/kernel/irq.c | 4
arch/powerpc/kernel/mce_power.c | 4
arch/powerpc/kernel/paca.c | 4
arch/powerpc/kernel/process.c | 30
arch/powerpc/kernel/prom.c | 4
arch/powerpc/kernel/prom_init.c | 4
arch/powerpc/kernel/rtas_pci.c | 4
arch/powerpc/kernel/setup-common.c | 4
arch/powerpc/kernel/setup_32.c | 4
arch/powerpc/kernel/setup_64.c | 4
arch/powerpc/kernel/signal_32.c | 1
arch/powerpc/kernel/signal_64.c | 1
arch/powerpc/kernel/smp.c | 4
arch/powerpc/kernel/stacktrace.c | 2
arch/powerpc/kernel/traps.c | 1
arch/powerpc/kernel/vdso.c | 7
arch/powerpc/kvm/book3s_64_mmu_radix.c | 4
arch/powerpc/kvm/book3s_hv.c | 6
arch/powerpc/kvm/book3s_hv_nested.c | 4
arch/powerpc/kvm/book3s_hv_rm_xics.c | 4
arch/powerpc/kvm/book3s_hv_rm_xive.c | 4
arch/powerpc/kvm/book3s_hv_uvmem.c | 18
arch/powerpc/kvm/e500_mmu_host.c | 4
arch/powerpc/kvm/fpu.S | 4
arch/powerpc/lib/code-patching.c | 1
arch/powerpc/mm/book3s32/hash_low.S | 4
arch/powerpc/mm/book3s32/mmu.c | 2
arch/powerpc/mm/book3s32/tlb.c | 6
arch/powerpc/mm/book3s64/hash_hugetlbpage.c | 1
arch/powerpc/mm/book3s64/hash_native.c | 4
arch/powerpc/mm/book3s64/hash_pgtable.c | 5
arch/powerpc/mm/book3s64/hash_utils.c | 4
arch/powerpc/mm/book3s64/iommu_api.c | 4
arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 1
arch/powerpc/mm/book3s64/radix_pgtable.c | 1
arch/powerpc/mm/book3s64/slb.c | 4
arch/powerpc/mm/book3s64/subpage_prot.c | 16
arch/powerpc/mm/copro_fault.c | 4
arch/powerpc/mm/fault.c | 23
arch/powerpc/mm/hugetlbpage.c | 1
arch/powerpc/mm/init-common.c | 4
arch/powerpc/mm/init_32.c | 1
arch/powerpc/mm/init_64.c | 1
arch/powerpc/mm/kasan/8xx.c | 4
arch/powerpc/mm/kasan/book3s_32.c | 2
arch/powerpc/mm/kasan/kasan_init_32.c | 8
arch/powerpc/mm/mem.c | 1
arch/powerpc/mm/nohash/40x.c | 5
arch/powerpc/mm/nohash/8xx.c | 2
arch/powerpc/mm/nohash/fsl_booke.c | 1
arch/powerpc/mm/nohash/tlb_low_64e.S | 4
arch/powerpc/mm/pgtable.c | 2
arch/powerpc/mm/pgtable_32.c | 5
arch/powerpc/mm/pgtable_64.c | 1
arch/powerpc/mm/ptdump/8xx.c | 2
arch/powerpc/mm/ptdump/bats.c | 4
arch/powerpc/mm/ptdump/book3s64.c | 2
arch/powerpc/mm/ptdump/hashpagetable.c | 1
arch/powerpc/mm/ptdump/ptdump.c | 1
arch/powerpc/mm/ptdump/shared.c | 2
arch/powerpc/oprofile/cell/spu_task_sync.c | 6
arch/powerpc/perf/callchain.c | 1
arch/powerpc/perf/callchain_32.c | 1
arch/powerpc/perf/callchain_64.c | 1
arch/powerpc/platforms/85xx/corenet_generic.c | 4
arch/powerpc/platforms/85xx/mpc85xx_cds.c | 4
arch/powerpc/platforms/85xx/qemu_e500.c | 4
arch/powerpc/platforms/85xx/sbc8548.c | 4
arch/powerpc/platforms/85xx/smp.c | 4
arch/powerpc/platforms/86xx/mpc86xx_smp.c | 4
arch/powerpc/platforms/8xx/cpm1.c | 1
arch/powerpc/platforms/8xx/micropatch.c | 1
arch/powerpc/platforms/cell/cbe_regs.c | 4
arch/powerpc/platforms/cell/interrupt.c | 4
arch/powerpc/platforms/cell/pervasive.c | 4
arch/powerpc/platforms/cell/setup.c | 1
arch/powerpc/platforms/cell/smp.c | 4
arch/powerpc/platforms/cell/spider-pic.c | 4
arch/powerpc/platforms/cell/spufs/file.c | 10
arch/powerpc/platforms/chrp/pci.c | 4
arch/powerpc/platforms/chrp/setup.c | 1
arch/powerpc/platforms/chrp/smp.c | 4
arch/powerpc/platforms/maple/setup.c | 1
arch/powerpc/platforms/maple/time.c | 1
arch/powerpc/platforms/powermac/setup.c | 1
arch/powerpc/platforms/powermac/smp.c | 4
arch/powerpc/platforms/powermac/time.c | 1
arch/powerpc/platforms/pseries/lpar.c | 4
arch/powerpc/platforms/pseries/setup.c | 1
arch/powerpc/platforms/pseries/smp.c | 4
arch/powerpc/sysdev/cpm2.c | 1
arch/powerpc/sysdev/fsl_85xx_cache_sram.c | 2
arch/powerpc/sysdev/mpic.c | 4
arch/powerpc/xmon/xmon.c | 1
arch/riscv/include/asm/fixmap.h | 4
arch/riscv/include/asm/io.h | 4
arch/riscv/include/asm/kasan.h | 4
arch/riscv/include/asm/pgtable-64.h | 7
arch/riscv/include/asm/pgtable.h | 22
arch/riscv/kernel/module.c | 2
arch/riscv/kernel/setup.c | 1
arch/riscv/kernel/soc.c | 2
arch/riscv/kernel/stacktrace.c | 23
arch/riscv/kernel/vdso.c | 4
arch/riscv/mm/cacheflush.c | 3
arch/riscv/mm/fault.c | 14
arch/riscv/mm/init.c | 31
arch/riscv/mm/kasan_init.c | 4
arch/riscv/mm/pageattr.c | 6
arch/riscv/mm/ptdump.c | 2
arch/s390/boot/ipl_parm.c | 4
arch/s390/boot/kaslr.c | 4
arch/s390/include/asm/hugetlb.h | 4
arch/s390/include/asm/kasan.h | 4
arch/s390/include/asm/pgtable.h | 15
arch/s390/include/asm/tlbflush.h | 1
arch/s390/kernel/asm-offsets.c | 4
arch/s390/kernel/dumpstack.c | 25
arch/s390/kernel/machine_kexec.c | 1
arch/s390/kernel/ptrace.c | 1
arch/s390/kernel/uv.c | 4
arch/s390/kernel/vdso.c | 5
arch/s390/kvm/gaccess.c | 8
arch/s390/kvm/interrupt.c | 4
arch/s390/kvm/kvm-s390.c | 32
arch/s390/kvm/priv.c | 38
arch/s390/mm/dump_pagetables.c | 1
arch/s390/mm/extmem.c | 4
arch/s390/mm/fault.c | 17
arch/s390/mm/gmap.c | 80
arch/s390/mm/init.c | 1
arch/s390/mm/kasan_init.c | 4
arch/s390/mm/pageattr.c | 13
arch/s390/mm/pgalloc.c | 2
arch/s390/mm/pgtable.c | 1
arch/s390/mm/vmem.c | 1
arch/s390/pci/pci_mmio.c | 4
arch/sh/include/asm/io.h | 2
arch/sh/include/asm/kdebug.h | 6
arch/sh/include/asm/pgtable-3level.h | 7
arch/sh/include/asm/pgtable.h | 2
arch/sh/include/asm/pgtable_32.h | 25
arch/sh/include/asm/processor_32.h | 2
arch/sh/kernel/dumpstack.c | 54
arch/sh/kernel/machine_kexec.c | 1
arch/sh/kernel/process_32.c | 2
arch/sh/kernel/ptrace_32.c | 1
arch/sh/kernel/signal_32.c | 1
arch/sh/kernel/sys_sh.c | 6
arch/sh/kernel/traps.c | 4
arch/sh/kernel/vsyscall/vsyscall.c | 4
arch/sh/mm/cache-sh3.c | 1
arch/sh/mm/cache-sh4.c | 11
arch/sh/mm/cache-sh7705.c | 1
arch/sh/mm/fault.c | 16
arch/sh/mm/kmap.c | 5
arch/sh/mm/nommu.c | 1
arch/sh/mm/pmb.c | 4
arch/sparc/include/asm/floppy_32.h | 4
arch/sparc/include/asm/highmem.h | 4
arch/sparc/include/asm/ide.h | 2
arch/sparc/include/asm/io-unit.h | 4
arch/sparc/include/asm/pgalloc_32.h | 4
arch/sparc/include/asm/pgalloc_64.h | 2
arch/sparc/include/asm/pgtable_32.h | 34
arch/sparc/include/asm/pgtable_64.h | 32
arch/sparc/kernel/cpu.c | 4
arch/sparc/kernel/entry.S | 4
arch/sparc/kernel/head_64.S | 4
arch/sparc/kernel/ktlb.S | 4
arch/sparc/kernel/leon_smp.c | 1
arch/sparc/kernel/pci.c | 4
arch/sparc/kernel/process_32.c | 29
arch/sparc/kernel/process_64.c | 3
arch/sparc/kernel/ptrace_32.c | 1
arch/sparc/kernel/ptrace_64.c | 1
arch/sparc/kernel/setup_32.c | 1
arch/sparc/kernel/setup_64.c | 1
arch/sparc/kernel/signal32.c | 1
arch/sparc/kernel/signal_32.c | 1
arch/sparc/kernel/signal_64.c | 1
arch/sparc/kernel/smp_32.c | 1
arch/sparc/kernel/smp_64.c | 1
arch/sparc/kernel/sun4m_irq.c | 4
arch/sparc/kernel/trampoline_64.S | 4
arch/sparc/kernel/traps_32.c | 4
arch/sparc/kernel/traps_64.c | 24
arch/sparc/lib/clear_page.S | 4
arch/sparc/lib/copy_page.S | 2
arch/sparc/mm/fault_32.c | 21
arch/sparc/mm/fault_64.c | 17
arch/sparc/mm/highmem.c | 12
arch/sparc/mm/hugetlbpage.c | 1
arch/sparc/mm/init_32.c | 1
arch/sparc/mm/init_64.c | 7
arch/sparc/mm/io-unit.c | 11
arch/sparc/mm/iommu.c | 9
arch/sparc/mm/tlb.c | 1
arch/sparc/mm/tsb.c | 4
arch/sparc/mm/ultra.S | 4
arch/sparc/vdso/vma.c | 4
arch/um/drivers/mconsole_kern.c | 2
arch/um/include/asm/mmu_context.h | 5
arch/um/include/asm/pgtable-3level.h | 4
arch/um/include/asm/pgtable.h | 69
arch/um/kernel/maccess.c | 12
arch/um/kernel/mem.c | 10
arch/um/kernel/process.c | 1
arch/um/kernel/skas/mmu.c | 3
arch/um/kernel/skas/uaccess.c | 1
arch/um/kernel/sysrq.c | 35
arch/um/kernel/tlb.c | 5
arch/um/kernel/trap.c | 15
arch/um/kernel/um_arch.c | 1
arch/unicore32/include/asm/pgtable.h | 19
arch/unicore32/kernel/hibernate.c | 4
arch/unicore32/kernel/hibernate_asm.S | 4
arch/unicore32/kernel/module.c | 1
arch/unicore32/kernel/setup.h | 4
arch/unicore32/kernel/traps.c | 50
arch/unicore32/lib/backtrace.S | 24
arch/unicore32/mm/alignment.c | 4
arch/unicore32/mm/fault.c | 9
arch/unicore32/mm/mm.h | 10
arch/unicore32/mm/proc-ucv2.S | 4
arch/x86/boot/compressed/kaslr_64.c | 4
arch/x86/entry/vdso/vma.c | 14
arch/x86/events/core.c | 4
arch/x86/include/asm/agp.h | 2
arch/x86/include/asm/asm-prototypes.h | 4
arch/x86/include/asm/efi.h | 4
arch/x86/include/asm/iomap.h | 1
arch/x86/include/asm/kaslr.h | 2
arch/x86/include/asm/mmu.h | 2
arch/x86/include/asm/pgtable-3level.h | 8
arch/x86/include/asm/pgtable.h | 89 -
arch/x86/include/asm/pgtable_32.h | 11
arch/x86/include/asm/pgtable_64.h | 4
arch/x86/include/asm/setup.h | 12
arch/x86/include/asm/stacktrace.h | 2
arch/x86/include/asm/uaccess.h | 16
arch/x86/include/asm/xen/hypercall.h | 4
arch/x86/include/asm/xen/page.h | 1
arch/x86/kernel/acpi/boot.c | 4
arch/x86/kernel/acpi/sleep.c | 4
arch/x86/kernel/alternative.c | 1
arch/x86/kernel/amd_gart_64.c | 5
arch/x86/kernel/apic/apic_numachip.c | 4
arch/x86/kernel/cpu/bugs.c | 4
arch/x86/kernel/cpu/common.c | 4
arch/x86/kernel/cpu/intel.c | 4
arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 6
arch/x86/kernel/cpu/resctrl/rdtgroup.c | 6
arch/x86/kernel/crash_core_32.c | 4
arch/x86/kernel/crash_core_64.c | 4
arch/x86/kernel/doublefault_32.c | 1
arch/x86/kernel/dumpstack.c | 21
arch/x86/kernel/early_printk.c | 4
arch/x86/kernel/espfix_64.c | 2
arch/x86/kernel/head64.c | 4
arch/x86/kernel/head_64.S | 4
arch/x86/kernel/i8259.c | 4
arch/x86/kernel/irqinit.c | 4
arch/x86/kernel/kprobes/core.c | 4
arch/x86/kernel/kprobes/opt.c | 4
arch/x86/kernel/ldt.c | 2
arch/x86/kernel/machine_kexec_32.c | 1
arch/x86/kernel/machine_kexec_64.c | 1
arch/x86/kernel/module.c | 1
arch/x86/kernel/paravirt.c | 4
arch/x86/kernel/process_32.c | 1
arch/x86/kernel/process_64.c | 1
arch/x86/kernel/ptrace.c | 1
arch/x86/kernel/reboot.c | 4
arch/x86/kernel/smpboot.c | 4
arch/x86/kernel/tboot.c | 3
arch/x86/kernel/vm86_32.c | 4
arch/x86/kvm/mmu/paging_tmpl.h | 8
arch/x86/mm/cpu_entry_area.c | 4
arch/x86/mm/debug_pagetables.c | 2
arch/x86/mm/dump_pagetables.c | 1
arch/x86/mm/fault.c | 22
arch/x86/mm/init.c | 22
arch/x86/mm/init_32.c | 27
arch/x86/mm/init_64.c | 1
arch/x86/mm/ioremap.c | 4
arch/x86/mm/kasan_init_64.c | 1
arch/x86/mm/kaslr.c | 37
arch/x86/mm/maccess.c | 44
arch/x86/mm/mem_encrypt_boot.S | 2
arch/x86/mm/mmio-mod.c | 4
arch/x86/mm/pat/cpa-test.c | 1
arch/x86/mm/pat/memtype.c | 1
arch/x86/mm/pat/memtype_interval.c | 4
arch/x86/mm/pgtable.c | 1
arch/x86/mm/pgtable_32.c | 1
arch/x86/mm/pti.c | 1
arch/x86/mm/setup_nx.c | 4
arch/x86/platform/efi/efi_32.c | 4
arch/x86/platform/efi/efi_64.c | 1
arch/x86/platform/olpc/olpc_ofw.c | 4
arch/x86/power/cpu.c | 4
arch/x86/power/hibernate.c | 4
arch/x86/power/hibernate_32.c | 4
arch/x86/power/hibernate_64.c | 4
arch/x86/realmode/init.c | 4
arch/x86/um/vdso/vma.c | 4
arch/x86/xen/enlighten_pv.c | 1
arch/x86/xen/grant-table.c | 1
arch/x86/xen/mmu_pv.c | 4
arch/x86/xen/smp_pv.c | 2
arch/xtensa/include/asm/fixmap.h | 12
arch/xtensa/include/asm/highmem.h | 4
arch/xtensa/include/asm/initialize_mmu.h | 2
arch/xtensa/include/asm/mmu_context.h | 4
arch/xtensa/include/asm/pgtable.h | 20
arch/xtensa/kernel/entry.S | 4
arch/xtensa/kernel/process.c | 1
arch/xtensa/kernel/ptrace.c | 1
arch/xtensa/kernel/setup.c | 1
arch/xtensa/kernel/traps.c | 42
arch/xtensa/kernel/vectors.S | 4
arch/xtensa/mm/cache.c | 4
arch/xtensa/mm/fault.c | 12
arch/xtensa/mm/highmem.c | 2
arch/xtensa/mm/ioremap.c | 4
arch/xtensa/mm/kasan_init.c | 10
arch/xtensa/mm/misc.S | 4
arch/xtensa/mm/mmu.c | 5
drivers/acpi/scan.c | 3
drivers/android/binder_alloc.c | 14
drivers/atm/fore200e.c | 4
drivers/base/power/main.c | 4
drivers/block/z2ram.c | 4
drivers/char/agp/frontend.c | 1
drivers/char/agp/generic.c | 1
drivers/char/bsr.c | 1
drivers/char/mspec.c | 3
drivers/dma-buf/dma-resv.c | 5
drivers/firmware/efi/arm-runtime.c | 4
drivers/firmware/efi/efi.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gpuvm.c | 4
drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c | 10
drivers/gpu/drm/amd/amdkfd/kfd_events.c | 4
drivers/gpu/drm/drm_vm.c | 4
drivers/gpu/drm/etnaviv/etnaviv_gem.c | 2
drivers/gpu/drm/i915/gem/i915_gem_mman.c | 4
drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 14
drivers/gpu/drm/i915/i915_mm.c | 1
drivers/gpu/drm/i915/i915_perf.c | 2
drivers/gpu/drm/nouveau/nouveau_svm.c | 22
drivers/gpu/drm/radeon/radeon_cs.c | 4
drivers/gpu/drm/radeon/radeon_gem.c | 6
drivers/gpu/drm/ttm/ttm_bo_vm.c | 10
drivers/infiniband/core/umem_odp.c | 4
drivers/infiniband/core/uverbs_main.c | 6
drivers/infiniband/hw/hfi1/mmu_rb.c | 2
drivers/infiniband/hw/mlx4/mr.c | 4
drivers/infiniband/hw/qib/qib_file_ops.c | 4
drivers/infiniband/hw/qib/qib_user_pages.c | 6
drivers/infiniband/hw/usnic/usnic_uiom.c | 4
drivers/infiniband/sw/rdmavt/mmap.c | 1
drivers/infiniband/sw/rxe/rxe_mmap.c | 1
drivers/infiniband/sw/siw/siw_mem.c | 4
drivers/iommu/amd_iommu_v2.c | 4
drivers/iommu/intel-svm.c | 4
drivers/macintosh/macio-adb.c | 4
drivers/macintosh/mediabay.c | 4
drivers/macintosh/via-pmu.c | 4
drivers/media/pci/bt8xx/bt878.c | 4
drivers/media/pci/bt8xx/btcx-risc.c | 4
drivers/media/pci/bt8xx/bttv-risc.c | 4
drivers/media/platform/davinci/vpbe_display.c | 1
drivers/media/v4l2-core/v4l2-common.c | 1
drivers/media/v4l2-core/videobuf-core.c | 4
drivers/media/v4l2-core/videobuf-dma-contig.c | 4
drivers/media/v4l2-core/videobuf-dma-sg.c | 10
drivers/media/v4l2-core/videobuf-vmalloc.c | 4
drivers/misc/cxl/cxllib.c | 9
drivers/misc/cxl/fault.c | 4
drivers/misc/genwqe/card_utils.c | 2
drivers/misc/sgi-gru/grufault.c | 25
drivers/misc/sgi-gru/grufile.c | 4
drivers/mtd/ubi/ubi.h | 2
drivers/net/ethernet/amd/7990.c | 4
drivers/net/ethernet/amd/hplance.c | 4
drivers/net/ethernet/amd/mvme147.c | 4
drivers/net/ethernet/amd/sun3lance.c | 4
drivers/net/ethernet/amd/sunlance.c | 4
drivers/net/ethernet/apple/bmac.c | 4
drivers/net/ethernet/apple/mace.c | 4
drivers/net/ethernet/freescale/fs_enet/fs_enet-main.c | 4
drivers/net/ethernet/freescale/fs_enet/mac-fcc.c | 4
drivers/net/ethernet/freescale/fs_enet/mii-fec.c | 4
drivers/net/ethernet/i825xx/82596.c | 4
drivers/net/ethernet/korina.c | 4
drivers/net/ethernet/marvell/pxa168_eth.c | 4
drivers/net/ethernet/natsemi/jazzsonic.c | 4
drivers/net/ethernet/natsemi/macsonic.c | 4
drivers/net/ethernet/natsemi/xtsonic.c | 4
drivers/net/ethernet/sun/sunbmac.c | 4
drivers/net/ethernet/sun/sunhme.c | 1
drivers/net/ethernet/sun/sunqe.c | 4
drivers/oprofile/buffer_sync.c | 12
drivers/sbus/char/flash.c | 1
drivers/sbus/char/uctrl.c | 1
drivers/scsi/53c700.c | 4
drivers/scsi/a2091.c | 1
drivers/scsi/a3000.c | 1
drivers/scsi/arm/cumana_2.c | 4
drivers/scsi/arm/eesox.c | 4
drivers/scsi/arm/powertec.c | 4
drivers/scsi/dpt_i2o.c | 4
drivers/scsi/gvp11.c | 1
drivers/scsi/lasi700.c | 1
drivers/scsi/mac53c94.c | 4
drivers/scsi/mesh.c | 4
drivers/scsi/mvme147.c | 1
drivers/scsi/qlogicpti.c | 4
drivers/scsi/sni_53c710.c | 1
drivers/scsi/zorro_esp.c | 4
drivers/staging/android/ashmem.c | 4
drivers/staging/comedi/comedi_fops.c | 2
drivers/staging/kpc2000/kpc_dma/fileops.c | 4
drivers/staging/media/atomisp/pci/hmm/hmm_bo.c | 4
drivers/tee/optee/call.c | 4
drivers/tty/sysrq.c | 4
drivers/tty/vt/consolemap.c | 2
drivers/vfio/pci/vfio_pci.c | 22
drivers/vfio/vfio_iommu_type1.c | 8
drivers/vhost/vdpa.c | 4
drivers/video/console/newport_con.c | 1
drivers/video/fbdev/acornfb.c | 1
drivers/video/fbdev/atafb.c | 1
drivers/video/fbdev/cirrusfb.c | 1
drivers/video/fbdev/cyber2000fb.c | 1
drivers/video/fbdev/fb-puv3.c | 1
drivers/video/fbdev/hitfb.c | 1
drivers/video/fbdev/neofb.c | 1
drivers/video/fbdev/q40fb.c | 1
drivers/video/fbdev/savage/savagefb_driver.c | 1
drivers/xen/balloon.c | 1
drivers/xen/gntdev.c | 6
drivers/xen/grant-table.c | 1
drivers/xen/privcmd.c | 15
drivers/xen/xenbus/xenbus_probe.c | 1
drivers/xen/xenbus/xenbus_probe_backend.c | 1
drivers/xen/xenbus/xenbus_probe_frontend.c | 1
fs/aio.c | 4
fs/coredump.c | 8
fs/exec.c | 18
fs/ext2/file.c | 2
fs/ext4/super.c | 6
fs/hugetlbfs/inode.c | 2
fs/io_uring.c | 4
fs/kernfs/file.c | 4
fs/proc/array.c | 1
fs/proc/base.c | 24
fs/proc/meminfo.c | 1
fs/proc/nommu.c | 1
fs/proc/task_mmu.c | 34
fs/proc/task_nommu.c | 18
fs/proc/vmcore.c | 1
fs/userfaultfd.c | 46
fs/xfs/xfs_file.c | 2
fs/xfs/xfs_inode.c | 14
fs/xfs/xfs_iops.c | 4
include/asm-generic/io.h | 2
include/asm-generic/pgtable-nopmd.h | 1
include/asm-generic/pgtable-nopud.h | 1
include/asm-generic/pgtable.h | 1322 ----------------
include/linux/cache.h | 10
include/linux/crash_dump.h | 3
include/linux/dax.h | 1
include/linux/dma-noncoherent.h | 2
include/linux/fs.h | 4
include/linux/hmm.h | 2
include/linux/huge_mm.h | 2
include/linux/hugetlb.h | 2
include/linux/io-mapping.h | 4
include/linux/kallsyms.h | 4
include/linux/kasan.h | 4
include/linux/mempolicy.h | 2
include/linux/mm.h | 15
include/linux/mm_types.h | 4
include/linux/mmap_lock.h | 128 +
include/linux/mmu_notifier.h | 13
include/linux/pagemap.h | 2
include/linux/pgtable.h | 1444 +++++++++++++++++-
include/linux/rmap.h | 2
include/linux/sched/debug.h | 7
include/linux/sched/mm.h | 10
include/linux/uaccess.h | 62
include/xen/arm/page.h | 4
init/init_task.c | 1
ipc/shm.c | 8
kernel/acct.c | 6
kernel/bpf/stackmap.c | 21
kernel/bpf/syscall.c | 2
kernel/cgroup/cpuset.c | 4
kernel/debug/kdb/kdb_bt.c | 17
kernel/events/core.c | 10
kernel/events/uprobes.c | 20
kernel/exit.c | 11
kernel/fork.c | 15
kernel/futex.c | 4
kernel/locking/lockdep.c | 4
kernel/locking/rtmutex-debug.c | 4
kernel/power/snapshot.c | 1
kernel/relay.c | 2
kernel/sched/core.c | 10
kernel/sched/fair.c | 4
kernel/sys.c | 22
kernel/trace/bpf_trace.c | 176 +-
kernel/trace/ftrace.c | 8
kernel/trace/trace_kprobe.c | 80
kernel/trace/trace_output.c | 4
lib/dump_stack.c | 4
lib/ioremap.c | 1
lib/test_hmm.c | 14
lib/test_lockup.c | 16
mm/debug.c | 10
mm/debug_vm_pgtable.c | 1
mm/filemap.c | 46
mm/frame_vector.c | 6
mm/gup.c | 73
mm/hmm.c | 2
mm/huge_memory.c | 8
mm/hugetlb.c | 3
mm/init-mm.c | 6
mm/internal.h | 6
mm/khugepaged.c | 72
mm/ksm.c | 48
mm/maccess.c | 496 +++---
mm/madvise.c | 40
mm/memcontrol.c | 10
mm/memory.c | 61
mm/mempolicy.c | 36
mm/migrate.c | 16
mm/mincore.c | 8
mm/mlock.c | 22
mm/mmap.c | 74
mm/mmu_gather.c | 2
mm/mmu_notifier.c | 22
mm/mprotect.c | 22
mm/mremap.c | 14
mm/msync.c | 8
mm/nommu.c | 22
mm/oom_kill.c | 14
mm/page_io.c | 1
mm/page_reporting.h | 2
mm/pagewalk.c | 12
mm/pgtable-generic.c | 6
mm/process_vm_access.c | 4
mm/ptdump.c | 4
mm/rmap.c | 12
mm/shmem.c | 5
mm/sparse-vmemmap.c | 1
mm/sparse.c | 1
mm/swap_state.c | 5
mm/swapfile.c | 5
mm/userfaultfd.c | 26
mm/util.c | 12
mm/vmacache.c | 1
mm/zsmalloc.c | 4
net/ipv4/tcp.c | 8
net/xdp/xdp_umem.c | 4
security/keys/keyctl.c | 2
sound/core/oss/pcm_oss.c | 2
sound/core/sgbuf.c | 1
sound/pci/hda/hda_intel.c | 4
sound/soc/intel/common/sst-firmware.c | 4
sound/soc/intel/haswell/sst-haswell-pcm.c | 4
tools/include/linux/kallsyms.h | 2
virt/kvm/async_pf.c | 4
virt/kvm/kvm_main.c | 9
942 files changed, 4580 insertions(+), 5662 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-06-09 4:29 incoming Andrew Morton
@ 2020-06-09 16:58 ` Linus Torvalds
0 siblings, 0 replies; 419+ messages in thread
From: Linus Torvalds @ 2020-06-09 16:58 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Mon, Jun 8, 2020 at 9:29 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 942 files changed, 4580 insertions(+), 5662 deletions(-)
If you use proper tools, add a "-M" to your diff script, so that you see
941 files changed, 2614 insertions(+), 3696 deletions(-)
because a big portion of the lines were due to a rename:
rename include/{asm-generic => linux}/pgtable.h (91%)
but at some earlier point you mentioned "diffstat", so I guess "proper
tools" isn't an option ;(
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-06-11 1:40 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-06-11 1:40 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- various hotfixes and minor things
- hch's use_mm/unuse_mm clearnups
- new syscall process_madvise(): perform madvise() on a process other
than self
25 patches, based on 6f630784cc0d92fb58ea326e2bc01aa056279ecb.
Subsystems affected by this patch series:
mm/hugetlb
scripts
kcov
lib
nilfs
checkpatch
lib
mm/debug
ocfs2
lib
misc
mm/madvise
Subsystem: mm/hugetlb
Dan Carpenter <dan.carpenter@oracle.com>:
khugepaged: selftests: fix timeout condition in wait_for_scan()
Subsystem: scripts
SeongJae Park <sjpark@amazon.de>:
scripts/spelling: add a few more typos
Subsystem: kcov
Andrey Konovalov <andreyknvl@google.com>:
kcov: check kcov_softirq in kcov_remote_stop()
Subsystem: lib
Joe Perches <joe@perches.com>:
lib/lz4/lz4_decompress.c: document deliberate use of `&'
Subsystem: nilfs
Ryusuke Konishi <konishi.ryusuke@gmail.com>:
nilfs2: fix null pointer dereference at nilfs_segctor_do_construct()
Subsystem: checkpatch
Tim Froidcoeur <tim.froidcoeur@tessares.net>:
checkpatch: correct check for kernel parameters doc
Subsystem: lib
Alexander Gordeev <agordeev@linux.ibm.com>:
lib: fix bitmap_parse() on 64-bit big endian archs
Subsystem: mm/debug
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/debug_vm_pgtable: fix kernel crash by checking for THP support
Subsystem: ocfs2
Keyur Patel <iamkeyur96@gmail.com>:
ocfs2: fix spelling mistake and grammar
Ben Widawsky <ben.widawsky@intel.com>:
mm: add comments on pglist_data zones
Subsystem: lib
Wei Yang <richard.weiyang@gmail.com>:
lib: test get_count_order/long in test_bitops.c
Subsystem: misc
Walter Wu <walter-zh.wu@mediatek.com>:
stacktrace: cleanup inconsistent variable type
Christoph Hellwig <hch@lst.de>:
Patch series "improve use_mm / unuse_mm", v2:
kernel: move use_mm/unuse_mm to kthread.c
kernel: move use_mm/unuse_mm to kthread.c
kernel: better document the use_mm/unuse_mm API contract
kernel: set USER_DS in kthread_use_mm
Subsystem: mm/madvise
Minchan Kim <minchan@kernel.org>:
Patch series "introduce memory hinting API for external process", v7:
mm/madvise: pass task and mm to do_madvise
mm/madvise: introduce process_madvise() syscall: an external memory hinting API
mm/madvise: check fatal signal pending of target process
pid: move pidfd_get_pid() to pid.c
mm/madvise: support both pid and pidfd for process_madvise
Oleksandr Natalenko <oleksandr@redhat.com>:
mm/madvise: allow KSM hints for remote API
Minchan Kim <minchan@kernel.org>:
mm: support vector address ranges for process_madvise
mm: use only pidfd for process_madvise syscall
YueHaibing <yuehaibing@huawei.com>:
mm/madvise.c: remove duplicated include
arch/alpha/kernel/syscalls/syscall.tbl | 1
arch/arm/tools/syscall.tbl | 1
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 4
arch/ia64/kernel/syscalls/syscall.tbl | 1
arch/m68k/kernel/syscalls/syscall.tbl | 1
arch/microblaze/kernel/syscalls/syscall.tbl | 1
arch/mips/kernel/syscalls/syscall_n32.tbl | 3
arch/mips/kernel/syscalls/syscall_n64.tbl | 1
arch/mips/kernel/syscalls/syscall_o32.tbl | 3
arch/parisc/kernel/syscalls/syscall.tbl | 3
arch/powerpc/kernel/syscalls/syscall.tbl | 3
arch/powerpc/platforms/powernv/vas-fault.c | 4
arch/s390/kernel/syscalls/syscall.tbl | 3
arch/sh/kernel/syscalls/syscall.tbl | 1
arch/sparc/kernel/syscalls/syscall.tbl | 3
arch/x86/entry/syscalls/syscall_32.tbl | 3
arch/x86/entry/syscalls/syscall_64.tbl | 5
arch/xtensa/kernel/syscalls/syscall.tbl | 1
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 5
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_arcturus.c | 1
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v10.c | 1
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v9.c | 2
drivers/gpu/drm/i915/gvt/kvmgt.c | 2
drivers/usb/gadget/function/f_fs.c | 10
drivers/usb/gadget/legacy/inode.c | 6
drivers/vfio/vfio_iommu_type1.c | 6
drivers/vhost/vhost.c | 8
fs/aio.c | 1
fs/io-wq.c | 15 -
fs/io_uring.c | 11
fs/nilfs2/segment.c | 2
fs/ocfs2/mmap.c | 2
include/linux/compat.h | 10
include/linux/kthread.h | 9
include/linux/mm.h | 3
include/linux/mmu_context.h | 5
include/linux/mmzone.h | 14
include/linux/pid.h | 1
include/linux/stacktrace.h | 2
include/linux/syscalls.h | 16 -
include/uapi/asm-generic/unistd.h | 7
kernel/exit.c | 17 -
kernel/kcov.c | 26 +
kernel/kthread.c | 95 +++++-
kernel/pid.c | 17 +
kernel/sys_ni.c | 2
lib/Kconfig.debug | 10
lib/bitmap.c | 9
lib/lz4/lz4_decompress.c | 3
lib/test_bitops.c | 53 +++
mm/Makefile | 2
mm/debug_vm_pgtable.c | 6
mm/madvise.c | 295 ++++++++++++++------
mm/mmu_context.c | 64 ----
mm/oom_kill.c | 6
mm/vmacache.c | 4
scripts/checkpatch.pl | 4
scripts/spelling.txt | 9
tools/testing/selftests/vm/khugepaged.c | 2
62 files changed, 526 insertions(+), 285 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-06-12 0:30 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-06-12 0:30 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
A few fixes and stragglers.
5 patches, based on 623f6dc593eaf98b91916836785278eddddaacf8.
Subsystems affected by this patch series:
mm/memory-failure
ocfs2
lib/lzo
misc
Subsystem: mm/memory-failure
Naoya Horiguchi <nao.horiguchi@gmail.com>:
Patch series "hwpoison: fixes signaling on memory error":
mm/memory-failure: prioritize prctl(PR_MCE_KILL) over vm.memory_failure_early_kill
mm/memory-failure: send SIGBUS(BUS_MCEERR_AR) only to current thread
Subsystem: ocfs2
Tom Seewald <tseewald@gmail.com>:
ocfs2: fix build failure when TCP/IP is disabled
Subsystem: lib/lzo
Dave Rodgman <dave.rodgman@arm.com>:
lib/lzo: fix ambiguous encoding bug in lzo-rle
Subsystem: misc
Christoph Hellwig <hch@lst.de>:
amdgpu: a NULL ->mm does not mean a thread is a kthread
Documentation/lzo.txt | 8 ++++-
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 2 -
fs/ocfs2/Kconfig | 2 -
lib/lzo/lzo1x_compress.c | 13 ++++++++
mm/memory-failure.c | 43 +++++++++++++++++------------
5 files changed, 47 insertions(+), 21 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-06-26 3:28 Andrew Morton
2020-06-26 6:51 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-06-26 3:28 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a.
Subsystems affected by this patch series:
hotfixes
mm/pagealloc
kexec
ocfs2
lib
misc
mm/slab
mm/slab
mm/slub
mm/swap
mm/pagemap
mm/vmalloc
mm/memcg
mm/gup
mm/thp
mm/vmscan
x86
mm/memory-hotplug
MAINTAINERS
Subsystem: hotfixes
Stafford Horne <shorne@gmail.com>:
openrisc: fix boot oops when DEBUG_VM is enabled
Michal Hocko <mhocko@suse.com>:
mm: do_swap_page(): fix up the error code
Subsystem: mm/pagealloc
Vlastimil Babka <vbabka@suse.cz>:
mm, compaction: make capture control handling safe wrt interrupts
Subsystem: kexec
Lianbo Jiang <lijiang@redhat.com>:
kexec: do not verify the signature without the lockdown or mandatory signature
Subsystem: ocfs2
Junxiao Bi <junxiao.bi@oracle.com>:
Patch series "ocfs2: fix nfsd over ocfs2 issues", v2:
ocfs2: avoid inode removal while nfsd is accessing it
ocfs2: load global_inode_alloc
ocfs2: fix panic on nfs server over ocfs2
ocfs2: fix value of OCFS2_INVALID_SLOT
Subsystem: lib
Randy Dunlap <rdunlap@infradead.org>:
lib: fix test_hmm.c reference after free
Subsystem: misc
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
linux/bits.h: fix unsigned less than zero warnings
Subsystem: mm/slab
Waiman Long <longman@redhat.com>:
mm, slab: fix sign conversion problem in memcg_uncharge_slab()
Subsystem: mm/slab
Waiman Long <longman@redhat.com>:
mm/slab: use memzero_explicit() in kzfree()
Subsystem: mm/slub
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
slub: cure list_slab_objects() from double fix
Subsystem: mm/swap
Hugh Dickins <hughd@google.com>:
mm: fix swap cache node allocation mask
Subsystem: mm/pagemap
Arjun Roy <arjunroy@google.com>:
mm/memory.c: properly pte_offset_map_lock/unlock in vm_insert_pages()
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm/debug_vm_pgtable: fix build failure with powerpc 8xx
Stephen Rothwell <sfr@canb.auug.org.au>:
make asm-generic/cacheflush.h more standalone
Nathan Chancellor <natechancellor@gmail.com>:
media: omap3isp: remove cacheflush.h
Subsystem: mm/vmalloc
Masanari Iida <standby24x7@gmail.com>:
mm/vmalloc.c: fix a warning while make xmldocs
Subsystem: mm/memcg
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: handle div0 crash race condition in memory.low
Muchun Song <songmuchun@bytedance.com>:
mm/memcontrol.c: add missed css_put()
Chris Down <chris@chrisdown.name>:
mm/memcontrol.c: prevent missed memory.low load tears
Subsystem: mm/gup
Souptick Joarder <jrdr.linux@gmail.com>:
docs: mm/gup: minor documentation update
Subsystem: mm/thp
Yang Shi <yang.shi@linux.alibaba.com>:
doc: THP CoW fault no longer allocate THP
Subsystem: mm/vmscan
Johannes Weiner <hannes@cmpxchg.org>:
Patch series "fix for "mm: balance LRU lists based on relative thrashing" patchset":
mm: workingset: age nonresident information alongside anonymous pages
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
mm/swap: fix for "mm: workingset: age nonresident information alongside anonymous pages"
mm/memory: fix IO cost for anonymous page
Subsystem: x86
Christoph Hellwig <hch@lst.de>:
Patch series "fix a hyperv W^X violation and remove vmalloc_exec":
x86/hyperv: allocate the hypercall page with only read and execute bits
arm64: use PAGE_KERNEL_ROX directly in alloc_insn_page
mm: remove vmalloc_exec
Subsystem: mm/memory-hotplug
Ben Widawsky <ben.widawsky@intel.com>:
mm/memory_hotplug.c: fix false softlockup during pfn range removal
Subsystem: MAINTAINERS
Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
MAINTAINERS: update info for sparse
Documentation/admin-guide/cgroup-v2.rst | 4 +-
Documentation/admin-guide/mm/transhuge.rst | 3 -
Documentation/core-api/pin_user_pages.rst | 2 -
MAINTAINERS | 4 +-
arch/arm64/kernel/probes/kprobes.c | 12 +------
arch/openrisc/kernel/dma.c | 5 +++
arch/x86/hyperv/hv_init.c | 4 +-
arch/x86/include/asm/pgtable_types.h | 2 +
drivers/media/platform/omap3isp/isp.c | 2 -
drivers/media/platform/omap3isp/ispvideo.c | 1
fs/ocfs2/dlmglue.c | 17 ++++++++++
fs/ocfs2/ocfs2.h | 1
fs/ocfs2/ocfs2_fs.h | 4 +-
fs/ocfs2/suballoc.c | 9 +++--
include/asm-generic/cacheflush.h | 5 +++
include/linux/bits.h | 3 +
include/linux/mmzone.h | 4 +-
include/linux/swap.h | 1
include/linux/vmalloc.h | 1
kernel/kexec_file.c | 36 ++++------------------
kernel/module.c | 4 +-
lib/test_hmm.c | 3 -
mm/compaction.c | 17 ++++++++--
mm/debug_vm_pgtable.c | 4 +-
mm/memcontrol.c | 18 ++++++++---
mm/memory.c | 33 +++++++++++++-------
mm/memory_hotplug.c | 13 ++++++--
mm/nommu.c | 17 ----------
mm/slab.h | 4 +-
mm/slab_common.c | 2 -
mm/slub.c | 19 ++---------
mm/swap.c | 3 -
mm/swap_state.c | 4 +-
mm/vmalloc.c | 21 -------------
mm/vmscan.c | 3 +
mm/workingset.c | 46 +++++++++++++++++------------
36 files changed, 168 insertions(+), 163 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-06-26 3:28 incoming Andrew Morton
@ 2020-06-26 6:51 ` Linus Torvalds
2020-06-26 7:31 ` incoming Linus Torvalds
2020-06-26 17:39 ` incoming Konstantin Ryabitsev
0 siblings, 2 replies; 419+ messages in thread
From: Linus Torvalds @ 2020-06-26 6:51 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits
On Thu, Jun 25, 2020 at 8:28 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a.
You didn't cc lkml, so now none of the nice 'b4' automation seems to
work for this series..
Yes, this cover-letter went to linux-mm (which is on lore), but the
individual patches didn't.
Konstantin, maybe mm-commits could be on lore too and then they'd have
been caught that way?
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-06-26 6:51 ` incoming Linus Torvalds
@ 2020-06-26 7:31 ` Linus Torvalds
2020-06-26 17:39 ` incoming Konstantin Ryabitsev
1 sibling, 0 replies; 419+ messages in thread
From: Linus Torvalds @ 2020-06-26 7:31 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits
On Thu, Jun 25, 2020 at 11:51 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> You didn't cc lkml, so now none of the nice 'b4' automation seems to
> work for this series..
Note that I've picked them up the old-fashioned way, so don't re-send them.
So more of a note for "please, next time..."
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-06-26 6:51 ` incoming Linus Torvalds
2020-06-26 7:31 ` incoming Linus Torvalds
@ 2020-06-26 17:39 ` Konstantin Ryabitsev
2020-06-26 17:40 ` incoming Konstantin Ryabitsev
1 sibling, 1 reply; 419+ messages in thread
From: Konstantin Ryabitsev @ 2020-06-26 17:39 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits
On Thu, Jun 25, 2020 at 11:51:06PM -0700, Linus Torvalds wrote:
> On Thu, Jun 25, 2020 at 8:28 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a.
>
> You didn't cc lkml, so now none of the nice 'b4' automation seems to
> work for this series..
>
> Yes, this cover-letter went to linux-mm (which is on lore), but the
> individual patches didn't.
>
> Konstantin, maybe mm-commits could be on lore too and then they'd have
> been caught that way?
Yes, I already have a request from Kees for linux-mm addition, so that
should show up in archives before long.
-K
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-06-26 17:39 ` incoming Konstantin Ryabitsev
@ 2020-06-26 17:40 ` Konstantin Ryabitsev
0 siblings, 0 replies; 419+ messages in thread
From: Konstantin Ryabitsev @ 2020-06-26 17:40 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits
On Fri, 26 Jun 2020 at 13:39, Konstantin Ryabitsev
<konstantin@linuxfoundation.org> wrote:
> > Konstantin, maybe mm-commits could be on lore too and then they'd have
> > been caught that way?
>
> Yes, I already have a request from Kees for linux-mm addition, so that
> should show up in archives before long.
correction: mm-commits, that is
-K
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-07-03 22:14 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-07-03 22:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
5 patches, based on cdd3bb54332f82295ed90cd0c09c78cd0c0ee822.
Subsystems affected by this patch series:
mm/hugetlb
samples
mm/cma
mm/vmalloc
mm/pagealloc
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
mm/hugetlb.c: fix pages per hugetlb calculation
Subsystem: samples
Kees Cook <keescook@chromium.org>:
samples/vfs: avoid warning in statx override
Subsystem: mm/cma
Barry Song <song.bao.hua@hisilicon.com>:
mm/cma.c: use exact_nid true to fix possible per-numa cma leak
Subsystem: mm/vmalloc
Christoph Hellwig <hch@lst.de>:
vmalloc: fix the owner argument for the new __vmalloc_node_range callers
Subsystem: mm/pagealloc
Joel Savitz <jsavitz@redhat.com>:
mm/page_alloc: fix documentation error
arch/arm64/kernel/probes/kprobes.c | 2 +-
arch/x86/hyperv/hv_init.c | 3 ++-
kernel/module.c | 2 +-
mm/cma.c | 4 ++--
mm/hugetlb.c | 2 +-
mm/page_alloc.c | 2 +-
samples/vfs/test-statx.c | 2 ++
7 files changed, 10 insertions(+), 7 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-07-24 4:14 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-07-24 4:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
15 patches, based on f37e99aca03f63aa3f2bd13ceaf769455d12c4b0.
Subsystems affected by this patch series:
mm/pagemap
mm/shmem
mm/hotfixes
mm/memcg
mm/hugetlb
mailmap
squashfs
scripts
io-mapping
MAINTAINERS
gdb
Subsystem: mm/pagemap
Yang Shi <yang.shi@linux.alibaba.com>:
mm/memory.c: avoid access flag update TLB flush for retried page fault
"Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
mm/mmap.c: close race between munmap() and expand_upwards()/downwards()
Subsystem: mm/shmem
Chengguang Xu <cgxu519@mykernel.net>:
vfs/xattr: mm/shmem: kernfs: release simple xattr entry in a right way
Subsystem: mm/hotfixes
Tom Rix <trix@redhat.com>:
mm: initialize return of vm_insert_pages
Bhupesh Sharma <bhsharma@redhat.com>:
mm/memcontrol: fix OOPS inside mem_cgroup_get_nr_swap_pages()
Subsystem: mm/memcg
Hugh Dickins <hughd@google.com>:
mm/memcg: fix refcount error while moving and swapping
Muchun Song <songmuchun@bytedance.com>:
mm: memcg/slab: fix memory leak at non-root kmem_cache destroy
Subsystem: mm/hugetlb
Barry Song <song.bao.hua@hisilicon.com>:
mm/hugetlb: avoid hardcoding while checking if cma is enabled
"Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
khugepaged: fix null-pointer dereference due to race
Subsystem: mailmap
Mike Rapoport <rppt@linux.ibm.com>:
mailmap: add entry for Mike Rapoport
Subsystem: squashfs
Phillip Lougher <phillip@squashfs.org.uk>:
squashfs: fix length field overlap check in metadata reading
Subsystem: scripts
Pi-Hsun Shih <pihsun@chromium.org>:
scripts/decode_stacktrace: strip basepath from all paths
Subsystem: io-mapping
"Michael J. Ruhl" <michael.j.ruhl@intel.com>:
io-mapping: indicate mapping failure
Subsystem: MAINTAINERS
Andrey Konovalov <andreyknvl@google.com>:
MAINTAINERS: add KCOV section
Subsystem: gdb
Stefano Garzarella <sgarzare@redhat.com>:
scripts/gdb: fix lx-symbols 'gdb.error' while loading modules
.mailmap | 3 +++
MAINTAINERS | 11 +++++++++++
fs/squashfs/block.c | 2 +-
include/linux/io-mapping.h | 5 ++++-
include/linux/xattr.h | 3 ++-
mm/hugetlb.c | 15 ++++++++++-----
mm/khugepaged.c | 3 +++
mm/memcontrol.c | 13 ++++++++++---
mm/memory.c | 9 +++++++--
mm/mmap.c | 16 ++++++++++++++--
mm/shmem.c | 2 +-
mm/slab_common.c | 35 ++++++++++++++++++++++++++++-------
scripts/decode_stacktrace.sh | 4 ++--
scripts/gdb/linux/symbols.py | 2 +-
14 files changed, 97 insertions(+), 26 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-08-07 6:16 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-08-07 6:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- A few MM hotfixes
- kthread, tools, scripts, ntfs and ocfs2
- Some of MM
163 patches, based on d6efb3ac3e6c19ab722b28bdb9252bae0b9676b6.
Subsystems affected by this patch series:
mm/pagemap
mm/hofixes
mm/pagealloc
kthread
tools
scripts
ntfs
ocfs2
mm/slab-generic
mm/slab
mm/slub
mm/kcsan
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/shmem
mm/memcg
mm/pagemap
mm/mremap
mm/mincore
mm/sparsemem
mm/vmalloc
mm/kasan
mm/pagealloc
mm/hugetlb
mm/vmscan
Subsystem: mm/pagemap
Yang Shi <yang.shi@linux.alibaba.com>:
mm/memory.c: avoid access flag update TLB flush for retried page fault
Subsystem: mm/hofixes
Ralph Campbell <rcampbell@nvidia.com>:
mm/migrate: fix migrate_pgmap_owner w/o CONFIG_MMU_NOTIFIER
Subsystem: mm/pagealloc
David Hildenbrand <david@redhat.com>:
mm/shuffle: don't move pages between zones and don't read garbage memmaps
Subsystem: kthread
Peter Zijlstra <peterz@infradead.org>:
mm: fix kthread_use_mm() vs TLB invalidate
Ilias Stamatis <stamatis.iliass@gmail.com>:
kthread: remove incorrect comment in kthread_create_on_cpu()
Subsystem: tools
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
tools/: replace HTTP links with HTTPS ones
Gaurav Singh <gaurav1086@gmail.com>:
tools/testing/selftests/cgroup/cgroup_util.c: cg_read_strcmp: fix null pointer dereference
Subsystem: scripts
Jialu Xu <xujialu@vimux.org>:
scripts/tags.sh: collect compiled source precisely
Nikolay Borisov <nborisov@suse.com>:
scripts/bloat-o-meter: Support comparing library archives
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
scripts/decode_stacktrace.sh: skip missing symbols
scripts/decode_stacktrace.sh: guess basepath if not specified
scripts/decode_stacktrace.sh: guess path to modules
scripts/decode_stacktrace.sh: guess path to vmlinux by release name
Joe Perches <joe@perches.com>:
const_structs.checkpatch: add regulator_ops
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ntfs
Luca Stefani <luca.stefani.ge1@gmail.com>:
ntfs: fix ntfs_test_inode and ntfs_init_locked_inode function type
Subsystem: ocfs2
Gang He <ghe@suse.com>:
ocfs2: fix remounting needed after setfacl command
Randy Dunlap <rdunlap@infradead.org>:
ocfs2: suballoc.h: delete a duplicated word
Junxiao Bi <junxiao.bi@oracle.com>:
ocfs2: change slot number type s16 to u16
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
ocfs2: replace HTTP links with HTTPS ones
Pavel Machek <pavel@ucw.cz>:
ocfs2: fix unbalanced locking
Subsystem: mm/slab-generic
Waiman Long <longman@redhat.com>:
mm, treewide: rename kzfree() to kfree_sensitive()
William Kucharski <william.kucharski@oracle.com>:
mm: ksize() should silently accept a NULL pointer
Subsystem: mm/slab
Kees Cook <keescook@chromium.org>:
Patch series "mm: Expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB":
mm/slab: expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB
mm/slab: add naive detection of double free
Long Li <lonuxli.64@gmail.com>:
mm, slab: check GFP_SLAB_BUG_MASK before alloc_pages in kmalloc_order
Xiao Yang <yangx.jy@cn.fujitsu.com>:
mm/slab.c: update outdated kmem_list3 in a comment
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
Patch series "slub_debug fixes and improvements":
mm, slub: extend slub_debug syntax for multiple blocks
mm, slub: make some slub_debug related attributes read-only
mm, slub: remove runtime allocation order changes
mm, slub: make remaining slub_debug related attributes read-only
mm, slub: make reclaim_account attribute read-only
mm, slub: introduce static key for slub_debug()
mm, slub: introduce kmem_cache_debug_flags()
mm, slub: extend checks guarded by slub_debug static key
mm, slab/slub: move and improve cache_from_obj()
mm, slab/slub: improve error reporting and overhead of cache_from_obj()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/slub.c: drop lockdep_assert_held() from put_map()
Subsystem: mm/kcsan
Marco Elver <elver@google.com>:
mm, kcsan: instrument SLAB/SLUB free with "ASSERT_EXCLUSIVE_ACCESS"
Subsystem: mm/debug
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/debug_vm_pgtable: Add some more tests", v5:
mm/debug_vm_pgtable: add tests validating arch helpers for core MM features
mm/debug_vm_pgtable: add tests validating advanced arch page table helpers
mm/debug_vm_pgtable: add debug prints for individual tests
Documentation/mm: add descriptions for arch page table helpers
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Improvements for dump_page()", v2:
mm/debug: handle page->mapping better in dump_page
mm/debug: dump compound page information on a second line
mm/debug: print head flags in dump_page
mm/debug: switch dump_page to get_kernel_nofault
mm/debug: print the inode number in dump_page
mm/debug: print hashed address of struct page
John Hubbard <jhubbard@nvidia.com>:
mm, dump_page: do not crash with bad compound_mapcount()
Subsystem: mm/pagecache
Yang Shi <yang.shi@linux.alibaba.com>:
mm: filemap: clear idle flag for writes
mm: filemap: add missing FGP_ flags in kerneldoc comment for pagecache_get_page
Subsystem: mm/gup
Tang Yizhou <tangyizhou@huawei.com>:
mm/gup.c: fix the comment of return value for populate_vma_page_range()
Subsystem: mm/swap
Zhen Lei <thunder.leizhen@huawei.com>:
Patch series "clean up some functions in mm/swap_slots.c":
mm/swap_slots.c: simplify alloc_swap_slot_cache()
mm/swap_slots.c: simplify enable_swap_slots_cache()
mm/swap_slots.c: remove redundant check for swap_slot_cache_initialized
Krzysztof Kozlowski <krzk@kernel.org>:
mm: swap: fix kerneldoc of swap_vma_readahead()
Xianting Tian <xianting_tian@126.com>:
mm/page_io.c: use blk_io_schedule() for avoiding task hung in sync io
Subsystem: mm/shmem
Chris Down <chris@chrisdown.name>:
Patch series "tmpfs: inode: Reduce risk of inum overflow", v7:
tmpfs: per-superblock i_ino support
tmpfs: support 64-bit inums per-sb
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: kmem: make memcg_kmem_enabled() irreversible
Patch series "The new cgroup slab memory controller", v7:
mm: memcg: factor out memcg- and lruvec-level changes out of __mod_lruvec_state()
mm: memcg: prepare for byte-sized vmstat items
mm: memcg: convert vmstat slab counters to bytes
mm: slub: implement SLUB version of obj_to_index()
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: decouple reference counting from page accounting
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: obj_cgroup API
mm: memcg/slab: allocate obj_cgroups for non-root slab pages
mm: memcg/slab: save obj_cgroup for non-root slab objects
mm: memcg/slab: charge individual slab objects instead of pages
mm: memcg/slab: deprecate memory.kmem.slabinfo
mm: memcg/slab: move memcg_kmem_bypass() to memcontrol.h
mm: memcg/slab: use a single set of kmem_caches for all accounted allocations
mm: memcg/slab: simplify memcg cache creation
mm: memcg/slab: remove memcg_kmem_get_cache()
mm: memcg/slab: deprecate slab_root_caches
mm: memcg/slab: remove redundant check in memcg_accumulate_slabinfo()
mm: memcg/slab: use a single set of kmem_caches for all allocations
kselftests: cgroup: add kernel memory accounting tests
tools/cgroup: add memcg_slabinfo.py tool
Shakeel Butt <shakeelb@google.com>:
mm: memcontrol: account kernel stack per node
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: remove unused argument by charge_slab_page()
mm: slab: rename (un)charge_slab_page() to (un)account_slab_page()
mm: kmem: switch to static_branch_likely() in memcg_kmem_enabled()
mm: memcontrol: avoid workload stalls when lowering memory.high
Chris Down <chris@chrisdown.name>:
Patch series "mm, memcg: reclaim harder before high throttling", v2:
mm, memcg: reclaim more aggressively before high allocator throttling
mm, memcg: unify reclaim retry limits with page allocator
Yafang Shao <laoar.shao@gmail.com>:
Patch series "mm, memcg: memory.{low,min} reclaim fix & cleanup", v4:
mm, memcg: avoid stale protection values when cgroup is above protection
Chris Down <chris@chrisdown.name>:
mm, memcg: decouple e{low,min} state mutations from protection checks
Yafang Shao <laoar.shao@gmail.com>:
memcg, oom: check memcg margin for parallel oom
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: restore proper dirty throttling when memory.high changes
mm: memcontrol: don't count limit-setting reclaim as memory pressure
Michal Koutný <mkoutny@suse.com>:
mm/page_counter.c: fix protection usage propagation
Subsystem: mm/pagemap
Ralph Campbell <rcampbell@nvidia.com>:
mm: remove redundant check non_swap_entry()
Alex Zhang <zhangalex@google.com>:
mm/memory.c: make remap_pfn_range() reject unaligned addr
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: cleanup usage of <asm/pgalloc.h>":
mm: remove unneeded includes of <asm/pgalloc.h>
opeinrisc: switch to generic version of pte allocation
xtensa: switch to generic version of pte allocation
asm-generic: pgalloc: provide generic pmd_alloc_one() and pmd_free_one()
asm-generic: pgalloc: provide generic pud_alloc_one() and pud_free_one()
asm-generic: pgalloc: provide generic pgd_free()
mm: move lib/ioremap.c to mm/
Joerg Roedel <jroedel@suse.de>:
mm: move p?d_alloc_track to separate header file
Zhen Lei <thunder.leizhen@huawei.com>:
mm/mmap: optimize a branch judgment in ksys_mmap_pgoff()
Feng Tang <feng.tang@intel.com>:
Patch series "make vm_committed_as_batch aware of vm overcommit policy", v6:
proc/meminfo: avoid open coded reading of vm_committed_as
mm/util.c: make vm_memory_committed() more accurate
percpu_counter: add percpu_counter_sync()
mm: adjust vm_committed_as_batch according to vm overcommit policy
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "arm64: Enable vmemmap mapping from device memory", v4:
mm/sparsemem: enable vmem_altmap support in vmemmap_populate_basepages()
mm/sparsemem: enable vmem_altmap support in vmemmap_alloc_block_buf()
arm64/mm: enable vmem_altmap support for vmemmap mappings
Miaohe Lin <linmiaohe@huawei.com>:
mm: mmap: merge vma after call_mmap() if possible
Peter Collingbourne <pcc@google.com>:
mm: remove unnecessary wrapper function do_mmap_pgoff()
Subsystem: mm/mremap
Wei Yang <richard.weiyang@linux.alibaba.com>:
Patch series "mm/mremap: cleanup move_page_tables() a little", v5:
mm/mremap: it is sure to have enough space when extent meets requirement
mm/mremap: calculate extent in one place
mm/mremap: start addresses are properly aligned
Subsystem: mm/mincore
Ricardo Cañuelo <ricardo.canuelo@collabora.com>:
selftests: add mincore() tests
Subsystem: mm/sparsemem
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/sparse: never partially remove memmap for early section
mm/sparse: only sub-section aligned range would be populated
Mike Rapoport <rppt@linux.ibm.com>:
mm/sparse: cleanup the code surrounding memory_present()
Subsystem: mm/vmalloc
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
vmalloc: convert to XArray
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: simplify merge_or_add_vmap_area()
mm/vmalloc: simplify augment_tree_propagate_check()
mm/vmalloc: switch to "propagate()" callback
mm/vmalloc: update the header about KVA rework
Mike Rapoport <rppt@linux.ibm.com>:
mm: vmalloc: remove redundant assignment in unmap_kernel_range_noflush()
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc.c: remove BUG() from the find_va_links()
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
kasan: improve and simplify Kconfig.kasan
kasan: update required compiler versions in documentation
Walter Wu <walter-zh.wu@mediatek.com>:
Patch series "kasan: memorize and print call_rcu stack", v8:
rcu: kasan: record and print call_rcu() call stack
kasan: record and print the free track
kasan: add tests for call_rcu stack recording
kasan: update documentation for generic kasan
Vincenzo Frascino <vincenzo.frascino@arm.com>:
kasan: remove kasan_unpoison_stack_above_sp_to()
Walter Wu <walter-zh.wu@mediatek.com>:
lib/test_kasan.c: fix KASAN unit tests for tag-based KASAN
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: support stack instrumentation for tag-based mode", v2:
kasan: don't tag stacks allocated with pagealloc
efi: provide empty efi_enter_virtual_mode implementation
kasan, arm64: don't instrument functions that enable kasan
kasan: allow enabling stack tagging for tag-based mode
kasan: adjust kasan_stack_oob for tag-based mode
Subsystem: mm/pagealloc
Vlastimil Babka <vbabka@suse.cz>:
mm, page_alloc: use unlikely() in task_capc()
Jaewon Kim <jaewon31.kim@samsung.com>:
page_alloc: consider highatomic reserve in watermark fast
Charan Teja Reddy <charante@codeaurora.org>:
mm, page_alloc: skip ->waternark_boost for atomic order-0 allocations
David Hildenbrand <david@redhat.com>:
mm: remove vm_total_pages
mm/page_alloc: remove nr_free_pagecache_pages()
mm/memory_hotplug: document why shuffle_zone() is relevant
mm/shuffle: remove dynamic reconfiguration
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/page_alloc.c: replace the definition of NR_MIGRATETYPE_BITS with PB_migratetype_bits
mm/page_alloc.c: extract the common part in pfn_to_bitidx()
mm/page_alloc.c: simplify pageblock bitmap access
mm/page_alloc.c: remove unnecessary end_bitidx for [set|get]_pfnblock_flags_mask()
Qian Cai <cai@lca.pw>:
mm/page_alloc: silence a KASAN false positive
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/page_alloc: fallbacks at most has 3 elements
Muchun Song <songmuchun@bytedance.com>:
mm/page_alloc.c: skip setting nodemask when we are in interrupt
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
mm/page_alloc: fix memalloc_nocma_{save/restore} APIs
Subsystem: mm/hugetlb
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
mm: thp: replace HTTP links with HTTPS ones
Peter Xu <peterx@redhat.com>:
mm/hugetlb: fix calculation of adjust_range_if_pmd_sharing_possible
Hugh Dickins <hughd@google.com>:
khugepaged: collapse_pte_mapped_thp() flush the right range
khugepaged: collapse_pte_mapped_thp() protect the pmd lock
khugepaged: retract_page_tables() remember to test exit
khugepaged: khugepaged_test_exit() check mmget_still_valid()
Subsystem: mm/vmscan
dylan-meiners <spacct.spacct@gmail.com>:
mm/vmscan.c: fix typo
Shakeel Butt <shakeelb@google.com>:
mm: vmscan: consistent update to pgrefill
Documentation/admin-guide/kernel-parameters.txt | 2
Documentation/dev-tools/kasan.rst | 10
Documentation/filesystems/dlmfs.rst | 2
Documentation/filesystems/ocfs2.rst | 2
Documentation/filesystems/tmpfs.rst | 18
Documentation/vm/arch_pgtable_helpers.rst | 258 +++++
Documentation/vm/memory-model.rst | 9
Documentation/vm/slub.rst | 51 -
arch/alpha/include/asm/pgalloc.h | 21
arch/alpha/include/asm/tlbflush.h | 1
arch/alpha/kernel/core_irongate.c | 1
arch/alpha/kernel/core_marvel.c | 1
arch/alpha/kernel/core_titan.c | 1
arch/alpha/kernel/machvec_impl.h | 2
arch/alpha/kernel/smp.c | 1
arch/alpha/mm/numa.c | 1
arch/arc/mm/fault.c | 1
arch/arc/mm/init.c | 1
arch/arm/include/asm/pgalloc.h | 12
arch/arm/include/asm/tlb.h | 1
arch/arm/kernel/machine_kexec.c | 1
arch/arm/kernel/smp.c | 1
arch/arm/kernel/suspend.c | 1
arch/arm/mach-omap2/omap-mpuss-lowpower.c | 1
arch/arm/mm/hugetlbpage.c | 1
arch/arm/mm/init.c | 9
arch/arm/mm/mmu.c | 1
arch/arm64/include/asm/pgalloc.h | 39
arch/arm64/kernel/setup.c | 2
arch/arm64/kernel/smp.c | 1
arch/arm64/mm/hugetlbpage.c | 1
arch/arm64/mm/init.c | 6
arch/arm64/mm/ioremap.c | 1
arch/arm64/mm/mmu.c | 63 -
arch/csky/include/asm/pgalloc.h | 7
arch/csky/kernel/smp.c | 1
arch/hexagon/include/asm/pgalloc.h | 7
arch/ia64/include/asm/pgalloc.h | 24
arch/ia64/include/asm/tlb.h | 1
arch/ia64/kernel/process.c | 1
arch/ia64/kernel/smp.c | 1
arch/ia64/kernel/smpboot.c | 1
arch/ia64/mm/contig.c | 1
arch/ia64/mm/discontig.c | 4
arch/ia64/mm/hugetlbpage.c | 1
arch/ia64/mm/tlb.c | 1
arch/m68k/include/asm/mmu_context.h | 2
arch/m68k/include/asm/sun3_pgalloc.h | 7
arch/m68k/kernel/dma.c | 2
arch/m68k/kernel/traps.c | 3
arch/m68k/mm/cache.c | 2
arch/m68k/mm/fault.c | 1
arch/m68k/mm/kmap.c | 2
arch/m68k/mm/mcfmmu.c | 1
arch/m68k/mm/memory.c | 1
arch/m68k/sun3x/dvma.c | 2
arch/microblaze/include/asm/pgalloc.h | 6
arch/microblaze/include/asm/tlbflush.h | 1
arch/microblaze/kernel/process.c | 1
arch/microblaze/kernel/signal.c | 1
arch/microblaze/mm/init.c | 3
arch/mips/include/asm/pgalloc.h | 19
arch/mips/kernel/setup.c | 8
arch/mips/loongson64/numa.c | 1
arch/mips/sgi-ip27/ip27-memory.c | 2
arch/mips/sgi-ip32/ip32-memory.c | 1
arch/nds32/mm/mm-nds32.c | 2
arch/nios2/include/asm/pgalloc.h | 7
arch/openrisc/include/asm/pgalloc.h | 33
arch/openrisc/include/asm/tlbflush.h | 1
arch/openrisc/kernel/or32_ksyms.c | 1
arch/parisc/include/asm/mmu_context.h | 1
arch/parisc/include/asm/pgalloc.h | 12
arch/parisc/kernel/cache.c | 1
arch/parisc/kernel/pci-dma.c | 1
arch/parisc/kernel/process.c | 1
arch/parisc/kernel/signal.c | 1
arch/parisc/kernel/smp.c | 1
arch/parisc/mm/hugetlbpage.c | 1
arch/parisc/mm/init.c | 5
arch/parisc/mm/ioremap.c | 2
arch/powerpc/include/asm/tlb.h | 1
arch/powerpc/mm/book3s64/hash_hugetlbpage.c | 1
arch/powerpc/mm/book3s64/hash_pgtable.c | 1
arch/powerpc/mm/book3s64/hash_tlb.c | 1
arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 1
arch/powerpc/mm/init_32.c | 1
arch/powerpc/mm/init_64.c | 4
arch/powerpc/mm/kasan/8xx.c | 1
arch/powerpc/mm/kasan/book3s_32.c | 1
arch/powerpc/mm/mem.c | 3
arch/powerpc/mm/nohash/40x.c | 1
arch/powerpc/mm/nohash/8xx.c | 1
arch/powerpc/mm/nohash/fsl_booke.c | 1
arch/powerpc/mm/nohash/kaslr_booke.c | 1
arch/powerpc/mm/nohash/tlb.c | 1
arch/powerpc/mm/numa.c | 1
arch/powerpc/mm/pgtable.c | 1
arch/powerpc/mm/pgtable_64.c | 1
arch/powerpc/mm/ptdump/hashpagetable.c | 2
arch/powerpc/mm/ptdump/ptdump.c | 1
arch/powerpc/platforms/pseries/cmm.c | 1
arch/riscv/include/asm/pgalloc.h | 18
arch/riscv/mm/fault.c | 1
arch/riscv/mm/init.c | 3
arch/s390/crypto/prng.c | 4
arch/s390/include/asm/tlb.h | 1
arch/s390/include/asm/tlbflush.h | 1
arch/s390/kernel/machine_kexec.c | 1
arch/s390/kernel/ptrace.c | 1
arch/s390/kvm/diag.c | 1
arch/s390/kvm/priv.c | 1
arch/s390/kvm/pv.c | 1
arch/s390/mm/cmm.c | 1
arch/s390/mm/init.c | 1
arch/s390/mm/mmap.c | 1
arch/s390/mm/pgtable.c | 1
arch/sh/include/asm/pgalloc.h | 4
arch/sh/kernel/idle.c | 1
arch/sh/kernel/machine_kexec.c | 1
arch/sh/mm/cache-sh3.c | 1
arch/sh/mm/cache-sh7705.c | 1
arch/sh/mm/hugetlbpage.c | 1
arch/sh/mm/init.c | 7
arch/sh/mm/ioremap_fixed.c | 1
arch/sh/mm/numa.c | 3
arch/sh/mm/tlb-sh3.c | 1
arch/sparc/include/asm/ide.h | 1
arch/sparc/include/asm/tlb_64.h | 1
arch/sparc/kernel/leon_smp.c | 1
arch/sparc/kernel/process_32.c | 1
arch/sparc/kernel/signal_32.c | 1
arch/sparc/kernel/smp_32.c | 1
arch/sparc/kernel/smp_64.c | 1
arch/sparc/kernel/sun4m_irq.c | 1
arch/sparc/mm/highmem.c | 1
arch/sparc/mm/init_64.c | 1
arch/sparc/mm/io-unit.c | 1
arch/sparc/mm/iommu.c | 1
arch/sparc/mm/tlb.c | 1
arch/um/include/asm/pgalloc.h | 9
arch/um/include/asm/pgtable-3level.h | 3
arch/um/kernel/mem.c | 17
arch/x86/ia32/ia32_aout.c | 1
arch/x86/include/asm/mmu_context.h | 1
arch/x86/include/asm/pgalloc.h | 42
arch/x86/kernel/alternative.c | 1
arch/x86/kernel/apic/apic.c | 1
arch/x86/kernel/mpparse.c | 1
arch/x86/kernel/traps.c | 1
arch/x86/mm/fault.c | 1
arch/x86/mm/hugetlbpage.c | 1
arch/x86/mm/init_32.c | 2
arch/x86/mm/init_64.c | 12
arch/x86/mm/kaslr.c | 1
arch/x86/mm/pgtable_32.c | 1
arch/x86/mm/pti.c | 1
arch/x86/platform/uv/bios_uv.c | 1
arch/x86/power/hibernate.c | 2
arch/xtensa/include/asm/pgalloc.h | 46
arch/xtensa/kernel/xtensa_ksyms.c | 1
arch/xtensa/mm/cache.c | 1
arch/xtensa/mm/fault.c | 1
crypto/adiantum.c | 2
crypto/ahash.c | 4
crypto/api.c | 2
crypto/asymmetric_keys/verify_pefile.c | 4
crypto/deflate.c | 2
crypto/drbg.c | 10
crypto/ecc.c | 8
crypto/ecdh.c | 2
crypto/gcm.c | 2
crypto/gf128mul.c | 4
crypto/jitterentropy-kcapi.c | 2
crypto/rng.c | 2
crypto/rsa-pkcs1pad.c | 6
crypto/seqiv.c | 2
crypto/shash.c | 2
crypto/skcipher.c | 2
crypto/testmgr.c | 6
crypto/zstd.c | 2
drivers/base/node.c | 10
drivers/block/xen-blkback/common.h | 1
drivers/crypto/allwinner/sun8i-ce/sun8i-ce-cipher.c | 2
drivers/crypto/allwinner/sun8i-ss/sun8i-ss-cipher.c | 2
drivers/crypto/amlogic/amlogic-gxl-cipher.c | 4
drivers/crypto/atmel-ecc.c | 2
drivers/crypto/caam/caampkc.c | 28
drivers/crypto/cavium/cpt/cptvf_main.c | 6
drivers/crypto/cavium/cpt/cptvf_reqmanager.c | 12
drivers/crypto/cavium/nitrox/nitrox_lib.c | 4
drivers/crypto/cavium/zip/zip_crypto.c | 6
drivers/crypto/ccp/ccp-crypto-rsa.c | 6
drivers/crypto/ccree/cc_aead.c | 4
drivers/crypto/ccree/cc_buffer_mgr.c | 4
drivers/crypto/ccree/cc_cipher.c | 6
drivers/crypto/ccree/cc_hash.c | 8
drivers/crypto/ccree/cc_request_mgr.c | 2
drivers/crypto/marvell/cesa/hash.c | 2
drivers/crypto/marvell/octeontx/otx_cptvf_main.c | 6
drivers/crypto/marvell/octeontx/otx_cptvf_reqmgr.h | 2
drivers/crypto/nx/nx.c | 4
drivers/crypto/virtio/virtio_crypto_algs.c | 12
drivers/crypto/virtio/virtio_crypto_core.c | 2
drivers/iommu/ipmmu-vmsa.c | 1
drivers/md/dm-crypt.c | 32
drivers/md/dm-integrity.c | 6
drivers/misc/ibmvmc.c | 6
drivers/net/ethernet/hisilicon/hns3/hns3pf/hclge_mbx.c | 2
drivers/net/ethernet/intel/ixgbe/ixgbe_ipsec.c | 6
drivers/net/ppp/ppp_mppe.c | 6
drivers/net/wireguard/noise.c | 4
drivers/net/wireguard/peer.c | 2
drivers/net/wireless/intel/iwlwifi/pcie/rx.c | 2
drivers/net/wireless/intel/iwlwifi/pcie/tx-gen2.c | 6
drivers/net/wireless/intel/iwlwifi/pcie/tx.c | 6
drivers/net/wireless/intersil/orinoco/wext.c | 4
drivers/s390/crypto/ap_bus.h | 4
drivers/staging/ks7010/ks_hostif.c | 2
drivers/staging/rtl8723bs/core/rtw_security.c | 2
drivers/staging/wlan-ng/p80211netdev.c | 2
drivers/target/iscsi/iscsi_target_auth.c | 2
drivers/xen/balloon.c | 1
drivers/xen/privcmd.c | 1
fs/Kconfig | 21
fs/aio.c | 6
fs/binfmt_elf_fdpic.c | 1
fs/cifs/cifsencrypt.c | 2
fs/cifs/connect.c | 10
fs/cifs/dfs_cache.c | 2
fs/cifs/misc.c | 8
fs/crypto/inline_crypt.c | 5
fs/crypto/keyring.c | 6
fs/crypto/keysetup_v1.c | 4
fs/ecryptfs/keystore.c | 4
fs/ecryptfs/messaging.c | 2
fs/hugetlbfs/inode.c | 2
fs/ntfs/dir.c | 2
fs/ntfs/inode.c | 27
fs/ntfs/inode.h | 4
fs/ntfs/mft.c | 4
fs/ocfs2/Kconfig | 6
fs/ocfs2/acl.c | 2
fs/ocfs2/blockcheck.c | 2
fs/ocfs2/dlmglue.c | 8
fs/ocfs2/ocfs2.h | 4
fs/ocfs2/suballoc.c | 4
fs/ocfs2/suballoc.h | 2
fs/ocfs2/super.c | 4
fs/proc/meminfo.c | 10
include/asm-generic/pgalloc.h | 80 +
include/asm-generic/tlb.h | 1
include/crypto/aead.h | 2
include/crypto/akcipher.h | 2
include/crypto/gf128mul.h | 2
include/crypto/hash.h | 2
include/crypto/internal/acompress.h | 2
include/crypto/kpp.h | 2
include/crypto/skcipher.h | 2
include/linux/efi.h | 4
include/linux/fs.h | 17
include/linux/huge_mm.h | 2
include/linux/kasan.h | 4
include/linux/memcontrol.h | 209 +++-
include/linux/mm.h | 86 -
include/linux/mm_types.h | 5
include/linux/mman.h | 4
include/linux/mmu_notifier.h | 13
include/linux/mmzone.h | 54 -
include/linux/pageblock-flags.h | 30
include/linux/percpu_counter.h | 4
include/linux/sched/mm.h | 8
include/linux/shmem_fs.h | 3
include/linux/slab.h | 11
include/linux/slab_def.h | 9
include/linux/slub_def.h | 31
include/linux/swap.h | 2
include/linux/vmstat.h | 14
init/Kconfig | 9
init/main.c | 2
ipc/shm.c | 2
kernel/fork.c | 54 -
kernel/kthread.c | 8
kernel/power/snapshot.c | 2
kernel/rcu/tree.c | 2
kernel/scs.c | 2
kernel/sysctl.c | 2
lib/Kconfig.kasan | 39
lib/Makefile | 1
lib/ioremap.c | 287 -----
lib/mpi/mpiutil.c | 6
lib/percpu_counter.c | 19
lib/test_kasan.c | 87 +
mm/Kconfig | 6
mm/Makefile | 2
mm/debug.c | 103 +-
mm/debug_vm_pgtable.c | 666 +++++++++++++
mm/filemap.c | 9
mm/gup.c | 3
mm/huge_memory.c | 14
mm/hugetlb.c | 25
mm/ioremap.c | 289 +++++
mm/kasan/common.c | 41
mm/kasan/generic.c | 43
mm/kasan/generic_report.c | 1
mm/kasan/kasan.h | 25
mm/kasan/quarantine.c | 1
mm/kasan/report.c | 54 -
mm/kasan/tags.c | 37
mm/khugepaged.c | 75 -
mm/memcontrol.c | 832 ++++++++++-------
mm/memory.c | 15
mm/memory_hotplug.c | 11
mm/migrate.c | 6
mm/mm_init.c | 20
mm/mmap.c | 45
mm/mremap.c | 19
mm/nommu.c | 6
mm/oom_kill.c | 2
mm/page-writeback.c | 6
mm/page_alloc.c | 226 ++--
mm/page_counter.c | 6
mm/page_io.c | 2
mm/pgalloc-track.h | 51 +
mm/shmem.c | 133 ++
mm/shuffle.c | 46
mm/shuffle.h | 17
mm/slab.c | 129 +-
mm/slab.h | 755 ++++++---------
mm/slab_common.c | 829 ++--------------
mm/slob.c | 12
mm/slub.c | 680 ++++---------
mm/sparse-vmemmap.c | 62 -
mm/sparse.c | 31
mm/swap_slots.c | 45
mm/swap_state.c | 2
mm/util.c | 52 +
mm/vmalloc.c | 176 +--
mm/vmscan.c | 39
mm/vmstat.c | 38
mm/workingset.c | 6
net/atm/mpoa_caches.c | 4
net/bluetooth/ecdh_helper.c | 6
net/bluetooth/smp.c | 24
net/core/sock.c | 2
net/ipv4/tcp_fastopen.c | 2
net/mac80211/aead_api.c | 4
net/mac80211/aes_gmac.c | 2
net/mac80211/key.c | 2
net/mac802154/llsec.c | 20
net/sctp/auth.c | 2
net/sunrpc/auth_gss/gss_krb5_crypto.c | 4
net/sunrpc/auth_gss/gss_krb5_keys.c | 6
net/sunrpc/auth_gss/gss_krb5_mech.c | 2
net/tipc/crypto.c | 10
net/wireless/core.c | 2
net/wireless/ibss.c | 4
net/wireless/lib80211_crypt_tkip.c | 2
net/wireless/lib80211_crypt_wep.c | 2
net/wireless/nl80211.c | 24
net/wireless/sme.c | 6
net/wireless/util.c | 2
net/wireless/wext-sme.c | 2
scripts/Makefile.kasan | 3
scripts/bloat-o-meter | 2
scripts/coccinelle/free/devm_free.cocci | 4
scripts/coccinelle/free/ifnullfree.cocci | 4
scripts/coccinelle/free/kfree.cocci | 6
scripts/coccinelle/free/kfreeaddr.cocci | 2
scripts/const_structs.checkpatch | 1
scripts/decode_stacktrace.sh | 85 +
scripts/spelling.txt | 19
scripts/tags.sh | 18
security/apparmor/domain.c | 4
security/apparmor/include/file.h | 2
security/apparmor/policy.c | 24
security/apparmor/policy_ns.c | 6
security/apparmor/policy_unpack.c | 14
security/keys/big_key.c | 6
security/keys/dh.c | 14
security/keys/encrypted-keys/encrypted.c | 14
security/keys/trusted-keys/trusted_tpm1.c | 34
security/keys/user_defined.c | 6
tools/cgroup/memcg_slabinfo.py | 226 ++++
tools/include/linux/jhash.h | 2
tools/lib/rbtree.c | 2
tools/lib/traceevent/event-parse.h | 2
tools/testing/ktest/examples/README | 2
tools/testing/ktest/examples/crosstests.conf | 2
tools/testing/selftests/Makefile | 1
tools/testing/selftests/cgroup/.gitignore | 1
tools/testing/selftests/cgroup/Makefile | 2
tools/testing/selftests/cgroup/cgroup_util.c | 2
tools/testing/selftests/cgroup/test_kmem.c | 382 +++++++
tools/testing/selftests/mincore/.gitignore | 2
tools/testing/selftests/mincore/Makefile | 6
tools/testing/selftests/mincore/mincore_selftest.c | 361 +++++++
397 files changed, 5547 insertions(+), 4072 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-08-12 1:29 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-08-12 1:29 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- Most of the rest of MM
- various other subsystems
165 patches, based on 00e4db51259a5f936fec1424b884f029479d3981.
Subsystems affected by this patch series:
mm/memcg
mm/hugetlb
mm/vmscan
mm/proc
mm/compaction
mm/mempolicy
mm/oom-kill
mm/hugetlbfs
mm/migration
mm/thp
mm/cma
mm/util
mm/memory-hotplug
mm/cleanups
mm/uaccess
alpha
misc
sparse
bitmap
lib
lz4
bitops
checkpatch
autofs
minix
nilfs
ufs
fat
signals
kmod
coredump
exec
kdump
rapidio
panic
kcov
kgdb
ipc
mm/migration
mm/gup
mm/pagemap
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
Patch series "mm: memcg accounting of percpu memory", v3:
percpu: return number of released bytes from pcpu_free_area()
mm: memcg/percpu: account percpu memory to memory cgroups
mm: memcg/percpu: per-memcg percpu memory statistics
mm: memcg: charge memcg percpu memory to the parent cgroup
kselftests: cgroup: add perpcu memory accounting test
Subsystem: mm/hugetlb
Muchun Song <songmuchun@bytedance.com>:
mm/hugetlb: add mempolicy check in the reservation routine
Subsystem: mm/vmscan
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
Patch series "workingset protection/detection on the anonymous LRU list", v7:
mm/vmscan: make active/inactive ratio as 1:1 for anon lru
mm/vmscan: protect the workingset on anonymous LRU
mm/workingset: prepare the workingset detection infrastructure for anon LRU
mm/swapcache: support to handle the shadow entries
mm/swap: implement workingset detection for anonymous LRU
mm/vmscan: restore active/inactive ratio for anonymous LRU
Subsystem: mm/proc
Michal Koutný <mkoutny@suse.com>:
/proc/PID/smaps: consistent whitespace output format
Subsystem: mm/compaction
Nitin Gupta <nigupta@nvidia.com>:
mm: proactive compaction
mm: fix compile error due to COMPACTION_HPAGE_ORDER
mm: use unsigned types for fragmentation score
Alex Shi <alex.shi@linux.alibaba.com>:
mm/compaction: correct the comments of compact_defer_shift
Subsystem: mm/mempolicy
Krzysztof Kozlowski <krzk@kernel.org>:
mm: mempolicy: fix kerneldoc of numa_map_to_online_node()
Wenchao Hao <haowenchao22@gmail.com>:
mm/mempolicy.c: check parameters first in kernel_get_mempolicy
Yanfei Xu <yanfei.xu@windriver.com>:
include/linux/mempolicy.h: fix typo
Subsystem: mm/oom-kill
Yafang Shao <laoar.shao@gmail.com>:
mm, oom: make the calculation of oom badness more accurate
Michal Hocko <mhocko@suse.com>:
doc, mm: sync up oom_score_adj documentation
doc, mm: clarify /proc/<pid>/oom_score value range
Yafang Shao <laoar.shao@gmail.com>:
mm, oom: show process exiting information in __oom_kill_process()
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlbfs: prevent filesystem stacking of hugetlbfs
hugetlbfs: remove call to huge_pte_alloc without i_mmap_rwsem
Subsystem: mm/migration
Ralph Campbell <rcampbell@nvidia.com>:
Patch series "mm/migrate: optimize migrate_vma_setup() for holes":
mm/migrate: optimize migrate_vma_setup() for holes
mm/migrate: add migrate-shared test for migrate_vma_*()
Subsystem: mm/thp
Yang Shi <yang.shi@linux.alibaba.com>:
mm: thp: remove debug_cow switch
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/vmstat: add events for THP migration without split
Subsystem: mm/cma
Jianqun Xu <jay.xu@rock-chips.com>:
mm/cma.c: fix NULL pointer dereference when cma could not be activated
Barry Song <song.bao.hua@hisilicon.com>:
Patch series "mm: fix the names of general cma and hugetlb cma", v2:
mm: cma: fix the name of CMA areas
mm: hugetlb: fix the name of hugetlb CMA
Mike Kravetz <mike.kravetz@oracle.com>:
cma: don't quit at first error when activating reserved areas
Subsystem: mm/util
Waiman Long <longman@redhat.com>:
include/linux/sched/mm.h: optimize current_gfp_context()
Krzysztof Kozlowski <krzk@kernel.org>:
mm: mmu_notifier: fix and extend kerneldoc
Subsystem: mm/memory-hotplug
Daniel Jordan <daniel.m.jordan@oracle.com>:
x86/mm: use max memory block size on bare metal
Jia He <justin.he@arm.com>:
mm/memory_hotplug: introduce default dummy memory_add_physaddr_to_nid()
mm/memory_hotplug: fix unpaired mem_hotplug_begin/done
Charan Teja Reddy <charante@codeaurora.org>:
mm, memory_hotplug: update pcp lists everytime onlining a memory block
Subsystem: mm/cleanups
Randy Dunlap <rdunlap@infradead.org>:
mm: drop duplicated words in <linux/pgtable.h>
mm: drop duplicated words in <linux/mm.h>
include/linux/highmem.h: fix duplicated words in a comment
include/linux/frontswap.h: drop duplicated word in a comment
include/linux/memcontrol.h: drop duplicate word and fix spello
Arvind Sankar <nivedita@alum.mit.edu>:
sh/mm: drop unused MAX_PHYSADDR_BITS
sparc: drop unused MAX_PHYSADDR_BITS
Randy Dunlap <rdunlap@infradead.org>:
mm/compaction.c: delete duplicated word
mm/filemap.c: delete duplicated word
mm/hmm.c: delete duplicated word
mm/hugetlb.c: delete duplicated words
mm/memcontrol.c: delete duplicated words
mm/memory.c: delete duplicated words
mm/migrate.c: delete duplicated word
mm/nommu.c: delete duplicated words
mm/page_alloc.c: delete or fix duplicated words
mm/shmem.c: delete duplicated word
mm/slab_common.c: delete duplicated word
mm/usercopy.c: delete duplicated word
mm/vmscan.c: delete or fix duplicated words
mm/zpool.c: delete duplicated word and fix grammar
mm/zsmalloc.c: fix duplicated words
Subsystem: mm/uaccess
Christoph Hellwig <hch@lst.de>:
Patch series "clean up address limit helpers", v2:
syscalls: use uaccess_kernel in addr_limit_user_check
nds32: use uaccess_kernel in show_regs
riscv: include <asm/pgtable.h> in <asm/uaccess.h>
uaccess: remove segment_eq
uaccess: add force_uaccess_{begin,end} helpers
exec: use force_uaccess_begin during exec and exit
Subsystem: alpha
Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
alpha: fix annotation of io{read,write}{16,32}be()
Subsystem: misc
Randy Dunlap <rdunlap@infradead.org>:
include/linux/compiler-clang.h: drop duplicated word in a comment
include/linux/exportfs.h: drop duplicated word in a comment
include/linux/async_tx.h: drop duplicated word in a comment
include/linux/xz.h: drop duplicated word
Christoph Hellwig <hch@lst.de>:
kernel: add a kernel_wait helper
Feng Tang <feng.tang@intel.com>:
./Makefile: add debug option to enable function aligned on 32 bytes
Arvind Sankar <nivedita@alum.mit.edu>:
kernel.h: remove duplicate include of asm/div64.h
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
include/: replace HTTP links with HTTPS ones
Matthew Wilcox <willy@infradead.org>:
include/linux/poison.h: remove obsolete comment
Subsystem: sparse
Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
sparse: group the defines by functionality
Subsystem: bitmap
Stefano Brivio <sbrivio@redhat.com>:
Patch series "lib: Fix bitmap_cut() for overlaps, add test":
lib/bitmap.c: fix bitmap_cut() for partial overlapping case
lib/test_bitmap.c: add test for bitmap_cut()
Subsystem: lib
Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
lib/generic-radix-tree.c: remove unneeded __rcu
Geert Uytterhoeven <geert@linux-m68k.org>:
lib/test_bitops: do the full test during module init
Wei Yongjun <weiyongjun1@huawei.com>:
lib/test_lockup.c: make symbol 'test_works' static
Tiezhu Yang <yangtiezhu@loongson.cn>:
lib/Kconfig.debug: make TEST_LOCKUP depend on module
lib/test_lockup.c: fix return value of test_lockup_init()
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
lib/: replace HTTP links with HTTPS ones
"Kars Mulder" <kerneldev@karsmulder.nl>:
kstrto*: correct documentation references to simple_strto*()
kstrto*: do not describe simple_strto*() as obsolete/replaced
Subsystem: lz4
Nick Terrell <terrelln@fb.com>:
lz4: fix kernel decompression speed
Subsystem: bitops
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
lib/test_bits.c: add tests of GENMASK
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: add test for possible misuse of IS_ENABLED() without CONFIG_
checkpatch: add --fix option for ASSIGN_IN_IF
Quentin Monnet <quentin@isovalent.com>:
checkpatch: fix CONST_STRUCT when const_structs.checkpatch is missing
Joe Perches <joe@perches.com>:
checkpatch: add test for repeated words
checkpatch: remove missing switch/case break test
Subsystem: autofs
Randy Dunlap <rdunlap@infradead.org>:
autofs: fix doubled word
Subsystem: minix
Eric Biggers <ebiggers@google.com>:
Patch series "fs/minix: fix syzbot bugs and set s_maxbytes":
fs/minix: check return value of sb_getblk()
fs/minix: don't allow getting deleted inodes
fs/minix: reject too-large maximum file size
fs/minix: set s_maxbytes correctly
fs/minix: fix block limit check for V1 filesystems
fs/minix: remove expected error message in block_to_path()
Subsystem: nilfs
Eric Biggers <ebiggers@google.com>:
Patch series "nilfs2 updates":
nilfs2: only call unlock_new_inode() if I_NEW
Joe Perches <joe@perches.com>:
nilfs2: convert __nilfs_msg to integrate the level and format
nilfs2: use a more common logging style
Subsystem: ufs
Colin Ian King <colin.king@canonical.com>:
fs/ufs: avoid potential u32 multiplication overflow
Subsystem: fat
Yubo Feng <fengyubo3@huawei.com>:
fatfs: switch write_lock to read_lock in fat_ioctl_get_attributes
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
VFAT/FAT/MSDOS FILESYSTEM: replace HTTP links with HTTPS ones
OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
fat: fix fat_ra_init() for data clusters == 0
Subsystem: signals
Helge Deller <deller@gmx.de>:
fs/signalfd.c: fix inconsistent return codes for signalfd4
Subsystem: kmod
Tiezhu Yang <yangtiezhu@loongson.cn>:
Patch series "kmod/umh: a few fixes":
selftests: kmod: use variable NAME in kmod_test_0001()
kmod: remove redundant "be an" in the comment
test_kmod: avoid potential double free in trigger_config_run_type()
Subsystem: coredump
Lepton Wu <ytht.net@gmail.com>:
coredump: add %f for executable filename
Subsystem: exec
Kees Cook <keescook@chromium.org>:
Patch series "Relocate execve() sanity checks", v2:
exec: change uselib(2) IS_SREG() failure to EACCES
exec: move S_ISREG() check earlier
exec: move path_noexec() check earlier
Subsystem: kdump
Vijay Balakrishna <vijayb@linux.microsoft.com>:
kdump: append kernel build-id string to VMCOREINFO
Subsystem: rapidio
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
drivers/rapidio/devices/rio_mport_cdev.c: use struct_size() helper
drivers/rapidio/rio-scan.c: use struct_size() helper
rapidio/rio_mport_cdev: use array_size() helper in copy_{from,to}_user()
Subsystem: panic
Tiezhu Yang <yangtiezhu@loongson.cn>:
kernel/panic.c: make oops_may_print() return bool
lib/Kconfig.debug: fix typo in the help text of CONFIG_PANIC_TIMEOUT
Yue Hu <huyue2@yulong.com>:
panic: make print_oops_end_marker() static
Subsystem: kcov
Marco Elver <elver@google.com>:
kcov: unconditionally add -fno-stack-protector to compiler options
Wei Yongjun <weiyongjun1@huawei.com>:
kcov: make some symbols static
Subsystem: kgdb
Nick Desaulniers <ndesaulniers@google.com>:
scripts/gdb: fix python 3.8 SyntaxWarning
Subsystem: ipc
Alexey Dobriyan <adobriyan@gmail.com>:
ipc: uninline functions
Liao Pingfang <liao.pingfang@zte.com.cn>:
ipc/shm.c: remove the superfluous break
Subsystem: mm/migration
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
Patch series "clean-up the migration target allocation functions", v5:
mm/page_isolation: prefer the node of the source page
mm/migrate: move migration helper from .h to .c
mm/hugetlb: unify migration callbacks
mm/migrate: clear __GFP_RECLAIM to make the migration callback consistent with regular THP allocations
mm/migrate: introduce a standard migration target allocation function
mm/mempolicy: use a standard migration target allocation callback
mm/page_alloc: remove a wrapper for alloc_migration_target()
Subsystem: mm/gup
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
mm/gup: restrict CMA region by using allocation scope API
mm/hugetlb: make hugetlb migration callback CMA aware
mm/gup: use a standard migration target allocation callback
Subsystem: mm/pagemap
Peter Xu <peterx@redhat.com>:
Patch series "mm: Page fault accounting cleanups", v5:
mm: do page fault accounting in handle_mm_fault
mm/alpha: use general page fault accounting
mm/arc: use general page fault accounting
mm/arm: use general page fault accounting
mm/arm64: use general page fault accounting
mm/csky: use general page fault accounting
mm/hexagon: use general page fault accounting
mm/ia64: use general page fault accounting
mm/m68k: use general page fault accounting
mm/microblaze: use general page fault accounting
mm/mips: use general page fault accounting
mm/nds32: use general page fault accounting
mm/nios2: use general page fault accounting
mm/openrisc: use general page fault accounting
mm/parisc: use general page fault accounting
mm/powerpc: use general page fault accounting
mm/riscv: use general page fault accounting
mm/s390: use general page fault accounting
mm/sh: use general page fault accounting
mm/sparc32: use general page fault accounting
mm/sparc64: use general page fault accounting
mm/x86: use general page fault accounting
mm/xtensa: use general page fault accounting
mm: clean up the last pieces of page fault accountings
mm/gup: remove task_struct pointer for all gup code
Documentation/admin-guide/cgroup-v2.rst | 4
Documentation/admin-guide/sysctl/kernel.rst | 3
Documentation/admin-guide/sysctl/vm.rst | 15 +
Documentation/filesystems/proc.rst | 11 -
Documentation/vm/page_migration.rst | 27 +++
Makefile | 4
arch/alpha/include/asm/io.h | 8
arch/alpha/include/asm/uaccess.h | 2
arch/alpha/mm/fault.c | 10 -
arch/arc/include/asm/segment.h | 3
arch/arc/kernel/process.c | 2
arch/arc/mm/fault.c | 20 --
arch/arm/include/asm/uaccess.h | 4
arch/arm/kernel/signal.c | 2
arch/arm/mm/fault.c | 27 ---
arch/arm64/include/asm/uaccess.h | 2
arch/arm64/kernel/sdei.c | 2
arch/arm64/mm/fault.c | 31 ---
arch/arm64/mm/numa.c | 10 -
arch/csky/include/asm/segment.h | 2
arch/csky/mm/fault.c | 15 -
arch/h8300/include/asm/segment.h | 2
arch/hexagon/mm/vm_fault.c | 11 -
arch/ia64/include/asm/uaccess.h | 2
arch/ia64/mm/fault.c | 11 -
arch/ia64/mm/numa.c | 2
arch/m68k/include/asm/segment.h | 2
arch/m68k/include/asm/tlbflush.h | 6
arch/m68k/mm/fault.c | 16 -
arch/microblaze/include/asm/uaccess.h | 2
arch/microblaze/mm/fault.c | 11 -
arch/mips/include/asm/uaccess.h | 2
arch/mips/kernel/unaligned.c | 27 +--
arch/mips/mm/fault.c | 16 -
arch/nds32/include/asm/uaccess.h | 2
arch/nds32/kernel/process.c | 2
arch/nds32/mm/alignment.c | 7
arch/nds32/mm/fault.c | 21 --
arch/nios2/include/asm/uaccess.h | 2
arch/nios2/mm/fault.c | 16 -
arch/openrisc/include/asm/uaccess.h | 2
arch/openrisc/mm/fault.c | 11 -
arch/parisc/include/asm/uaccess.h | 2
arch/parisc/mm/fault.c | 10 -
arch/powerpc/include/asm/uaccess.h | 3
arch/powerpc/mm/copro_fault.c | 7
arch/powerpc/mm/fault.c | 13 -
arch/riscv/include/asm/uaccess.h | 6
arch/riscv/mm/fault.c | 18 --
arch/s390/include/asm/uaccess.h | 2
arch/s390/kvm/interrupt.c | 2
arch/s390/kvm/kvm-s390.c | 2
arch/s390/kvm/priv.c | 8
arch/s390/mm/fault.c | 18 --
arch/s390/mm/gmap.c | 4
arch/sh/include/asm/segment.h | 3
arch/sh/include/asm/sparsemem.h | 4
arch/sh/kernel/traps_32.c | 12 -
arch/sh/mm/fault.c | 13 -
arch/sh/mm/init.c | 9 -
arch/sparc/include/asm/sparsemem.h | 1
arch/sparc/include/asm/uaccess_32.h | 2
arch/sparc/include/asm/uaccess_64.h | 2
arch/sparc/mm/fault_32.c | 15 -
arch/sparc/mm/fault_64.c | 13 -
arch/um/kernel/trap.c | 6
arch/x86/include/asm/uaccess.h | 2
arch/x86/mm/fault.c | 19 --
arch/x86/mm/init_64.c | 9 +
arch/x86/mm/numa.c | 1
arch/xtensa/include/asm/uaccess.h | 2
arch/xtensa/mm/fault.c | 17 -
drivers/firmware/arm_sdei.c | 5
drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 2
drivers/infiniband/core/umem_odp.c | 2
drivers/iommu/amd/iommu_v2.c | 2
drivers/iommu/intel/svm.c | 3
drivers/rapidio/devices/rio_mport_cdev.c | 7
drivers/rapidio/rio-scan.c | 8
drivers/vfio/vfio_iommu_type1.c | 4
fs/coredump.c | 17 +
fs/exec.c | 38 ++--
fs/fat/Kconfig | 2
fs/fat/fatent.c | 3
fs/fat/file.c | 4
fs/hugetlbfs/inode.c | 6
fs/minix/inode.c | 48 ++++-
fs/minix/itree_common.c | 8
fs/minix/itree_v1.c | 16 -
fs/minix/itree_v2.c | 15 -
fs/minix/minix.h | 1
fs/namei.c | 10 -
fs/nilfs2/alloc.c | 38 ++--
fs/nilfs2/btree.c | 42 ++--
fs/nilfs2/cpfile.c | 10 -
fs/nilfs2/dat.c | 14 -
fs/nilfs2/direct.c | 14 -
fs/nilfs2/gcinode.c | 2
fs/nilfs2/ifile.c | 4
fs/nilfs2/inode.c | 32 +--
fs/nilfs2/ioctl.c | 37 ++--
fs/nilfs2/mdt.c | 2
fs/nilfs2/namei.c | 6
fs/nilfs2/nilfs.h | 18 +-
fs/nilfs2/page.c | 11 -
fs/nilfs2/recovery.c | 32 +--
fs/nilfs2/segbuf.c | 2
fs/nilfs2/segment.c | 38 ++--
fs/nilfs2/sufile.c | 29 +--
fs/nilfs2/super.c | 73 ++++----
fs/nilfs2/sysfs.c | 29 +--
fs/nilfs2/the_nilfs.c | 85 ++++-----
fs/open.c | 6
fs/proc/base.c | 11 +
fs/proc/task_mmu.c | 4
fs/signalfd.c | 10 -
fs/ufs/super.c | 2
include/asm-generic/uaccess.h | 4
include/clocksource/timer-ti-dm.h | 2
include/linux/async_tx.h | 2
include/linux/btree.h | 2
include/linux/compaction.h | 6
include/linux/compiler-clang.h | 2
include/linux/compiler_types.h | 44 ++---
include/linux/crash_core.h | 6
include/linux/delay.h | 2
include/linux/dma/k3-psil.h | 2
include/linux/dma/k3-udma-glue.h | 2
include/linux/dma/ti-cppi5.h | 2
include/linux/exportfs.h | 2
include/linux/frontswap.h | 2
include/linux/fs.h | 10 +
include/linux/generic-radix-tree.h | 2
include/linux/highmem.h | 2
include/linux/huge_mm.h | 7
include/linux/hugetlb.h | 53 ++++--
include/linux/irqchip/irq-omap-intc.h | 2
include/linux/jhash.h | 2
include/linux/kernel.h | 12 -
include/linux/leds-ti-lmu-common.h | 2
include/linux/memcontrol.h | 12 +
include/linux/mempolicy.h | 18 +-
include/linux/migrate.h | 42 +---
include/linux/mm.h | 20 +-
include/linux/mmzone.h | 17 +
include/linux/oom.h | 4
include/linux/pgtable.h | 12 -
include/linux/platform_data/davinci-cpufreq.h | 2
include/linux/platform_data/davinci_asp.h | 2
include/linux/platform_data/elm.h | 2
include/linux/platform_data/gpio-davinci.h | 2
include/linux/platform_data/gpmc-omap.h | 2
include/linux/platform_data/mtd-davinci-aemif.h | 2
include/linux/platform_data/omap-twl4030.h | 2
include/linux/platform_data/uio_pruss.h | 2
include/linux/platform_data/usb-omap.h | 2
include/linux/poison.h | 4
include/linux/sched/mm.h | 8
include/linux/sched/task.h | 1
include/linux/soc/ti/k3-ringacc.h | 2
include/linux/soc/ti/knav_qmss.h | 2
include/linux/soc/ti/ti-msgmgr.h | 2
include/linux/swap.h | 25 ++
include/linux/syscalls.h | 2
include/linux/uaccess.h | 20 ++
include/linux/vm_event_item.h | 3
include/linux/wkup_m3_ipc.h | 2
include/linux/xxhash.h | 2
include/linux/xz.h | 4
include/linux/zlib.h | 2
include/soc/arc/aux.h | 2
include/trace/events/migrate.h | 17 +
include/uapi/linux/auto_dev-ioctl.h | 2
include/uapi/linux/elf.h | 2
include/uapi/linux/map_to_7segment.h | 2
include/uapi/linux/types.h | 2
include/uapi/linux/usb/ch9.h | 2
ipc/sem.c | 3
ipc/shm.c | 4
kernel/Makefile | 2
kernel/crash_core.c | 50 +++++
kernel/events/callchain.c | 5
kernel/events/core.c | 5
kernel/events/uprobes.c | 8
kernel/exit.c | 18 +-
kernel/futex.c | 2
kernel/kcov.c | 6
kernel/kmod.c | 5
kernel/kthread.c | 5
kernel/panic.c | 4
kernel/stacktrace.c | 5
kernel/sysctl.c | 11 +
kernel/umh.c | 29 ---
lib/Kconfig.debug | 27 ++-
lib/Makefile | 1
lib/bitmap.c | 4
lib/crc64.c | 2
lib/decompress_bunzip2.c | 2
lib/decompress_unlzma.c | 6
lib/kstrtox.c | 20 --
lib/lz4/lz4_compress.c | 4
lib/lz4/lz4_decompress.c | 18 +-
lib/lz4/lz4defs.h | 10 +
lib/lz4/lz4hc_compress.c | 2
lib/math/rational.c | 2
lib/rbtree.c | 2
lib/test_bitmap.c | 58 ++++++
lib/test_bitops.c | 18 +-
lib/test_bits.c | 75 ++++++++
lib/test_kmod.c | 2
lib/test_lockup.c | 6
lib/ts_bm.c | 2
lib/xxhash.c | 2
lib/xz/xz_crc32.c | 2
lib/xz/xz_dec_bcj.c | 2
lib/xz/xz_dec_lzma2.c | 2
lib/xz/xz_lzma2.h | 2
lib/xz/xz_stream.h | 2
mm/cma.c | 40 +---
mm/cma.h | 4
mm/compaction.c | 207 +++++++++++++++++++++--
mm/filemap.c | 2
mm/gup.c | 195 ++++++----------------
mm/hmm.c | 5
mm/huge_memory.c | 23 --
mm/hugetlb.c | 93 ++++------
mm/internal.h | 9 -
mm/khugepaged.c | 2
mm/ksm.c | 3
mm/maccess.c | 22 +-
mm/memcontrol.c | 42 +++-
mm/memory-failure.c | 7
mm/memory.c | 107 +++++++++---
mm/memory_hotplug.c | 30 ++-
mm/mempolicy.c | 49 +----
mm/migrate.c | 151 ++++++++++++++---
mm/mmu_notifier.c | 9 -
mm/nommu.c | 4
mm/oom_kill.c | 24 +-
mm/page_alloc.c | 14 +
mm/page_isolation.c | 21 --
mm/percpu-internal.h | 55 ++++++
mm/percpu-km.c | 5
mm/percpu-stats.c | 36 ++--
mm/percpu-vm.c | 5
mm/percpu.c | 208 +++++++++++++++++++++---
mm/process_vm_access.c | 2
mm/rmap.c | 2
mm/shmem.c | 5
mm/slab_common.c | 2
mm/swap.c | 13 -
mm/swap_state.c | 80 +++++++--
mm/swapfile.c | 4
mm/usercopy.c | 2
mm/userfaultfd.c | 2
mm/vmscan.c | 36 ++--
mm/vmstat.c | 32 +++
mm/workingset.c | 23 +-
mm/zpool.c | 8
mm/zsmalloc.c | 2
scripts/checkpatch.pl | 116 +++++++++----
scripts/gdb/linux/rbtree.py | 4
security/tomoyo/domain.c | 2
tools/testing/selftests/cgroup/test_kmem.c | 70 +++++++-
tools/testing/selftests/kmod/kmod.sh | 4
tools/testing/selftests/vm/hmm-tests.c | 35 ++++
virt/kvm/async_pf.c | 2
virt/kvm/kvm_main.c | 2
268 files changed, 2481 insertions(+), 1551 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-08-15 0:29 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-08-15 0:29 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
39 patches, based on b923f1247b72fc100b87792fd2129d026bb10e66.
Subsystems affected by this patch series:
mm/hotfixes
lz4
exec
mailmap
mm/thp
autofs
mm/madvise
sysctl
mm/kmemleak
mm/misc
lib
Subsystem: mm/hotfixes
Mike Rapoport <rppt@linux.ibm.com>:
asm-generic: pgalloc.h: use correct #ifdef to enable pud_alloc_one()
Baoquan He <bhe@redhat.com>:
Revert "mm/vmstat.c: do not show lowmem reserve protection information of empty zone"
Subsystem: lz4
Nick Terrell <terrelln@fb.com>:
lz4: fix kernel decompression speed
Subsystem: exec
Kees Cook <keescook@chromium.org>:
Patch series "Fix S_ISDIR execve() errno":
exec: restore EACCES of S_ISDIR execve()
selftests/exec: add file type errno tests
Subsystem: mailmap
Greg Kurz <groug@kaod.org>:
mailmap: add entry for Greg Kurz
Subsystem: mm/thp
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "THP prep patches":
mm: store compound_nr as well as compound_order
mm: move page-flags include to top of file
mm: add thp_order
mm: add thp_size
mm: replace hpage_nr_pages with thp_nr_pages
mm: add thp_head
mm: introduce offset_in_thp
Subsystem: autofs
Randy Dunlap <rdunlap@infradead.org>:
fs: autofs: delete repeated words in comments
Subsystem: mm/madvise
Minchan Kim <minchan@kernel.org>:
Patch series "introduce memory hinting API for external process", v8:
mm/madvise: pass task and mm to do_madvise
pid: move pidfd_get_pid() to pid.c
mm/madvise: introduce process_madvise() syscall: an external memory hinting API
mm/madvise: check fatal signal pending of target process
Subsystem: sysctl
Xiaoming Ni <nixiaoming@huawei.com>:
all arch: remove system call sys_sysctl
Subsystem: mm/kmemleak
Qian Cai <cai@lca.pw>:
mm/kmemleak: silence KCSAN splats in checksum
Subsystem: mm/misc
Qian Cai <cai@lca.pw>:
mm/frontswap: mark various intentional data races
mm/page_io: mark various intentional data races
mm/swap_state: mark various intentional data races
Kirill A. Shutemov <kirill@shutemov.name>:
mm/filemap.c: fix a data race in filemap_fault()
Qian Cai <cai@lca.pw>:
mm/swapfile: fix and annotate various data races
mm/page_counter: fix various data races at memsw
mm/memcontrol: fix a data race in scan count
mm/list_lru: fix a data race in list_lru_count_one
mm/mempool: fix a data race in mempool_free()
mm/rmap: annotate a data race at tlb_flush_batched
mm/swap.c: annotate data races for lru_rotate_pvecs
mm: annotate a data race in page_zonenum()
Romain Naour <romain.naour@gmail.com>:
include/asm-generic/vmlinux.lds.h: align ro_after_init
Kuninori Morimoto <kuninori.morimoto.gx@renesas.com>:
sh: clkfwk: remove r8/r16/r32
sh: use generic strncpy()
Subsystem: lib
Krzysztof Kozlowski <krzk@kernel.org>:
Patch series "iomap: Constify ioreadX() iomem argument", v3:
iomap: constify ioreadX() iomem argument (as in generic implementation)
rtl818x: constify ioreadX() iomem argument (as in generic implementation)
ntb: intel: constify ioreadX() iomem argument (as in generic implementation)
virtio: pci: constify ioreadX() iomem argument (as in generic implementation)
.mailmap | 1
arch/alpha/include/asm/core_apecs.h | 6
arch/alpha/include/asm/core_cia.h | 6
arch/alpha/include/asm/core_lca.h | 6
arch/alpha/include/asm/core_marvel.h | 4
arch/alpha/include/asm/core_mcpcia.h | 6
arch/alpha/include/asm/core_t2.h | 2
arch/alpha/include/asm/io.h | 12 -
arch/alpha/include/asm/io_trivial.h | 16 -
arch/alpha/include/asm/jensen.h | 2
arch/alpha/include/asm/machvec.h | 6
arch/alpha/kernel/core_marvel.c | 2
arch/alpha/kernel/io.c | 12 -
arch/alpha/kernel/syscalls/syscall.tbl | 3
arch/arm/configs/am200epdkit_defconfig | 1
arch/arm/tools/syscall.tbl | 3
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 6
arch/ia64/kernel/syscalls/syscall.tbl | 3
arch/m68k/kernel/syscalls/syscall.tbl | 3
arch/microblaze/kernel/syscalls/syscall.tbl | 3
arch/mips/configs/cu1000-neo_defconfig | 1
arch/mips/kernel/syscalls/syscall_n32.tbl | 3
arch/mips/kernel/syscalls/syscall_n64.tbl | 3
arch/mips/kernel/syscalls/syscall_o32.tbl | 3
arch/parisc/include/asm/io.h | 4
arch/parisc/kernel/syscalls/syscall.tbl | 3
arch/parisc/lib/iomap.c | 72 +++---
arch/powerpc/kernel/iomap.c | 28 +-
arch/powerpc/kernel/syscalls/syscall.tbl | 3
arch/s390/kernel/syscalls/syscall.tbl | 3
arch/sh/configs/dreamcast_defconfig | 1
arch/sh/configs/espt_defconfig | 1
arch/sh/configs/hp6xx_defconfig | 1
arch/sh/configs/landisk_defconfig | 1
arch/sh/configs/lboxre2_defconfig | 1
arch/sh/configs/microdev_defconfig | 1
arch/sh/configs/migor_defconfig | 1
arch/sh/configs/r7780mp_defconfig | 1
arch/sh/configs/r7785rp_defconfig | 1
arch/sh/configs/rts7751r2d1_defconfig | 1
arch/sh/configs/rts7751r2dplus_defconfig | 1
arch/sh/configs/se7206_defconfig | 1
arch/sh/configs/se7343_defconfig | 1
arch/sh/configs/se7619_defconfig | 1
arch/sh/configs/se7705_defconfig | 1
arch/sh/configs/se7750_defconfig | 1
arch/sh/configs/se7751_defconfig | 1
arch/sh/configs/secureedge5410_defconfig | 1
arch/sh/configs/sh03_defconfig | 1
arch/sh/configs/sh7710voipgw_defconfig | 1
arch/sh/configs/sh7757lcr_defconfig | 1
arch/sh/configs/sh7763rdp_defconfig | 1
arch/sh/configs/shmin_defconfig | 1
arch/sh/configs/titan_defconfig | 1
arch/sh/include/asm/string_32.h | 26 --
arch/sh/kernel/iomap.c | 22 -
arch/sh/kernel/syscalls/syscall.tbl | 3
arch/sparc/kernel/syscalls/syscall.tbl | 3
arch/x86/entry/syscalls/syscall_32.tbl | 3
arch/x86/entry/syscalls/syscall_64.tbl | 4
arch/xtensa/kernel/syscalls/syscall.tbl | 3
drivers/mailbox/bcm-pdc-mailbox.c | 2
drivers/net/wireless/realtek/rtl818x/rtl8180/rtl8180.h | 6
drivers/ntb/hw/intel/ntb_hw_gen1.c | 2
drivers/ntb/hw/intel/ntb_hw_gen3.h | 2
drivers/ntb/hw/intel/ntb_hw_intel.h | 2
drivers/nvdimm/btt.c | 4
drivers/nvdimm/pmem.c | 6
drivers/sh/clk/cpg.c | 25 --
drivers/virtio/virtio_pci_modern.c | 6
fs/autofs/dev-ioctl.c | 4
fs/io_uring.c | 2
fs/namei.c | 4
include/asm-generic/iomap.h | 28 +-
include/asm-generic/pgalloc.h | 2
include/asm-generic/vmlinux.lds.h | 1
include/linux/compat.h | 5
include/linux/huge_mm.h | 58 ++++-
include/linux/io-64-nonatomic-hi-lo.h | 4
include/linux/io-64-nonatomic-lo-hi.h | 4
include/linux/memcontrol.h | 2
include/linux/mm.h | 16 -
include/linux/mm_inline.h | 6
include/linux/mm_types.h | 1
include/linux/pagemap.h | 6
include/linux/pid.h | 1
include/linux/syscalls.h | 4
include/linux/sysctl.h | 6
include/uapi/asm-generic/unistd.h | 4
kernel/Makefile | 2
kernel/exit.c | 17 -
kernel/pid.c | 17 +
kernel/sys_ni.c | 3
kernel/sysctl_binary.c | 171 --------------
lib/iomap.c | 30 +-
lib/lz4/lz4_compress.c | 4
lib/lz4/lz4_decompress.c | 18 -
lib/lz4/lz4defs.h | 10
lib/lz4/lz4hc_compress.c | 2
mm/compaction.c | 2
mm/filemap.c | 22 +
mm/frontswap.c | 8
mm/gup.c | 2
mm/internal.h | 4
mm/kmemleak.c | 2
mm/list_lru.c | 2
mm/madvise.c | 190 ++++++++++++++--
mm/memcontrol.c | 10
mm/memory.c | 4
mm/memory_hotplug.c | 7
mm/mempolicy.c | 2
mm/mempool.c | 2
mm/migrate.c | 18 -
mm/mlock.c | 9
mm/page_alloc.c | 5
mm/page_counter.c | 13 -
mm/page_io.c | 12 -
mm/page_vma_mapped.c | 6
mm/rmap.c | 10
mm/swap.c | 21 -
mm/swap_state.c | 10
mm/swapfile.c | 33 +-
mm/vmscan.c | 6
mm/vmstat.c | 12 -
mm/workingset.c | 6
tools/perf/arch/powerpc/entry/syscalls/syscall.tbl | 2
tools/perf/arch/s390/entry/syscalls/syscall.tbl | 2
tools/perf/arch/x86/entry/syscalls/syscall_64.tbl | 2
tools/testing/selftests/exec/.gitignore | 1
tools/testing/selftests/exec/Makefile | 5
tools/testing/selftests/exec/non-regular.c | 196 +++++++++++++++++
132 files changed, 815 insertions(+), 614 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-08-21 0:41 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-08-21 0:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
11 patches, based on 7eac66d0456fe12a462e5c14c68e97c7460989da.
Subsystems affected by this patch series:
misc
mm/hugetlb
mm/vmalloc
mm/misc
romfs
relay
uprobes
squashfs
mm/cma
mm/pagealloc
Subsystem: misc
Nick Desaulniers <ndesaulniers@google.com>:
mailmap: add Andi Kleen
Subsystem: mm/hugetlb
Xu Wang <vulab@iscas.ac.cn>:
hugetlb_cgroup: convert comma to semicolon
Hugh Dickins <hughd@google.com>:
khugepaged: adjust VM_BUG_ON_MM() in __khugepaged_enter()
Subsystem: mm/vmalloc
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/vunmap: add cond_resched() in vunmap_pmd_range
Subsystem: mm/misc
Leon Romanovsky <leonro@nvidia.com>:
mm/rodata_test.c: fix missing function declaration
Subsystem: romfs
Jann Horn <jannh@google.com>:
romfs: fix uninitialized memory leak in romfs_dev_read()
Subsystem: relay
Wei Yongjun <weiyongjun1@huawei.com>:
kernel/relay.c: fix memleak on destroy relay channel
Subsystem: uprobes
Hugh Dickins <hughd@google.com>:
uprobes: __replace_page() avoid BUG in munlock_vma_page()
Subsystem: squashfs
Phillip Lougher <phillip@squashfs.org.uk>:
squashfs: avoid bio_alloc() failure with 1Mbyte blocks
Subsystem: mm/cma
Doug Berger <opendmb@gmail.com>:
mm: include CMA pages in lowmem_reserve at boot
Subsystem: mm/pagealloc
Charan Teja Reddy <charante@codeaurora.org>:
mm, page_alloc: fix core hung in free_pcppages_bulk()
.mailmap | 1 +
fs/romfs/storage.c | 4 +---
fs/squashfs/block.c | 6 +++++-
kernel/events/uprobes.c | 2 +-
kernel/relay.c | 1 +
mm/hugetlb_cgroup.c | 4 ++--
mm/khugepaged.c | 2 +-
mm/page_alloc.c | 7 ++++++-
mm/rodata_test.c | 1 +
mm/vmalloc.c | 2 ++
10 files changed, 21 insertions(+), 9 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-09-04 23:34 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-09-04 23:34 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
19 patches, based on 59126901f200f5fc907153468b03c64e0081b6e6.
Subsystems affected by this patch series:
mm/memcg
mm/slub
MAINTAINERS
mm/pagemap
ipc
fork
checkpatch
mm/madvise
mm/migration
mm/hugetlb
lib
Subsystem: mm/memcg
Michal Hocko <mhocko@suse.com>:
memcg: fix use-after-free in uncharge_batch
Xunlei Pang <xlpang@linux.alibaba.com>:
mm: memcg: fix memcg reclaim soft lockup
Subsystem: mm/slub
Eugeniu Rosca <erosca@de.adit-jv.com>:
mm: slub: fix conversion of freelist_corrupted()
Subsystem: MAINTAINERS
Robert Richter <rric@kernel.org>:
MAINTAINERS: update Cavium/Marvell entries
Nick Desaulniers <ndesaulniers@google.com>:
MAINTAINERS: add LLVM maintainers
Randy Dunlap <rdunlap@infradead.org>:
MAINTAINERS: IA64: mark Status as Odd Fixes only
Subsystem: mm/pagemap
Joerg Roedel <jroedel@suse.de>:
mm: track page table modifications in __apply_to_page_range()
Subsystem: ipc
Tobias Klauser <tklauser@distanz.ch>:
ipc: adjust proc_ipc_sem_dointvec definition to match prototype
Subsystem: fork
Tobias Klauser <tklauser@distanz.ch>:
fork: adjust sysctl_max_threads definition to match prototype
Subsystem: checkpatch
Mrinal Pandey <mrinalmni@gmail.com>:
checkpatch: fix the usage of capture group ( ... )
Subsystem: mm/madvise
Yang Shi <shy828301@gmail.com>:
mm: madvise: fix vma user-after-free
Subsystem: mm/migration
Alistair Popple <alistair@popple.id.au>:
mm/migrate: fixup setting UFFD_WP flag
mm/rmap: fixup copying of soft dirty and uffd ptes
Ralph Campbell <rcampbell@nvidia.com>:
Patch series "mm/migrate: preserve soft dirty in remove_migration_pte()":
mm/migrate: remove unnecessary is_zone_device_page() check
mm/migrate: preserve soft dirty in remove_migration_pte()
Subsystem: mm/hugetlb
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/hugetlb: try preferred node first when alloc gigantic page from cma
Muchun Song <songmuchun@bytedance.com>:
mm/hugetlb: fix a race between hugetlb sysctl handlers
David Howells <dhowells@redhat.com>:
mm/khugepaged.c: fix khugepaged's request size in collapse_file
Subsystem: lib
Jason Gunthorpe <jgg@nvidia.com>:
include/linux/log2.h: add missing () around n in roundup_pow_of_two()
MAINTAINERS | 32 ++++++++++++++++----------------
include/linux/log2.h | 2 +-
ipc/ipc_sysctl.c | 2 +-
kernel/fork.c | 2 +-
mm/hugetlb.c | 49 +++++++++++++++++++++++++++++++++++++------------
mm/khugepaged.c | 2 +-
mm/madvise.c | 2 +-
mm/memcontrol.c | 6 ++++++
mm/memory.c | 37 ++++++++++++++++++++++++-------------
mm/migrate.c | 31 +++++++++++++++++++------------
mm/rmap.c | 9 +++++++--
mm/slub.c | 12 ++++++------
mm/vmscan.c | 8 ++++++++
scripts/checkpatch.pl | 4 ++--
14 files changed, 130 insertions(+), 68 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-09-19 4:19 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-09-19 4:19 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
15 patches, based on 92ab97adeefccf375de7ebaad9d5b75d4125fe8b.
Subsystems affected by this patch series:
mailmap
mm/hotfixes
mm/thp
mm/memory-hotplug
misc
kcsan
Subsystem: mailmap
Kees Cook <keescook@chromium.org>:
mailmap: add older email addresses for Kees Cook
Subsystem: mm/hotfixes
Hugh Dickins <hughd@google.com>:
Patch series "mm: fixes to past from future testing":
ksm: reinstate memcg charge on copied pages
mm: migration of hugetlbfs page skip memcg
shmem: shmem_writepage() split unlikely i915 THP
mm: fix check_move_unevictable_pages() on THP
mlock: fix unevictable_pgs event counts on THP
Byron Stanoszek <gandalf@winds.org>:
tmpfs: restore functionality of nr_inodes=0
Muchun Song <songmuchun@bytedance.com>:
kprobes: fix kill kprobe which has been marked as gone
Subsystem: mm/thp
Ralph Campbell <rcampbell@nvidia.com>:
mm/thp: fix __split_huge_pmd_locked() for migration PMD
Christophe Leroy <christophe.leroy@csgroup.eu>:
selftests/vm: fix display of page size in map_hugetlb
Subsystem: mm/memory-hotplug
Pavel Tatashin <pasha.tatashin@soleen.com>:
mm/memory_hotplug: drain per-cpu pages again during memory offline
Subsystem: misc
Tobias Klauser <tklauser@distanz.ch>:
ftrace: let ftrace_enable_sysctl take a kernel pointer buffer
stackleak: let stack_erasing_sysctl take a kernel pointer buffer
fs/fs-writeback.c: adjust dirtytime_interval_handler definition to match prototype
Subsystem: kcsan
Changbin Du <changbin.du@gmail.com>:
kcsan: kconfig: move to menu 'Generic Kernel Debugging Instruments'
.mailmap | 4 ++
fs/fs-writeback.c | 2 -
include/linux/ftrace.h | 3 --
include/linux/stackleak.h | 2 -
kernel/kprobes.c | 9 +++++-
kernel/stackleak.c | 2 -
kernel/trace/ftrace.c | 3 --
lib/Kconfig.debug | 4 --
mm/huge_memory.c | 42 ++++++++++++++++---------------
mm/ksm.c | 4 ++
mm/memory_hotplug.c | 14 ++++++++++
mm/migrate.c | 3 +-
mm/mlock.c | 24 +++++++++++------
mm/page_isolation.c | 8 +++++
mm/shmem.c | 20 +++++++++++---
mm/swap.c | 6 ++--
mm/vmscan.c | 10 +++++--
tools/testing/selftests/vm/map_hugetlb.c | 2 -
18 files changed, 111 insertions(+), 51 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-09-26 4:17 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-09-26 4:17 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
9 patches, based on 7c7ec3226f5f33f9c050d85ec20f18419c622ad6.
Subsystems affected by this patch series:
mm/thp
mm/memcg
mm/gup
mm/migration
lib
x86
mm/memory-hotplug
Subsystem: mm/thp
Gao Xiang <hsiangkao@redhat.com>:
mm, THP, swap: fix allocating cluster for swapfile by mistake
Subsystem: mm/memcg
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: fix missing suffix of workingset_restore
Subsystem: mm/gup
Vasily Gorbik <gor@linux.ibm.com>:
mm/gup: fix gup_fast with dynamic page table folding
Subsystem: mm/migration
Zi Yan <ziy@nvidia.com>:
mm/migrate: correct thp migration stats
Subsystem: lib
Nick Desaulniers <ndesaulniers@google.com>:
lib/string.c: implement stpcpy
Jason Yan <yanaijie@huawei.com>:
lib/memregion.c: include memregion.h
Subsystem: x86
Mikulas Patocka <mpatocka@redhat.com>:
arch/x86/lib/usercopy_64.c: fix __copy_user_flushcache() cache writeback
Subsystem: mm/memory-hotplug
Laurent Dufour <ldufour@linux.ibm.com>:
Patch series "mm: fix memory to node bad links in sysfs", v3:
mm: replace memmap_context by meminit_context
mm: don't rely on system state to detect hot-plug operations
Documentation/admin-guide/cgroup-v2.rst | 25 ++++++---
arch/ia64/mm/init.c | 6 +-
arch/s390/include/asm/pgtable.h | 42 +++++++++++----
arch/x86/lib/usercopy_64.c | 2
drivers/base/node.c | 85 ++++++++++++++++++++------------
include/linux/mm.h | 2
include/linux/mmzone.h | 11 +++-
include/linux/node.h | 11 ++--
include/linux/pgtable.h | 10 +++
lib/memregion.c | 1
lib/string.c | 24 +++++++++
mm/gup.c | 18 +++---
mm/memcontrol.c | 4 -
mm/memory_hotplug.c | 5 +
mm/migrate.c | 7 +-
mm/page_alloc.c | 10 +--
mm/swapfile.c | 2
17 files changed, 181 insertions(+), 84 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-10-03 5:20 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-10-03 5:20 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
3 patches, based on d3d45f8220d60a0b2aaaacf8fb2be4e6ffd9008e.
Subsystems affected by this patch series:
mm/slub
mm/cma
scripts
Subsystem: mm/slub
Eric Farman <farman@linux.ibm.com>:
mm, slub: restore initial kmem_cache flags
Subsystem: mm/cma
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
mm/page_alloc: handle a missing case for memalloc_nocma_{save/restore} APIs
Subsystem: scripts
Eric Biggers <ebiggers@google.com>:
scripts/spelling.txt: fix malformed entry
mm/page_alloc.c | 19 ++++++++++++++++---
mm/slub.c | 6 +-----
scripts/spelling.txt | 2 +-
3 files changed, 18 insertions(+), 9 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-10-11 6:15 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-10-11 6:15 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
5 patches, based on da690031a5d6d50a361e3f19f3eeabd086a6f20d.
Subsystems affected by this patch series:
MAINTAINERS
mm/pagemap
mm/swap
mm/hugetlb
Subsystem: MAINTAINERS
Kees Cook <keescook@chromium.org>:
MAINTAINERS: change hardening mailing list
Antoine Tenart <atenart@kernel.org>:
MAINTAINERS: Antoine Tenart's email address
Subsystem: mm/pagemap
Miaohe Lin <linmiaohe@huawei.com>:
mm: mmap: Fix general protection fault in unlink_file_vma()
Subsystem: mm/swap
Minchan Kim <minchan@kernel.org>:
mm: validate inode in mapping_set_error()
Subsystem: mm/hugetlb
Vijay Balakrishna <vijayb@linux.microsoft.com>:
mm: khugepaged: recalculate min_free_kbytes after memory hotplug as expected by khugepaged
.mailmap | 4 +++-
MAINTAINERS | 8 ++++----
include/linux/khugepaged.h | 5 +++++
include/linux/pagemap.h | 3 ++-
mm/khugepaged.c | 13 +++++++++++--
mm/mmap.c | 6 +++++-
mm/page_alloc.c | 3 +++
7 files changed, 33 insertions(+), 9 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-10-13 23:46 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-10-13 23:46 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
181 patches, based on 029f56db6ac248769f2c260bfaf3c3c0e23e904c.
Subsystems affected by this patch series:
kbuild
scripts
ntfs
ocfs2
vfs
mm/slab
mm/slub
mm/kmemleak
mm/dax
mm/debug
mm/pagecache
mm/fadvise
mm/gup
mm/swap
mm/memremap
mm/memcg
mm/selftests
mm/pagemap
mm/mincore
mm/hmm
mm/dma
mm/memory-failure
mm/vmalloc
mm/documentation
mm/kasan
mm/pagealloc
mm/hugetlb
mm/vmscan
mm/z3fold
mm/zbud
mm/compaction
mm/mempolicy
mm/mempool
mm/memblock
mm/oom-kill
mm/migration
Subsystem: kbuild
Nick Desaulniers <ndesaulniers@google.com>:
Patch series "set clang minimum version to 10.0.1", v3:
compiler-clang: add build check for clang 10.0.1
Revert "kbuild: disable clang's default use of -fmerge-all-constants"
Revert "arm64: bti: Require clang >= 10.0.1 for in-kernel BTI support"
Revert "arm64: vdso: Fix compilation with clang older than 8"
Partially revert "ARM: 8905/1: Emit __gnu_mcount_nc when using Clang 10.0.0 or newer"
Marco Elver <elver@google.com>:
kasan: remove mentions of unsupported Clang versions
Nick Desaulniers <ndesaulniers@google.com>:
compiler-gcc: improve version error
compiler.h: avoid escaped section names
export.h: fix section name for CONFIG_TRIM_UNUSED_KSYMS for Clang
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
kbuild: doc: describe proper script invocation
Subsystem: scripts
Wang Qing <wangqing@vivo.com>:
scripts/spelling.txt: increase error-prone spell checking
Naoki Hayama <naoki.hayama@lineo.co.jp>:
scripts/spelling.txt: add "arbitrary" typo
Borislav Petkov <bp@suse.de>:
scripts/decodecode: add the capability to supply the program counter
Subsystem: ntfs
Rustam Kovhaev <rkovhaev@gmail.com>:
ntfs: add check for mft record size in superblock
Subsystem: ocfs2
Randy Dunlap <rdunlap@infradead.org>:
ocfs2: delete repeated words in comments
Gang He <ghe@suse.com>:
ocfs2: fix potential soft lockup during fstrim
Subsystem: vfs
Randy Dunlap <rdunlap@infradead.org>:
fs/xattr.c: fix kernel-doc warnings for setxattr & removexattr
Luo Jiaxing <luojiaxing@huawei.com>:
fs_parse: mark fs_param_bad_value() as static
Subsystem: mm/slab
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/slab.c: clean code by removing redundant if condition
tangjianqiang <wyqt1985@gmail.com>:
include/linux/slab.h: fix a typo error in comment
Subsystem: mm/slub
Abel Wu <wuyun.wu@huawei.com>:
mm/slub.c: branch optimization in free slowpath
mm/slub: fix missing ALLOC_SLOWPATH stat when bulk alloc
mm/slub: make add_full() condition more explicit
Subsystem: mm/kmemleak
Davidlohr Bueso <dave@stgolabs.net>:
mm/kmemleak: rely on rcu for task stack scanning
Hui Su <sh_def@163.com>:
mm,kmemleak-test.c: move kmemleak-test.c to samples dir
Subsystem: mm/dax
Dan Williams <dan.j.williams@intel.com>:
Patch series "device-dax: Support sub-dividing soft-reserved ranges", v5:
x86/numa: cleanup configuration dependent command-line options
x86/numa: add 'nohmat' option
efi/fake_mem: arrange for a resource entry per efi_fake_mem instance
ACPI: HMAT: refactor hmat_register_target_device to hmem_register_device
resource: report parent to walk_iomem_res_desc() callback
mm/memory_hotplug: introduce default phys_to_target_node() implementation
ACPI: HMAT: attach a device for each soft-reserved range
device-dax: drop the dax_region.pfn_flags attribute
device-dax: move instance creation parameters to 'struct dev_dax_data'
device-dax: make pgmap optional for instance creation
device-dax/kmem: introduce dax_kmem_range()
device-dax/kmem: move resource name tracking to drvdata
device-dax/kmem: replace release_resource() with release_mem_region()
device-dax: add an allocation interface for device-dax instances
device-dax: introduce 'struct dev_dax' typed-driver operations
device-dax: introduce 'seed' devices
drivers/base: make device_find_child_by_name() compatible with sysfs inputs
device-dax: add resize support
mm/memremap_pages: convert to 'struct range'
mm/memremap_pages: support multiple ranges per invocation
device-dax: add dis-contiguous resource support
device-dax: introduce 'mapping' devices
Joao Martins <joao.m.martins@oracle.com>:
device-dax: make align a per-device property
Dan Williams <dan.j.williams@intel.com>:
device-dax: add an 'align' attribute
Joao Martins <joao.m.martins@oracle.com>:
dax/hmem: introduce dax_hmem.region_idle parameter
device-dax: add a range mapping allocation attribute
Subsystem: mm/debug
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/debug.c: do not dereference i_ino blindly
John Hubbard <jhubbard@nvidia.com>:
mm, dump_page: rename head_mapcount() --> head_compound_mapcount()
Subsystem: mm/pagecache
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Return head pages from find_*_entry", v2:
mm: factor find_get_incore_page out of mincore_page
mm: use find_get_incore_page in memcontrol
mm: optimise madvise WILLNEED
proc: optimise smaps for shmem entries
i915: use find_lock_page instead of find_lock_entry
mm: convert find_get_entry to return the head page
mm/shmem: return head page from find_lock_entry
mm: add find_lock_head
mm/filemap: fix filemap_map_pages for THP
Subsystem: mm/fadvise
Yafang Shao <laoar.shao@gmail.com>:
mm, fadvise: improve the expensive remote LRU cache draining after FADV_DONTNEED
Subsystem: mm/gup
Barry Song <song.bao.hua@hisilicon.com>:
mm/gup_benchmark: update the documentation in Kconfig
mm/gup_benchmark: use pin_user_pages for FOLL_LONGTERM flag
mm/gup: don't permit users to call get_user_pages with FOLL_LONGTERM
John Hubbard <jhubbard@nvidia.com>:
mm/gup: protect unpin_user_pages() against npages==-ERRNO
Subsystem: mm/swap
Gao Xiang <hsiangkao@redhat.com>:
swap: rename SWP_FS to SWAP_FS_OPS to avoid ambiguity
Yu Zhao <yuzhao@google.com>:
mm: remove activate_page() from unuse_pte()
mm: remove superfluous __ClearPageActive()
Miaohe Lin <linmiaohe@huawei.com>:
mm/swap.c: fix confusing comment in release_pages()
mm/swap_slots.c: remove always zero and unused return value of enable_swap_slots_cache()
mm/page_io.c: remove useless out label in __swap_writepage()
mm/swap.c: fix incomplete comment in lru_cache_add_inactive_or_unevictable()
mm/swapfile.c: remove unnecessary goto out in _swap_info_get()
mm/swapfile.c: fix potential memory leak in sys_swapon
Subsystem: mm/memremap
Ira Weiny <ira.weiny@intel.com>:
mm/memremap.c: convert devmap static branch to {inc,dec}
Subsystem: mm/memcg
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
mm: memcontrol: use flex_array_size() helper in memcpy()
mm: memcontrol: use the preferred form for passing the size of a structure type
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: fix racy access to page->mem_cgroup in mem_cgroup_from_obj()
Miaohe Lin <linmiaohe@huawei.com>:
mm: memcontrol: correct the comment of mem_cgroup_iter()
Waiman Long <longman@redhat.com>:
Patch series "mm/memcg: Miscellaneous cleanups and streamlining", v2:
mm/memcg: clean up obsolete enum charge_type
mm/memcg: simplify mem_cgroup_get_max()
mm/memcg: unify swap and memsw page counters
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: add the missing numa_stat interface for cgroup v2
Miaohe Lin <linmiaohe@huawei.com>:
mm/page_counter: correct the obsolete func name in the comment of page_counter_try_charge()
mm: memcontrol: reword obsolete comment of mem_cgroup_unmark_under_oom()
Bharata B Rao <bharata@linux.ibm.com>:
mm: memcg/slab: uncharge during kmem_cache_free_bulk()
Ralph Campbell <rcampbell@nvidia.com>:
mm/memcg: fix device private memcg accounting
Subsystem: mm/selftests
John Hubbard <jhubbard@nvidia.com>:
Patch series "selftests/vm: fix some minor aggravating factors in the Makefile":
selftests/vm: fix false build success on the second and later attempts
selftests/vm: fix incorrect gcc invocation in some cases
Subsystem: mm/pagemap
Matthew Wilcox <willy@infradead.org>:
mm: account PMD tables like PTE tables
Yanfei Xu <yanfei.xu@windriver.com>:
mm/memory.c: fix typo in __do_fault() comment
mm/memory.c: replace vmf->vma with variable vma
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/mmap: rename __vma_unlink_common() to __vma_unlink()
mm/mmap: leverage vma_rb_erase_ignore() to implement vma_rb_erase()
Chinwen Chang <chinwen.chang@mediatek.com>:
Patch series "Try to release mmap_lock temporarily in smaps_rollup", v4:
mmap locking API: add mmap_lock_is_contended()
mm: smaps*: extend smap_gather_stats to support specified beginning
mm: proc: smaps_rollup: do not stall write attempts on mmap_lock
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Fix PageDoubleMap":
mm: move PageDoubleMap bit
mm: simplify PageDoubleMap with PF_SECOND policy
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/mmap: leave adjust_next as virtual address instead of page frame number
Randy Dunlap <rdunlap@infradead.org>:
mm/memory.c: fix spello of "function"
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/mmap: not necessary to check mapping separately
mm/mmap: check on file instead of the rb_root_cached of its address_space
Miaohe Lin <linmiaohe@huawei.com>:
mm: use helper function mapping_allow_writable()
mm/mmap.c: use helper function allow_write_access() in __remove_shared_vm_struct()
Liao Pingfang <liao.pingfang@zte.com.cn>:
mm/mmap.c: replace do_brk with do_brk_flags in comment of insert_vm_struct()
Peter Xu <peterx@redhat.com>:
mm: remove src/dst mm parameter in copy_page_range()
Subsystem: mm/mincore
yuleixzhang <yulei.kernel@gmail.com>:
include/linux/huge_mm.h: remove mincore_huge_pmd declaration
Subsystem: mm/hmm
Ralph Campbell <rcampbell@nvidia.com>:
tools/testing/selftests/vm/hmm-tests.c: use the new SKIP() macro
lib/test_hmm.c: remove unused dmirror_zero_page
Subsystem: mm/dma
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
mm/dmapool.c: replace open-coded list_for_each_entry_safe()
mm/dmapool.c: replace hard coded function name with __func__
Subsystem: mm/memory-failure
Xianting Tian <tian.xianting@h3c.com>:
mm/memory-failure: do pgoff calculation before for_each_process()
Alex Shi <alex.shi@linux.alibaba.com>:
mm/memory-failure.c: remove unused macro `writeback'
Subsystem: mm/vmalloc
Hui Su <sh_def@163.com>:
mm/vmalloc.c: update the comment in __vmalloc_area_node()
mm/vmalloc.c: fix the comment of find_vm_area
Subsystem: mm/documentation
Alexander Gordeev <agordeev@linux.ibm.com>:
docs/vm: fix 'mm_count' vs 'mm_users' counter confusion
Subsystem: mm/kasan
Patricia Alfonso <trishalfonso@google.com>:
Patch series "KASAN-KUnit Integration", v14:
kasan/kunit: add KUnit Struct to Current Task
KUnit: KASAN Integration
KASAN: port KASAN Tests to KUnit
KASAN: Testing Documentation
David Gow <davidgow@google.com>:
mm: kasan: do not panic if both panic_on_warn and kasan_multishot set
Subsystem: mm/pagealloc
David Hildenbrand <david@redhat.com>:
Patch series "mm / virtio-mem: support ZONE_MOVABLE", v5:
mm/page_alloc: tweak comments in has_unmovable_pages()
mm/page_isolation: exit early when pageblock is isolated in set_migratetype_isolate()
mm/page_isolation: drop WARN_ON_ONCE() in set_migratetype_isolate()
mm/page_isolation: cleanup set_migratetype_isolate()
virtio-mem: don't special-case ZONE_MOVABLE
mm: document semantics of ZONE_MOVABLE
Li Xinhai <lixinhai.lxh@gmail.com>:
mm, isolation: avoid checking unmovable pages across pageblock boundary
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/page_alloc.c: clean code by removing unnecessary initialization
mm/page_alloc.c: micro-optimization remove unnecessary branch
mm/page_alloc.c: fix early params garbage value accesses
mm/page_alloc.c: clean code by merging two functions
Yanfei Xu <yanfei.xu@windriver.com>:
mm/page_alloc.c: __perform_reclaim should return 'unsigned long'
Mateusz Nosek <mateusznosek0@gmail.com>:
mmzone: clean code by removing unused macro parameter
Ralph Campbell <rcampbell@nvidia.com>:
mm: move call to compound_head() in release_pages()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/page_alloc.c: fix freeing non-compound pages
Michal Hocko <mhocko@suse.com>:
include/linux/gfp.h: clarify usage of GFP_ATOMIC in !preemptible contexts
Subsystem: mm/hugetlb
Baoquan He <bhe@redhat.com>:
Patch series "mm/hugetlb: Small cleanup and improvement", v2:
mm/hugetlb.c: make is_hugetlb_entry_hwpoisoned return bool
mm/hugetlb.c: remove the unnecessary non_swap_entry()
doc/vm: fix typo in the hugetlb admin documentation
Wei Yang <richard.weiyang@linux.alibaba.com>:
Patch series "mm/hugetlb: code refine and simplification", v4:
mm/hugetlb: not necessary to coalesce regions recursively
mm/hugetlb: remove VM_BUG_ON(!nrg) in get_file_region_entry_from_cache()
mm/hugetlb: use list_splice to merge two list at once
mm/hugetlb: count file_region to be added when regions_needed != NULL
mm/hugetlb: a page from buddy is not on any list
mm/hugetlb: narrow the hugetlb_lock protection area during preparing huge page
mm/hugetlb: take the free hpage during the iteration directly
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: add lockdep check for i_mmap_rwsem held in huge_pmd_share
Subsystem: mm/vmscan
Chunxin Zang <zangchunxin@bytedance.com>:
mm/vmscan: fix infinite loop in drop_slab_node
Hui Su <sh_def@163.com>:
mm/vmscan: fix comments for isolate_lru_page()
Subsystem: mm/z3fold
Hui Su <sh_def@163.com>:
mm/z3fold.c: use xx_zalloc instead xx_alloc and memset
Subsystem: mm/zbud
Xiang Chen <chenxiang66@hisilicon.com>:
mm/zbud: remove redundant initialization
Subsystem: mm/compaction
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/compaction.c: micro-optimization remove unnecessary branch
include/linux/compaction.h: clean code by removing unused enum value
John Hubbard <jhubbard@nvidia.com>:
selftests/vm: 8x compaction_test speedup
Subsystem: mm/mempolicy
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/mempolicy: remove or narrow the lock on current
mm: remove unused alloc_page_vma_node()
Subsystem: mm/mempool
Miaohe Lin <linmiaohe@huawei.com>:
mm/mempool: add 'else' to split mutually exclusive case
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "memblock: seasonal cleaning^w cleanup", v3:
KVM: PPC: Book3S HV: simplify kvm_cma_reserve()
dma-contiguous: simplify cma_early_percent_memory()
arm, xtensa: simplify initialization of high memory pages
arm64: numa: simplify dummy_numa_init()
h8300, nds32, openrisc: simplify detection of memory extents
riscv: drop unneeded node initialization
mircoblaze: drop unneeded NUMA and sparsemem initializations
memblock: make for_each_memblock_type() iterator private
memblock: make memblock_debug and related functionality private
memblock: reduce number of parameters in for_each_mem_range()
arch, mm: replace for_each_memblock() with for_each_mem_pfn_range()
arch, drivers: replace for_each_membock() with for_each_mem_range()
x86/setup: simplify initrd relocation and reservation
x86/setup: simplify reserve_crashkernel()
memblock: remove unused memblock_mem_size()
memblock: implement for_each_reserved_mem_region() using __next_mem_region()
memblock: use separate iterators for memory and reserved regions
Subsystem: mm/oom-kill
Suren Baghdasaryan <surenb@google.com>:
mm, oom_adj: don't loop through tasks in __set_oom_adj when not necessary
Subsystem: mm/migration
Ralph Campbell <rcampbell@nvidia.com>:
mm/migrate: remove cpages-- in migrate_vma_finalize()
mm/migrate: remove obsolete comment about device public
.clang-format | 7
Documentation/admin-guide/cgroup-v2.rst | 69 +
Documentation/admin-guide/mm/hugetlbpage.rst | 2
Documentation/dev-tools/kasan.rst | 74 +
Documentation/dev-tools/kmemleak.rst | 2
Documentation/kbuild/makefiles.rst | 20
Documentation/vm/active_mm.rst | 2
Documentation/x86/x86_64/boot-options.rst | 4
MAINTAINERS | 2
Makefile | 9
arch/arm/Kconfig | 2
arch/arm/include/asm/tlb.h | 1
arch/arm/kernel/setup.c | 18
arch/arm/mm/init.c | 59 -
arch/arm/mm/mmu.c | 39
arch/arm/mm/pmsa-v7.c | 23
arch/arm/mm/pmsa-v8.c | 17
arch/arm/xen/mm.c | 7
arch/arm64/Kconfig | 2
arch/arm64/kernel/machine_kexec_file.c | 6
arch/arm64/kernel/setup.c | 4
arch/arm64/kernel/vdso/Makefile | 7
arch/arm64/mm/init.c | 11
arch/arm64/mm/kasan_init.c | 10
arch/arm64/mm/mmu.c | 11
arch/arm64/mm/numa.c | 15
arch/c6x/kernel/setup.c | 9
arch/h8300/kernel/setup.c | 8
arch/microblaze/mm/init.c | 23
arch/mips/cavium-octeon/dma-octeon.c | 14
arch/mips/kernel/setup.c | 31
arch/mips/netlogic/xlp/setup.c | 2
arch/nds32/kernel/setup.c | 8
arch/openrisc/kernel/setup.c | 9
arch/openrisc/mm/init.c | 8
arch/powerpc/kernel/fadump.c | 61 -
arch/powerpc/kexec/file_load_64.c | 16
arch/powerpc/kvm/book3s_hv_builtin.c | 12
arch/powerpc/kvm/book3s_hv_uvmem.c | 14
arch/powerpc/mm/book3s64/hash_utils.c | 16
arch/powerpc/mm/book3s64/radix_pgtable.c | 10
arch/powerpc/mm/kasan/kasan_init_32.c | 8
arch/powerpc/mm/mem.c | 31
arch/powerpc/mm/numa.c | 7
arch/powerpc/mm/pgtable_32.c | 8
arch/riscv/mm/init.c | 36
arch/riscv/mm/kasan_init.c | 10
arch/s390/kernel/setup.c | 27
arch/s390/mm/page-states.c | 6
arch/s390/mm/vmem.c | 7
arch/sh/mm/init.c | 9
arch/sparc/mm/init_64.c | 12
arch/x86/include/asm/numa.h | 8
arch/x86/kernel/e820.c | 16
arch/x86/kernel/setup.c | 56 -
arch/x86/mm/numa.c | 13
arch/x86/mm/numa_emulation.c | 3
arch/x86/xen/enlighten_pv.c | 2
arch/xtensa/mm/init.c | 55 -
drivers/acpi/numa/hmat.c | 76 -
drivers/acpi/numa/srat.c | 9
drivers/base/core.c | 2
drivers/bus/mvebu-mbus.c | 12
drivers/dax/Kconfig | 6
drivers/dax/Makefile | 3
drivers/dax/bus.c | 1237 +++++++++++++++++++++++----
drivers/dax/bus.h | 34
drivers/dax/dax-private.h | 74 +
drivers/dax/device.c | 164 +--
drivers/dax/hmem.c | 56 -
drivers/dax/hmem/Makefile | 8
drivers/dax/hmem/device.c | 100 ++
drivers/dax/hmem/hmem.c | 93 +-
drivers/dax/kmem.c | 236 ++---
drivers/dax/pmem/compat.c | 2
drivers/dax/pmem/core.c | 36
drivers/firmware/efi/x86_fake_mem.c | 12
drivers/gpu/drm/i915/gem/i915_gem_shmem.c | 4
drivers/gpu/drm/nouveau/nouveau_dmem.c | 15
drivers/irqchip/irq-gic-v3-its.c | 2
drivers/nvdimm/badrange.c | 26
drivers/nvdimm/claim.c | 13
drivers/nvdimm/nd.h | 3
drivers/nvdimm/pfn_devs.c | 13
drivers/nvdimm/pmem.c | 27
drivers/nvdimm/region.c | 21
drivers/pci/p2pdma.c | 12
drivers/virtio/virtio_mem.c | 47 -
drivers/xen/unpopulated-alloc.c | 45
fs/fs_parser.c | 2
fs/ntfs/inode.c | 6
fs/ocfs2/alloc.c | 6
fs/ocfs2/localalloc.c | 2
fs/proc/base.c | 3
fs/proc/task_mmu.c | 104 +-
fs/xattr.c | 22
include/acpi/acpi_numa.h | 14
include/kunit/test.h | 5
include/linux/acpi.h | 2
include/linux/compaction.h | 3
include/linux/compiler-clang.h | 8
include/linux/compiler-gcc.h | 2
include/linux/compiler.h | 2
include/linux/dax.h | 8
include/linux/export.h | 2
include/linux/fs.h | 4
include/linux/gfp.h | 6
include/linux/huge_mm.h | 3
include/linux/kasan.h | 6
include/linux/memblock.h | 90 +
include/linux/memcontrol.h | 13
include/linux/memory_hotplug.h | 23
include/linux/memremap.h | 15
include/linux/mm.h | 36
include/linux/mmap_lock.h | 5
include/linux/mmzone.h | 37
include/linux/numa.h | 11
include/linux/oom.h | 1
include/linux/page-flags.h | 42
include/linux/pagemap.h | 43
include/linux/range.h | 6
include/linux/sched.h | 4
include/linux/sched/coredump.h | 1
include/linux/slab.h | 2
include/linux/swap.h | 10
include/linux/swap_slots.h | 2
kernel/dma/contiguous.c | 11
kernel/fork.c | 25
kernel/resource.c | 11
lib/Kconfig.debug | 9
lib/Kconfig.kasan | 31
lib/Makefile | 5
lib/kunit/test.c | 13
lib/test_free_pages.c | 42
lib/test_hmm.c | 65 -
lib/test_kasan.c | 732 ++++++---------
lib/test_kasan_module.c | 111 ++
mm/Kconfig | 4
mm/Makefile | 1
mm/compaction.c | 5
mm/debug.c | 18
mm/dmapool.c | 46 -
mm/fadvise.c | 9
mm/filemap.c | 78 -
mm/gup.c | 44
mm/gup_benchmark.c | 23
mm/huge_memory.c | 4
mm/hugetlb.c | 100 +-
mm/internal.h | 3
mm/kasan/report.c | 34
mm/kmemleak-test.c | 99 --
mm/kmemleak.c | 8
mm/madvise.c | 21
mm/memblock.c | 102 --
mm/memcontrol.c | 262 +++--
mm/memory-failure.c | 5
mm/memory.c | 147 +--
mm/memory_hotplug.c | 10
mm/mempolicy.c | 8
mm/mempool.c | 18
mm/memremap.c | 344 ++++---
mm/migrate.c | 3
mm/mincore.c | 28
mm/mmap.c | 45
mm/oom_kill.c | 2
mm/page_alloc.c | 82 -
mm/page_counter.c | 2
mm/page_io.c | 14
mm/page_isolation.c | 41
mm/shmem.c | 19
mm/slab.c | 4
mm/slab.h | 50 -
mm/slub.c | 33
mm/sparse.c | 10
mm/swap.c | 14
mm/swap_slots.c | 3
mm/swap_state.c | 38
mm/swapfile.c | 12
mm/truncate.c | 58 -
mm/vmalloc.c | 6
mm/vmscan.c | 5
mm/z3fold.c | 3
mm/zbud.c | 1
samples/Makefile | 1
samples/kmemleak/Makefile | 3
samples/kmemleak/kmemleak-test.c | 99 ++
scripts/decodecode | 29
scripts/spelling.txt | 4
tools/testing/nvdimm/dax-dev.c | 28
tools/testing/nvdimm/test/iomap.c | 2
tools/testing/selftests/vm/Makefile | 17
tools/testing/selftests/vm/compaction_test.c | 11
tools/testing/selftests/vm/gup_benchmark.c | 14
tools/testing/selftests/vm/hmm-tests.c | 4
194 files changed, 4273 insertions(+), 2777 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-10-16 2:40 Andrew Morton
2020-10-16 3:03 ` incoming Andrew Morton
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-10-16 2:40 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- most of the rest of mm/
- various other subsystems
156 patches, based on 578a7155c5a1894a789d4ece181abf9d25dc6b0d.
Subsystems affected by this patch series:
mm/dax
mm/debug
mm/thp
mm/readahead
mm/page-poison
mm/util
mm/memory-hotplug
mm/zram
mm/cleanups
misc
core-kernel
get_maintainer
MAINTAINERS
lib
bitops
checkpatch
binfmt
ramfs
autofs
nilfs
rapidio
panic
relay
kgdb
ubsan
romfs
fault-injection
Subsystem: mm/dax
Dan Williams <dan.j.williams@intel.com>:
device-dax/kmem: fix resource release
Subsystem: mm/debug
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "mm/debug_vm_pgtable fixes", v4:
powerpc/mm: add DEBUG_VM WARN for pmd_clear
powerpc/mm: move setting pte specific flags to pfn_pte
mm/debug_vm_pgtable/ppc64: avoid setting top bits in radom value
mm/debug_vm_pgtables/hugevmap: use the arch helper to identify huge vmap support.
mm/debug_vm_pgtable/savedwrite: enable savedwrite test with CONFIG_NUMA_BALANCING
mm/debug_vm_pgtable/THP: mark the pte entry huge before using set_pmd/pud_at
mm/debug_vm_pgtable/set_pte/pmd/pud: don't use set_*_at to update an existing pte entry
mm/debug_vm_pgtable/locks: move non page table modifying test together
mm/debug_vm_pgtable/locks: take correct page table lock
mm/debug_vm_pgtable/thp: use page table depost/withdraw with THP
mm/debug_vm_pgtable/pmd_clear: don't use pmd/pud_clear on pte entries
mm/debug_vm_pgtable/hugetlb: disable hugetlb test on ppc64
mm/debug_vm_pgtable: avoid none pte in pte_clear_test
mm/debug_vm_pgtable: avoid doing memory allocation with pgtable_t mapped.
Subsystem: mm/thp
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Fix read-only THP for non-tmpfs filesystems":
XArray: add xa_get_order
XArray: add xas_split
mm/filemap: fix storing to a THP shadow entry
Patch series "Remove assumptions of THP size":
mm/filemap: fix page cache removal for arbitrary sized THPs
mm/memory: remove page fault assumption of compound page size
mm/page_owner: change split_page_owner to take a count
"Kirill A. Shutemov" <kirill@shutemov.name>:
mm/huge_memory: fix total_mapcount assumption of page size
mm/huge_memory: fix split assumption of page size
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/huge_memory: fix page_trans_huge_mapcount assumption of THP size
mm/huge_memory: fix can_split_huge_page assumption of THP size
mm/rmap: fix assumptions of THP size
mm/truncate: fix truncation for pages of arbitrary size
mm/page-writeback: support tail pages in wait_for_stable_page
mm/vmscan: allow arbitrary sized pages to be paged out
fs: add a filesystem flag for THPs
fs: do not update nr_thps for mappings which support THPs
Huang Ying <ying.huang@intel.com>:
mm: fix a race during THP splitting
Subsystem: mm/readahead
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Readahead patches for 5.9/5.10":
mm/readahead: add DEFINE_READAHEAD
mm/readahead: make page_cache_ra_unbounded take a readahead_control
mm/readahead: make do_page_cache_ra take a readahead_control
David Howells <dhowells@redhat.com>:
mm/readahead: make ondemand_readahead take a readahead_control
mm/readahead: pass readahead_control to force_page_cache_ra
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/readahead: add page_cache_sync_ra and page_cache_async_ra
David Howells <dhowells@redhat.com>:
mm/filemap: fold ra_submit into do_sync_mmap_readahead
mm/readahead: pass a file_ra_state into force_page_cache_ra
Subsystem: mm/page-poison
Naoya Horiguchi <naoya.horiguchi@nec.com>:
Patch series "HWPOISON: soft offline rework", v7:
mm,hwpoison: cleanup unused PageHuge() check
mm, hwpoison: remove recalculating hpage
mm,hwpoison-inject: don't pin for hwpoison_filter
Oscar Salvador <osalvador@suse.de>:
mm,hwpoison: unexport get_hwpoison_page and make it static
mm,hwpoison: refactor madvise_inject_error
mm,hwpoison: kill put_hwpoison_page
mm,hwpoison: unify THP handling for hard and soft offline
mm,hwpoison: rework soft offline for free pages
mm,hwpoison: rework soft offline for in-use pages
mm,hwpoison: refactor soft_offline_huge_page and __soft_offline_page
mm,hwpoison: return 0 if the page is already poisoned in soft-offline
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm,hwpoison: introduce MF_MSG_UNSPLIT_THP
mm,hwpoison: double-check page count in __get_any_page()
Oscar Salvador <osalvador@suse.de>:
mm,hwpoison: try to narrow window race for free pages
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/page_poison.c: replace bool variable with static key
Miaohe Lin <linmiaohe@huawei.com>:
mm/vmstat.c: use helper macro abs()
Subsystem: mm/util
Bartosz Golaszewski <bgolaszewski@baylibre.com>:
mm/util.c: update the kerneldoc for kstrdup_const()
Jann Horn <jannh@google.com>:
mm/mmu_notifier: fix mmget() assert in __mmu_interval_notifier_insert
Subsystem: mm/memory-hotplug
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: online_pages()/offline_pages() cleanups", v2:
mm/memory_hotplug: inline __offline_pages() into offline_pages()
mm/memory_hotplug: enforce section granularity when onlining/offlining
mm/memory_hotplug: simplify page offlining
mm/page_alloc: simplify __offline_isolated_pages()
mm/memory_hotplug: drop nr_isolate_pageblock in offline_pages()
mm/page_isolation: simplify return value of start_isolate_page_range()
mm/memory_hotplug: simplify page onlining
mm/page_alloc: drop stale pageblock comment in memmap_init_zone*()
mm: pass migratetype into memmap_init_zone() and move_pfn_range_to_zone()
mm/memory_hotplug: mark pageblocks MIGRATE_ISOLATE while onlining memory
Patch series "selective merging of system ram resources", v4:
kernel/resource: make release_mem_region_adjustable() never fail
kernel/resource: move and rename IORESOURCE_MEM_DRIVER_MANAGED
mm/memory_hotplug: guard more declarations by CONFIG_MEMORY_HOTPLUG
mm/memory_hotplug: prepare passing flags to add_memory() and friends
mm/memory_hotplug: MEMHP_MERGE_RESOURCE to specify merging of System RAM resources
virtio-mem: try to merge system ram resources
xen/balloon: try to merge system ram resources
hv_balloon: try to merge system ram resources
kernel/resource: make iomem_resource implicit in release_mem_region_adjustable()
Laurent Dufour <ldufour@linux.ibm.com>:
mm: don't panic when links can't be created in sysfs
David Hildenbrand <david@redhat.com>:
Patch series "mm: place pages to the freelist tail when onlining and undoing isolation", v2:
mm/page_alloc: convert "report" flag of __free_one_page() to a proper flag
mm/page_alloc: place pages to tail in __putback_isolated_page()
mm/page_alloc: move pages to tail in move_to_free_list()
mm/page_alloc: place pages to tail in __free_pages_core()
mm/memory_hotplug: update comment regarding zone shuffling
Subsystem: mm/zram
Douglas Anderson <dianders@chromium.org>:
zram: failing to decompress is WARN_ON worthy
Subsystem: mm/cleanups
YueHaibing <yuehaibing@huawei.com>:
mm/slab.h: remove duplicate include
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/page_reporting.c: drop stale list head check in page_reporting_cycle
Ira Weiny <ira.weiny@intel.com>:
mm/highmem.c: clean up endif comments
Yu Zhao <yuzhao@google.com>:
mm: use self-explanatory macros rather than "2"
Miaohe Lin <linmiaohe@huawei.com>:
mm: fix some broken comments
Chen Tao <chentao3@hotmail.com>:
mm: fix some comments formatting
Xiaofei Tan <tanxiaofei@huawei.com>:
mm/workingset.c: fix some doc warnings
Miaohe Lin <linmiaohe@huawei.com>:
mm: use helper function put_write_access()
Mike Rapoport <rppt@linux.ibm.com>:
include/linux/mmzone.h: remove unused early_pfn_valid()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: rename page_order() to buddy_order()
Subsystem: misc
Randy Dunlap <rdunlap@infradead.org>:
fs: configfs: delete repeated words in comments
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: split out min()/max() et al. helpers
Subsystem: core-kernel
Liao Pingfang <liao.pingfang@zte.com.cn>:
kernel/sys.c: replace do_brk with do_brk_flags in comment of prctl_set_mm_map()
Randy Dunlap <rdunlap@infradead.org>:
kernel/: fix repeated words in comments
kernel: acct.c: fix some kernel-doc nits
Subsystem: get_maintainer
Joe Perches <joe@perches.com>:
get_maintainer: add test for file in VCS
Subsystem: MAINTAINERS
Joe Perches <joe@perches.com>:
get_maintainer: exclude MAINTAINERS file(s) from --git-fallback
Jarkko Sakkinen <jarkko.sakkinen@linux.intel.com>:
MAINTAINERS: jarkko.sakkinen@linux.intel.com -> jarkko@kernel.org
Subsystem: lib
Randy Dunlap <rdunlap@infradead.org>:
lib: bitmap: delete duplicated words
lib: libcrc32c: delete duplicated words
lib: decompress_bunzip2: delete duplicated words
lib: dynamic_queue_limits: delete duplicated words + fix typo
lib: earlycpio: delete duplicated words
lib: radix-tree: delete duplicated words
lib: syscall: delete duplicated words
lib: test_sysctl: delete duplicated words
lib/mpi/mpi-bit.c: fix spello of "functions"
Stephen Boyd <swboyd@chromium.org>:
lib/idr.c: document calling context for IDA APIs mustn't use locks
lib/idr.c: document that ida_simple_{get,remove}() are deprecated
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
lib/scatterlist.c: avoid a double memset
Miaohe Lin <linmiaohe@huawei.com>:
lib/percpu_counter.c: use helper macro abs()
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
include/linux/list.h: add a macro to test if entry is pointing to the head
Dan Carpenter <dan.carpenter@oracle.com>:
lib/test_hmm.c: fix an error code in dmirror_allocate_chunk()
Tobias Jordan <kernel@cdqe.de>:
lib/crc32.c: fix trivial typo in preprocessor condition
Subsystem: bitops
Wei Yang <richard.weiyang@linux.alibaba.com>:
bitops: simplify get_count_order_long()
bitops: use the same mechanism for get_count_order[_long]
Subsystem: checkpatch
Jerome Forissier <jerome@forissier.org>:
checkpatch: add --kconfig-prefix
Joe Perches <joe@perches.com>:
checkpatch: move repeated word test
checkpatch: add test for comma use that should be semicolon
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
const_structs.checkpatch: add phy_ops
Nicolas Boichat <drinkcat@chromium.org>:
checkpatch: warn if trace_printk and friends are called
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
const_structs.checkpatch: add pinctrl_ops and pinmux_ops
Joe Perches <joe@perches.com>:
checkpatch: warn on self-assignments
checkpatch: allow not using -f with files that are in git
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: extend author Signed-off-by check for split From: header
Joe Perches <joe@perches.com>:
checkpatch: emit a warning on embedded filenames
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: fix multi-statement macro checks for while blocks.
Łukasz Stelmach <l.stelmach@samsung.com>:
checkpatch: fix false positive on empty block comment lines
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: add new warnings to author signoff checks.
Subsystem: binfmt
Chris Kennelly <ckennelly@google.com>:
Patch series "Selecting Load Addresses According to p_align", v3:
fs/binfmt_elf: use PT_LOAD p_align values for suitable start address
tools/testing/selftests: add self-test for verifying load alignment
Jann Horn <jannh@google.com>:
Patch series "Fix ELF / FDPIC ELF core dumping, and use mmap_lock properly in there", v5:
binfmt_elf_fdpic: stop using dump_emit() on user pointers on !MMU
coredump: let dump_emit() bail out on short writes
coredump: refactor page range dumping into common helper
coredump: rework elf/elf_fdpic vma_dump_size() into common helper
binfmt_elf, binfmt_elf_fdpic: use a VMA list snapshot
mm/gup: take mmap_lock in get_dump_page()
mm: remove the now-unnecessary mmget_still_valid() hack
Subsystem: ramfs
Matthew Wilcox (Oracle) <willy@infradead.org>:
ramfs: fix nommu mmap with gaps in the page cache
Subsystem: autofs
Matthew Wilcox <willy@infradead.org>:
autofs: harden ioctl table
Subsystem: nilfs
Wang Hai <wanghai38@huawei.com>:
nilfs2: fix some kernel-doc warnings for nilfs2
Subsystem: rapidio
Souptick Joarder <jrdr.linux@gmail.com>:
rapidio: fix error handling path
Jing Xiangfeng <jingxiangfeng@huawei.com>:
rapidio: fix the missed put_device() for rio_mport_add_riodev
Subsystem: panic
Alexey Kardashevskiy <aik@ozlabs.ru>:
panic: dump registers on panic_on_warn
Subsystem: relay
Sudip Mukherjee <sudipm.mukherjee@gmail.com>:
kernel/relay.c: drop unneeded initialization
Subsystem: kgdb
Ritesh Harjani <riteshh@linux.ibm.com>:
scripts/gdb/proc: add struct mount & struct super_block addr in lx-mounts command
scripts/gdb/tasks: add headers and improve spacing format
Subsystem: ubsan
Elena Petrova <lenaptr@google.com>:
sched.h: drop in_ubsan field when UBSAN is in trap mode
George Popescu <georgepope@android.com>:
ubsan: introduce CONFIG_UBSAN_LOCAL_BOUNDS for Clang
Subsystem: romfs
Libing Zhou <libing.zhou@nokia-sbell.com>:
ROMFS: support inode blocks calculation
Subsystem: fault-injection
Albert van der Linde <alinde@google.com>:
Patch series "add fault injection to user memory access", v3:
lib, include/linux: add usercopy failure capability
lib, uaccess: add failure injection to usercopy functions
.mailmap | 1
Documentation/admin-guide/kernel-parameters.txt | 1
Documentation/core-api/xarray.rst | 14
Documentation/fault-injection/fault-injection.rst | 7
MAINTAINERS | 6
arch/ia64/mm/init.c | 4
arch/powerpc/include/asm/book3s/64/pgtable.h | 29 +
arch/powerpc/include/asm/nohash/pgtable.h | 5
arch/powerpc/mm/pgtable.c | 5
arch/powerpc/platforms/powernv/memtrace.c | 2
arch/powerpc/platforms/pseries/hotplug-memory.c | 2
drivers/acpi/acpi_memhotplug.c | 3
drivers/base/memory.c | 3
drivers/base/node.c | 33 +-
drivers/block/zram/zram_drv.c | 2
drivers/dax/kmem.c | 50 ++-
drivers/hv/hv_balloon.c | 4
drivers/infiniband/core/uverbs_main.c | 3
drivers/rapidio/devices/rio_mport_cdev.c | 18 -
drivers/s390/char/sclp_cmd.c | 2
drivers/vfio/pci/vfio_pci.c | 38 +-
drivers/virtio/virtio_mem.c | 5
drivers/xen/balloon.c | 4
fs/autofs/dev-ioctl.c | 8
fs/binfmt_elf.c | 267 +++-------------
fs/binfmt_elf_fdpic.c | 176 ++--------
fs/configfs/dir.c | 2
fs/configfs/file.c | 2
fs/coredump.c | 238 +++++++++++++-
fs/ext4/verity.c | 4
fs/f2fs/verity.c | 4
fs/inode.c | 2
fs/nilfs2/bmap.c | 2
fs/nilfs2/cpfile.c | 6
fs/nilfs2/page.c | 1
fs/nilfs2/sufile.c | 4
fs/proc/task_mmu.c | 18 -
fs/ramfs/file-nommu.c | 2
fs/romfs/super.c | 1
fs/userfaultfd.c | 28 -
include/linux/bitops.h | 13
include/linux/blkdev.h | 1
include/linux/bvec.h | 6
include/linux/coredump.h | 13
include/linux/fault-inject-usercopy.h | 22 +
include/linux/fs.h | 28 -
include/linux/idr.h | 13
include/linux/ioport.h | 15
include/linux/jiffies.h | 3
include/linux/kernel.h | 150 ---------
include/linux/list.h | 29 +
include/linux/memory_hotplug.h | 42 +-
include/linux/minmax.h | 153 +++++++++
include/linux/mm.h | 5
include/linux/mmzone.h | 17 -
include/linux/node.h | 16
include/linux/nodemask.h | 2
include/linux/page-flags.h | 6
include/linux/page_owner.h | 6
include/linux/pagemap.h | 111 ++++++
include/linux/sched.h | 2
include/linux/sched/mm.h | 25 -
include/linux/uaccess.h | 12
include/linux/vmstat.h | 2
include/linux/xarray.h | 22 +
include/ras/ras_event.h | 3
kernel/acct.c | 10
kernel/cgroup/cpuset.c | 2
kernel/dma/direct.c | 2
kernel/fork.c | 4
kernel/futex.c | 2
kernel/irq/timings.c | 2
kernel/jump_label.c | 2
kernel/kcsan/encoding.h | 2
kernel/kexec_core.c | 2
kernel/kexec_file.c | 2
kernel/kthread.c | 2
kernel/livepatch/state.c | 2
kernel/panic.c | 12
kernel/pid_namespace.c | 2
kernel/power/snapshot.c | 2
kernel/range.c | 3
kernel/relay.c | 2
kernel/resource.c | 114 +++++--
kernel/smp.c | 2
kernel/sys.c | 2
kernel/user_namespace.c | 2
lib/Kconfig.debug | 7
lib/Kconfig.ubsan | 14
lib/Makefile | 1
lib/bitmap.c | 2
lib/crc32.c | 2
lib/decompress_bunzip2.c | 2
lib/dynamic_queue_limits.c | 4
lib/earlycpio.c | 2
lib/fault-inject-usercopy.c | 39 ++
lib/find_bit.c | 1
lib/hexdump.c | 1
lib/idr.c | 9
lib/iov_iter.c | 5
lib/libcrc32c.c | 2
lib/math/rational.c | 2
lib/math/reciprocal_div.c | 1
lib/mpi/mpi-bit.c | 2
lib/percpu_counter.c | 2
lib/radix-tree.c | 2
lib/scatterlist.c | 2
lib/strncpy_from_user.c | 3
lib/syscall.c | 2
lib/test_hmm.c | 2
lib/test_sysctl.c | 2
lib/test_xarray.c | 65 ++++
lib/usercopy.c | 5
lib/xarray.c | 208 ++++++++++++
mm/Kconfig | 2
mm/compaction.c | 6
mm/debug_vm_pgtable.c | 267 ++++++++--------
mm/filemap.c | 58 ++-
mm/gup.c | 73 ++--
mm/highmem.c | 4
mm/huge_memory.c | 47 +-
mm/hwpoison-inject.c | 18 -
mm/internal.h | 47 +-
mm/khugepaged.c | 2
mm/madvise.c | 52 ---
mm/memory-failure.c | 357 ++++++++++------------
mm/memory.c | 7
mm/memory_hotplug.c | 223 +++++--------
mm/memremap.c | 3
mm/migrate.c | 11
mm/mmap.c | 7
mm/mmu_notifier.c | 2
mm/page-writeback.c | 1
mm/page_alloc.c | 289 +++++++++++------
mm/page_isolation.c | 16
mm/page_owner.c | 10
mm/page_poison.c | 20 -
mm/page_reporting.c | 4
mm/readahead.c | 174 ++++------
mm/rmap.c | 10
mm/shmem.c | 2
mm/shuffle.c | 2
mm/slab.c | 2
mm/slab.h | 1
mm/slub.c | 2
mm/sparse.c | 2
mm/swap_state.c | 2
mm/truncate.c | 6
mm/util.c | 3
mm/vmscan.c | 5
mm/vmstat.c | 8
mm/workingset.c | 2
scripts/Makefile.ubsan | 10
scripts/checkpatch.pl | 238 ++++++++++----
scripts/const_structs.checkpatch | 3
scripts/gdb/linux/proc.py | 15
scripts/gdb/linux/tasks.py | 9
scripts/get_maintainer.pl | 9
tools/testing/selftests/exec/.gitignore | 1
tools/testing/selftests/exec/Makefile | 9
tools/testing/selftests/exec/load_address.c | 68 ++++
161 files changed, 2532 insertions(+), 1864 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-10-16 2:40 incoming Andrew Morton
@ 2020-10-16 3:03 ` Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-10-16 3:03 UTC (permalink / raw)
To: Linus Torvalds, mm-commits, linux-mm
And... I forgot to set in-reply-to :(
Shall resend, omitting linux-mm.
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-10-17 23:13 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-10-17 23:13 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
40 patches, based on 9d9af1007bc08971953ae915d88dc9bb21344b53.
Subsystems affected by this patch series:
ia64
mm/memcg
mm/migration
mm/pagemap
mm/gup
mm/madvise
mm/vmalloc
misc
Subsystem: ia64
Krzysztof Kozlowski <krzk@kernel.org>:
ia64: fix build error with !COREDUMP
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm, memcg: rework remote charging API to support nesting
Patch series "mm: kmem: kernel memory accounting in an interrupt context":
mm: kmem: move memcg_kmem_bypass() calls to get_mem/obj_cgroup_from_current()
mm: kmem: remove redundant checks from get_obj_cgroup_from_current()
mm: kmem: prepare remote memcg charging infra for interrupt contexts
mm: kmem: enable kernel memcg accounting from interrupt contexts
Subsystem: mm/migration
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
mm/memory-failure: remove a wrapper for alloc_migration_target()
mm/memory_hotplug: remove a wrapper for alloc_migration_target()
Miaohe Lin <linmiaohe@huawei.com>:
mm/migrate: avoid possible unnecessary process right check in kernel_move_pages()
Subsystem: mm/pagemap
"Liam R. Howlett" <Liam.Howlett@Oracle.com>:
mm/mmap: add inline vma_next() for readability of mmap code
mm/mmap: add inline munmap_vma_range() for code readability
Subsystem: mm/gup
Jann Horn <jannh@google.com>:
mm/gup_benchmark: take the mmap lock around GUP
binfmt_elf: take the mmap lock around find_extend_vma()
mm/gup: assert that the mmap lock is held in __get_user_pages()
John Hubbard <jhubbard@nvidia.com>:
Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v2:
mm/gup_benchmark: rename to mm/gup_test
selftests/vm: use a common gup_test.h
selftests/vm: rename run_vmtests --> run_vmtests.sh
selftests/vm: minor cleanup: Makefile and gup_test.c
selftests/vm: only some gup_test items are really benchmarks
selftests/vm: gup_test: introduce the dump_pages() sub-test
selftests/vm: run_vmtests.sh: update and clean up gup_test invocation
selftests/vm: hmm-tests: remove the libhugetlbfs dependency
selftests/vm: 10x speedup for hmm-tests
Subsystem: mm/madvise
Minchan Kim <minchan@kernel.org>:
Patch series "introduce memory hinting API for external process", v9:
mm/madvise: pass mm to do_madvise
pid: move pidfd_get_pid() to pid.c
mm/madvise: introduce process_madvise() syscall: an external memory hinting API
Subsystem: mm/vmalloc
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "remove alloc_vm_area", v4:
mm: update the documentation for vfree
Christoph Hellwig <hch@lst.de>:
mm: add a VM_MAP_PUT_PAGES flag for vmap
mm: add a vmap_pfn function
mm: allow a NULL fn callback in apply_to_page_range
zsmalloc: switch from alloc_vm_area to get_vm_area
drm/i915: use vmap in shmem_pin_map
drm/i915: stop using kmap in i915_gem_object_map
drm/i915: use vmap in i915_gem_object_map
xen/xenbus: use apply_to_page_range directly in xenbus_map_ring_pv
x86/xen: open code alloc_vm_area in arch_gnttab_valloc
mm: remove alloc_vm_area
Patch series "two small vmalloc cleanups":
mm: cleanup the gfp_mask handling in __vmalloc_area_node
mm: remove the filename in the top of file comment in vmalloc.c
Subsystem: misc
Tian Tao <tiantao6@hisilicon.com>:
mm: remove duplicate include statement in mmu.c
Documentation/core-api/pin_user_pages.rst | 8
arch/alpha/kernel/syscalls/syscall.tbl | 1
arch/arm/mm/mmu.c | 1
arch/arm/tools/syscall.tbl | 1
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 2
arch/ia64/kernel/Makefile | 2
arch/ia64/kernel/syscalls/syscall.tbl | 1
arch/m68k/kernel/syscalls/syscall.tbl | 1
arch/microblaze/kernel/syscalls/syscall.tbl | 1
arch/mips/kernel/syscalls/syscall_n32.tbl | 1
arch/mips/kernel/syscalls/syscall_n64.tbl | 1
arch/mips/kernel/syscalls/syscall_o32.tbl | 1
arch/parisc/kernel/syscalls/syscall.tbl | 1
arch/powerpc/kernel/syscalls/syscall.tbl | 1
arch/s390/configs/debug_defconfig | 2
arch/s390/configs/defconfig | 2
arch/s390/kernel/syscalls/syscall.tbl | 1
arch/sh/kernel/syscalls/syscall.tbl | 1
arch/sparc/kernel/syscalls/syscall.tbl | 1
arch/x86/entry/syscalls/syscall_32.tbl | 1
arch/x86/entry/syscalls/syscall_64.tbl | 1
arch/x86/xen/grant-table.c | 27 +-
arch/xtensa/kernel/syscalls/syscall.tbl | 1
drivers/gpu/drm/i915/Kconfig | 1
drivers/gpu/drm/i915/gem/i915_gem_pages.c | 136 ++++------
drivers/gpu/drm/i915/gt/shmem_utils.c | 78 +-----
drivers/xen/xenbus/xenbus_client.c | 30 +-
fs/binfmt_elf.c | 3
fs/buffer.c | 6
fs/io_uring.c | 2
fs/notify/fanotify/fanotify.c | 5
fs/notify/inotify/inotify_fsnotify.c | 5
include/linux/memcontrol.h | 12
include/linux/mm.h | 2
include/linux/pid.h | 1
include/linux/sched/mm.h | 43 +--
include/linux/syscalls.h | 2
include/linux/vmalloc.h | 7
include/uapi/asm-generic/unistd.h | 4
kernel/exit.c | 19 -
kernel/pid.c | 19 +
kernel/sys_ni.c | 1
mm/Kconfig | 24 +
mm/Makefile | 2
mm/gup.c | 2
mm/gup_benchmark.c | 225 ------------------
mm/gup_test.c | 295 +++++++++++++++++++++--
mm/gup_test.h | 40 ++-
mm/madvise.c | 125 ++++++++--
mm/memcontrol.c | 83 ++++--
mm/memory-failure.c | 18 -
mm/memory.c | 16 -
mm/memory_hotplug.c | 46 +--
mm/migrate.c | 71 +++--
mm/mmap.c | 74 ++++-
mm/nommu.c | 7
mm/percpu.c | 3
mm/slab.h | 3
mm/vmalloc.c | 147 +++++------
mm/zsmalloc.c | 10
tools/testing/selftests/vm/.gitignore | 3
tools/testing/selftests/vm/Makefile | 40 ++-
tools/testing/selftests/vm/check_config.sh | 31 ++
tools/testing/selftests/vm/config | 2
tools/testing/selftests/vm/gup_benchmark.c | 143 -----------
tools/testing/selftests/vm/gup_test.c | 260 ++++++++++++++++++--
tools/testing/selftests/vm/hmm-tests.c | 12
tools/testing/selftests/vm/run_vmtests | 334 --------------------------
tools/testing/selftests/vm/run_vmtests.sh | 350 +++++++++++++++++++++++++++-
70 files changed, 1580 insertions(+), 1224 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-11-02 1:06 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-11-02 1:06 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
15 patches, based on 3cea11cd5e3b00d91caf0b4730194039b45c5891.
Subsystems affected by this patch series:
mm/memremap
mm/memcg
mm/slab-generic
mm/kasan
mm/mempolicy
signals
lib
mm/pagecache
kthread
mm/oom-kill
mm/pagemap
epoll
core-kernel
Subsystem: mm/memremap
Ralph Campbell <rcampbell@nvidia.com>:
mm/mremap_pages: fix static key devmap_managed_key updates
Subsystem: mm/memcg
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb_cgroup: fix reservation accounting
zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>:
mm: memcontrol: correct the NR_ANON_THPS counter of hierarchical memcg
Roman Gushchin <guro@fb.com>:
mm: memcg: link page counters to root if use_hierarchy is false
Subsystem: mm/slab-generic
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: adopt KUNIT tests to SW_TAGS mode
Subsystem: mm/mempolicy
Shijie Luo <luoshijie1@huawei.com>:
mm: mempolicy: fix potential pte_unmap_unlock pte error
Subsystem: signals
Oleg Nesterov <oleg@redhat.com>:
ptrace: fix task_join_group_stop() for the case when current is traced
Subsystem: lib
Vasily Gorbik <gor@linux.ibm.com>:
lib/crc32test: remove extra local_irq_disable/enable
Subsystem: mm/pagecache
Jason Yan <yanaijie@huawei.com>:
mm/truncate.c: make __invalidate_mapping_pages() static
Subsystem: kthread
Zqiang <qiang.zhang@windriver.com>:
kthread_worker: prevent queuing delayed work from timer_fn when it is being canceled
Subsystem: mm/oom-kill
Charles Haithcock <chaithco@redhat.com>:
mm, oom: keep oom_adj under or at upper limit when printing
Subsystem: mm/pagemap
Jason Gunthorpe <jgg@nvidia.com>:
mm: always have io_remap_pfn_range() set pgprot_decrypted()
Subsystem: epoll
Soheil Hassas Yeganeh <soheil@google.com>:
epoll: check ep_events_available() upon timeout
epoll: add a selftest for epoll timeout race
Subsystem: core-kernel
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
kernel/hung_task.c: make type annotations consistent
fs/eventpoll.c | 16 +
fs/proc/base.c | 2
include/linux/mm.h | 9
include/linux/pgtable.h | 4
kernel/hung_task.c | 3
kernel/kthread.c | 3
kernel/signal.c | 19 -
lib/crc32test.c | 4
lib/test_kasan.c | 149 +++++++---
mm/hugetlb.c | 20 -
mm/memcontrol.c | 25 +
mm/mempolicy.c | 6
mm/memremap.c | 39 +-
mm/truncate.c | 2
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 95 ++++++
15 files changed, 290 insertions(+), 106 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-11-14 6:51 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-11-14 6:51 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
14 patches, based on 9e6a39eae450b81c8b2c8cbbfbdf8218e9b40c81.
Subsystems affected by this patch series:
mm/migration
mm/vmscan
mailmap
mm/slub
mm/gup
kbuild
reboot
kernel/watchdog
mm/memcg
mm/hugetlbfs
panic
ocfs2
Subsystem: mm/migration
Zi Yan <ziy@nvidia.com>:
mm/compaction: count pages and stop correctly during page isolation
mm/compaction: stop isolation if too many pages are isolated and we have pages to migrate
Subsystem: mm/vmscan
Nicholas Piggin <npiggin@gmail.com>:
mm/vmscan: fix NR_ISOLATED_FILE corruption on 64-bit
Subsystem: mailmap
Dmitry Baryshkov <dbaryshkov@gmail.com>:
mailmap: fix entry for Dmitry Baryshkov/Eremin-Solenikov
Subsystem: mm/slub
Laurent Dufour <ldufour@linux.ibm.com>:
mm/slub: fix panic in slab_alloc_node()
Subsystem: mm/gup
Jason Gunthorpe <jgg@nvidia.com>:
mm/gup: use unpin_user_pages() in __gup_longterm_locked()
Subsystem: kbuild
Arvind Sankar <nivedita@alum.mit.edu>:
compiler.h: fix barrier_data() on clang
Subsystem: reboot
Matteo Croce <mcroce@microsoft.com>:
Patch series "fix parsing of reboot= cmdline", v3:
Revert "kernel/reboot.c: convert simple_strtoul to kstrtoint"
reboot: fix overflow parsing reboot cpu number
Subsystem: kernel/watchdog
Santosh Sivaraj <santosh@fossix.org>:
kernel/watchdog: fix watchdog_allowed_mask not used warning
Subsystem: mm/memcg
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: fix missing wakeup polling thread
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlbfs: fix anon huge page migration race
Subsystem: panic
Christophe Leroy <christophe.leroy@csgroup.eu>:
panic: don't dump stack twice on warn
Subsystem: ocfs2
Wengang Wang <wen.gang.wang@oracle.com>:
ocfs2: initialize ip_next_orphan
.mailmap | 5 +-
fs/ocfs2/super.c | 1
include/asm-generic/barrier.h | 1
include/linux/compiler-clang.h | 6 --
include/linux/compiler-gcc.h | 19 --------
include/linux/compiler.h | 18 +++++++-
include/linux/memcontrol.h | 11 ++++-
kernel/panic.c | 3 -
kernel/reboot.c | 28 ++++++------
kernel/watchdog.c | 4 -
mm/compaction.c | 12 +++--
mm/gup.c | 14 ++++--
mm/hugetlb.c | 90 ++---------------------------------------
mm/memory-failure.c | 36 +++++++---------
mm/migrate.c | 46 +++++++++++---------
mm/rmap.c | 5 --
mm/slub.c | 2
mm/vmscan.c | 5 +-
18 files changed, 119 insertions(+), 187 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-11-22 6:16 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-11-22 6:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
8 patches, based on a349e4c659609fd20e4beea89e5c4a4038e33a95.
Subsystems affected by this patch series:
mm/madvise
kbuild
mm/pagemap
mm/readahead
mm/memcg
mm/userfaultfd
vfs-akpm
mm/madvise
Subsystem: mm/madvise
Eric Dumazet <edumazet@google.com>:
mm/madvise: fix memory leak from process_madvise
Subsystem: kbuild
Nick Desaulniers <ndesaulniers@google.com>:
compiler-clang: remove version check for BPF Tracing
Subsystem: mm/pagemap
Dan Williams <dan.j.williams@intel.com>:
mm: fix phys_to_target_node() and memory_add_physaddr_to_nid() exports
Subsystem: mm/readahead
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: fix readahead_page_batch for retry entries
Subsystem: mm/memcg
Muchun Song <songmuchun@bytedance.com>:
mm: memcg/slab: fix root memcg vmstats
Subsystem: mm/userfaultfd
Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
mm/userfaultfd: do not access vma->vm_mm after calling handle_userfault()
Subsystem: vfs-akpm
Yicong Yang <yangyicong@hisilicon.com>:
libfs: fix error cast of negative value in simple_attr_write()
Subsystem: mm/madvise
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: fix madvise WILLNEED performance problem
arch/ia64/include/asm/sparsemem.h | 6 ++++++
arch/powerpc/include/asm/mmzone.h | 5 +++++
arch/powerpc/include/asm/sparsemem.h | 5 ++---
arch/powerpc/mm/mem.c | 1 +
arch/x86/include/asm/sparsemem.h | 10 ++++++++++
arch/x86/mm/numa.c | 2 ++
drivers/dax/Kconfig | 1 -
fs/libfs.c | 6 ++++--
include/linux/compiler-clang.h | 2 ++
include/linux/memory_hotplug.h | 14 --------------
include/linux/numa.h | 30 +++++++++++++++++++++++++++++-
include/linux/pagemap.h | 2 ++
mm/huge_memory.c | 9 ++++-----
mm/madvise.c | 4 +---
mm/memcontrol.c | 9 +++++++--
mm/memory_hotplug.c | 18 ------------------
16 files changed, 75 insertions(+), 49 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-12-06 6:14 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-06 6:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
12 patches, based on 33256ce194110874d4bc90078b577c59f9076c59.
Subsystems affected by this patch series:
lib
coredump
mm/memcg
mm/zsmalloc
mm/swap
mailmap
mm/selftests
mm/pagecache
mm/hugetlb
mm/pagemap
Subsystem: lib
Randy Dunlap <rdunlap@infradead.org>:
zlib: export S390 symbols for zlib modules
Subsystem: coredump
Menglong Dong <dong.menglong@zte.com.cn>:
coredump: fix core_pattern parse error
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: fix obj_cgroup_charge() return value handling
Yang Shi <shy828301@gmail.com>:
mm: list_lru: set shrinker map bit when child nr_items is not zero
Subsystem: mm/zsmalloc
Minchan Kim <minchan@kernel.org>:
mm/zsmalloc.c: drop ZSMALLOC_PGTABLE_MAPPING
Subsystem: mm/swap
Qian Cai <qcai@redhat.com>:
mm/swapfile: do not sleep with a spin lock held
Subsystem: mailmap
Uwe Kleine-König <u.kleine-koenig@pengutronix.de>:
mailmap: add two more addresses of Uwe Kleine-König
Subsystem: mm/selftests
Xingxing Su <suxingxing@loongson.cn>:
tools/testing/selftests/vm: fix build error
Axel Rasmussen <axelrasmussen@google.com>:
userfaultfd: selftests: fix SIGSEGV if huge mmap fails
Subsystem: mm/pagecache
Alex Shi <alex.shi@linux.alibaba.com>:
mm/filemap: add static for function __add_to_page_cache_locked
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb_cgroup: fix offline of hugetlb cgroup with reservations
Subsystem: mm/pagemap
Liu Zixian <liuzixian4@huawei.com>:
mm/mmap.c: fix mmap return value when vma is merged after call_mmap()
.mailmap | 2 +
arch/arm/configs/omap2plus_defconfig | 1
fs/coredump.c | 3 +
include/linux/zsmalloc.h | 1
lib/zlib_dfltcc/dfltcc_inflate.c | 3 +
mm/Kconfig | 13 -------
mm/filemap.c | 2 -
mm/hugetlb_cgroup.c | 8 +---
mm/list_lru.c | 10 ++---
mm/mmap.c | 26 ++++++--------
mm/slab.h | 40 +++++++++++++---------
mm/swapfile.c | 4 +-
mm/zsmalloc.c | 54 -------------------------------
tools/testing/selftests/vm/Makefile | 4 ++
tools/testing/selftests/vm/userfaultfd.c | 25 +++++++++-----
15 files changed, 75 insertions(+), 121 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-12-11 21:35 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-11 21:35 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
8 patches, based on 33dc9614dc208291d0c4bcdeb5d30d481dcd2c4c.
Subsystems affected by this patch series:
mm/pagecache
proc
selftests
kbuild
mm/kasan
mm/hugetlb
Subsystem: mm/pagecache
Andrew Morton <akpm@linux-foundation.org>:
revert "mm/filemap: add static for function __add_to_page_cache_locked"
Subsystem: proc
Miles Chen <miles.chen@mediatek.com>:
proc: use untagged_addr() for pagemap_read addresses
Subsystem: selftests
Arnd Bergmann <arnd@arndb.de>:
selftest/fpu: avoid clang warning
Subsystem: kbuild
Arnd Bergmann <arnd@arndb.de>:
kbuild: avoid static_assert for genksyms
initramfs: fix clang build failure
elfcore: fix building with clang
Subsystem: mm/kasan
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
kasan: fix object remaining in offline per-cpu quarantine
Subsystem: mm/hugetlb
Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
mm/hugetlb: clear compound_nr before freeing gigantic pages
fs/proc/task_mmu.c | 8 ++++++--
include/linux/build_bug.h | 5 +++++
include/linux/elfcore.h | 22 ++++++++++++++++++++++
init/initramfs.c | 2 +-
kernel/Makefile | 1 -
kernel/elfcore.c | 26 --------------------------
lib/Makefile | 3 ++-
mm/filemap.c | 2 +-
mm/hugetlb.c | 1 +
mm/kasan/quarantine.c | 39 +++++++++++++++++++++++++++++++++++++++
10 files changed, 77 insertions(+), 32 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-12-15 3:02 Andrew Morton
2020-12-15 3:03 ` [patch 001/200] kthread: add kthread_work tracepoints Andrew Morton
` (200 more replies)
0 siblings, 201 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:02 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- a few random little subsystems
- almost all of the MM patches which are staged ahead of linux-next
material. I'll trickle to post-linux-next work in as the dependents
get merged up.
200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442.
Subsystems affected by this patch series:
kthread
kbuild
ide
ntfs
ocfs2
arch
mm/slab-generic
mm/slab
mm/slub
mm/dax
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/shmem
mm/memcg
mm/pagemap
mm/mremap
mm/hmm
mm/vmalloc
mm/documentation
mm/kasan
mm/pagealloc
mm/memory-failure
mm/hugetlb
mm/vmscan
mm/z3fold
mm/compaction
mm/oom-kill
mm/migration
mm/cma
mm/page-poison
mm/userfaultfd
mm/zswap
mm/zsmalloc
mm/uaccess
mm/zram
mm/cleanups
Subsystem: kthread
Rob Clark <robdclark@chromium.org>:
kthread: add kthread_work tracepoints
Petr Mladek <pmladek@suse.com>:
kthread_worker: document CPU hotplug handling
Subsystem: kbuild
Petr Vorel <petr.vorel@gmail.com>:
uapi: move constants from <linux/kernel.h> to <linux/const.h>
Subsystem: ide
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
ide/falcon: remove in_interrupt() usage
ide: remove BUG_ON(in_interrupt() || irqs_disabled()) from ide_unregister()
Subsystem: ntfs
Alex Shi <alex.shi@linux.alibaba.com>:
fs/ntfs: remove unused varibles
fs/ntfs: remove unused variable attr_len
Subsystem: ocfs2
Tom Rix <trix@redhat.com>:
fs/ocfs2/cluster/tcp.c: remove unneeded break
Mauricio Faria de Oliveira <mfo@canonical.com>:
ocfs2: ratelimit the 'max lookup times reached' notice
Subsystem: arch
Colin Ian King <colin.king@canonical.com>:
arch/Kconfig: fix spelling mistakes
Subsystem: mm/slab-generic
Hui Su <sh_def@163.com>:
mm/slab_common.c: use list_for_each_entry in dump_unreclaimable_slab()
Bartosz Golaszewski <bgolaszewski@baylibre.com>:
Patch series "slab: provide and use krealloc_array()", v3:
mm: slab: clarify krealloc()'s behavior with __GFP_ZERO
mm: slab: provide krealloc_array()
ALSA: pcm: use krealloc_array()
vhost: vringh: use krealloc_array()
pinctrl: use krealloc_array()
edac: ghes: use krealloc_array()
drm: atomic: use krealloc_array()
hwtracing: intel: use krealloc_array()
dma-buf: use krealloc_array()
Vlastimil Babka <vbabka@suse.cz>:
mm, slab, slub: clear the slab_cache field when freeing page
Subsystem: mm/slab
Alexander Popov <alex.popov@linux.com>:
mm/slab: rerform init_on_free earlier
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: use kmem_cache_debug_flags() in deactivate_slab()
Bharata B Rao <bharata@linux.ibm.com>:
mm/slub: let number of online CPUs determine the slub page order
Subsystem: mm/dax
Dan Williams <dan.j.williams@intel.com>:
device-dax/kmem: use struct_size()
Subsystem: mm/debug
Zhenhua Huang <zhenhuah@codeaurora.org>:
mm: fix page_owner initializing issue for arm32
Liam Mark <lmark@codeaurora.org>:
mm/page_owner: record timestamp and pid
Subsystem: mm/pagecache
Kent Overstreet <kent.overstreet@gmail.com>:
Patch series "generic_file_buffered_read() improvements", v2:
mm/filemap/c: break generic_file_buffered_read up into multiple functions
mm/filemap.c: generic_file_buffered_read() now uses find_get_pages_contig
Alex Shi <alex.shi@linux.alibaba.com>:
mm/truncate: add parameter explanation for invalidate_mapping_pagevec
Hailong Liu <carver4lio@163.com>:
mm/filemap.c: remove else after a return
Subsystem: mm/gup
John Hubbard <jhubbard@nvidia.com>:
Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v3:
mm/gup_benchmark: rename to mm/gup_test
selftests/vm: use a common gup_test.h
selftests/vm: rename run_vmtests --> run_vmtests.sh
selftests/vm: minor cleanup: Makefile and gup_test.c
selftests/vm: only some gup_test items are really benchmarks
selftests/vm: gup_test: introduce the dump_pages() sub-test
selftests/vm: run_vmtests.sh: update and clean up gup_test invocation
selftests/vm: hmm-tests: remove the libhugetlbfs dependency
selftests/vm: 2x speedup for run_vmtests.sh
Barry Song <song.bao.hua@hisilicon.com>:
mm/gup_test.c: mark gup_test_init as __init function
mm/gup_test: GUP_TEST depends on DEBUG_FS
Jason Gunthorpe <jgg@nvidia.com>:
Patch series "Add a seqcount between gup_fast and copy_page_range()", v4:
mm/gup: reorganize internal_get_user_pages_fast()
mm/gup: prevent gup_fast from racing with COW during fork
mm/gup: remove the vma allocation from gup_longterm_locked()
mm/gup: combine put_compound_head() and unpin_user_page()
Subsystem: mm/swap
Ralph Campbell <rcampbell@nvidia.com>:
mm: handle zone device pages in release_pages()
Miaohe Lin <linmiaohe@huawei.com>:
mm/swapfile.c: use helper function swap_count() in add_swap_count_continuation()
mm/swap_state: skip meaningless swap cache readahead when ra_info.win == 0
mm/swapfile.c: remove unnecessary out label in __swap_duplicate()
mm/swapfile.c: use memset to fill the swap_map with SWAP_HAS_CACHE
Jeff Layton <jlayton@kernel.org>:
mm: remove pagevec_lookup_range_nr_tag()
Subsystem: mm/shmem
Hui Su <sh_def@163.com>:
mm/shmem.c: make shmem_mapping() inline
Randy Dunlap <rdunlap@infradead.org>:
tmpfs: fix Documentation nits
Subsystem: mm/memcg
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: add file_thp, shmem_thp to memory.stat
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: remove unused mod_memcg_obj_state()
Miaohe Lin <linmiaohe@huawei.com>:
mm: memcontrol: eliminate redundant check in __mem_cgroup_insert_exceeded()
Muchun Song <songmuchun@bytedance.com>:
mm: memcg/slab: fix return of child memcg objcg for root memcg
mm: memcg/slab: fix use after free in obj_cgroup_charge
Shakeel Butt <shakeelb@google.com>:
mm/rmap: always do TTU_IGNORE_ACCESS
Alex Shi <alex.shi@linux.alibaba.com>:
mm/memcg: update page struct member in comments
Roman Gushchin <guro@fb.com>:
mm: memcg: fix obsolete code comments
Patch series "mm: memcg: deprecate cgroup v1 non-hierarchical mode", v1:
mm: memcg: deprecate the non-hierarchical mode
docs: cgroup-v1: reflect the deprecation of the non-hierarchical mode
cgroup: remove obsoleted broken_hierarchy and warned_broken_hierarchy
Hui Su <sh_def@163.com>:
mm/page_counter: use page_counter_read in page_counter_set_max
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
mm: memcg: remove obsolete memcg_has_children()
Muchun Song <songmuchun@bytedance.com>:
mm: memcg/slab: rename *_lruvec_slab_state to *_lruvec_kmem_state
Kaixu Xia <kaixuxia@tencent.com>:
mm: memcontrol: sssign boolean values to a bool variable
Alex Shi <alex.shi@linux.alibaba.com>:
mm/memcg: remove incorrect comment
Shakeel Butt <shakeelb@google.com>:
Patch series "memcg: add pagetable comsumption to memory.stat", v2:
mm: move lruvec stats update functions to vmstat.h
mm: memcontrol: account pagetables per node
Subsystem: mm/pagemap
Dan Williams <dan.j.williams@intel.com>:
xen/unpopulated-alloc: consolidate pgmap manipulation
Kalesh Singh <kaleshsingh@google.com>:
Patch series "Speed up mremap on large regions", v4:
kselftests: vm: add mremap tests
mm: speedup mremap on 1GB or larger regions
arm64: mremap speedup - enable HAVE_MOVE_PUD
x86: mremap speedup - Enable HAVE_MOVE_PUD
John Hubbard <jhubbard@nvidia.com>:
mm: cleanup: remove unused tsk arg from __access_remote_vm
Alex Shi <alex.shi@linux.alibaba.com>:
mm/mapping_dirty_helpers: enhance the kernel-doc markups
mm/page_vma_mapped.c: add colon to fix kernel-doc markups error for check_pte
Axel Rasmussen <axelrasmussen@google.com>:
mm: mmap_lock: add tracepoints around lock acquisition
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
sparc: fix handling of page table constructor failure
mm: move free_unref_page to mm/internal.h
Subsystem: mm/mremap
Dmitry Safonov <dima@arista.com>:
Patch series "mremap: move_vma() fixes":
mm/mremap: account memory on do_munmap() failure
mm/mremap: for MREMAP_DONTUNMAP check security_vm_enough_memory_mm()
mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio
vm_ops: rename .split() callback to .may_split()
mremap: check if it's possible to split original vma
mm: forbid splitting special mappings
Subsystem: mm/hmm
Daniel Vetter <daniel.vetter@ffwll.ch>:
mm: track mmu notifiers in fs_reclaim_acquire/release
mm: extract might_alloc() debug check
locking/selftests: add testcases for fs_reclaim
Subsystem: mm/vmalloc
Andrew Morton <akpm@linux-foundation.org>:
mm/vmalloc.c:__vmalloc_area_node(): avoid 32-bit overflow
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: use free_vm_area() if an allocation fails
mm/vmalloc: rework the drain logic
Alex Shi <alex.shi@linux.alibaba.com>:
mm/vmalloc: add 'align' parameter explanation for pvm_determine_end_from_reverse
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm/vmalloc.c: remove unnecessary return statement
Waiman Long <longman@redhat.com>:
mm/vmalloc: Fix unlock order in s_stop()
Subsystem: mm/documentation
Alex Shi <alex.shi@linux.alibaba.com>:
docs/vm: remove unused 3 items explanation for /proc/vmstat
Subsystem: mm/kasan
Vincenzo Frascino <vincenzo.frascino@arm.com>:
mm/vmalloc.c: fix kasan shadow poisoning size
Walter Wu <walter-zh.wu@mediatek.com>:
Patch series "kasan: add workqueue stack for generic KASAN", v5:
workqueue: kasan: record workqueue stack
kasan: print workqueue stack
lib/test_kasan.c: add workqueue test case
kasan: update documentation for generic kasan
Marco Elver <elver@google.com>:
lkdtm: disable KASAN for rodata.o
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "arch, mm: deprecate DISCONTIGMEM", v2:
alpha: switch from DISCONTIGMEM to SPARSEMEM
ia64: remove custom __early_pfn_to_nid()
ia64: remove 'ifdef CONFIG_ZONE_DMA32' statements
ia64: discontig: paging_init(): remove local max_pfn calculation
ia64: split virtual map initialization out of paging_init()
ia64: forbid using VIRTUAL_MEM_MAP with FLATMEM
ia64: make SPARSEMEM default and disable DISCONTIGMEM
arm: remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL
arm, arm64: move free_unused_memmap() to generic mm
arc: use FLATMEM with freeing of unused memory map instead of DISCONTIGMEM
m68k/mm: make node data and node setup depend on CONFIG_DISCONTIGMEM
m68k/mm: enable use of generic memory_model.h for !DISCONTIGMEM
m68k: deprecate DISCONTIGMEM
Patch series "arch, mm: improve robustness of direct map manipulation", v7:
mm: introduce debug_pagealloc_{map,unmap}_pages() helpers
PM: hibernate: make direct map manipulations more explicit
arch, mm: restore dependency of __kernel_map_pages() on DEBUG_PAGEALLOC
arch, mm: make kernel_page_present() always available
Vlastimil Babka <vbabka@suse.cz>:
Patch series "disable pcplists during memory offline", v3:
mm, page_alloc: clean up pageset high and batch update
mm, page_alloc: calculate pageset high and batch once per zone
mm, page_alloc: remove setup_pageset()
mm, page_alloc: simplify pageset_update()
mm, page_alloc: cache pageset high and batch in struct zone
mm, page_alloc: move draining pcplists to page isolation users
mm, page_alloc: disable pcplists during memory offline
Miaohe Lin <linmiaohe@huawei.com>:
include/linux/page-flags.h: remove unused __[Set|Clear]PagePrivate
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/page-flags: fix comment
mm/page_alloc: add __free_pages() documentation
Zou Wei <zou_wei@huawei.com>:
mm/page_alloc: mark some symbols with static keyword
David Hildenbrand <david@redhat.com>:
mm/page_alloc: clear all pages in post_alloc_hook() with init_on_alloc=1
Lin Feng <linf@wangsu.com>:
init/main: fix broken buffer_init when DEFERRED_STRUCT_PAGE_INIT set
Lorenzo Stoakes <lstoakes@gmail.com>:
mm: page_alloc: refactor setup_per_zone_lowmem_reserve()
Muchun Song <songmuchun@bytedance.com>:
mm/page_alloc: speed up the iteration of max_order
Subsystem: mm/memory-failure
Oscar Salvador <osalvador@suse.de>:
Patch series "HWpoison: further fixes and cleanups", v5:
mm,hwpoison: drain pcplists before bailing out for non-buddy zero-refcount page
mm,hwpoison: take free pages off the buddy freelists
mm,hwpoison: drop unneeded pcplist draining
Patch series "HWPoison: Refactor get page interface", v2:
mm,hwpoison: refactor get_any_page
mm,hwpoison: disable pcplists before grabbing a refcount
mm,hwpoison: remove drain_all_pages from shake_page
mm,memory_failure: always pin the page in madvise_inject_error
mm,hwpoison: return -EBUSY when migration fails
Subsystem: mm/hugetlb
Hui Su <sh_def@163.com>:
mm/hugetlb.c: just use put_page_testzero() instead of page_count()
Ralph Campbell <rcampbell@nvidia.com>:
include/linux/huge_mm.h: remove extern keyword
Alex Shi <alex.shi@linux.alibaba.com>:
khugepaged: add parameter explanations for kernel-doc markup
Liu Xiang <liu.xiang@zlingsmart.com>:
mm: hugetlb: fix type of delta parameter and related local variables in gather_surplus_pages()
Oscar Salvador <osalvador@suse.de>:
mm,hugetlb: remove unneeded initialization
Dan Carpenter <dan.carpenter@oracle.com>:
hugetlb: fix an error code in hugetlb_reserve_pages()
Subsystem: mm/vmscan
Johannes Weiner <hannes@cmpxchg.org>:
mm: don't wake kswapd prematurely when watermark boosting is disabled
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
mm/vmscan: drop unneeded assignment in kswapd()
"logic.yu" <hymmsx.yu@gmail.com>:
mm/vmscan.c: remove the filename in the top of file comment
Muchun Song <songmuchun@bytedance.com>:
mm/page_isolation: do not isolate the max order page
Subsystem: mm/z3fold
Vitaly Wool <vitaly.wool@konsulko.com>:
Patch series "z3fold: stability / rt fixes":
z3fold: simplify freeing slots
z3fold: stricter locking and more careful reclaim
z3fold: remove preempt disabled sections for RT
Subsystem: mm/compaction
Yanfei Xu <yanfei.xu@windriver.com>:
mm/compaction: rename 'start_pfn' to 'iteration_start_pfn' in compact_zone()
Hui Su <sh_def@163.com>:
mm/compaction: move compaction_suitable's comment to right place
mm/compaction: make defer_compaction and compaction_deferred static
Subsystem: mm/oom-kill
Hui Su <sh_def@163.com>:
mm/oom_kill: change comment and rename is_dump_unreclaim_slabs()
Subsystem: mm/migration
Long Li <lonuxli.64@gmail.com>:
mm/migrate.c: fix comment spelling
Ralph Campbell <rcampbell@nvidia.com>:
mm/migrate.c: optimize migrate_vma_pages() mmu notifier
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: support THPs in zero_user_segments
Yang Shi <shy828301@gmail.com>:
Patch series "mm: misc migrate cleanup and improvement", v3:
mm: truncate_complete_page() does not exist any more
mm: migrate: simplify the logic for handling permanent failure
mm: migrate: skip shared exec THP for NUMA balancing
mm: migrate: clean up migrate_prep{_local}
mm: migrate: return -ENOSYS if THP migration is unsupported
Stephen Zhang <starzhangzsd@gmail.com>:
mm: migrate: remove unused parameter in migrate_vma_insert_page()
Subsystem: mm/cma
Lecopzer Chen <lecopzer.chen@mediatek.com>:
mm/cma.c: remove redundant cma_mutex lock
Charan Teja Reddy <charante@codeaurora.org>:
mm: cma: improve pr_debug log in cma_release()
Subsystem: mm/page-poison
Vlastimil Babka <vbabka@suse.cz>:
Patch series "cleanup page poisoning", v3:
mm, page_alloc: do not rely on the order of page_poison and init_on_alloc/free parameters
mm, page_poison: use static key more efficiently
kernel/power: allow hibernation with page_poison sanity checking
mm, page_poison: remove CONFIG_PAGE_POISONING_NO_SANITY
mm, page_poison: remove CONFIG_PAGE_POISONING_ZERO
Subsystem: mm/userfaultfd
Lokesh Gidra <lokeshgidra@google.com>:
Patch series "Control over userfaultfd kernel-fault handling", v6:
userfaultfd: add UFFD_USER_MODE_ONLY
userfaultfd: add user-mode only option to unprivileged_userfaultfd sysctl knob
Axel Rasmussen <axelrasmussen@google.com>:
userfaultfd: selftests: make __{s,u}64 format specifiers portable
Peter Xu <peterx@redhat.com>:
Patch series "userfaultfd: selftests: Small fixes":
userfaultfd/selftests: always dump something in modes
userfaultfd/selftests: fix retval check for userfaultfd_open()
userfaultfd/selftests: hint the test runner on required privilege
Subsystem: mm/zswap
Joe Perches <joe@perches.com>:
mm/zswap: make struct kernel_param_ops definitions const
YueHaibing <yuehaibing@huawei.com>:
mm/zswap: fix passing zero to 'PTR_ERR' warning
Barry Song <song.bao.hua@hisilicon.com>:
mm/zswap: move to use crypto_acomp API for hardware acceleration
Subsystem: mm/zsmalloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/zsmalloc.c: rework the list_add code in insert_zspage()
Subsystem: mm/uaccess
Colin Ian King <colin.king@canonical.com>:
mm/process_vm_access: remove redundant initialization of iov_r
Subsystem: mm/zram
Minchan Kim <minchan@kernel.org>:
zram: support page writeback
zram: add stat to gather incompressible pages since zram set up
Rui Salvaterra <rsalvaterra@gmail.com>:
zram: break the strict dependency from lzo
Subsystem: mm/cleanups
Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
mm: fix kernel-doc markups
Joe Perches <joe@perches.com>:
Patch series "mm: Convert sysfs sprintf family to sysfs_emit", v2:
mm: use sysfs_emit for struct kobject * uses
mm: huge_memory: convert remaining use of sprintf to sysfs_emit and neatening
mm:backing-dev: use sysfs_emit in macro defining functions
mm: shmem: convert shmem_enabled_show to use sysfs_emit_at
mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
mm: fix fall-through warnings for Clang
Alexey Dobriyan <adobriyan@gmail.com>:
mm: cleanup kstrto*() usage
/mmap_lock.h | 107 ++
a/Documentation/admin-guide/blockdev/zram.rst | 6
a/Documentation/admin-guide/cgroup-v1/memcg_test.rst | 8
a/Documentation/admin-guide/cgroup-v1/memory.rst | 42
a/Documentation/admin-guide/cgroup-v2.rst | 11
a/Documentation/admin-guide/mm/transhuge.rst | 15
a/Documentation/admin-guide/sysctl/vm.rst | 15
a/Documentation/core-api/memory-allocation.rst | 4
a/Documentation/core-api/pin_user_pages.rst | 8
a/Documentation/dev-tools/kasan.rst | 5
a/Documentation/filesystems/tmpfs.rst | 8
a/Documentation/vm/memory-model.rst | 3
a/Documentation/vm/page_owner.rst | 12
a/arch/Kconfig | 21
a/arch/alpha/Kconfig | 8
a/arch/alpha/include/asm/mmzone.h | 14
a/arch/alpha/include/asm/page.h | 7
a/arch/alpha/include/asm/pgtable.h | 12
a/arch/alpha/include/asm/sparsemem.h | 18
a/arch/alpha/kernel/setup.c | 1
a/arch/arc/Kconfig | 3
a/arch/arc/include/asm/page.h | 20
a/arch/arc/mm/init.c | 29
a/arch/arm/Kconfig | 12
a/arch/arm/kernel/vdso.c | 9
a/arch/arm/mach-bcm/Kconfig | 1
a/arch/arm/mach-davinci/Kconfig | 1
a/arch/arm/mach-exynos/Kconfig | 1
a/arch/arm/mach-highbank/Kconfig | 1
a/arch/arm/mach-omap2/Kconfig | 1
a/arch/arm/mach-s5pv210/Kconfig | 1
a/arch/arm/mach-tango/Kconfig | 1
a/arch/arm/mm/init.c | 78 -
a/arch/arm64/Kconfig | 9
a/arch/arm64/include/asm/cacheflush.h | 1
a/arch/arm64/include/asm/pgtable.h | 1
a/arch/arm64/kernel/vdso.c | 41
a/arch/arm64/mm/init.c | 68 -
a/arch/arm64/mm/pageattr.c | 12
a/arch/ia64/Kconfig | 11
a/arch/ia64/include/asm/meminit.h | 2
a/arch/ia64/mm/contig.c | 88 --
a/arch/ia64/mm/discontig.c | 44 -
a/arch/ia64/mm/init.c | 14
a/arch/ia64/mm/numa.c | 30
a/arch/m68k/Kconfig.cpu | 31
a/arch/m68k/include/asm/page.h | 2
a/arch/m68k/include/asm/page_mm.h | 7
a/arch/m68k/include/asm/virtconvert.h | 7
a/arch/m68k/mm/init.c | 10
a/arch/mips/vdso/genvdso.c | 4
a/arch/nds32/mm/mm-nds32.c | 6
a/arch/powerpc/Kconfig | 5
a/arch/riscv/Kconfig | 4
a/arch/riscv/include/asm/pgtable.h | 2
a/arch/riscv/include/asm/set_memory.h | 1
a/arch/riscv/mm/pageattr.c | 31
a/arch/s390/Kconfig | 4
a/arch/s390/configs/debug_defconfig | 2
a/arch/s390/configs/defconfig | 2
a/arch/s390/kernel/vdso.c | 11
a/arch/sparc/Kconfig | 4
a/arch/sparc/mm/init_64.c | 2
a/arch/x86/Kconfig | 5
a/arch/x86/entry/vdso/vma.c | 17
a/arch/x86/include/asm/set_memory.h | 1
a/arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 2
a/arch/x86/kernel/tboot.c | 1
a/arch/x86/mm/pat/set_memory.c | 6
a/drivers/base/node.c | 2
a/drivers/block/zram/Kconfig | 42
a/drivers/block/zram/zcomp.c | 2
a/drivers/block/zram/zram_drv.c | 29
a/drivers/block/zram/zram_drv.h | 1
a/drivers/dax/device.c | 4
a/drivers/dax/kmem.c | 2
a/drivers/dma-buf/sync_file.c | 3
a/drivers/edac/ghes_edac.c | 4
a/drivers/firmware/efi/efi.c | 1
a/drivers/gpu/drm/drm_atomic.c | 3
a/drivers/hwtracing/intel_th/msu.c | 2
a/drivers/ide/falconide.c | 2
a/drivers/ide/ide-probe.c | 3
a/drivers/misc/lkdtm/Makefile | 1
a/drivers/pinctrl/pinctrl-utils.c | 2
a/drivers/vhost/vringh.c | 3
a/drivers/virtio/virtio_balloon.c | 6
a/drivers/xen/unpopulated-alloc.c | 14
a/fs/aio.c | 5
a/fs/ntfs/file.c | 5
a/fs/ntfs/inode.c | 2
a/fs/ntfs/logfile.c | 3
a/fs/ocfs2/cluster/tcp.c | 1
a/fs/ocfs2/namei.c | 4
a/fs/proc/kcore.c | 2
a/fs/proc/meminfo.c | 2
a/fs/userfaultfd.c | 20
a/include/linux/cgroup-defs.h | 15
a/include/linux/compaction.h | 12
a/include/linux/fs.h | 2
a/include/linux/gfp.h | 2
a/include/linux/highmem.h | 19
a/include/linux/huge_mm.h | 93 --
a/include/linux/memcontrol.h | 148 ---
a/include/linux/migrate.h | 4
a/include/linux/mm.h | 118 +-
a/include/linux/mm_types.h | 8
a/include/linux/mmap_lock.h | 94 ++
a/include/linux/mmzone.h | 50 -
a/include/linux/page-flags.h | 6
a/include/linux/page_ext.h | 8
a/include/linux/pagevec.h | 3
a/include/linux/poison.h | 4
a/include/linux/rmap.h | 1
a/include/linux/sched/mm.h | 16
a/include/linux/set_memory.h | 5
a/include/linux/shmem_fs.h | 6
a/include/linux/slab.h | 18
a/include/linux/vmalloc.h | 8
a/include/linux/vmstat.h | 104 ++
a/include/trace/events/sched.h | 84 +
a/include/uapi/linux/const.h | 5
a/include/uapi/linux/ethtool.h | 2
a/include/uapi/linux/kernel.h | 9
a/include/uapi/linux/lightnvm.h | 2
a/include/uapi/linux/mroute6.h | 2
a/include/uapi/linux/netfilter/x_tables.h | 2
a/include/uapi/linux/netlink.h | 2
a/include/uapi/linux/sysctl.h | 2
a/include/uapi/linux/userfaultfd.h | 9
a/init/main.c | 6
a/ipc/shm.c | 8
a/kernel/cgroup/cgroup.c | 12
a/kernel/fork.c | 3
a/kernel/kthread.c | 29
a/kernel/power/hibernate.c | 2
a/kernel/power/power.h | 2
a/kernel/power/snapshot.c | 52 +
a/kernel/ptrace.c | 2
a/kernel/workqueue.c | 3
a/lib/locking-selftest.c | 47 +
a/lib/test_kasan_module.c | 29
a/mm/Kconfig | 25
a/mm/Kconfig.debug | 28
a/mm/Makefile | 4
a/mm/backing-dev.c | 8
a/mm/cma.c | 6
a/mm/compaction.c | 29
a/mm/filemap.c | 823 ++++++++++---------
a/mm/gup.c | 329 ++-----
a/mm/gup_benchmark.c | 210 ----
a/mm/gup_test.c | 299 ++++++
a/mm/gup_test.h | 40
a/mm/highmem.c | 52 +
a/mm/huge_memory.c | 86 +
a/mm/hugetlb.c | 28
a/mm/init-mm.c | 1
a/mm/internal.h | 5
a/mm/kasan/generic.c | 3
a/mm/kasan/report.c | 4
a/mm/khugepaged.c | 58 -
a/mm/ksm.c | 50 -
a/mm/madvise.c | 14
a/mm/mapping_dirty_helpers.c | 6
a/mm/memblock.c | 80 +
a/mm/memcontrol.c | 170 +--
a/mm/memory-failure.c | 322 +++----
a/mm/memory.c | 24
a/mm/memory_hotplug.c | 44 -
a/mm/mempolicy.c | 8
a/mm/migrate.c | 183 ++--
a/mm/mm_init.c | 1
a/mm/mmap.c | 22
a/mm/mmap_lock.c | 230 +++++
a/mm/mmu_notifier.c | 7
a/mm/mmzone.c | 14
a/mm/mremap.c | 282 ++++--
a/mm/nommu.c | 8
a/mm/oom_kill.c | 14
a/mm/page_alloc.c | 517 ++++++-----
a/mm/page_counter.c | 4
a/mm/page_ext.c | 10
a/mm/page_isolation.c | 18
a/mm/page_owner.c | 17
a/mm/page_poison.c | 56 -
a/mm/page_vma_mapped.c | 9
a/mm/process_vm_access.c | 2
a/mm/rmap.c | 9
a/mm/shmem.c | 39
a/mm/slab.c | 10
a/mm/slab.h | 9
a/mm/slab_common.c | 10
a/mm/slob.c | 6
a/mm/slub.c | 156 +--
a/mm/swap.c | 12
a/mm/swap_state.c | 7
a/mm/swapfile.c | 14
a/mm/truncate.c | 18
a/mm/vmalloc.c | 105 +-
a/mm/vmscan.c | 21
a/mm/vmstat.c | 6
a/mm/workingset.c | 8
a/mm/z3fold.c | 215 ++--
a/mm/zsmalloc.c | 11
a/mm/zswap.c | 193 +++-
a/sound/core/pcm_lib.c | 4
a/tools/include/linux/poison.h | 6
a/tools/testing/selftests/vm/.gitignore | 4
a/tools/testing/selftests/vm/Makefile | 41
a/tools/testing/selftests/vm/check_config.sh | 31
a/tools/testing/selftests/vm/config | 2
a/tools/testing/selftests/vm/gup_benchmark.c | 143 ---
a/tools/testing/selftests/vm/gup_test.c | 258 +++++
a/tools/testing/selftests/vm/hmm-tests.c | 10
a/tools/testing/selftests/vm/mremap_test.c | 344 +++++++
a/tools/testing/selftests/vm/run_vmtests | 51 -
a/tools/testing/selftests/vm/userfaultfd.c | 94 --
217 files changed, 4817 insertions(+), 3369 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 001/200] kthread: add kthread_work tracepoints
2020-12-15 3:02 incoming Andrew Morton
@ 2020-12-15 3:03 ` Andrew Morton
2020-12-15 3:03 ` [patch 002/200] kthread_worker: document CPU hotplug handling Andrew Morton
` (199 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:03 UTC (permalink / raw)
To: a.p.zijlstra, akpm, axboe, ben.dooks, bfields, cl, frederic,
linux-mm, mgorman, mingo, mm-commits, mtosatti, pauld, peterz,
rdunlap, robdclark, rostedt, stamatis.iliass, thara.gopinath,
torvalds, valentin.schneider, vincent.donnefort
From: Rob Clark <robdclark@chromium.org>
Subject: kthread: add kthread_work tracepoints
While migrating some code from wq to kthread_worker, I found that I missed
the execute_start/end tracepoints. So add similar tracepoints for
kthread_work. And for completeness, queue_work tracepoint (although this
one differs slightly from the matching workqueue tracepoint).
Link: https://lkml.kernel.org/r/20201010180323.126634-1-robdclark@gmail.com
Signed-off-by: Rob Clark <robdclark@chromium.org>
Cc: Rob Clark <robdclark@chromium.org>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: "Peter Zijlstra (Intel)" <peterz@infradead.org>
Cc: Phil Auld <pauld@redhat.com>
Cc: Valentin Schneider <valentin.schneider@arm.com>
Cc: Thara Gopinath <thara.gopinath@linaro.org>
Cc: Randy Dunlap <rdunlap@infradead.org>
Cc: Vincent Donnefort <vincent.donnefort@arm.com>
Cc: Mel Gorman <mgorman@techsingularity.net>
Cc: Jens Axboe <axboe@kernel.dk>
Cc: Marcelo Tosatti <mtosatti@redhat.com>
Cc: Frederic Weisbecker <frederic@kernel.org>
Cc: Ilias Stamatis <stamatis.iliass@gmail.com>
Cc: Liang Chen <cl@rock-chips.com>
Cc: Ben Dooks <ben.dooks@codethink.co.uk>
Cc: Peter Zijlstra <a.p.zijlstra@chello.nl>
Cc: "J. Bruce Fields" <bfields@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/trace/events/sched.h | 84 +++++++++++++++++++++++++++++++++
kernel/kthread.c | 9 +++
2 files changed, 93 insertions(+)
--- a/include/trace/events/sched.h~kthread-add-kthread_work-tracepoints
+++ a/include/trace/events/sched.h
@@ -5,6 +5,7 @@
#if !defined(_TRACE_SCHED_H) || defined(TRACE_HEADER_MULTI_READ)
#define _TRACE_SCHED_H
+#include <linux/kthread.h>
#include <linux/sched/numa_balancing.h>
#include <linux/tracepoint.h>
#include <linux/binfmts.h>
@@ -51,6 +52,89 @@ TRACE_EVENT(sched_kthread_stop_ret,
TP_printk("ret=%d", __entry->ret)
);
+/**
+ * sched_kthread_work_queue_work - called when a work gets queued
+ * @worker: pointer to the kthread_worker
+ * @work: pointer to struct kthread_work
+ *
+ * This event occurs when a work is queued immediately or once a
+ * delayed work is actually queued (ie: once the delay has been
+ * reached).
+ */
+TRACE_EVENT(sched_kthread_work_queue_work,
+
+ TP_PROTO(struct kthread_worker *worker,
+ struct kthread_work *work),
+
+ TP_ARGS(worker, work),
+
+ TP_STRUCT__entry(
+ __field( void *, work )
+ __field( void *, function)
+ __field( void *, worker)
+ ),
+
+ TP_fast_assign(
+ __entry->work = work;
+ __entry->function = work->func;
+ __entry->worker = worker;
+ ),
+
+ TP_printk("work struct=%p function=%ps worker=%p",
+ __entry->work, __entry->function, __entry->worker)
+);
+
+/**
+ * sched_kthread_work_execute_start - called immediately before the work callback
+ * @work: pointer to struct kthread_work
+ *
+ * Allows to track kthread work execution.
+ */
+TRACE_EVENT(sched_kthread_work_execute_start,
+
+ TP_PROTO(struct kthread_work *work),
+
+ TP_ARGS(work),
+
+ TP_STRUCT__entry(
+ __field( void *, work )
+ __field( void *, function)
+ ),
+
+ TP_fast_assign(
+ __entry->work = work;
+ __entry->function = work->func;
+ ),
+
+ TP_printk("work struct %p: function %ps", __entry->work, __entry->function)
+);
+
+/**
+ * sched_kthread_work_execute_end - called immediately after the work callback
+ * @work: pointer to struct work_struct
+ * @function: pointer to worker function
+ *
+ * Allows to track workqueue execution.
+ */
+TRACE_EVENT(sched_kthread_work_execute_end,
+
+ TP_PROTO(struct kthread_work *work, kthread_work_func_t function),
+
+ TP_ARGS(work, function),
+
+ TP_STRUCT__entry(
+ __field( void *, work )
+ __field( void *, function)
+ ),
+
+ TP_fast_assign(
+ __entry->work = work;
+ __entry->function = function;
+ ),
+
+ TP_printk("work struct %p: function %ps", __entry->work, __entry->function)
+);
+
/*
* Tracepoint for waking up a task:
*/
--- a/kernel/kthread.c~kthread-add-kthread_work-tracepoints
+++ a/kernel/kthread.c
@@ -704,8 +704,15 @@ repeat:
raw_spin_unlock_irq(&worker->lock);
if (work) {
+ kthread_work_func_t func = work->func;
__set_current_state(TASK_RUNNING);
+ trace_sched_kthread_work_execute_start(work);
work->func(work);
+ /*
+ * Avoid dereferencing work after this point. The trace
+ * event only cares about the address.
+ */
+ trace_sched_kthread_work_execute_end(work, func);
} else if (!freezing(current))
schedule();
@@ -834,6 +841,8 @@ static void kthread_insert_work(struct k
{
kthread_insert_work_sanity_check(worker, work);
+ trace_sched_kthread_work_queue_work(worker, work);
+
list_add_tail(&work->node, pos);
work->worker = worker;
if (!worker->current_work && likely(worker->task))
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 002/200] kthread_worker: document CPU hotplug handling
2020-12-15 3:02 incoming Andrew Morton
2020-12-15 3:03 ` [patch 001/200] kthread: add kthread_work tracepoints Andrew Morton
@ 2020-12-15 3:03 ` Andrew Morton
2020-12-15 3:03 ` [patch 003/200] uapi: move constants from <linux/kernel.h> to <linux/const.h> Andrew Morton
` (198 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:03 UTC (permalink / raw)
To: akpm, linux-mm, mm-commits, pmladek, Qiang.Zhang, tglx, tj,
torvalds
From: Petr Mladek <pmladek@suse.com>
Subject: kthread_worker: document CPU hotplug handling
The kthread worker API is simple. In short, it allows to create, use, and
destroy workers. kthread_create_worker_on_cpu() just allows to bind a
newly created worker to a given CPU.
It is up to the API user how to handle CPU hotplug. They have to decide
how to handle pending work items, prevent queuing new ones, and restore
the functionality when the CPU goes off and on. There are few catches:
+ The CPU affinity gets lost when it is scheduled on an offline CPU.
+ The worker might not exist when the CPU was off when the user
created the workers.
A good practice is to implement two CPU hotplug callbacks and
destroy/create the worker when CPU goes down/up.
Mention this in the function description.
[akpm@linux-foundation.org: grammar tweaks]
Link: https://lore.kernel.org/r/20201028073031.4536-1-qiang.zhang@windriver.com
Link: https://lkml.kernel.org/r/20201102101039.19227-1-pmladek@suse.com
Reported-by: Zhang Qiang <Qiang.Zhang@windriver.com>
Signed-off-by: Petr Mladek <pmladek@suse.com>
Cc: Tejun Heo <tj@kernel.org>
Cc: Thomas Gleixner <tglx@linutronix.de>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
kernel/kthread.c | 20 +++++++++++++++++++-
1 file changed, 19 insertions(+), 1 deletion(-)
--- a/kernel/kthread.c~kthread_worker-document-cpu-hotplug-handling
+++ a/kernel/kthread.c
@@ -793,7 +793,25 @@ EXPORT_SYMBOL(kthread_create_worker);
* A good practice is to add the cpu number also into the worker name.
* For example, use kthread_create_worker_on_cpu(cpu, "helper/%d", cpu).
*
- * Returns a pointer to the allocated worker on success, ERR_PTR(-ENOMEM)
+ * CPU hotplug:
+ * The kthread worker API is simple and generic. It just provides a way
+ * to create, use, and destroy workers.
+ *
+ * It is up to the API user how to handle CPU hotplug. They have to decide
+ * how to handle pending work items, prevent queuing new ones, and
+ * restore the functionality when the CPU goes off and on. There are a
+ * few catches:
+ *
+ * - CPU affinity gets lost when it is scheduled on an offline CPU.
+ *
+ * - The worker might not exist when the CPU was off when the user
+ * created the workers.
+ *
+ * Good practice is to implement two CPU hotplug callbacks and to
+ * destroy/create the worker when the CPU goes down/up.
+ *
+ * Return:
+ * The pointer to the allocated worker on success, ERR_PTR(-ENOMEM)
* when the needed structures could not get allocated, and ERR_PTR(-EINTR)
* when the worker was SIGKILLed.
*/
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 003/200] uapi: move constants from <linux/kernel.h> to <linux/const.h>
2020-12-15 3:02 incoming Andrew Morton
2020-12-15 3:03 ` [patch 001/200] kthread: add kthread_work tracepoints Andrew Morton
2020-12-15 3:03 ` [patch 002/200] kthread_worker: document CPU hotplug handling Andrew Morton
@ 2020-12-15 3:03 ` Andrew Morton
2020-12-15 3:03 ` [patch 004/200] ide/falcon: remove in_interrupt() usage Andrew Morton
` (197 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:03 UTC (permalink / raw)
To: akpm, baruch, dalias, dalias, fweimer, linux-mm, mm-commits,
peter, petr.vorel, torvalds
From: Petr Vorel <petr.vorel@gmail.com>
Subject: uapi: move constants from <linux/kernel.h> to <linux/const.h>
and include <linux/const.h> in UAPI headers instead of <linux/kernel.h>.
The reason is to avoid indirect <linux/sysinfo.h> include when using
some network headers: <linux/netlink.h> or others -> <linux/kernel.h>
-> <linux/sysinfo.h>.
This indirect include causes on MUSL redefinition of struct sysinfo when
included both <sys/sysinfo.h> and some of UAPI headers:
In file included from x86_64-buildroot-linux-musl/sysroot/usr/include/linux/kernel.h:5,
from x86_64-buildroot-linux-musl/sysroot/usr/include/linux/netlink.h:5,
from ../include/tst_netlink.h:14,
from tst_crypto.c:13:
x86_64-buildroot-linux-musl/sysroot/usr/include/linux/sysinfo.h:8:8: error: redefinition of `struct sysinfo'
struct sysinfo {
^~~~~~~
In file included from ../include/tst_safe_macros.h:15,
from ../include/tst_test.h:93,
from tst_crypto.c:11:
x86_64-buildroot-linux-musl/sysroot/usr/include/sys/sysinfo.h:10:8: note: originally defined here
Link: https://lkml.kernel.org/r/20201015190013.8901-1-petr.vorel@gmail.com
Signed-off-by: Petr Vorel <petr.vorel@gmail.com>
Suggested-by: Rich Felker <dalias@aerifal.cx>
Acked-by: Rich Felker <dalias@libc.org>
Cc: Peter Korsgaard <peter@korsgaard.com>
Cc: Baruch Siach <baruch@tkos.co.il>
Cc: Florian Weimer <fweimer@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/uapi/linux/const.h | 5 +++++
include/uapi/linux/ethtool.h | 2 +-
include/uapi/linux/kernel.h | 9 +--------
include/uapi/linux/lightnvm.h | 2 +-
include/uapi/linux/mroute6.h | 2 +-
include/uapi/linux/netfilter/x_tables.h | 2 +-
include/uapi/linux/netlink.h | 2 +-
include/uapi/linux/sysctl.h | 2 +-
8 files changed, 12 insertions(+), 14 deletions(-)
--- a/include/uapi/linux/const.h~uapi-move-constants-from-linux-kernelh-to-linux-consth
+++ a/include/uapi/linux/const.h
@@ -28,4 +28,9 @@
#define _BITUL(x) (_UL(1) << (x))
#define _BITULL(x) (_ULL(1) << (x))
+#define __ALIGN_KERNEL(x, a) __ALIGN_KERNEL_MASK(x, (typeof(x))(a) - 1)
+#define __ALIGN_KERNEL_MASK(x, mask) (((x) + (mask)) & ~(mask))
+
+#define __KERNEL_DIV_ROUND_UP(n, d) (((n) + (d) - 1) / (d))
+
#endif /* _UAPI_LINUX_CONST_H */
--- a/include/uapi/linux/ethtool.h~uapi-move-constants-from-linux-kernelh-to-linux-consth
+++ a/include/uapi/linux/ethtool.h
@@ -14,7 +14,7 @@
#ifndef _UAPI_LINUX_ETHTOOL_H
#define _UAPI_LINUX_ETHTOOL_H
-#include <linux/kernel.h>
+#include <linux/const.h>
#include <linux/types.h>
#include <linux/if_ether.h>
--- a/include/uapi/linux/kernel.h~uapi-move-constants-from-linux-kernelh-to-linux-consth
+++ a/include/uapi/linux/kernel.h
@@ -3,13 +3,6 @@
#define _UAPI_LINUX_KERNEL_H
#include <linux/sysinfo.h>
-
-/*
- * 'kernel.h' contains some often-used function prototypes etc
- */
-#define __ALIGN_KERNEL(x, a) __ALIGN_KERNEL_MASK(x, (typeof(x))(a) - 1)
-#define __ALIGN_KERNEL_MASK(x, mask) (((x) + (mask)) & ~(mask))
-
-#define __KERNEL_DIV_ROUND_UP(n, d) (((n) + (d) - 1) / (d))
+#include <linux/const.h>
#endif /* _UAPI_LINUX_KERNEL_H */
--- a/include/uapi/linux/lightnvm.h~uapi-move-constants-from-linux-kernelh-to-linux-consth
+++ a/include/uapi/linux/lightnvm.h
@@ -21,7 +21,7 @@
#define _UAPI_LINUX_LIGHTNVM_H
#ifdef __KERNEL__
-#include <linux/kernel.h>
+#include <linux/const.h>
#include <linux/ioctl.h>
#else /* __KERNEL__ */
#include <stdio.h>
--- a/include/uapi/linux/mroute6.h~uapi-move-constants-from-linux-kernelh-to-linux-consth
+++ a/include/uapi/linux/mroute6.h
@@ -2,7 +2,7 @@
#ifndef _UAPI__LINUX_MROUTE6_H
#define _UAPI__LINUX_MROUTE6_H
-#include <linux/kernel.h>
+#include <linux/const.h>
#include <linux/types.h>
#include <linux/sockios.h>
#include <linux/in6.h> /* For struct sockaddr_in6. */
--- a/include/uapi/linux/netfilter/x_tables.h~uapi-move-constants-from-linux-kernelh-to-linux-consth
+++ a/include/uapi/linux/netfilter/x_tables.h
@@ -1,7 +1,7 @@
/* SPDX-License-Identifier: GPL-2.0 WITH Linux-syscall-note */
#ifndef _UAPI_X_TABLES_H
#define _UAPI_X_TABLES_H
-#include <linux/kernel.h>
+#include <linux/const.h>
#include <linux/types.h>
#define XT_FUNCTION_MAXNAMELEN 30
--- a/include/uapi/linux/netlink.h~uapi-move-constants-from-linux-kernelh-to-linux-consth
+++ a/include/uapi/linux/netlink.h
@@ -2,7 +2,7 @@
#ifndef _UAPI__LINUX_NETLINK_H
#define _UAPI__LINUX_NETLINK_H
-#include <linux/kernel.h>
+#include <linux/const.h>
#include <linux/socket.h> /* for __kernel_sa_family_t */
#include <linux/types.h>
--- a/include/uapi/linux/sysctl.h~uapi-move-constants-from-linux-kernelh-to-linux-consth
+++ a/include/uapi/linux/sysctl.h
@@ -23,7 +23,7 @@
#ifndef _UAPI_LINUX_SYSCTL_H
#define _UAPI_LINUX_SYSCTL_H
-#include <linux/kernel.h>
+#include <linux/const.h>
#include <linux/types.h>
#include <linux/compiler.h>
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 004/200] ide/falcon: remove in_interrupt() usage
2020-12-15 3:02 incoming Andrew Morton
` (2 preceding siblings ...)
2020-12-15 3:03 ` [patch 003/200] uapi: move constants from <linux/kernel.h> to <linux/const.h> Andrew Morton
@ 2020-12-15 3:03 ` Andrew Morton
2020-12-15 3:03 ` [patch 005/200] ide: remove BUG_ON(in_interrupt() || irqs_disabled()) from ide_unregister() Andrew Morton
` (196 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:03 UTC (permalink / raw)
To: akpm, bigeasy, davem, linux-mm, mm-commits, torvalds
From: Sebastian Andrzej Siewior <bigeasy@linutronix.de>
Subject: ide/falcon: remove in_interrupt() usage
falconide_get_lock() is called by ide_lock_host() and its caller
(ide_issue_rq()) has already a might_sleep() check.
stdma_lock() has wait_event() which also has a might_sleep() check.
Remove the in_interrupt() check.
Link: https://lkml.kernel.org/r/20201113161021.2217361-2-bigeasy@linutronix.de
Signed-off-by: Sebastian Andrzej Siewior <bigeasy@linutronix.de>
Cc: "David S. Miller" <davem@davemloft.net>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/ide/falconide.c | 2 --
1 file changed, 2 deletions(-)
--- a/drivers/ide/falconide.c~ide-falcon-remove-in_interrupt-usage
+++ a/drivers/ide/falconide.c
@@ -51,8 +51,6 @@ static void falconide_release_lock(void)
static void falconide_get_lock(irq_handler_t handler, void *data)
{
if (falconide_intr_lock == 0) {
- if (in_interrupt() > 0)
- panic("Falcon IDE hasn't ST-DMA lock in interrupt");
stdma_lock(handler, data);
falconide_intr_lock = 1;
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 005/200] ide: remove BUG_ON(in_interrupt() || irqs_disabled()) from ide_unregister()
2020-12-15 3:02 incoming Andrew Morton
` (3 preceding siblings ...)
2020-12-15 3:03 ` [patch 004/200] ide/falcon: remove in_interrupt() usage Andrew Morton
@ 2020-12-15 3:03 ` Andrew Morton
2020-12-15 3:03 ` [patch 006/200] fs/ntfs: remove unused varibles Andrew Morton
` (195 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:03 UTC (permalink / raw)
To: akpm, axboe, bigeasy, davem, linux-mm, mm-commits, torvalds
From: Sebastian Andrzej Siewior <bigeasy@linutronix.de>
Subject: ide: remove BUG_ON(in_interrupt() || irqs_disabled()) from ide_unregister()
In the discussion about preempt count consistency across kernel
configurations:
https://lore.kernel.org/r/20200914204209.256266093@linutronix.de/
it was concluded that the usage of in_interrupt() and related context
checks should be removed from non-core code.
Both BUG_ON()s in ide-probe.c were introduced in commit
4015c949fb465 ("[PATCH] update ide core")
when ide_unregister() was extended with semaphore based locking. Both
checks won't complain about disabled preemption which is also wrong.
The might_sleep() in today's mutex_lock() will complain about the
missuses.
Remove the BUG_ON() statements.
Link: https://lkml.kernel.org/r/20201120092421.1023428-3-bigeasy@linutronix.de
Signed-off-by: Sebastian Andrzej Siewior <bigeasy@linutronix.de>
Acked-by: Jens Axboe <axboe@kernel.dk>
Cc: "David S. Miller" <davem@davemloft.net>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/ide/ide-probe.c | 3 ---
1 file changed, 3 deletions(-)
--- a/drivers/ide/ide-probe.c~ide-remove-bug_onin_interrupt-irqs_disabled-from-ide_unregister
+++ a/drivers/ide/ide-probe.c
@@ -1592,9 +1592,6 @@ EXPORT_SYMBOL_GPL(ide_port_unregister_de
static void ide_unregister(ide_hwif_t *hwif)
{
- BUG_ON(in_interrupt());
- BUG_ON(irqs_disabled());
-
mutex_lock(&ide_cfg_mtx);
if (hwif->present) {
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 006/200] fs/ntfs: remove unused varibles
2020-12-15 3:02 incoming Andrew Morton
` (4 preceding siblings ...)
2020-12-15 3:03 ` [patch 005/200] ide: remove BUG_ON(in_interrupt() || irqs_disabled()) from ide_unregister() Andrew Morton
@ 2020-12-15 3:03 ` Andrew Morton
2020-12-15 3:03 ` [patch 007/200] fs/ntfs: remove unused variable attr_len Andrew Morton
` (194 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:03 UTC (permalink / raw)
To: akpm, alex.shi, anton, linux-mm, mm-commits, torvalds
From: Alex Shi <alex.shi@linux.alibaba.com>
Subject: fs/ntfs: remove unused varibles
We actually don't use these varibles, so remove them to avoid gcc warning:
fs/ntfs/file.c:326:14: warning: variable `base_ni' set but not used
[-Wunused-but-set-variable]
fs/ntfs/logfile.c:481:21: warning: variable `log_page_mask' set but not
used [-Wunused-but-set-variable]
Link: https://lkml.kernel.org/r/1604821092-54631-1-git-send-email-alex.shi@linux.alibaba.com
Signed-off-by: Alex Shi <alex.shi@linux.alibaba.com>
Acked-by: Anton Altaparmakov <anton@tuxera.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/ntfs/file.c | 5 +----
fs/ntfs/logfile.c | 3 +--
2 files changed, 2 insertions(+), 6 deletions(-)
--- a/fs/ntfs/file.c~fs-ntfs-remove-unused-varibles
+++ a/fs/ntfs/file.c
@@ -323,7 +323,7 @@ static ssize_t ntfs_prepare_file_for_wri
unsigned long flags;
struct file *file = iocb->ki_filp;
struct inode *vi = file_inode(file);
- ntfs_inode *base_ni, *ni = NTFS_I(vi);
+ ntfs_inode *ni = NTFS_I(vi);
ntfs_volume *vol = ni->vol;
ntfs_debug("Entering for i_ino 0x%lx, attribute type 0x%x, pos "
@@ -365,9 +365,6 @@ static ssize_t ntfs_prepare_file_for_wri
err = -EOPNOTSUPP;
goto out;
}
- base_ni = ni;
- if (NInoAttr(ni))
- base_ni = ni->ext.base_ntfs_ino;
err = file_remove_privs(file);
if (unlikely(err))
goto out;
--- a/fs/ntfs/logfile.c~fs-ntfs-remove-unused-varibles
+++ a/fs/ntfs/logfile.c
@@ -478,7 +478,7 @@ bool ntfs_check_logfile(struct inode *lo
u8 *kaddr = NULL;
RESTART_PAGE_HEADER *rstr1_ph = NULL;
RESTART_PAGE_HEADER *rstr2_ph = NULL;
- int log_page_size, log_page_mask, err;
+ int log_page_size, err;
bool logfile_is_empty = true;
u8 log_page_bits;
@@ -501,7 +501,6 @@ bool ntfs_check_logfile(struct inode *lo
log_page_size = DefaultLogPageSize;
else
log_page_size = PAGE_SIZE;
- log_page_mask = log_page_size - 1;
/*
* Use ntfs_ffs() instead of ffs() to enable the compiler to
* optimize log_page_size and log_page_bits into constants.
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 007/200] fs/ntfs: remove unused variable attr_len
2020-12-15 3:02 incoming Andrew Morton
` (5 preceding siblings ...)
2020-12-15 3:03 ` [patch 006/200] fs/ntfs: remove unused varibles Andrew Morton
@ 2020-12-15 3:03 ` Andrew Morton
2020-12-15 3:03 ` [patch 008/200] fs/ocfs2/cluster/tcp.c: remove unneeded break Andrew Morton
` (193 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:03 UTC (permalink / raw)
To: akpm, alex.shi, anton, linux-mm, mm-commits, torvalds
From: Alex Shi <alex.shi@linux.alibaba.com>
Subject: fs/ntfs: remove unused variable attr_len
This variable isn't used anymore, remove it to skip W=1 warning:
fs/ntfs/inode.c:2350:6: warning: variable `attr_len' set but not used
[-Wunused-but-set-variable]
Link: https://lkml.kernel.org/r/4194376f-898b-b602-81c3-210567712092@linux.alibaba.com
Signed-off-by: Alex Shi <alex.shi@linux.alibaba.com>
Acked-by: Anton Altaparmakov <anton@tuxera.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/ntfs/inode.c | 2 --
1 file changed, 2 deletions(-)
--- a/fs/ntfs/inode.c~fs-ntfs-remove-unused-varible-attr_len
+++ a/fs/ntfs/inode.c
@@ -2347,7 +2347,6 @@ int ntfs_truncate(struct inode *vi)
ATTR_RECORD *a;
const char *te = " Leaving file length out of sync with i_size.";
int err, mp_size, size_change, alloc_change;
- u32 attr_len;
ntfs_debug("Entering for inode 0x%lx.", vi->i_ino);
BUG_ON(NInoAttr(ni));
@@ -2721,7 +2720,6 @@ do_non_resident_truncate:
* this cannot fail since we are making the attribute smaller thus by
* definition there is enough space to do so.
*/
- attr_len = le32_to_cpu(a->length);
err = ntfs_attr_record_resize(m, a, mp_size +
le16_to_cpu(a->data.non_resident.mapping_pairs_offset));
BUG_ON(err);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 008/200] fs/ocfs2/cluster/tcp.c: remove unneeded break
2020-12-15 3:02 incoming Andrew Morton
` (6 preceding siblings ...)
2020-12-15 3:03 ` [patch 007/200] fs/ntfs: remove unused variable attr_len Andrew Morton
@ 2020-12-15 3:03 ` Andrew Morton
2020-12-15 3:03 ` [patch 009/200] ocfs2: ratelimit the 'max lookup times reached' notice Andrew Morton
` (192 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:03 UTC (permalink / raw)
To: akpm, gechangwei, ghe, jlbec, joseph.qi, junxiao.bi, linux-mm,
mark, mm-commits, piaojun, torvalds, trix
From: Tom Rix <trix@redhat.com>
Subject: fs/ocfs2/cluster/tcp.c: remove unneeded break
A break is not needed if it is preceded by a goto
Link: https://lkml.kernel.org/r/20201019175216.2329-1-trix@redhat.com
Signed-off-by: Tom Rix <trix@redhat.com>
Acked-by: Joseph Qi <joseph.qi@linux.alibaba.com>
Cc: Mark Fasheh <mark@fasheh.com>
Cc: Joel Becker <jlbec@evilplan.org>
Cc: Junxiao Bi <junxiao.bi@oracle.com>
Cc: Changwei Ge <gechangwei@live.cn>
Cc: Gang He <ghe@suse.com>
Cc: Jun Piao <piaojun@huawei.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/ocfs2/cluster/tcp.c | 1 -
1 file changed, 1 deletion(-)
--- a/fs/ocfs2/cluster/tcp.c~fs-ocfs2-remove-unneeded-break
+++ a/fs/ocfs2/cluster/tcp.c
@@ -1198,7 +1198,6 @@ static int o2net_process_message(struct
msglog(hdr, "bad magic\n");
ret = -EINVAL;
goto out;
- break;
}
/* find a handler for it */
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 009/200] ocfs2: ratelimit the 'max lookup times reached' notice
2020-12-15 3:02 incoming Andrew Morton
` (7 preceding siblings ...)
2020-12-15 3:03 ` [patch 008/200] fs/ocfs2/cluster/tcp.c: remove unneeded break Andrew Morton
@ 2020-12-15 3:03 ` Andrew Morton
2020-12-15 3:03 ` [patch 010/200] arch/Kconfig: fix spelling mistakes Andrew Morton
` (191 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:03 UTC (permalink / raw)
To: akpm, gechangwei, ghe, jlbec, joseph.qi, junxiao.bi, linux-mm,
mark, mfo, mm-commits, piaojun, torvalds
From: Mauricio Faria de Oliveira <mfo@canonical.com>
Subject: ocfs2: ratelimit the 'max lookup times reached' notice
Running stress-ng on ocfs2 completely fills the kernel log with 'max
lookup times reached, filesystem may have nested directories.'
Let's ratelimit this message as done with others in the code.
Test-case:
# mkfs.ocfs2 --mount local $DEV
# mount $DEV $MNT
# cd $MNT
# dmesg -C
# stress-ng --dirdeep 1 --dirdeep-ops 1000
# dmesg | grep -c 'max lookup times reached'
Before:
# dmesg -C
# stress-ng --dirdeep 1 --dirdeep-ops 1000
...
stress-ng: info: [11116] successful run completed in 3.03s
# dmesg | grep -c 'max lookup times reached'
967
After:
# dmesg -C
# stress-ng --dirdeep 1 --dirdeep-ops 1000
...
stress-ng: info: [739] successful run completed in 0.96s
# dmesg | grep -c 'max lookup times reached'
10
# dmesg
[ 259.086086] ocfs2_check_if_ancestor: 1990 callbacks suppressed
[ 259.086092] (stress-ng-dirde,740,1):ocfs2_check_if_ancestor:1091 max lookup times reached, filesystem may have nested directories, src inode: 18007, dest inode: 17940.
...
Link: https://lkml.kernel.org/r/20201001224417.478263-1-mfo@canonical.com
Signed-off-by: Mauricio Faria de Oliveira <mfo@canonical.com>
Reviewed-by: Joseph Qi <joseph.qi@linux.alibaba.com>
Cc: Mark Fasheh <mark@fasheh.com>
Cc: Joel Becker <jlbec@evilplan.org>
Cc: Junxiao Bi <junxiao.bi@oracle.com>
Cc: Changwei Ge <gechangwei@live.cn>
Cc: Gang He <ghe@suse.com>
Cc: Jun Piao <piaojun@huawei.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/ocfs2/namei.c | 4 ++--
1 file changed, 2 insertions(+), 2 deletions(-)
--- a/fs/ocfs2/namei.c~ocfs2-ratelimit-the-max-lookup-times-reached-notice
+++ a/fs/ocfs2/namei.c
@@ -1088,8 +1088,8 @@ static int ocfs2_check_if_ancestor(struc
child_inode_no = parent_inode_no;
if (++i >= MAX_LOOKUP_TIMES) {
- mlog(ML_NOTICE, "max lookup times reached, filesystem "
- "may have nested directories, "
+ mlog_ratelimited(ML_NOTICE, "max lookup times reached, "
+ "filesystem may have nested directories, "
"src inode: %llu, dest inode: %llu.\n",
(unsigned long long)src_inode_no,
(unsigned long long)dest_inode_no);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 010/200] arch/Kconfig: fix spelling mistakes
2020-12-15 3:02 incoming Andrew Morton
` (8 preceding siblings ...)
2020-12-15 3:03 ` [patch 009/200] ocfs2: ratelimit the 'max lookup times reached' notice Andrew Morton
@ 2020-12-15 3:03 ` Andrew Morton
2020-12-15 3:03 ` [patch 011/200] mm/slab_common.c: use list_for_each_entry in dump_unreclaimable_slab() Andrew Morton
` (190 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:03 UTC (permalink / raw)
To: akpm, colin.king, linux-mm, mm-commits, rdunlap, torvalds
From: Colin Ian King <colin.king@canonical.com>
Subject: arch/Kconfig: fix spelling mistakes
There are a few spelling mistakes in the Kconfig comments and help text.
Fix these.
Link: https://lkml.kernel.org/r/20201207155004.171962-1-colin.king@canonical.com
Signed-off-by: Colin Ian King <colin.king@canonical.com>
Acked-by: Randy Dunlap <rdunlap@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/Kconfig | 8 ++++----
1 file changed, 4 insertions(+), 4 deletions(-)
--- a/arch/Kconfig~arch-fix-spelling-mistakes-in-kconfig
+++ a/arch/Kconfig
@@ -261,7 +261,7 @@ config ARCH_HAS_SET_DIRECT_MAP
#
# Select if the architecture provides the arch_dma_set_uncached symbol to
-# either provide an uncached segement alias for a DMA allocation, or
+# either provide an uncached segment alias for a DMA allocation, or
# to remap the page tables in place.
#
config ARCH_HAS_DMA_SET_UNCACHED
@@ -314,14 +314,14 @@ config ARCH_32BIT_OFF_T
config HAVE_ASM_MODVERSIONS
bool
help
- This symbol should be selected by an architecure if it provides
+ This symbol should be selected by an architecture if it provides
<asm/asm-prototypes.h> to support the module versioning for symbols
exported from assembly code.
config HAVE_REGS_AND_STACK_ACCESS_API
bool
help
- This symbol should be selected by an architecure if it supports
+ This symbol should be selected by an architecture if it supports
the API needed to access registers and stack entries from pt_regs,
declared in asm/ptrace.h
For example the kprobes-based event tracer needs this API.
@@ -336,7 +336,7 @@ config HAVE_RSEQ
config HAVE_FUNCTION_ARG_ACCESS_API
bool
help
- This symbol should be selected by an architecure if it supports
+ This symbol should be selected by an architecture if it supports
the API needed to access function arguments from pt_regs,
declared in asm/ptrace.h
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 011/200] mm/slab_common.c: use list_for_each_entry in dump_unreclaimable_slab()
2020-12-15 3:02 incoming Andrew Morton
` (9 preceding siblings ...)
2020-12-15 3:03 ` [patch 010/200] arch/Kconfig: fix spelling mistakes Andrew Morton
@ 2020-12-15 3:03 ` Andrew Morton
2020-12-15 3:03 ` [patch 012/200] mm: slab: clarify krealloc()'s behavior with __GFP_ZERO Andrew Morton
` (189 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:03 UTC (permalink / raw)
To: akpm, cl, iamjoonsoo.kim, linux-mm, mm-commits, penberg, rientjes,
sh_def, torvalds
From: Hui Su <sh_def@163.com>
Subject: mm/slab_common.c: use list_for_each_entry in dump_unreclaimable_slab()
dump_unreclaimable_slab() acquires the slab_mutex first, and it won't
remove any slab_caches list entry when itering the slab_caches lists.
Thus we do not need list_for_each_entry_safe here, which is against
removal of list entry.
Link: https://lkml.kernel.org/r/20200926043440.GA180545@rlk
Signed-off-by: Hui Su <sh_def@163.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: David Rientjes <rientjes@google.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/slab_common.c | 4 ++--
1 file changed, 2 insertions(+), 2 deletions(-)
--- a/mm/slab_common.c~mmslab_common-use-list_for_each_entry-in-dump_unreclaimable_slab
+++ a/mm/slab_common.c
@@ -978,7 +978,7 @@ static int slab_show(struct seq_file *m,
void dump_unreclaimable_slab(void)
{
- struct kmem_cache *s, *s2;
+ struct kmem_cache *s;
struct slabinfo sinfo;
/*
@@ -996,7 +996,7 @@ void dump_unreclaimable_slab(void)
pr_info("Unreclaimable slab info:\n");
pr_info("Name Used Total\n");
- list_for_each_entry_safe(s, s2, &slab_caches, list) {
+ list_for_each_entry(s, &slab_caches, list) {
if (s->flags & SLAB_RECLAIM_ACCOUNT)
continue;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 012/200] mm: slab: clarify krealloc()'s behavior with __GFP_ZERO
2020-12-15 3:02 incoming Andrew Morton
` (10 preceding siblings ...)
2020-12-15 3:03 ` [patch 011/200] mm/slab_common.c: use list_for_each_entry in dump_unreclaimable_slab() Andrew Morton
@ 2020-12-15 3:03 ` Andrew Morton
2020-12-15 14:30 ` Christian König
2020-12-15 3:03 ` [patch 013/200] mm: slab: provide krealloc_array() Andrew Morton
` (188 subsequent siblings)
200 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:03 UTC (permalink / raw)
To: airlied, akpm, alexander.shishkin, andriy.shevchenko,
bgolaszewski, bp, bp, christian.koenig, cl, daniel.vetter, daniel,
gustavo, iamjoonsoo.kim, james.morse, jasowang, linus.walleij,
linux-mm, maarten.lankhorst, mchehab, mm-commits, mripard, mst,
penberg, perex, rientjes, rric, sumit.semwal, tiwai, tiwai,
tony.luck, torvalds, tzimmermann, vbabka
From: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Subject: mm: slab: clarify krealloc()'s behavior with __GFP_ZERO
Patch series "slab: provide and use krealloc_array()", v3.
Andy brought to my attention the fact that users allocating an array of
equally sized elements should check if the size multiplication doesn't
overflow. This is why we have helpers like kmalloc_array().
However we don't have krealloc_array() equivalent and there are many users
who do their own multiplication when calling krealloc() for arrays.
This series provides krealloc_array() and uses it in a couple places.
A separate series will follow adding devm_krealloc_array() which is needed
in the xilinx adc driver.
This patch (of 9):
__GFP_ZERO is ignored by krealloc() (unless we fall-back to kmalloc()
path, in which case it's honored). Point that out in the kerneldoc.
Link: https://lkml.kernel.org/r/20201109110654.12547-1-brgl@bgdev.pl
Link: https://lkml.kernel.org/r/20201109110654.12547-2-brgl@bgdev.pl
Signed-off-by: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com>
Cc: Sumit Semwal <sumit.semwal@linaro.org>
Cc: Gustavo Padovan <gustavo@padovan.org>
Cc: Christian Knig <christian.koenig@amd.com>
Cc: Mauro Carvalho Chehab <mchehab@kernel.org>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Tony Luck <tony.luck@intel.com>
Cc: James Morse <james.morse@arm.com>
Cc: Robert Richter <rric@kernel.org>
Cc: Maarten Lankhorst <maarten.lankhorst@linux.intel.com>
Cc: Maxime Ripard <mripard@kernel.org>
Cc: Thomas Zimmermann <tzimmermann@suse.de>
Cc: David Airlie <airlied@linux.ie>
Cc: Daniel Vetter <daniel@ffwll.ch>
Cc: Alexander Shishkin <alexander.shishkin@linux.intel.com>
Cc: Linus Walleij <linus.walleij@linaro.org>
Cc: "Michael S . Tsirkin" <mst@redhat.com>
Cc: Jason Wang <jasowang@redhat.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: David Rientjes <rientjes@google.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Jaroslav Kysela <perex@perex.cz>
Cc: Takashi Iwai <tiwai@suse.com>
Cc: Borislav Petkov <bp@suse.de>
Cc: Daniel Vetter <daniel.vetter@ffwll.ch>
Cc: Takashi Iwai <tiwai@suse.de>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/slab_common.c | 6 +++---
1 file changed, 3 insertions(+), 3 deletions(-)
--- a/mm/slab_common.c~mm-slab-clarify-kreallocs-behavior-with-__gfp_zero
+++ a/mm/slab_common.c
@@ -1091,9 +1091,9 @@ static __always_inline void *__do_kreall
* @flags: the type of memory to allocate.
*
* The contents of the object pointed to are preserved up to the
- * lesser of the new and old sizes. If @p is %NULL, krealloc()
- * behaves exactly like kmalloc(). If @new_size is 0 and @p is not a
- * %NULL pointer, the object pointed to is freed.
+ * lesser of the new and old sizes (__GFP_ZERO flag is effectively ignored).
+ * If @p is %NULL, krealloc() behaves exactly like kmalloc(). If @new_size
+ * is 0 and @p is not a %NULL pointer, the object pointed to is freed.
*
* Return: pointer to the allocated memory or %NULL in case of error
*/
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 013/200] mm: slab: provide krealloc_array()
2020-12-15 3:02 incoming Andrew Morton
` (11 preceding siblings ...)
2020-12-15 3:03 ` [patch 012/200] mm: slab: clarify krealloc()'s behavior with __GFP_ZERO Andrew Morton
@ 2020-12-15 3:03 ` Andrew Morton
2020-12-15 3:03 ` [patch 014/200] ALSA: pcm: use krealloc_array() Andrew Morton
` (187 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:03 UTC (permalink / raw)
To: airlied, akpm, alexander.shishkin, andriy.shevchenko,
bgolaszewski, bp, bp, christian.koenig, cl, daniel.vetter, daniel,
gustavo, iamjoonsoo.kim, james.morse, jasowang, linus.walleij,
linux-mm, maarten.lankhorst, mchehab, mm-commits, mripard, mst,
penberg, perex, rientjes, rric, sumit.semwal, tiwai, tiwai,
tony.luck, torvalds, tzimmermann, vbabka
From: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Subject: mm: slab: provide krealloc_array()
When allocating an array of elements, users should check for
multiplication overflow or preferably use one of the provided helpers
like: kmalloc_array().
There's no krealloc_array() counterpart but there are many users who use
regular krealloc() to reallocate arrays. Let's provide an actual
krealloc_array() implementation.
While at it: add some documentation regarding krealloc.
Link: https://lkml.kernel.org/r/20201109110654.12547-3-brgl@bgdev.pl
Signed-off-by: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Cc: Alexander Shishkin <alexander.shishkin@linux.intel.com>
Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Borislav Petkov <bp@suse.de>
Cc: Christian Knig <christian.koenig@amd.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Daniel Vetter <daniel@ffwll.ch>
Cc: Daniel Vetter <daniel.vetter@ffwll.ch>
Cc: David Airlie <airlied@linux.ie>
Cc: David Rientjes <rientjes@google.com>
Cc: Gustavo Padovan <gustavo@padovan.org>
Cc: James Morse <james.morse@arm.com>
Cc: Jaroslav Kysela <perex@perex.cz>
Cc: Jason Wang <jasowang@redhat.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Linus Walleij <linus.walleij@linaro.org>
Cc: Maarten Lankhorst <maarten.lankhorst@linux.intel.com>
Cc: Mauro Carvalho Chehab <mchehab@kernel.org>
Cc: Maxime Ripard <mripard@kernel.org>
Cc: "Michael S . Tsirkin" <mst@redhat.com>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Robert Richter <rric@kernel.org>
Cc: Sumit Semwal <sumit.semwal@linaro.org>
Cc: Takashi Iwai <tiwai@suse.com>
Cc: Takashi Iwai <tiwai@suse.de>
Cc: Thomas Zimmermann <tzimmermann@suse.de>
Cc: Tony Luck <tony.luck@intel.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/core-api/memory-allocation.rst | 4 +++
include/linux/slab.h | 18 +++++++++++++++++
2 files changed, 22 insertions(+)
--- a/Documentation/core-api/memory-allocation.rst~mm-slab-provide-krealloc_array
+++ a/Documentation/core-api/memory-allocation.rst
@@ -147,6 +147,10 @@ The address of a chunk allocated with `k
ARCH_KMALLOC_MINALIGN bytes. For sizes which are a power of two, the
alignment is also guaranteed to be at least the respective size.
+Chunks allocated with kmalloc() can be resized with krealloc(). Similarly
+to kmalloc_array(): a helper for resizing arrays is provided in the form of
+krealloc_array().
+
For large allocations you can use vmalloc() and vzalloc(), or directly
request pages from the page allocator. The memory allocated by `vmalloc`
and related functions is not physically contiguous.
--- a/include/linux/slab.h~mm-slab-provide-krealloc_array
+++ a/include/linux/slab.h
@@ -593,6 +593,24 @@ static inline void *kmalloc_array(size_t
}
/**
+ * krealloc_array - reallocate memory for an array.
+ * @p: pointer to the memory chunk to reallocate
+ * @new_n: new number of elements to alloc
+ * @new_size: new size of a single member of the array
+ * @flags: the type of memory to allocate (see kmalloc)
+ */
+static __must_check inline void *
+krealloc_array(void *p, size_t new_n, size_t new_size, gfp_t flags)
+{
+ size_t bytes;
+
+ if (unlikely(check_mul_overflow(new_n, new_size, &bytes)))
+ return NULL;
+
+ return krealloc(p, bytes, flags);
+}
+
+/**
* kcalloc - allocate memory for an array. The memory is set to zero.
* @n: number of elements.
* @size: element size.
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 014/200] ALSA: pcm: use krealloc_array()
2020-12-15 3:02 incoming Andrew Morton
` (12 preceding siblings ...)
2020-12-15 3:03 ` [patch 013/200] mm: slab: provide krealloc_array() Andrew Morton
@ 2020-12-15 3:03 ` Andrew Morton
2020-12-15 3:04 ` [patch 015/200] vhost: vringh: " Andrew Morton
` (186 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:03 UTC (permalink / raw)
To: airlied, akpm, alexander.shishkin, andriy.shevchenko,
bgolaszewski, bp, bp, christian.koenig, cl, daniel.vetter, daniel,
gustavo, iamjoonsoo.kim, james.morse, jasowang, linus.walleij,
linux-mm, maarten.lankhorst, mchehab, mm-commits, mripard, mst,
penberg, perex, rientjes, rric, sumit.semwal, tiwai, tiwai,
tony.luck, torvalds, tzimmermann, vbabka
From: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Subject: ALSA: pcm: use krealloc_array()
Use the helper that checks for overflows internally instead of manually
calculating the size of the new array.
Link: https://lkml.kernel.org/r/20201109110654.12547-4-brgl@bgdev.pl
Signed-off-by: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Reviewed-by: Takashi Iwai <tiwai@suse.de>
Cc: Alexander Shishkin <alexander.shishkin@linux.intel.com>
Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Borislav Petkov <bp@suse.de>
Cc: Christian Knig <christian.koenig@amd.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Daniel Vetter <daniel@ffwll.ch>
Cc: Daniel Vetter <daniel.vetter@ffwll.ch>
Cc: David Airlie <airlied@linux.ie>
Cc: David Rientjes <rientjes@google.com>
Cc: Gustavo Padovan <gustavo@padovan.org>
Cc: James Morse <james.morse@arm.com>
Cc: Jaroslav Kysela <perex@perex.cz>
Cc: Jason Wang <jasowang@redhat.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Linus Walleij <linus.walleij@linaro.org>
Cc: Maarten Lankhorst <maarten.lankhorst@linux.intel.com>
Cc: Mauro Carvalho Chehab <mchehab@kernel.org>
Cc: Maxime Ripard <mripard@kernel.org>
Cc: "Michael S . Tsirkin" <mst@redhat.com>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Robert Richter <rric@kernel.org>
Cc: Sumit Semwal <sumit.semwal@linaro.org>
Cc: Takashi Iwai <tiwai@suse.com>
Cc: Thomas Zimmermann <tzimmermann@suse.de>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
sound/core/pcm_lib.c | 4 ++--
1 file changed, 2 insertions(+), 2 deletions(-)
--- a/sound/core/pcm_lib.c~alsa-pcm-use-krealloc_array
+++ a/sound/core/pcm_lib.c
@@ -1129,8 +1129,8 @@ int snd_pcm_hw_rule_add(struct snd_pcm_r
if (constrs->rules_num >= constrs->rules_all) {
struct snd_pcm_hw_rule *new;
unsigned int new_rules = constrs->rules_all + 16;
- new = krealloc(constrs->rules, new_rules * sizeof(*c),
- GFP_KERNEL);
+ new = krealloc_array(constrs->rules, new_rules,
+ sizeof(*c), GFP_KERNEL);
if (!new) {
va_end(args);
return -ENOMEM;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 015/200] vhost: vringh: use krealloc_array()
2020-12-15 3:02 incoming Andrew Morton
` (13 preceding siblings ...)
2020-12-15 3:03 ` [patch 014/200] ALSA: pcm: use krealloc_array() Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 3:04 ` [patch 016/200] pinctrl: " Andrew Morton
` (185 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: airlied, akpm, alexander.shishkin, andriy.shevchenko,
bgolaszewski, bp, bp, christian.koenig, cl, daniel.vetter, daniel,
gustavo, iamjoonsoo.kim, james.morse, jasowang, linus.walleij,
linux-mm, maarten.lankhorst, mchehab, mm-commits, mripard, mst,
penberg, perex, rientjes, rric, sumit.semwal, tiwai, tiwai,
tony.luck, torvalds, tzimmermann, vbabka
From: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Subject: vhost: vringh: use krealloc_array()
Use the helper that checks for overflows internally instead of manually
calculating the size of the new array.
Link: https://lkml.kernel.org/r/20201109110654.12547-5-brgl@bgdev.pl
Signed-off-by: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Acked-by: Michael S. Tsirkin <mst@redhat.com>
Cc: Alexander Shishkin <alexander.shishkin@linux.intel.com>
Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Borislav Petkov <bp@suse.de>
Cc: Christian Knig <christian.koenig@amd.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Daniel Vetter <daniel@ffwll.ch>
Cc: Daniel Vetter <daniel.vetter@ffwll.ch>
Cc: David Airlie <airlied@linux.ie>
Cc: David Rientjes <rientjes@google.com>
Cc: Gustavo Padovan <gustavo@padovan.org>
Cc: James Morse <james.morse@arm.com>
Cc: Jaroslav Kysela <perex@perex.cz>
Cc: Jason Wang <jasowang@redhat.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Linus Walleij <linus.walleij@linaro.org>
Cc: Maarten Lankhorst <maarten.lankhorst@linux.intel.com>
Cc: Mauro Carvalho Chehab <mchehab@kernel.org>
Cc: Maxime Ripard <mripard@kernel.org>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Robert Richter <rric@kernel.org>
Cc: Sumit Semwal <sumit.semwal@linaro.org>
Cc: Takashi Iwai <tiwai@suse.com>
Cc: Takashi Iwai <tiwai@suse.de>
Cc: Thomas Zimmermann <tzimmermann@suse.de>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/vhost/vringh.c | 3 ++-
1 file changed, 2 insertions(+), 1 deletion(-)
--- a/drivers/vhost/vringh.c~vhost-vringh-use-krealloc_array
+++ a/drivers/vhost/vringh.c
@@ -198,7 +198,8 @@ static int resize_iovec(struct vringh_ki
flag = (iov->max_num & VRINGH_IOV_ALLOCATED);
if (flag)
- new = krealloc(iov->iov, new_num * sizeof(struct iovec), gfp);
+ new = krealloc_array(iov->iov, new_num,
+ sizeof(struct iovec), gfp);
else {
new = kmalloc_array(new_num, sizeof(struct iovec), gfp);
if (new) {
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 016/200] pinctrl: use krealloc_array()
2020-12-15 3:02 incoming Andrew Morton
` (14 preceding siblings ...)
2020-12-15 3:04 ` [patch 015/200] vhost: vringh: " Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 3:04 ` [patch 017/200] edac: ghes: " Andrew Morton
` (184 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: airlied, akpm, alexander.shishkin, andriy.shevchenko,
bgolaszewski, bp, bp, christian.koenig, cl, daniel.vetter, daniel,
gustavo, iamjoonsoo.kim, james.morse, jasowang, linus.walleij,
linux-mm, maarten.lankhorst, mchehab, mm-commits, mripard, mst,
penberg, perex, rientjes, rric, sumit.semwal, tiwai, tiwai,
tony.luck, torvalds, tzimmermann, vbabka
From: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Subject: pinctrl: use krealloc_array()
Use the helper that checks for overflows internally instead of manually
calculating the size of the new array.
Link: https://lkml.kernel.org/r/20201109110654.12547-6-brgl@bgdev.pl
Signed-off-by: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Reviewed-by: Andy Shevchenko <andriy.shevchenko@linux.intel.com>
Cc: Alexander Shishkin <alexander.shishkin@linux.intel.com>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Borislav Petkov <bp@suse.de>
Cc: Christian Knig <christian.koenig@amd.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Daniel Vetter <daniel@ffwll.ch>
Cc: Daniel Vetter <daniel.vetter@ffwll.ch>
Cc: David Airlie <airlied@linux.ie>
Cc: David Rientjes <rientjes@google.com>
Cc: Gustavo Padovan <gustavo@padovan.org>
Cc: James Morse <james.morse@arm.com>
Cc: Jaroslav Kysela <perex@perex.cz>
Cc: Jason Wang <jasowang@redhat.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Linus Walleij <linus.walleij@linaro.org>
Cc: Maarten Lankhorst <maarten.lankhorst@linux.intel.com>
Cc: Mauro Carvalho Chehab <mchehab@kernel.org>
Cc: Maxime Ripard <mripard@kernel.org>
Cc: "Michael S . Tsirkin" <mst@redhat.com>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Robert Richter <rric@kernel.org>
Cc: Sumit Semwal <sumit.semwal@linaro.org>
Cc: Takashi Iwai <tiwai@suse.com>
Cc: Takashi Iwai <tiwai@suse.de>
Cc: Thomas Zimmermann <tzimmermann@suse.de>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/pinctrl/pinctrl-utils.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/drivers/pinctrl/pinctrl-utils.c~pinctrl-use-krealloc_array
+++ a/drivers/pinctrl/pinctrl-utils.c
@@ -39,7 +39,7 @@ int pinctrl_utils_reserve_map(struct pin
if (old_num >= new_num)
return 0;
- new_map = krealloc(*map, sizeof(*new_map) * new_num, GFP_KERNEL);
+ new_map = krealloc_array(*map, new_num, sizeof(*new_map), GFP_KERNEL);
if (!new_map) {
dev_err(pctldev->dev, "krealloc(map) failed\n");
return -ENOMEM;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 017/200] edac: ghes: use krealloc_array()
2020-12-15 3:02 incoming Andrew Morton
` (15 preceding siblings ...)
2020-12-15 3:04 ` [patch 016/200] pinctrl: " Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 3:04 ` [patch 018/200] drm: atomic: " Andrew Morton
` (183 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: airlied, akpm, alexander.shishkin, andriy.shevchenko,
bgolaszewski, bp, bp, christian.koenig, cl, daniel.vetter, daniel,
gustavo, iamjoonsoo.kim, james.morse, jasowang, linus.walleij,
linux-mm, maarten.lankhorst, mchehab, mm-commits, mripard, mst,
penberg, perex, rientjes, rric, sumit.semwal, tiwai, tiwai,
tony.luck, torvalds, tzimmermann, vbabka
From: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Subject: edac: ghes: use krealloc_array()
Use the helper that checks for overflows internally instead of manually
calculating the size of the new array.
Link: https://lkml.kernel.org/r/20201109110654.12547-7-brgl@bgdev.pl
Signed-off-by: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Acked-by: Borislav Petkov <bp@suse.de>
Cc: Alexander Shishkin <alexander.shishkin@linux.intel.com>
Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Christian Knig <christian.koenig@amd.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Daniel Vetter <daniel@ffwll.ch>
Cc: Daniel Vetter <daniel.vetter@ffwll.ch>
Cc: David Airlie <airlied@linux.ie>
Cc: David Rientjes <rientjes@google.com>
Cc: Gustavo Padovan <gustavo@padovan.org>
Cc: James Morse <james.morse@arm.com>
Cc: Jaroslav Kysela <perex@perex.cz>
Cc: Jason Wang <jasowang@redhat.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Linus Walleij <linus.walleij@linaro.org>
Cc: Maarten Lankhorst <maarten.lankhorst@linux.intel.com>
Cc: Mauro Carvalho Chehab <mchehab@kernel.org>
Cc: Maxime Ripard <mripard@kernel.org>
Cc: "Michael S . Tsirkin" <mst@redhat.com>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Robert Richter <rric@kernel.org>
Cc: Sumit Semwal <sumit.semwal@linaro.org>
Cc: Takashi Iwai <tiwai@suse.com>
Cc: Takashi Iwai <tiwai@suse.de>
Cc: Thomas Zimmermann <tzimmermann@suse.de>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/edac/ghes_edac.c | 4 ++--
1 file changed, 2 insertions(+), 2 deletions(-)
--- a/drivers/edac/ghes_edac.c~edac-ghes-use-krealloc_array
+++ a/drivers/edac/ghes_edac.c
@@ -207,8 +207,8 @@ static void enumerate_dimms(const struct
if (!hw->num_dimms || !(hw->num_dimms % 16)) {
struct dimm_info *new;
- new = krealloc(hw->dimms, (hw->num_dimms + 16) * sizeof(struct dimm_info),
- GFP_KERNEL);
+ new = krealloc_array(hw->dimms, hw->num_dimms + 16,
+ sizeof(struct dimm_info), GFP_KERNEL);
if (!new) {
WARN_ON_ONCE(1);
return;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 018/200] drm: atomic: use krealloc_array()
2020-12-15 3:02 incoming Andrew Morton
` (16 preceding siblings ...)
2020-12-15 3:04 ` [patch 017/200] edac: ghes: " Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 3:04 ` [patch 019/200] hwtracing: intel: " Andrew Morton
` (182 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: airlied, akpm, alexander.shishkin, andriy.shevchenko,
bgolaszewski, bp, bp, christian.koenig, cl, daniel.vetter, daniel,
gustavo, iamjoonsoo.kim, james.morse, jasowang, linus.walleij,
linux-mm, maarten.lankhorst, mchehab, mm-commits, mripard, mst,
penberg, perex, rientjes, rric, sumit.semwal, tiwai, tiwai,
tony.luck, torvalds, tzimmermann, vbabka
From: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Subject: drm: atomic: use krealloc_array()
Use the helper that checks for overflows internally instead of manually
calculating the size of the new array.
Link: https://lkml.kernel.org/r/20201109110654.12547-8-brgl@bgdev.pl
Signed-off-by: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Acked-by: Daniel Vetter <daniel.vetter@ffwll.ch>
Cc: Alexander Shishkin <alexander.shishkin@linux.intel.com>
Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Borislav Petkov <bp@suse.de>
Cc: Christian Knig <christian.koenig@amd.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Daniel Vetter <daniel@ffwll.ch>
Cc: David Airlie <airlied@linux.ie>
Cc: David Rientjes <rientjes@google.com>
Cc: Gustavo Padovan <gustavo@padovan.org>
Cc: James Morse <james.morse@arm.com>
Cc: Jaroslav Kysela <perex@perex.cz>
Cc: Jason Wang <jasowang@redhat.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Linus Walleij <linus.walleij@linaro.org>
Cc: Maarten Lankhorst <maarten.lankhorst@linux.intel.com>
Cc: Mauro Carvalho Chehab <mchehab@kernel.org>
Cc: Maxime Ripard <mripard@kernel.org>
Cc: "Michael S . Tsirkin" <mst@redhat.com>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Robert Richter <rric@kernel.org>
Cc: Sumit Semwal <sumit.semwal@linaro.org>
Cc: Takashi Iwai <tiwai@suse.com>
Cc: Takashi Iwai <tiwai@suse.de>
Cc: Thomas Zimmermann <tzimmermann@suse.de>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/gpu/drm/drm_atomic.c | 3 ++-
1 file changed, 2 insertions(+), 1 deletion(-)
--- a/drivers/gpu/drm/drm_atomic.c~drm-atomic-use-krealloc_array
+++ a/drivers/gpu/drm/drm_atomic.c
@@ -960,7 +960,8 @@ drm_atomic_get_connector_state(struct dr
struct __drm_connnectors_state *c;
int alloc = max(index + 1, config->num_connector);
- c = krealloc(state->connectors, alloc * sizeof(*state->connectors), GFP_KERNEL);
+ c = krealloc_array(state->connectors, alloc,
+ sizeof(*state->connectors), GFP_KERNEL);
if (!c)
return ERR_PTR(-ENOMEM);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 019/200] hwtracing: intel: use krealloc_array()
2020-12-15 3:02 incoming Andrew Morton
` (17 preceding siblings ...)
2020-12-15 3:04 ` [patch 018/200] drm: atomic: " Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 3:04 ` [patch 020/200] dma-buf: " Andrew Morton
` (181 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: airlied, akpm, alexander.shishkin, andriy.shevchenko,
bgolaszewski, bp, bp, christian.koenig, cl, daniel.vetter, daniel,
gustavo, iamjoonsoo.kim, james.morse, jasowang, linus.walleij,
linux-mm, maarten.lankhorst, mchehab, mm-commits, mripard, mst,
penberg, perex, rientjes, rric, sumit.semwal, tiwai, tiwai,
tony.luck, torvalds, tzimmermann, vbabka
From: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Subject: hwtracing: intel: use krealloc_array()
Use the helper that checks for overflows internally instead of manually
calculating the size of the new array.
Link: https://lkml.kernel.org/r/20201109110654.12547-9-brgl@bgdev.pl
Signed-off-by: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Cc: Alexander Shishkin <alexander.shishkin@linux.intel.com>
Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Borislav Petkov <bp@suse.de>
Cc: Christian Knig <christian.koenig@amd.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Daniel Vetter <daniel@ffwll.ch>
Cc: Daniel Vetter <daniel.vetter@ffwll.ch>
Cc: David Airlie <airlied@linux.ie>
Cc: David Rientjes <rientjes@google.com>
Cc: Gustavo Padovan <gustavo@padovan.org>
Cc: James Morse <james.morse@arm.com>
Cc: Jaroslav Kysela <perex@perex.cz>
Cc: Jason Wang <jasowang@redhat.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Linus Walleij <linus.walleij@linaro.org>
Cc: Maarten Lankhorst <maarten.lankhorst@linux.intel.com>
Cc: Mauro Carvalho Chehab <mchehab@kernel.org>
Cc: Maxime Ripard <mripard@kernel.org>
Cc: "Michael S . Tsirkin" <mst@redhat.com>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Robert Richter <rric@kernel.org>
Cc: Sumit Semwal <sumit.semwal@linaro.org>
Cc: Takashi Iwai <tiwai@suse.com>
Cc: Takashi Iwai <tiwai@suse.de>
Cc: Thomas Zimmermann <tzimmermann@suse.de>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/hwtracing/intel_th/msu.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/drivers/hwtracing/intel_th/msu.c~hwtracing-intel-use-krealloc_array
+++ a/drivers/hwtracing/intel_th/msu.c
@@ -2002,7 +2002,7 @@ nr_pages_store(struct device *dev, struc
}
nr_wins++;
- rewin = krealloc(win, sizeof(*win) * nr_wins, GFP_KERNEL);
+ rewin = krealloc_array(win, nr_wins, sizeof(*win), GFP_KERNEL);
if (!rewin) {
kfree(win);
return -ENOMEM;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 020/200] dma-buf: use krealloc_array()
2020-12-15 3:02 incoming Andrew Morton
` (18 preceding siblings ...)
2020-12-15 3:04 ` [patch 019/200] hwtracing: intel: " Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 7:42 ` Christian König
2020-12-15 3:04 ` [patch 021/200] mm, slab, slub: clear the slab_cache field when freeing page Andrew Morton
` (180 subsequent siblings)
200 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: airlied, akpm, alexander.shishkin, andriy.shevchenko,
bgolaszewski, bp, bp, christian.koenig, cl, daniel.vetter, daniel,
gustavo, iamjoonsoo.kim, james.morse, jasowang, linus.walleij,
linux-mm, maarten.lankhorst, mchehab, mm-commits, mripard, mst,
penberg, perex, rientjes, rric, sumit.semwal, tiwai, tiwai,
tony.luck, torvalds, tzimmermann, vbabka
From: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Subject: dma-buf: use krealloc_array()
Use the helper that checks for overflows internally instead of manually
calculating the size of the new array.
Link: https://lkml.kernel.org/r/20201109110654.12547-10-brgl@bgdev.pl
Signed-off-by: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Acked-by: Christian König <christian.koenig@amd.com>
Cc: Alexander Shishkin <alexander.shishkin@linux.intel.com>
Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Borislav Petkov <bp@suse.de>
Cc: Christoph Lameter <cl@linux.com>
Cc: Daniel Vetter <daniel@ffwll.ch>
Cc: Daniel Vetter <daniel.vetter@ffwll.ch>
Cc: David Airlie <airlied@linux.ie>
Cc: David Rientjes <rientjes@google.com>
Cc: Gustavo Padovan <gustavo@padovan.org>
Cc: James Morse <james.morse@arm.com>
Cc: Jaroslav Kysela <perex@perex.cz>
Cc: Jason Wang <jasowang@redhat.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Linus Walleij <linus.walleij@linaro.org>
Cc: Maarten Lankhorst <maarten.lankhorst@linux.intel.com>
Cc: Mauro Carvalho Chehab <mchehab@kernel.org>
Cc: Maxime Ripard <mripard@kernel.org>
Cc: "Michael S . Tsirkin" <mst@redhat.com>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Robert Richter <rric@kernel.org>
Cc: Sumit Semwal <sumit.semwal@linaro.org>
Cc: Takashi Iwai <tiwai@suse.com>
Cc: Takashi Iwai <tiwai@suse.de>
Cc: Thomas Zimmermann <tzimmermann@suse.de>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/dma-buf/sync_file.c | 3 +--
1 file changed, 1 insertion(+), 2 deletions(-)
--- a/drivers/dma-buf/sync_file.c~dma-buf-use-krealloc_array
+++ a/drivers/dma-buf/sync_file.c
@@ -270,8 +270,7 @@ static struct sync_file *sync_file_merge
fences[i++] = dma_fence_get(a_fences[0]);
if (num_fences > i) {
- nfences = krealloc(fences, i * sizeof(*fences),
- GFP_KERNEL);
+ nfences = krealloc_array(fences, i, sizeof(*fences), GFP_KERNEL);
if (!nfences)
goto err;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 021/200] mm, slab, slub: clear the slab_cache field when freeing page
2020-12-15 3:02 incoming Andrew Morton
` (19 preceding siblings ...)
2020-12-15 3:04 ` [patch 020/200] dma-buf: " Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 3:04 ` [patch 022/200] mm/slab: rerform init_on_free earlier Andrew Morton
` (179 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: akpm, cl, iamjoonsoo.kim, linux-mm, mm-commits, penberg, rientjes,
torvalds, vbabka, willy
From: Vlastimil Babka <vbabka@suse.cz>
Subject: mm, slab, slub: clear the slab_cache field when freeing page
The page allocator expects that page->mapping is NULL for a page being
freed. SLAB and SLUB use the slab_cache field which is in union with
mapping, but before freeing the page, the field is referenced with the
"mapping" name when set to NULL.
It's IMHO more correct (albeit functionally the same) to use the
slab_cache name as that's the field we use in SL*B, and document why we
clear it in a comment (we don't clear fields such as s_mem or freelist, as
page allocator doesn't care about those). While using the 'mapping' name
would automagically keep the code correct if the unions in struct page
changed, such changes should be done consciously and needed changes
evaluated - the comment should help with that.
Link: https://lkml.kernel.org/r/20201210160020.21562-1-vbabka@suse.cz
Signed-off-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: David Rientjes <rientjes@google.com>
Acked-by: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Matthew Wilcox <willy@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/slab.c | 3 ++-
mm/slub.c | 4 ++--
2 files changed, 4 insertions(+), 3 deletions(-)
--- a/mm/slab.c~mm-slab-slub-clear-the-slab_cache-field-when-freeing-page
+++ a/mm/slab.c
@@ -1399,7 +1399,8 @@ static void kmem_freepages(struct kmem_c
__ClearPageSlabPfmemalloc(page);
__ClearPageSlab(page);
page_mapcount_reset(page);
- page->mapping = NULL;
+ /* In union with page->mapping where page allocator expects NULL */
+ page->slab_cache = NULL;
if (current->reclaim_state)
current->reclaim_state->reclaimed_slab += 1 << order;
--- a/mm/slub.c~mm-slab-slub-clear-the-slab_cache-field-when-freeing-page
+++ a/mm/slub.c
@@ -1836,8 +1836,8 @@ static void __free_slab(struct kmem_cach
__ClearPageSlabPfmemalloc(page);
__ClearPageSlab(page);
-
- page->mapping = NULL;
+ /* In union with page->mapping where page allocator expects NULL */
+ page->slab_cache = NULL;
if (current->reclaim_state)
current->reclaim_state->reclaimed_slab += pages;
unaccount_slab_page(page, order, s);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 022/200] mm/slab: rerform init_on_free earlier
2020-12-15 3:02 incoming Andrew Morton
` (20 preceding siblings ...)
2020-12-15 3:04 ` [patch 021/200] mm, slab, slub: clear the slab_cache field when freeing page Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 16:45 ` Alexander Potapenko
2020-12-15 3:04 ` [patch 023/200] mm, slub: use kmem_cache_debug_flags() in deactivate_slab() Andrew Morton
` (178 subsequent siblings)
200 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: akpm, alex.popov, cl, glider, iamjoonsoo.kim, linux-mm,
mm-commits, penberg, rientjes, torvalds
From: Alexander Popov <alex.popov@linux.com>
Subject: mm/slab: rerform init_on_free earlier
Currently in CONFIG_SLAB init_on_free happens too late, and heap objects
go to the heap quarantine not being erased.
Lets move init_on_free clearing before calling kasan_slab_free(). In that
case heap quarantine will store erased objects, similarly to CONFIG_SLUB=y
behavior.
Link: https://lkml.kernel.org/r/20201210183729.1261524-1-alex.popov@linux.com
Signed-off-by: Alexander Popov <alex.popov@linux.com>
Reviewed-by: Alexander Potapenko <glider@google.com>
Acked-by: David Rientjes <rientjes@google.com>
Acked-by: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Pekka Enberg <penberg@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/slab.c | 5 +++--
1 file changed, 3 insertions(+), 2 deletions(-)
--- a/mm/slab.c~mm-slab-perform-init_on_free-earlier
+++ a/mm/slab.c
@@ -3417,6 +3417,9 @@ free_done:
static __always_inline void __cache_free(struct kmem_cache *cachep, void *objp,
unsigned long caller)
{
+ if (unlikely(slab_want_init_on_free(cachep)))
+ memset(objp, 0, cachep->object_size);
+
/* Put the object into the quarantine, don't touch it for now. */
if (kasan_slab_free(cachep, objp, _RET_IP_))
return;
@@ -3435,8 +3438,6 @@ void ___cache_free(struct kmem_cache *ca
struct array_cache *ac = cpu_cache_get(cachep);
check_irq_off();
- if (unlikely(slab_want_init_on_free(cachep)))
- memset(objp, 0, cachep->object_size);
kmemleak_free_recursive(objp, cachep->flags);
objp = cache_free_debugcheck(cachep, objp, caller);
memcg_slab_free_hook(cachep, &objp, 1);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 023/200] mm, slub: use kmem_cache_debug_flags() in deactivate_slab()
2020-12-15 3:02 incoming Andrew Morton
` (21 preceding siblings ...)
2020-12-15 3:04 ` [patch 022/200] mm/slab: rerform init_on_free earlier Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 3:04 ` [patch 024/200] mm/slub: let number of online CPUs determine the slub page order Andrew Morton
` (177 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: akpm, cl, iamjoonsoo.kim, linux-mm, liu.xiang6, mm-commits,
penberg, rientjes, torvalds, vbabka, wuyun.wu
From: Vlastimil Babka <vbabka@suse.cz>
Subject: mm, slub: use kmem_cache_debug_flags() in deactivate_slab()
Commit 9cf7a1118365 ("mm/slub: make add_full() condition more explicit")
replaced an unnecessarily generic kmem_cache_debug(s) check with an
explicit check of SLAB_STORE_USER and #ifdef CONFIG_SLUB_DEBUG.
We can achieve the same specific check with the recently added
kmem_cache_debug_flags() which removes the #ifdef and restores the
no-branch-overhead benefit of static key check when slub debugging is not
enabled.
Link: https://lkml.kernel.org/r/3ef24214-38c7-1238-8296-88caf7f48ab6@suse.cz
Signed-off-by: Vlastimil Babka <vbabka@suse.cz>
Cc: Abel Wu <wuyun.wu@huawei.com>
Cc: Christopher Lameter <cl@linux.com>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: David Rientjes <rientjes@google.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Liu Xiang <liu.xiang6@zte.com.cn>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/slub.c | 4 +---
1 file changed, 1 insertion(+), 3 deletions(-)
--- a/mm/slub.c~mm-slub-use-kmem_cache_debug_flags-in-deactivate_slab
+++ a/mm/slub.c
@@ -2245,8 +2245,7 @@ redo:
}
} else {
m = M_FULL;
-#ifdef CONFIG_SLUB_DEBUG
- if ((s->flags & SLAB_STORE_USER) && !lock) {
+ if (kmem_cache_debug_flags(s, SLAB_STORE_USER) && !lock) {
lock = 1;
/*
* This also ensures that the scanning of full
@@ -2255,7 +2254,6 @@ redo:
*/
spin_lock(&n->list_lock);
}
-#endif
}
if (l != m) {
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 024/200] mm/slub: let number of online CPUs determine the slub page order
2020-12-15 3:02 incoming Andrew Morton
` (22 preceding siblings ...)
2020-12-15 3:04 ` [patch 023/200] mm, slub: use kmem_cache_debug_flags() in deactivate_slab() Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 3:04 ` [patch 025/200] device-dax/kmem: use struct_size() Andrew Morton
` (176 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: akpm, aneesh.kumar, bharata, cl, guro, hannes, iamjoonsoo.kim,
linux-mm, mm-commits, rientjes, shakeelb, torvalds, vbabka
From: Bharata B Rao <bharata@linux.ibm.com>
Subject: mm/slub: let number of online CPUs determine the slub page order
The page order of the slab that gets chosen for a given slab cache depends
on the number of objects that can be fit in the slab while meeting other
requirements. We start with a value of minimum objects based on
nr_cpu_ids that is driven by possible number of CPUs and hence could be
higher than the actual number of CPUs present in the system. This leads
to calculate_order() chosing a page order that is on the higher side
leading to increased slab memory consumption on systems that have bigger
page sizes.
Hence rely on the number of online CPUs when determining the mininum
objects, thereby increasing the chances of chosing a lower conservative
page order for the slab.
Vlastimil:
: Ideally, we would react to hotplug events and update existing caches
: accordingly. But for that, recalculation of order for existing caches
: would have to be made safe, while not affecting hot paths. We have
: removed the sysfs interface with 32a6f409b693 ("mm, slub: remove runtime
: allocation order changes") as it didn't seem easy and worth the trouble.
:
: In case somebody wants to start with a large order right from the boot
: because they know they will hotplug lots of cpus later, they can use
: slub_min_objects= boot param to override this heuristic. So in case this
: change regresses somebody's performance, there's a way around it and
: thus the risk is low IMHO.
Link: https://lkml.kernel.org/r/20201118082759.1413056-1-bharata@linux.ibm.com
Signed-off-by: Bharata B Rao <bharata@linux.ibm.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Roman Gushchin <guro@fb.com>
Acked-by: David Rientjes <rientjes@google.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/slub.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/slub.c~mm-slub-let-number-of-online-cpus-determine-the-slub-page-order
+++ a/mm/slub.c
@@ -3431,7 +3431,7 @@ static inline int calculate_order(unsign
*/
min_objects = slub_min_objects;
if (!min_objects)
- min_objects = 4 * (fls(nr_cpu_ids) + 1);
+ min_objects = 4 * (fls(num_online_cpus()) + 1);
max_objects = order_objects(slub_max_order, size);
min_objects = min(min_objects, max_objects);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 025/200] device-dax/kmem: use struct_size()
2020-12-15 3:02 incoming Andrew Morton
` (23 preceding siblings ...)
2020-12-15 3:04 ` [patch 024/200] mm/slub: let number of online CPUs determine the slub page order Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 3:04 ` [patch 026/200] mm: fix page_owner initializing issue for arm32 Andrew Morton
` (175 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: akpm, dan.j.williams, linux-mm, mm-commits, torvalds
From: Dan Williams <dan.j.williams@intel.com>
Subject: device-dax/kmem: use struct_size()
Linus notes the kernel has had a nice helper for the 'size of struct with
variable array member at the end' operation for a couple years now, use
it.
Link: http://lore.kernel.org/r/CAHk-=wgNTLbvAD8mNTvh+GQyapNWeX20PXhU_+frqEvVq4298w@mail.gmail.com
Link: https://lkml.kernel.org/r/160288261564.3242821.6055291930923876456.stgit@dwillia2-desk3.amr.corp.intel.com
Signed-off-by: Dan Williams <dan.j.williams@intel.com>
Reported-by: Linus Torvalds <torvalds@linux-foundation.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/dax/kmem.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/drivers/dax/kmem.c~device-dax-kmem-use-struct_size
+++ a/drivers/dax/kmem.c
@@ -61,7 +61,7 @@ static int dev_dax_kmem_probe(struct dev
return -EINVAL;
}
- data = kzalloc(sizeof(*data) + sizeof(struct resource *) * dev_dax->nr_range, GFP_KERNEL);
+ data = kzalloc(struct_size(data, res, dev_dax->nr_range), GFP_KERNEL);
if (!data)
return -ENOMEM;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 026/200] mm: fix page_owner initializing issue for arm32
2020-12-15 3:02 incoming Andrew Morton
` (24 preceding siblings ...)
2020-12-15 3:04 ` [patch 025/200] device-dax/kmem: use struct_size() Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 3:04 ` [patch 027/200] mm/page_owner: record timestamp and pid Andrew Morton
` (174 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: akpm, iamjoonsoo.kim, linux-mm, mm-commits, torvalds, vbabka,
zhenhuah
From: Zhenhua Huang <zhenhuah@codeaurora.org>
Subject: mm: fix page_owner initializing issue for arm32
Page owner of pages used by page owner itself used is missing on arm32
targets. The reason is dummy_handle and failure_handle is not initialized
correctly. Buddy allocator is used to initialize these two handles.
However, buddy allocator is not ready when page owner calls it. This
change fixed that by initializing page owner after buddy initialization.
The working flow before and after this change are:
original logic:
1. allocated memory for page_ext(using memblock).
2. invoke the init callback of page_ext_ops like
page_owner(using buddy allocator).
3. initialize buddy.
after this change:
1. allocated memory for page_ext(using memblock).
2. initialize buddy.
3. invoke the init callback of page_ext_ops like
page_owner(using buddy allocator).
with the change, failure/dummy_handle can get its correct value and page
owner output for example has the one for page owner itself:
Page allocated via order 2, mask 0x6202c0(GFP_USER|__GFP_NOWARN), pid 1006, ts
67278156558 ns
PFN 543776 type Unmovable Block 531 type Unmovable Flags 0x0()
init_page_owner+0x28/0x2f8
invoke_init_callbacks_flatmem+0x24/0x34
start_kernel+0x33c/0x5d8
(null)
Link: https://lkml.kernel.org/r/1603104925-5888-1-git-send-email-zhenhuah@codeaurora.org
Signed-off-by: Zhenhua Huang <zhenhuah@codeaurora.org>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/page_ext.h | 8 ++++++++
init/main.c | 2 ++
mm/page_ext.c | 10 ++++++++--
3 files changed, 18 insertions(+), 2 deletions(-)
--- a/include/linux/page_ext.h~mm-fix-page_owner-initializing-issue-for-arm32
+++ a/include/linux/page_ext.h
@@ -44,8 +44,12 @@ static inline void page_ext_init_flatmem
{
}
extern void page_ext_init(void);
+static inline void page_ext_init_flatmem_late(void)
+{
+}
#else
extern void page_ext_init_flatmem(void);
+extern void page_ext_init_flatmem_late(void);
static inline void page_ext_init(void)
{
}
@@ -76,6 +80,10 @@ static inline void page_ext_init(void)
{
}
+static inline void page_ext_init_flatmem_late(void)
+{
+}
+
static inline void page_ext_init_flatmem(void)
{
}
--- a/init/main.c~mm-fix-page_owner-initializing-issue-for-arm32
+++ a/init/main.c
@@ -828,6 +828,8 @@ static void __init mm_init(void)
init_debug_pagealloc();
report_meminit();
mem_init();
+ /* page_owner must be initialized after buddy is ready */
+ page_ext_init_flatmem_late();
kmem_cache_init();
kmemleak_init();
pgtable_init();
--- a/mm/page_ext.c~mm-fix-page_owner-initializing-issue-for-arm32
+++ a/mm/page_ext.c
@@ -99,12 +99,19 @@ static void __init invoke_init_callbacks
}
}
+#ifndef CONFIG_SPARSEMEM
+void __init page_ext_init_flatmem_late(void)
+{
+ invoke_init_callbacks();
+}
+#endif
+
static inline struct page_ext *get_entry(void *base, unsigned long index)
{
return base + page_ext_size * index;
}
-#if !defined(CONFIG_SPARSEMEM)
+#ifndef CONFIG_SPARSEMEM
void __meminit pgdat_page_ext_init(struct pglist_data *pgdat)
@@ -177,7 +184,6 @@ void __init page_ext_init_flatmem(void)
goto fail;
}
pr_info("allocated %ld bytes of page_ext\n", total_usage);
- invoke_init_callbacks();
return;
fail:
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 027/200] mm/page_owner: record timestamp and pid
2020-12-15 3:02 incoming Andrew Morton
` (25 preceding siblings ...)
2020-12-15 3:04 ` [patch 026/200] mm: fix page_owner initializing issue for arm32 Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 3:04 ` [patch 028/200] mm/filemap/c: break generic_file_buffered_read up into multiple functions Andrew Morton
` (173 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: akpm, corbet, georgi.djakov, iamjoonsoo.kim, linux-mm, lmark,
mm-commits, torvalds, vbabka
From: Liam Mark <lmark@codeaurora.org>
Subject: mm/page_owner: record timestamp and pid
Collect the time for each allocation recorded in page owner so that
allocation "surges" can be measured.
Record the pid for each allocation recorded in page owner so that the
source of allocation "surges" can be better identified.
The above is very useful when doing memory analysis. On a crash for
example, we can get this information from kdump (or ramdump) and parse it
to figure out memory allocation problems.
Please note that on x86_64 this increases the size of struct page_owner
from 16 bytes to 32.
Vlastimil: it's not a functionality intended for production, so unless
somebody says they need to enable page_owner for debugging and this
increase prevents them from fitting into available memory, let's not
complicate things with making this optional.
[lmark@codeaurora.org: v3]
Link: https://lkml.kernel.org/r/20201210160357.27779-1-georgi.djakov@linaro.org
Link: https://lkml.kernel.org/r/20201209125153.10533-1-georgi.djakov@linaro.org
Signed-off-by: Liam Mark <lmark@codeaurora.org>
Signed-off-by: Georgi Djakov <georgi.djakov@linaro.org>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/vm/page_owner.rst | 12 ++++++------
mm/page_owner.c | 17 +++++++++++++----
2 files changed, 19 insertions(+), 10 deletions(-)
--- a/Documentation/vm/page_owner.rst~mm-page_owner-record-timestamp-and-pid
+++ a/Documentation/vm/page_owner.rst
@@ -41,17 +41,17 @@ size change due to this facility.
- Without page owner::
text data bss dec hex filename
- 40662 1493 644 42799 a72f mm/page_alloc.o
+ 48392 2333 644 51369 c8a9 mm/page_alloc.o
- With page owner::
text data bss dec hex filename
- 40892 1493 644 43029 a815 mm/page_alloc.o
- 1427 24 8 1459 5b3 mm/page_ext.o
- 2722 50 0 2772 ad4 mm/page_owner.o
+ 48800 2445 644 51889 cab1 mm/page_alloc.o
+ 6574 108 29 6711 1a37 mm/page_owner.o
+ 1025 8 8 1041 411 mm/page_ext.o
-Although, roughly, 4 KB code is added in total, page_alloc.o increase by
-230 bytes and only half of it is in hotpath. Building the kernel with
+Although, roughly, 8 KB code is added in total, page_alloc.o increase by
+520 bytes and less than half of it is in hotpath. Building the kernel with
page owner and turning it on if needed would be great option to debug
kernel memory problem.
--- a/mm/page_owner.c~mm-page_owner-record-timestamp-and-pid
+++ a/mm/page_owner.c
@@ -10,6 +10,7 @@
#include <linux/migrate.h>
#include <linux/stackdepot.h>
#include <linux/seq_file.h>
+#include <linux/sched/clock.h>
#include "internal.h"
@@ -25,6 +26,8 @@ struct page_owner {
gfp_t gfp_mask;
depot_stack_handle_t handle;
depot_stack_handle_t free_handle;
+ u64 ts_nsec;
+ pid_t pid;
};
static bool page_owner_enabled = false;
@@ -172,6 +175,8 @@ static inline void __set_page_owner_hand
page_owner->order = order;
page_owner->gfp_mask = gfp_mask;
page_owner->last_migrate_reason = -1;
+ page_owner->pid = current->pid;
+ page_owner->ts_nsec = local_clock();
__set_bit(PAGE_EXT_OWNER, &page_ext->flags);
__set_bit(PAGE_EXT_OWNER_ALLOCATED, &page_ext->flags);
@@ -236,6 +241,8 @@ void __copy_page_owner(struct page *oldp
new_page_owner->last_migrate_reason =
old_page_owner->last_migrate_reason;
new_page_owner->handle = old_page_owner->handle;
+ new_page_owner->pid = old_page_owner->pid;
+ new_page_owner->ts_nsec = old_page_owner->ts_nsec;
/*
* We don't clear the bit on the oldpage as it's going to be freed
@@ -349,9 +356,10 @@ print_page_owner(char __user *buf, size_
return -ENOMEM;
ret = snprintf(kbuf, count,
- "Page allocated via order %u, mask %#x(%pGg)\n",
+ "Page allocated via order %u, mask %#x(%pGg), pid %d, ts %llu ns\n",
page_owner->order, page_owner->gfp_mask,
- &page_owner->gfp_mask);
+ &page_owner->gfp_mask, page_owner->pid,
+ page_owner->ts_nsec);
if (ret >= count)
goto err;
@@ -427,8 +435,9 @@ void __dump_page_owner(struct page *page
else
pr_alert("page_owner tracks the page as freed\n");
- pr_alert("page last allocated via order %u, migratetype %s, gfp_mask %#x(%pGg)\n",
- page_owner->order, migratetype_names[mt], gfp_mask, &gfp_mask);
+ pr_alert("page last allocated via order %u, migratetype %s, gfp_mask %#x(%pGg), pid %d, ts %llu\n",
+ page_owner->order, migratetype_names[mt], gfp_mask, &gfp_mask,
+ page_owner->pid, page_owner->ts_nsec);
handle = READ_ONCE(page_owner->handle);
if (!handle) {
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 028/200] mm/filemap/c: break generic_file_buffered_read up into multiple functions
2020-12-15 3:02 incoming Andrew Morton
` (26 preceding siblings ...)
2020-12-15 3:04 ` [patch 027/200] mm/page_owner: record timestamp and pid Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 3:04 ` [patch 029/200] mm/filemap.c: generic_file_buffered_read() now uses find_get_pages_contig Andrew Morton
` (172 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: akpm, axboe, kent.overstreet, linux-mm, mm-commits, torvalds,
willy
From: Kent Overstreet <kent.overstreet@gmail.com>
Subject: mm/filemap/c: break generic_file_buffered_read up into multiple functions
Patch series "generic_file_buffered_read() improvements", v2.
generic_file_buffered_read() has turned into a real monstrosity to work
with. And it's a major performance improvement, for both small random and
large sequential reads. On my test box, 4k buffered random reads go from
~150k to ~250k iops, and the improvements to big sequential reads are even
bigger.
This incorporates the fix for IOCB_WAITQ handling that Jens just posted as
well, also factors out lock_page_for_iocb() to improve handling of the
various iocb flags.
This patch (of 2):
This is prep work for changing generic_file_buffered_read() to use
find_get_pages_contig() to batch up all the pagecache lookups.
This patch should be functionally identical to the existing code and
changes as little as of the flow control as possible. More refactoring
could be done, this patch is intended to be relatively minimal.
Link: https://lkml.kernel.org/r/20201025212949.602194-1-kent.overstreet@gmail.com
Link: https://lkml.kernel.org/r/20201025212949.602194-2-kent.overstreet@gmail.com
Signed-off-by: Kent Overstreet <kent.overstreet@gmail.com>
Cc: Matthew Wilcox (Oracle) <willy@infradead.org>
Cc: Jens Axboe <axboe@kernel.dk>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/filemap.c | 483 ++++++++++++++++++++++++++-----------------------
1 file changed, 261 insertions(+), 222 deletions(-)
--- a/mm/filemap.c~fs-break-generic_file_buffered_read-up-into-multiple-functions
+++ a/mm/filemap.c
@@ -2166,6 +2166,234 @@ static void shrink_readahead_size_eio(st
ra->ra_pages /= 4;
}
+static int lock_page_for_iocb(struct kiocb *iocb, struct page *page)
+{
+ if (iocb->ki_flags & IOCB_WAITQ)
+ return lock_page_async(page, iocb->ki_waitq);
+ else if (iocb->ki_flags & IOCB_NOWAIT)
+ return trylock_page(page) ? 0 : -EAGAIN;
+ else
+ return lock_page_killable(page);
+}
+
+static int generic_file_buffered_read_page_ok(struct kiocb *iocb,
+ struct iov_iter *iter,
+ struct page *page)
+{
+ struct address_space *mapping = iocb->ki_filp->f_mapping;
+ struct inode *inode = mapping->host;
+ struct file_ra_state *ra = &iocb->ki_filp->f_ra;
+ unsigned int offset = iocb->ki_pos & ~PAGE_MASK;
+ unsigned int bytes, copied;
+ loff_t isize, end_offset;
+
+ BUG_ON(iocb->ki_pos >> PAGE_SHIFT != page->index);
+
+ /*
+ * i_size must be checked after we know the page is Uptodate.
+ *
+ * Checking i_size after the check allows us to calculate
+ * the correct value for "bytes", which means the zero-filled
+ * part of the page is not copied back to userspace (unless
+ * another truncate extends the file - this is desired though).
+ */
+
+ isize = i_size_read(inode);
+ if (unlikely(iocb->ki_pos >= isize))
+ return 1;
+
+ end_offset = min_t(loff_t, isize, iocb->ki_pos + iter->count);
+
+ bytes = min_t(loff_t, end_offset - iocb->ki_pos, PAGE_SIZE - offset);
+
+ /* If users can be writing to this page using arbitrary
+ * virtual addresses, take care about potential aliasing
+ * before reading the page on the kernel side.
+ */
+ if (mapping_writably_mapped(mapping))
+ flush_dcache_page(page);
+
+ /*
+ * Ok, we have the page, and it's up-to-date, so
+ * now we can copy it to user space...
+ */
+
+ copied = copy_page_to_iter(page, offset, bytes, iter);
+
+ iocb->ki_pos += copied;
+
+ /*
+ * When a sequential read accesses a page several times,
+ * only mark it as accessed the first time.
+ */
+ if (iocb->ki_pos >> PAGE_SHIFT != ra->prev_pos >> PAGE_SHIFT)
+ mark_page_accessed(page);
+
+ ra->prev_pos = iocb->ki_pos;
+
+ if (copied < bytes)
+ return -EFAULT;
+
+ return !iov_iter_count(iter) || iocb->ki_pos == isize;
+}
+
+static struct page *
+generic_file_buffered_read_readpage(struct kiocb *iocb,
+ struct file *filp,
+ struct address_space *mapping,
+ struct page *page)
+{
+ struct file_ra_state *ra = &filp->f_ra;
+ int error;
+
+ if (iocb->ki_flags & (IOCB_NOIO | IOCB_NOWAIT)) {
+ unlock_page(page);
+ put_page(page);
+ return ERR_PTR(-EAGAIN);
+ }
+
+ /*
+ * A previous I/O error may have been due to temporary
+ * failures, eg. multipath errors.
+ * PG_error will be set again if readpage fails.
+ */
+ ClearPageError(page);
+ /* Start the actual read. The read will unlock the page. */
+ error = mapping->a_ops->readpage(filp, page);
+
+ if (unlikely(error)) {
+ put_page(page);
+ return error != AOP_TRUNCATED_PAGE ? ERR_PTR(error) : NULL;
+ }
+
+ if (!PageUptodate(page)) {
+ error = lock_page_for_iocb(iocb, page);
+ if (unlikely(error)) {
+ put_page(page);
+ return ERR_PTR(error);
+ }
+ if (!PageUptodate(page)) {
+ if (page->mapping == NULL) {
+ /*
+ * invalidate_mapping_pages got it
+ */
+ unlock_page(page);
+ put_page(page);
+ return NULL;
+ }
+ unlock_page(page);
+ shrink_readahead_size_eio(ra);
+ put_page(page);
+ return ERR_PTR(-EIO);
+ }
+ unlock_page(page);
+ }
+
+ return page;
+}
+
+static struct page *
+generic_file_buffered_read_pagenotuptodate(struct kiocb *iocb,
+ struct file *filp,
+ struct iov_iter *iter,
+ struct page *page,
+ loff_t pos, loff_t count)
+{
+ struct address_space *mapping = filp->f_mapping;
+ struct inode *inode = mapping->host;
+ int error;
+
+ /*
+ * See comment in do_read_cache_page on why
+ * wait_on_page_locked is used to avoid unnecessarily
+ * serialisations and why it's safe.
+ */
+ if (iocb->ki_flags & IOCB_WAITQ) {
+ error = wait_on_page_locked_async(page,
+ iocb->ki_waitq);
+ } else {
+ error = wait_on_page_locked_killable(page);
+ }
+ if (unlikely(error)) {
+ put_page(page);
+ return ERR_PTR(error);
+ }
+ if (PageUptodate(page))
+ return page;
+
+ if (inode->i_blkbits == PAGE_SHIFT ||
+ !mapping->a_ops->is_partially_uptodate)
+ goto page_not_up_to_date;
+ /* pipes can't handle partially uptodate pages */
+ if (unlikely(iov_iter_is_pipe(iter)))
+ goto page_not_up_to_date;
+ if (!trylock_page(page))
+ goto page_not_up_to_date;
+ /* Did it get truncated before we got the lock? */
+ if (!page->mapping)
+ goto page_not_up_to_date_locked;
+ if (!mapping->a_ops->is_partially_uptodate(page,
+ pos & ~PAGE_MASK, count))
+ goto page_not_up_to_date_locked;
+ unlock_page(page);
+ return page;
+
+page_not_up_to_date:
+ /* Get exclusive access to the page ... */
+ error = lock_page_for_iocb(iocb, page);
+ if (unlikely(error)) {
+ put_page(page);
+ return ERR_PTR(error);
+ }
+
+page_not_up_to_date_locked:
+ /* Did it get truncated before we got the lock? */
+ if (!page->mapping) {
+ unlock_page(page);
+ put_page(page);
+ return NULL;
+ }
+
+ /* Did somebody else fill it already? */
+ if (PageUptodate(page)) {
+ unlock_page(page);
+ return page;
+ }
+
+ return generic_file_buffered_read_readpage(iocb, filp, mapping, page);
+}
+
+static struct page *
+generic_file_buffered_read_no_cached_page(struct kiocb *iocb,
+ struct iov_iter *iter)
+{
+ struct file *filp = iocb->ki_filp;
+ struct address_space *mapping = filp->f_mapping;
+ pgoff_t index = iocb->ki_pos >> PAGE_SHIFT;
+ struct page *page;
+ int error;
+
+ if (iocb->ki_flags & IOCB_NOIO)
+ return ERR_PTR(-EAGAIN);
+
+ /*
+ * Ok, it wasn't cached, so we need to create a new
+ * page..
+ */
+ page = page_cache_alloc(mapping);
+ if (!page)
+ return ERR_PTR(-ENOMEM);
+
+ error = add_to_page_cache_lru(page, mapping, index,
+ mapping_gfp_constraint(mapping, GFP_KERNEL));
+ if (error) {
+ put_page(page);
+ return error != -EEXIST ? ERR_PTR(error) : NULL;
+ }
+
+ return generic_file_buffered_read_readpage(iocb, filp, mapping, page);
+}
+
/**
* generic_file_buffered_read - generic file read routine
* @iocb: the iocb to read
@@ -2189,23 +2417,15 @@ ssize_t generic_file_buffered_read(struc
struct address_space *mapping = filp->f_mapping;
struct inode *inode = mapping->host;
struct file_ra_state *ra = &filp->f_ra;
- loff_t *ppos = &iocb->ki_pos;
- pgoff_t index;
+ size_t orig_count = iov_iter_count(iter);
pgoff_t last_index;
- pgoff_t prev_index;
- unsigned long offset; /* offset into pagecache page */
- unsigned int prev_offset;
int error = 0;
- if (unlikely(*ppos >= inode->i_sb->s_maxbytes))
+ if (unlikely(iocb->ki_pos >= inode->i_sb->s_maxbytes))
return 0;
iov_iter_truncate(iter, inode->i_sb->s_maxbytes);
- index = *ppos >> PAGE_SHIFT;
- prev_index = ra->prev_pos >> PAGE_SHIFT;
- prev_offset = ra->prev_pos & (PAGE_SIZE-1);
- last_index = (*ppos + iter->count + PAGE_SIZE-1) >> PAGE_SHIFT;
- offset = *ppos & ~PAGE_MASK;
+ last_index = (iocb->ki_pos + iter->count + PAGE_SIZE-1) >> PAGE_SHIFT;
/*
* If we've already successfully copied some data, then we
@@ -2216,10 +2436,8 @@ ssize_t generic_file_buffered_read(struc
iocb->ki_flags |= IOCB_NOWAIT;
for (;;) {
+ pgoff_t index = iocb->ki_pos >> PAGE_SHIFT;
struct page *page;
- pgoff_t end_index;
- loff_t isize;
- unsigned long nr, ret;
cond_resched();
find_page:
@@ -2228,6 +2446,14 @@ find_page:
goto out;
}
+ /*
+ * We can't return -EIOCBQUEUED once we've done some work, so
+ * ensure we don't block:
+ */
+ if ((iocb->ki_flags & IOCB_WAITQ) &&
+ (written + orig_count - iov_iter_count(iter)))
+ iocb->ki_flags |= IOCB_NOWAIT;
+
page = find_get_page(mapping, index);
if (!page) {
if (iocb->ki_flags & IOCB_NOIO)
@@ -2236,8 +2462,15 @@ find_page:
ra, filp,
index, last_index - index);
page = find_get_page(mapping, index);
- if (unlikely(page == NULL))
- goto no_cached_page;
+ if (unlikely(page == NULL)) {
+ page = generic_file_buffered_read_no_cached_page(iocb, iter);
+ if (!page)
+ goto find_page;
+ if (IS_ERR(page)) {
+ error = PTR_ERR(page);
+ goto out;
+ }
+ }
}
if (PageReadahead(page)) {
if (iocb->ki_flags & IOCB_NOIO) {
@@ -2249,231 +2482,37 @@ find_page:
index, last_index - index);
}
if (!PageUptodate(page)) {
- /*
- * See comment in do_read_cache_page on why
- * wait_on_page_locked is used to avoid unnecessarily
- * serialisations and why it's safe.
- */
- if (iocb->ki_flags & IOCB_WAITQ) {
- if (written) {
- put_page(page);
- goto out;
- }
- error = wait_on_page_locked_async(page,
- iocb->ki_waitq);
- } else {
- if (iocb->ki_flags & IOCB_NOWAIT) {
- put_page(page);
- goto would_block;
- }
- error = wait_on_page_locked_killable(page);
- }
- if (unlikely(error))
- goto readpage_error;
- if (PageUptodate(page))
- goto page_ok;
-
- if (inode->i_blkbits == PAGE_SHIFT ||
- !mapping->a_ops->is_partially_uptodate)
- goto page_not_up_to_date;
- /* pipes can't handle partially uptodate pages */
- if (unlikely(iov_iter_is_pipe(iter)))
- goto page_not_up_to_date;
- if (!trylock_page(page))
- goto page_not_up_to_date;
- /* Did it get truncated before we got the lock? */
- if (!page->mapping)
- goto page_not_up_to_date_locked;
- if (!mapping->a_ops->is_partially_uptodate(page,
- offset, iter->count))
- goto page_not_up_to_date_locked;
- unlock_page(page);
- }
-page_ok:
- /*
- * i_size must be checked after we know the page is Uptodate.
- *
- * Checking i_size after the check allows us to calculate
- * the correct value for "nr", which means the zero-filled
- * part of the page is not copied back to userspace (unless
- * another truncate extends the file - this is desired though).
- */
-
- isize = i_size_read(inode);
- end_index = (isize - 1) >> PAGE_SHIFT;
- if (unlikely(!isize || index > end_index)) {
- put_page(page);
- goto out;
- }
-
- /* nr is the maximum number of bytes to copy from this page */
- nr = PAGE_SIZE;
- if (index == end_index) {
- nr = ((isize - 1) & ~PAGE_MASK) + 1;
- if (nr <= offset) {
+ if (iocb->ki_flags & IOCB_NOWAIT) {
put_page(page);
+ error = -EAGAIN;
goto out;
}
- }
- nr = nr - offset;
-
- /* If users can be writing to this page using arbitrary
- * virtual addresses, take care about potential aliasing
- * before reading the page on the kernel side.
- */
- if (mapping_writably_mapped(mapping))
- flush_dcache_page(page);
-
- /*
- * When a sequential read accesses a page several times,
- * only mark it as accessed the first time.
- */
- if (prev_index != index || offset != prev_offset)
- mark_page_accessed(page);
- prev_index = index;
-
- /*
- * Ok, we have the page, and it's up-to-date, so
- * now we can copy it to user space...
- */
-
- ret = copy_page_to_iter(page, offset, nr, iter);
- offset += ret;
- index += offset >> PAGE_SHIFT;
- offset &= ~PAGE_MASK;
- prev_offset = offset;
-
- put_page(page);
- written += ret;
- if (!iov_iter_count(iter))
- goto out;
- if (ret < nr) {
- error = -EFAULT;
- goto out;
- }
- continue;
-
-page_not_up_to_date:
- /* Get exclusive access to the page ... */
- if (iocb->ki_flags & IOCB_WAITQ) {
- if (written) {
- put_page(page);
- goto out;
- }
- error = lock_page_async(page, iocb->ki_waitq);
- } else {
- error = lock_page_killable(page);
- }
- if (unlikely(error))
- goto readpage_error;
-
-page_not_up_to_date_locked:
- /* Did it get truncated before we got the lock? */
- if (!page->mapping) {
- unlock_page(page);
- put_page(page);
- continue;
- }
-
- /* Did somebody else fill it already? */
- if (PageUptodate(page)) {
- unlock_page(page);
- goto page_ok;
- }
-
-readpage:
- if (iocb->ki_flags & (IOCB_NOIO | IOCB_NOWAIT)) {
- unlock_page(page);
- put_page(page);
- goto would_block;
- }
- /*
- * A previous I/O error may have been due to temporary
- * failures, eg. multipath errors.
- * PG_error will be set again if readpage fails.
- */
- ClearPageError(page);
- /* Start the actual read. The read will unlock the page. */
- error = mapping->a_ops->readpage(filp, page);
-
- if (unlikely(error)) {
- if (error == AOP_TRUNCATED_PAGE) {
- put_page(page);
- error = 0;
+ page = generic_file_buffered_read_pagenotuptodate(iocb,
+ filp, iter, page, iocb->ki_pos, iter->count);
+ if (!page)
goto find_page;
+ if (IS_ERR(page)) {
+ error = PTR_ERR(page);
+ goto out;
}
- goto readpage_error;
- }
-
- if (!PageUptodate(page)) {
- if (iocb->ki_flags & IOCB_WAITQ) {
- if (written) {
- put_page(page);
- goto out;
- }
- error = lock_page_async(page, iocb->ki_waitq);
- } else {
- error = lock_page_killable(page);
- }
-
- if (unlikely(error))
- goto readpage_error;
- if (!PageUptodate(page)) {
- if (page->mapping == NULL) {
- /*
- * invalidate_mapping_pages got it
- */
- unlock_page(page);
- put_page(page);
- goto find_page;
- }
- unlock_page(page);
- shrink_readahead_size_eio(ra);
- error = -EIO;
- goto readpage_error;
- }
- unlock_page(page);
}
- goto page_ok;
-
-readpage_error:
- /* UHHUH! A synchronous read error occurred. Report it */
+ error = generic_file_buffered_read_page_ok(iocb, iter, page);
put_page(page);
- goto out;
-no_cached_page:
- /*
- * Ok, it wasn't cached, so we need to create a new
- * page..
- */
- page = page_cache_alloc(mapping);
- if (!page) {
- error = -ENOMEM;
- goto out;
- }
- error = add_to_page_cache_lru(page, mapping, index,
- mapping_gfp_constraint(mapping, GFP_KERNEL));
if (error) {
- put_page(page);
- if (error == -EEXIST) {
+ if (error > 0)
error = 0;
- goto find_page;
- }
goto out;
}
- goto readpage;
}
would_block:
error = -EAGAIN;
out:
- ra->prev_pos = prev_index;
- ra->prev_pos <<= PAGE_SHIFT;
- ra->prev_pos |= prev_offset;
-
- *ppos = ((loff_t)index << PAGE_SHIFT) + offset;
file_accessed(filp);
+ written += orig_count - iov_iter_count(iter);
+
return written ? written : error;
}
EXPORT_SYMBOL_GPL(generic_file_buffered_read);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 029/200] mm/filemap.c: generic_file_buffered_read() now uses find_get_pages_contig
2020-12-15 3:02 incoming Andrew Morton
` (27 preceding siblings ...)
2020-12-15 3:04 ` [patch 028/200] mm/filemap/c: break generic_file_buffered_read up into multiple functions Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 3:04 ` [patch 030/200] mm/truncate: add parameter explanation for invalidate_mapping_pagevec Andrew Morton
` (171 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: akpm, axboe, kent.overstreet, linux-mm, mm-commits, rong.a.chen,
torvalds, willy
From: Kent Overstreet <kent.overstreet@gmail.com>
Subject: mm/filemap.c: generic_file_buffered_read() now uses find_get_pages_contig
Convert generic_file_buffered_read() to get pages to read from in batches,
and then copy data to userspace from many pages at once - in particular,
we now don't touch any cachelines that might be contended while we're in
the loop to copy data to userspace.
This is is a performance improvement on workloads that do buffered reads
with large blocksizes, and a very large performance improvement if that
file is also being accessed concurrently by different threads.
On smaller reads (512 bytes), there's a very small performance improvement
(1%, within the margin of error).
akpm: kernel test robot found a 32% speedup on one test:
https://lkml.kernel.org/r/20201030081456.GY31092@shao2-debian
Link: https://lkml.kernel.org/r/20201025212949.602194-3-kent.overstreet@gmail.com
Signed-off-by: Kent Overstreet <kent.overstreet@gmail.com>
Cc: Jens Axboe <axboe@kernel.dk>
Cc: Matthew Wilcox (Oracle) <willy@infradead.org>
Cc: kernel test robot <rong.a.chen@intel.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/filemap.c | 313 +++++++++++++++++++++++++++----------------------
1 file changed, 175 insertions(+), 138 deletions(-)
--- a/mm/filemap.c~fs-generic_file_buffered_read-now-uses-find_get_pages_contig
+++ a/mm/filemap.c
@@ -2176,67 +2176,6 @@ static int lock_page_for_iocb(struct kio
return lock_page_killable(page);
}
-static int generic_file_buffered_read_page_ok(struct kiocb *iocb,
- struct iov_iter *iter,
- struct page *page)
-{
- struct address_space *mapping = iocb->ki_filp->f_mapping;
- struct inode *inode = mapping->host;
- struct file_ra_state *ra = &iocb->ki_filp->f_ra;
- unsigned int offset = iocb->ki_pos & ~PAGE_MASK;
- unsigned int bytes, copied;
- loff_t isize, end_offset;
-
- BUG_ON(iocb->ki_pos >> PAGE_SHIFT != page->index);
-
- /*
- * i_size must be checked after we know the page is Uptodate.
- *
- * Checking i_size after the check allows us to calculate
- * the correct value for "bytes", which means the zero-filled
- * part of the page is not copied back to userspace (unless
- * another truncate extends the file - this is desired though).
- */
-
- isize = i_size_read(inode);
- if (unlikely(iocb->ki_pos >= isize))
- return 1;
-
- end_offset = min_t(loff_t, isize, iocb->ki_pos + iter->count);
-
- bytes = min_t(loff_t, end_offset - iocb->ki_pos, PAGE_SIZE - offset);
-
- /* If users can be writing to this page using arbitrary
- * virtual addresses, take care about potential aliasing
- * before reading the page on the kernel side.
- */
- if (mapping_writably_mapped(mapping))
- flush_dcache_page(page);
-
- /*
- * Ok, we have the page, and it's up-to-date, so
- * now we can copy it to user space...
- */
-
- copied = copy_page_to_iter(page, offset, bytes, iter);
-
- iocb->ki_pos += copied;
-
- /*
- * When a sequential read accesses a page several times,
- * only mark it as accessed the first time.
- */
- if (iocb->ki_pos >> PAGE_SHIFT != ra->prev_pos >> PAGE_SHIFT)
- mark_page_accessed(page);
-
- ra->prev_pos = iocb->ki_pos;
-
- if (copied < bytes)
- return -EFAULT;
-
- return !iov_iter_count(iter) || iocb->ki_pos == isize;
-}
-
static struct page *
generic_file_buffered_read_readpage(struct kiocb *iocb,
struct file *filp,
@@ -2394,6 +2333,92 @@ generic_file_buffered_read_no_cached_pag
return generic_file_buffered_read_readpage(iocb, filp, mapping, page);
}
+static int generic_file_buffered_read_get_pages(struct kiocb *iocb,
+ struct iov_iter *iter,
+ struct page **pages,
+ unsigned int nr)
+{
+ struct file *filp = iocb->ki_filp;
+ struct address_space *mapping = filp->f_mapping;
+ struct file_ra_state *ra = &filp->f_ra;
+ pgoff_t index = iocb->ki_pos >> PAGE_SHIFT;
+ pgoff_t last_index = (iocb->ki_pos + iter->count + PAGE_SIZE-1) >> PAGE_SHIFT;
+ int i, j, nr_got, err = 0;
+
+ nr = min_t(unsigned long, last_index - index, nr);
+find_page:
+ if (fatal_signal_pending(current))
+ return -EINTR;
+
+ nr_got = find_get_pages_contig(mapping, index, nr, pages);
+ if (nr_got)
+ goto got_pages;
+
+ if (iocb->ki_flags & IOCB_NOIO)
+ return -EAGAIN;
+
+ page_cache_sync_readahead(mapping, ra, filp, index, last_index - index);
+
+ nr_got = find_get_pages_contig(mapping, index, nr, pages);
+ if (nr_got)
+ goto got_pages;
+
+ pages[0] = generic_file_buffered_read_no_cached_page(iocb, iter);
+ err = PTR_ERR_OR_ZERO(pages[0]);
+ if (!IS_ERR_OR_NULL(pages[0]))
+ nr_got = 1;
+got_pages:
+ for (i = 0; i < nr_got; i++) {
+ struct page *page = pages[i];
+ pgoff_t pg_index = index + i;
+ loff_t pg_pos = max(iocb->ki_pos,
+ (loff_t) pg_index << PAGE_SHIFT);
+ loff_t pg_count = iocb->ki_pos + iter->count - pg_pos;
+
+ if (PageReadahead(page)) {
+ if (iocb->ki_flags & IOCB_NOIO) {
+ for (j = i; j < nr_got; j++)
+ put_page(pages[j]);
+ nr_got = i;
+ err = -EAGAIN;
+ break;
+ }
+ page_cache_async_readahead(mapping, ra, filp, page,
+ pg_index, last_index - pg_index);
+ }
+
+ if (!PageUptodate(page)) {
+ if ((iocb->ki_flags & IOCB_NOWAIT) ||
+ ((iocb->ki_flags & IOCB_WAITQ) && i)) {
+ for (j = i; j < nr_got; j++)
+ put_page(pages[j]);
+ nr_got = i;
+ err = -EAGAIN;
+ break;
+ }
+
+ page = generic_file_buffered_read_pagenotuptodate(iocb,
+ filp, iter, page, pg_pos, pg_count);
+ if (IS_ERR_OR_NULL(page)) {
+ for (j = i + 1; j < nr_got; j++)
+ put_page(pages[j]);
+ nr_got = i;
+ err = PTR_ERR_OR_ZERO(page);
+ break;
+ }
+ }
+ }
+
+ if (likely(nr_got))
+ return nr_got;
+ if (err)
+ return err;
+ /*
+ * No pages and no error means we raced and should retry:
+ */
+ goto find_page;
+}
+
/**
* generic_file_buffered_read - generic file read routine
* @iocb: the iocb to read
@@ -2414,104 +2439,116 @@ ssize_t generic_file_buffered_read(struc
struct iov_iter *iter, ssize_t written)
{
struct file *filp = iocb->ki_filp;
+ struct file_ra_state *ra = &filp->f_ra;
struct address_space *mapping = filp->f_mapping;
struct inode *inode = mapping->host;
- struct file_ra_state *ra = &filp->f_ra;
- size_t orig_count = iov_iter_count(iter);
- pgoff_t last_index;
- int error = 0;
+ struct page *pages_onstack[PAGEVEC_SIZE], **pages = NULL;
+ unsigned int nr_pages = min_t(unsigned int, 512,
+ ((iocb->ki_pos + iter->count + PAGE_SIZE - 1) >> PAGE_SHIFT) -
+ (iocb->ki_pos >> PAGE_SHIFT));
+ int i, pg_nr, error = 0;
+ bool writably_mapped;
+ loff_t isize, end_offset;
if (unlikely(iocb->ki_pos >= inode->i_sb->s_maxbytes))
return 0;
iov_iter_truncate(iter, inode->i_sb->s_maxbytes);
- last_index = (iocb->ki_pos + iter->count + PAGE_SIZE-1) >> PAGE_SHIFT;
-
- /*
- * If we've already successfully copied some data, then we
- * can no longer safely return -EIOCBQUEUED. Hence mark
- * an async read NOWAIT at that point.
- */
- if (written && (iocb->ki_flags & IOCB_WAITQ))
- iocb->ki_flags |= IOCB_NOWAIT;
+ if (nr_pages > ARRAY_SIZE(pages_onstack))
+ pages = kmalloc_array(nr_pages, sizeof(void *), GFP_KERNEL);
- for (;;) {
- pgoff_t index = iocb->ki_pos >> PAGE_SHIFT;
- struct page *page;
+ if (!pages) {
+ pages = pages_onstack;
+ nr_pages = min_t(unsigned int, nr_pages, ARRAY_SIZE(pages_onstack));
+ }
+ do {
cond_resched();
-find_page:
- if (fatal_signal_pending(current)) {
- error = -EINTR;
- goto out;
- }
/*
- * We can't return -EIOCBQUEUED once we've done some work, so
- * ensure we don't block:
+ * If we've already successfully copied some data, then we
+ * can no longer safely return -EIOCBQUEUED. Hence mark
+ * an async read NOWAIT at that point.
*/
- if ((iocb->ki_flags & IOCB_WAITQ) &&
- (written + orig_count - iov_iter_count(iter)))
+ if ((iocb->ki_flags & IOCB_WAITQ) && written)
iocb->ki_flags |= IOCB_NOWAIT;
- page = find_get_page(mapping, index);
- if (!page) {
- if (iocb->ki_flags & IOCB_NOIO)
- goto would_block;
- page_cache_sync_readahead(mapping,
- ra, filp,
- index, last_index - index);
- page = find_get_page(mapping, index);
- if (unlikely(page == NULL)) {
- page = generic_file_buffered_read_no_cached_page(iocb, iter);
- if (!page)
- goto find_page;
- if (IS_ERR(page)) {
- error = PTR_ERR(page);
- goto out;
- }
- }
- }
- if (PageReadahead(page)) {
- if (iocb->ki_flags & IOCB_NOIO) {
- put_page(page);
- goto out;
- }
- page_cache_async_readahead(mapping,
- ra, filp, page,
- index, last_index - index);
- }
- if (!PageUptodate(page)) {
- if (iocb->ki_flags & IOCB_NOWAIT) {
- put_page(page);
- error = -EAGAIN;
- goto out;
- }
- page = generic_file_buffered_read_pagenotuptodate(iocb,
- filp, iter, page, iocb->ki_pos, iter->count);
- if (!page)
- goto find_page;
- if (IS_ERR(page)) {
- error = PTR_ERR(page);
- goto out;
- }
+ i = 0;
+ pg_nr = generic_file_buffered_read_get_pages(iocb, iter,
+ pages, nr_pages);
+ if (pg_nr < 0) {
+ error = pg_nr;
+ break;
}
- error = generic_file_buffered_read_page_ok(iocb, iter, page);
- put_page(page);
+ /*
+ * i_size must be checked after we know the pages are Uptodate.
+ *
+ * Checking i_size after the check allows us to calculate
+ * the correct value for "nr", which means the zero-filled
+ * part of the page is not copied back to userspace (unless
+ * another truncate extends the file - this is desired though).
+ */
+ isize = i_size_read(inode);
+ if (unlikely(iocb->ki_pos >= isize))
+ goto put_pages;
+
+ end_offset = min_t(loff_t, isize, iocb->ki_pos + iter->count);
+
+ while ((iocb->ki_pos >> PAGE_SHIFT) + pg_nr >
+ (end_offset + PAGE_SIZE - 1) >> PAGE_SHIFT)
+ put_page(pages[--pg_nr]);
+
+ /*
+ * Once we start copying data, we don't want to be touching any
+ * cachelines that might be contended:
+ */
+ writably_mapped = mapping_writably_mapped(mapping);
- if (error) {
- if (error > 0)
- error = 0;
- goto out;
+ /*
+ * When a sequential read accesses a page several times, only
+ * mark it as accessed the first time.
+ */
+ if (iocb->ki_pos >> PAGE_SHIFT !=
+ ra->prev_pos >> PAGE_SHIFT)
+ mark_page_accessed(pages[0]);
+ for (i = 1; i < pg_nr; i++)
+ mark_page_accessed(pages[i]);
+
+ for (i = 0; i < pg_nr; i++) {
+ unsigned int offset = iocb->ki_pos & ~PAGE_MASK;
+ unsigned int bytes = min_t(loff_t, end_offset - iocb->ki_pos,
+ PAGE_SIZE - offset);
+ unsigned int copied;
+
+ /*
+ * If users can be writing to this page using arbitrary
+ * virtual addresses, take care about potential aliasing
+ * before reading the page on the kernel side.
+ */
+ if (writably_mapped)
+ flush_dcache_page(pages[i]);
+
+ copied = copy_page_to_iter(pages[i], offset, bytes, iter);
+
+ written += copied;
+ iocb->ki_pos += copied;
+ ra->prev_pos = iocb->ki_pos;
+
+ if (copied < bytes) {
+ error = -EFAULT;
+ break;
+ }
}
- }
+put_pages:
+ for (i = 0; i < pg_nr; i++)
+ put_page(pages[i]);
+ } while (iov_iter_count(iter) && iocb->ki_pos < isize && !error);
-would_block:
- error = -EAGAIN;
-out:
file_accessed(filp);
- written += orig_count - iov_iter_count(iter);
+
+ if (pages != pages_onstack)
+ kfree(pages);
return written ? written : error;
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 030/200] mm/truncate: add parameter explanation for invalidate_mapping_pagevec
2020-12-15 3:02 incoming Andrew Morton
` (28 preceding siblings ...)
2020-12-15 3:04 ` [patch 029/200] mm/filemap.c: generic_file_buffered_read() now uses find_get_pages_contig Andrew Morton
@ 2020-12-15 3:04 ` Andrew Morton
2020-12-15 3:05 ` [patch 031/200] mm/filemap.c: remove else after a return Andrew Morton
` (170 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:04 UTC (permalink / raw)
To: akpm, alex.shi, corbet, linux-mm, mm-commits, rdunlap, torvalds
From: Alex Shi <alex.shi@linux.alibaba.com>
Subject: mm/truncate: add parameter explanation for invalidate_mapping_pagevec
To fix a kernel-doc markups issue:
mm/truncate.c:646: warning: Function parameter or member 'mapping' not
described in 'invalidate_mapping_pagevec'
mm/truncate.c:646: warning: Function parameter or member 'start' not
described in 'invalidate_mapping_pagevec'
mm/truncate.c:646: warning: Function parameter or member 'end' not
described in 'invalidate_mapping_pagevec'
mm/truncate.c:646: warning: Function parameter or member 'nr_pagevec'
not described in 'invalidate_mapping_pagevec'
Link: https://lkml.kernel.org/r/1605605088-30668-1-git-send-email-alex.shi@linux.alibaba.com
Signed-off-by: Alex Shi <alex.shi@linux.alibaba.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Randy Dunlap <rdunlap@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/truncate.c | 12 +++++++++---
1 file changed, 9 insertions(+), 3 deletions(-)
--- a/mm/truncate.c~mm-truncate-add-parameter-explanation-for-invalidate_mapping_pagevec
+++ a/mm/truncate.c
@@ -637,9 +637,15 @@ unsigned long invalidate_mapping_pages(s
EXPORT_SYMBOL(invalidate_mapping_pages);
/**
- * This helper is similar with the above one, except that it accounts for pages
- * that are likely on a pagevec and count them in @nr_pagevec, which will used by
- * the caller.
+ * invalidate_mapping_pagevec - Invalidate all the unlocked pages of one inode
+ * @mapping: the address_space which holds the pages to invalidate
+ * @start: the offset 'from' which to invalidate
+ * @end: the offset 'to' which to invalidate (inclusive)
+ * @nr_pagevec: invalidate failed page number for caller
+ *
+ * This helper is similar with invalidate_mapping_pages, except that it accounts
+ * for pages that failed to invalidate on a pagevec and count them in
+ * @nr_pagevec, which will used by the caller.
*/
void invalidate_mapping_pagevec(struct address_space *mapping,
pgoff_t start, pgoff_t end, unsigned long *nr_pagevec)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 031/200] mm/filemap.c: remove else after a return
2020-12-15 3:02 incoming Andrew Morton
` (29 preceding siblings ...)
2020-12-15 3:04 ` [patch 030/200] mm/truncate: add parameter explanation for invalidate_mapping_pagevec Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 032/200] mm/gup_benchmark: rename to mm/gup_test Andrew Morton
` (169 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, carver4lio, linux-mm, liu.hailong6, mm-commits, torvalds
From: Hailong Liu <carver4lio@163.com>
Subject: mm/filemap.c: remove else after a return
The `else' is not useful after a `return' in __lock_page_or_retry().
[akpm@linux-foundation.org: coding style fixes]
Link: https://lkml.kernel.org/r/20201202154720.115162-1-carver4lio@163.com
Signed-off-by: Hailong Liu<liu.hailong6@zte.com.cn>
Reviewed-by: Andrew Morton <akpm@linux-foundation.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/filemap.c | 23 ++++++++++++-----------
1 file changed, 12 insertions(+), 11 deletions(-)
--- a/mm/filemap.c~mm-remove-the-unuseful-else-after-a-return
+++ a/mm/filemap.c
@@ -1583,19 +1583,20 @@ int __lock_page_or_retry(struct page *pa
else
wait_on_page_locked(page);
return 0;
- } else {
- if (flags & FAULT_FLAG_KILLABLE) {
- int ret;
+ }
+ if (flags & FAULT_FLAG_KILLABLE) {
+ int ret;
- ret = __lock_page_killable(page);
- if (ret) {
- mmap_read_unlock(mm);
- return 0;
- }
- } else
- __lock_page(page);
- return 1;
+ ret = __lock_page_killable(page);
+ if (ret) {
+ mmap_read_unlock(mm);
+ return 0;
+ }
+ } else {
+ __lock_page(page);
}
+ return 1;
+
}
/**
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 032/200] mm/gup_benchmark: rename to mm/gup_test
2020-12-15 3:02 incoming Andrew Morton
` (30 preceding siblings ...)
2020-12-15 3:05 ` [patch 031/200] mm/filemap.c: remove else after a return Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 033/200] selftests/vm: use a common gup_test.h Andrew Morton
` (168 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, corbet, jglisse, jhubbard, linux-mm, mm-commits, rcampbell,
shuah, torvalds
From: John Hubbard <jhubbard@nvidia.com>
Subject: mm/gup_benchmark: rename to mm/gup_test
Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v3.
Summary: This series provides two main things, and a number of smaller
supporting goodies. The two main points are:
1) Add a new sub-test to gup_test, which in turn is a renamed version
of gup_benchmark. This sub-test allows nicer testing of dump_pages(),
at least on user-space pages.
For quite a while, I was doing a quick hack to gup_test.c whenever I
wanted to try out changes to dump_page(). Then Matthew Wilcox asked me
what I meant when I said "I used my dump_page() unit test", and I
realized that it might be nice to check in a polished up version of
that.
Details about how it works and how to use it are in the commit
description for patch #6 ("selftests/vm: gup_test: introduce the
dump_pages() sub-test").
2) Fixes a limitation of hmm-tests: these tests are incredibly useful,
but only if people actually build and run them. And it turns out that
libhugetlbfs is a little too effective at throwing a wrench in the
works, there. So I've added a little configuration check that removes
just two of the 21 hmm-tests, if libhugetlbfs is not available.
Further details in the commit description of patch #8
("selftests/vm: hmm-tests: remove the libhugetlbfs dependency").
Other smaller things that this series does:
a) Remove code duplication by creating gup_test.h.
b) Clear up the sub-test organization, and their invocation within
run_vmtests.sh.
c) Other minor assorted improvements.
[1] v2 is here:
https://lore.kernel.org/linux-doc/20200929212747.251804-1-jhubbard@nvidia.com/
[2] https://lore.kernel.org/r/CAHk-=wgh-TMPHLY3jueHX7Y2fWh3D+nMBqVS__AZm6-oorquWA@mail.gmail.com
This patch (of 9):
Rename nearly every "gup_benchmark" reference and file name to "gup_test".
The one exception is for the actual gup benchmark test itself.
The current code already does a *little* bit more than benchmarking, and
definitely covers more than get_user_pages_fast(). More importantly,
however, subsequent patches are about to add some functionality that is
non-benchmark related.
Closely related changes:
* Kconfig: in addition to renaming the options from GUP_BENCHMARK to
GUP_TEST, update the help text to reflect that it's no longer a
benchmark-only test.
Link: https://lkml.kernel.org/r/20201026064021.3545418-1-jhubbard@nvidia.com
Link: https://lkml.kernel.org/r/20201026064021.3545418-2-jhubbard@nvidia.com
Signed-off-by: John Hubbard <jhubbard@nvidia.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Jérôme Glisse <jglisse@redhat.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Shuah Khan <shuah@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/core-api/pin_user_pages.rst | 6
arch/s390/configs/debug_defconfig | 2
arch/s390/configs/defconfig | 2
mm/Kconfig | 15 -
mm/Makefile | 2
mm/gup_benchmark.c | 210 -------------------
mm/gup_test.c | 210 +++++++++++++++++++
tools/testing/selftests/vm/.gitignore | 2
tools/testing/selftests/vm/Makefile | 2
tools/testing/selftests/vm/config | 2
tools/testing/selftests/vm/gup_benchmark.c | 143 ------------
tools/testing/selftests/vm/gup_test.c | 143 ++++++++++++
tools/testing/selftests/vm/run_vmtests | 8
13 files changed, 376 insertions(+), 371 deletions(-)
--- a/arch/s390/configs/debug_defconfig~mm-gup_benchmark-rename-to-mm-gup_test
+++ a/arch/s390/configs/debug_defconfig
@@ -102,7 +102,7 @@ CONFIG_ZSMALLOC_STAT=y
CONFIG_DEFERRED_STRUCT_PAGE_INIT=y
CONFIG_IDLE_PAGE_TRACKING=y
CONFIG_PERCPU_STATS=y
-CONFIG_GUP_BENCHMARK=y
+CONFIG_GUP_TEST=y
CONFIG_NET=y
CONFIG_PACKET=y
CONFIG_PACKET_DIAG=m
--- a/arch/s390/configs/defconfig~mm-gup_benchmark-rename-to-mm-gup_test
+++ a/arch/s390/configs/defconfig
@@ -95,7 +95,7 @@ CONFIG_ZSMALLOC_STAT=y
CONFIG_DEFERRED_STRUCT_PAGE_INIT=y
CONFIG_IDLE_PAGE_TRACKING=y
CONFIG_PERCPU_STATS=y
-CONFIG_GUP_BENCHMARK=y
+CONFIG_GUP_TEST=y
CONFIG_NET=y
CONFIG_PACKET=y
CONFIG_PACKET_DIAG=m
--- a/Documentation/core-api/pin_user_pages.rst~mm-gup_benchmark-rename-to-mm-gup_test
+++ a/Documentation/core-api/pin_user_pages.rst
@@ -221,12 +221,12 @@ Unit testing
============
This file::
- tools/testing/selftests/vm/gup_benchmark.c
+ tools/testing/selftests/vm/gup_test.c
has the following new calls to exercise the new pin*() wrapper functions:
-* PIN_FAST_BENCHMARK (./gup_benchmark -a)
-* PIN_BENCHMARK (./gup_benchmark -b)
+* PIN_FAST_BENCHMARK (./gup_test -a)
+* PIN_BENCHMARK (./gup_test -b)
You can monitor how many total dma-pinned pages have been acquired and released
since the system was booted, via two new /proc/vmstat entries: ::
--- a/mm/gup_benchmark.c
+++ /dev/null
@@ -1,210 +0,0 @@
-#include <linux/kernel.h>
-#include <linux/mm.h>
-#include <linux/slab.h>
-#include <linux/uaccess.h>
-#include <linux/ktime.h>
-#include <linux/debugfs.h>
-
-#define GUP_FAST_BENCHMARK _IOWR('g', 1, struct gup_benchmark)
-#define GUP_BENCHMARK _IOWR('g', 2, struct gup_benchmark)
-#define PIN_FAST_BENCHMARK _IOWR('g', 3, struct gup_benchmark)
-#define PIN_BENCHMARK _IOWR('g', 4, struct gup_benchmark)
-#define PIN_LONGTERM_BENCHMARK _IOWR('g', 5, struct gup_benchmark)
-
-struct gup_benchmark {
- __u64 get_delta_usec;
- __u64 put_delta_usec;
- __u64 addr;
- __u64 size;
- __u32 nr_pages_per_call;
- __u32 flags;
- __u64 expansion[10]; /* For future use */
-};
-
-static void put_back_pages(unsigned int cmd, struct page **pages,
- unsigned long nr_pages)
-{
- unsigned long i;
-
- switch (cmd) {
- case GUP_FAST_BENCHMARK:
- case GUP_BENCHMARK:
- for (i = 0; i < nr_pages; i++)
- put_page(pages[i]);
- break;
-
- case PIN_FAST_BENCHMARK:
- case PIN_BENCHMARK:
- case PIN_LONGTERM_BENCHMARK:
- unpin_user_pages(pages, nr_pages);
- break;
- }
-}
-
-static void verify_dma_pinned(unsigned int cmd, struct page **pages,
- unsigned long nr_pages)
-{
- unsigned long i;
- struct page *page;
-
- switch (cmd) {
- case PIN_FAST_BENCHMARK:
- case PIN_BENCHMARK:
- case PIN_LONGTERM_BENCHMARK:
- for (i = 0; i < nr_pages; i++) {
- page = pages[i];
- if (WARN(!page_maybe_dma_pinned(page),
- "pages[%lu] is NOT dma-pinned\n", i)) {
-
- dump_page(page, "gup_benchmark failure");
- break;
- }
- }
- break;
- }
-}
-
-static int __gup_benchmark_ioctl(unsigned int cmd,
- struct gup_benchmark *gup)
-{
- ktime_t start_time, end_time;
- unsigned long i, nr_pages, addr, next;
- int nr;
- struct page **pages;
- int ret = 0;
- bool needs_mmap_lock =
- cmd != GUP_FAST_BENCHMARK && cmd != PIN_FAST_BENCHMARK;
-
- if (gup->size > ULONG_MAX)
- return -EINVAL;
-
- nr_pages = gup->size / PAGE_SIZE;
- pages = kvcalloc(nr_pages, sizeof(void *), GFP_KERNEL);
- if (!pages)
- return -ENOMEM;
-
- if (needs_mmap_lock && mmap_read_lock_killable(current->mm)) {
- ret = -EINTR;
- goto free_pages;
- }
-
- i = 0;
- nr = gup->nr_pages_per_call;
- start_time = ktime_get();
- for (addr = gup->addr; addr < gup->addr + gup->size; addr = next) {
- if (nr != gup->nr_pages_per_call)
- break;
-
- next = addr + nr * PAGE_SIZE;
- if (next > gup->addr + gup->size) {
- next = gup->addr + gup->size;
- nr = (next - addr) / PAGE_SIZE;
- }
-
- /* Filter out most gup flags: only allow a tiny subset here: */
- gup->flags &= FOLL_WRITE;
-
- switch (cmd) {
- case GUP_FAST_BENCHMARK:
- nr = get_user_pages_fast(addr, nr, gup->flags,
- pages + i);
- break;
- case GUP_BENCHMARK:
- nr = get_user_pages(addr, nr, gup->flags, pages + i,
- NULL);
- break;
- case PIN_FAST_BENCHMARK:
- nr = pin_user_pages_fast(addr, nr, gup->flags,
- pages + i);
- break;
- case PIN_BENCHMARK:
- nr = pin_user_pages(addr, nr, gup->flags, pages + i,
- NULL);
- break;
- case PIN_LONGTERM_BENCHMARK:
- nr = pin_user_pages(addr, nr,
- gup->flags | FOLL_LONGTERM,
- pages + i, NULL);
- break;
- default:
- ret = -EINVAL;
- goto unlock;
- }
-
- if (nr <= 0)
- break;
- i += nr;
- }
- end_time = ktime_get();
-
- /* Shifting the meaning of nr_pages: now it is actual number pinned: */
- nr_pages = i;
-
- gup->get_delta_usec = ktime_us_delta(end_time, start_time);
- gup->size = addr - gup->addr;
-
- /*
- * Take an un-benchmark-timed moment to verify DMA pinned
- * state: print a warning if any non-dma-pinned pages are found:
- */
- verify_dma_pinned(cmd, pages, nr_pages);
-
- start_time = ktime_get();
-
- put_back_pages(cmd, pages, nr_pages);
-
- end_time = ktime_get();
- gup->put_delta_usec = ktime_us_delta(end_time, start_time);
-
-unlock:
- if (needs_mmap_lock)
- mmap_read_unlock(current->mm);
-free_pages:
- kvfree(pages);
- return ret;
-}
-
-static long gup_benchmark_ioctl(struct file *filep, unsigned int cmd,
- unsigned long arg)
-{
- struct gup_benchmark gup;
- int ret;
-
- switch (cmd) {
- case GUP_FAST_BENCHMARK:
- case GUP_BENCHMARK:
- case PIN_FAST_BENCHMARK:
- case PIN_BENCHMARK:
- case PIN_LONGTERM_BENCHMARK:
- break;
- default:
- return -EINVAL;
- }
-
- if (copy_from_user(&gup, (void __user *)arg, sizeof(gup)))
- return -EFAULT;
-
- ret = __gup_benchmark_ioctl(cmd, &gup);
- if (ret)
- return ret;
-
- if (copy_to_user((void __user *)arg, &gup, sizeof(gup)))
- return -EFAULT;
-
- return 0;
-}
-
-static const struct file_operations gup_benchmark_fops = {
- .open = nonseekable_open,
- .unlocked_ioctl = gup_benchmark_ioctl,
-};
-
-static int gup_benchmark_init(void)
-{
- debugfs_create_file_unsafe("gup_benchmark", 0600, NULL, NULL,
- &gup_benchmark_fops);
-
- return 0;
-}
-
-late_initcall(gup_benchmark_init);
--- /dev/null
+++ a/mm/gup_test.c
@@ -0,0 +1,210 @@
+#include <linux/kernel.h>
+#include <linux/mm.h>
+#include <linux/slab.h>
+#include <linux/uaccess.h>
+#include <linux/ktime.h>
+#include <linux/debugfs.h>
+
+#define GUP_FAST_BENCHMARK _IOWR('g', 1, struct gup_test)
+#define GUP_BENCHMARK _IOWR('g', 2, struct gup_test)
+#define PIN_FAST_BENCHMARK _IOWR('g', 3, struct gup_test)
+#define PIN_BENCHMARK _IOWR('g', 4, struct gup_test)
+#define PIN_LONGTERM_BENCHMARK _IOWR('g', 5, struct gup_test)
+
+struct gup_test {
+ __u64 get_delta_usec;
+ __u64 put_delta_usec;
+ __u64 addr;
+ __u64 size;
+ __u32 nr_pages_per_call;
+ __u32 flags;
+ __u64 expansion[10]; /* For future use */
+};
+
+static void put_back_pages(unsigned int cmd, struct page **pages,
+ unsigned long nr_pages)
+{
+ unsigned long i;
+
+ switch (cmd) {
+ case GUP_FAST_BENCHMARK:
+ case GUP_BENCHMARK:
+ for (i = 0; i < nr_pages; i++)
+ put_page(pages[i]);
+ break;
+
+ case PIN_FAST_BENCHMARK:
+ case PIN_BENCHMARK:
+ case PIN_LONGTERM_BENCHMARK:
+ unpin_user_pages(pages, nr_pages);
+ break;
+ }
+}
+
+static void verify_dma_pinned(unsigned int cmd, struct page **pages,
+ unsigned long nr_pages)
+{
+ unsigned long i;
+ struct page *page;
+
+ switch (cmd) {
+ case PIN_FAST_BENCHMARK:
+ case PIN_BENCHMARK:
+ case PIN_LONGTERM_BENCHMARK:
+ for (i = 0; i < nr_pages; i++) {
+ page = pages[i];
+ if (WARN(!page_maybe_dma_pinned(page),
+ "pages[%lu] is NOT dma-pinned\n", i)) {
+
+ dump_page(page, "gup_test failure");
+ break;
+ }
+ }
+ break;
+ }
+}
+
+static int __gup_test_ioctl(unsigned int cmd,
+ struct gup_test *gup)
+{
+ ktime_t start_time, end_time;
+ unsigned long i, nr_pages, addr, next;
+ int nr;
+ struct page **pages;
+ int ret = 0;
+ bool needs_mmap_lock =
+ cmd != GUP_FAST_BENCHMARK && cmd != PIN_FAST_BENCHMARK;
+
+ if (gup->size > ULONG_MAX)
+ return -EINVAL;
+
+ nr_pages = gup->size / PAGE_SIZE;
+ pages = kvcalloc(nr_pages, sizeof(void *), GFP_KERNEL);
+ if (!pages)
+ return -ENOMEM;
+
+ if (needs_mmap_lock && mmap_read_lock_killable(current->mm)) {
+ ret = -EINTR;
+ goto free_pages;
+ }
+
+ i = 0;
+ nr = gup->nr_pages_per_call;
+ start_time = ktime_get();
+ for (addr = gup->addr; addr < gup->addr + gup->size; addr = next) {
+ if (nr != gup->nr_pages_per_call)
+ break;
+
+ next = addr + nr * PAGE_SIZE;
+ if (next > gup->addr + gup->size) {
+ next = gup->addr + gup->size;
+ nr = (next - addr) / PAGE_SIZE;
+ }
+
+ /* Filter out most gup flags: only allow a tiny subset here: */
+ gup->flags &= FOLL_WRITE;
+
+ switch (cmd) {
+ case GUP_FAST_BENCHMARK:
+ nr = get_user_pages_fast(addr, nr, gup->flags,
+ pages + i);
+ break;
+ case GUP_BENCHMARK:
+ nr = get_user_pages(addr, nr, gup->flags, pages + i,
+ NULL);
+ break;
+ case PIN_FAST_BENCHMARK:
+ nr = pin_user_pages_fast(addr, nr, gup->flags,
+ pages + i);
+ break;
+ case PIN_BENCHMARK:
+ nr = pin_user_pages(addr, nr, gup->flags, pages + i,
+ NULL);
+ break;
+ case PIN_LONGTERM_BENCHMARK:
+ nr = pin_user_pages(addr, nr,
+ gup->flags | FOLL_LONGTERM,
+ pages + i, NULL);
+ break;
+ default:
+ ret = -EINVAL;
+ goto unlock;
+ }
+
+ if (nr <= 0)
+ break;
+ i += nr;
+ }
+ end_time = ktime_get();
+
+ /* Shifting the meaning of nr_pages: now it is actual number pinned: */
+ nr_pages = i;
+
+ gup->get_delta_usec = ktime_us_delta(end_time, start_time);
+ gup->size = addr - gup->addr;
+
+ /*
+ * Take an un-benchmark-timed moment to verify DMA pinned
+ * state: print a warning if any non-dma-pinned pages are found:
+ */
+ verify_dma_pinned(cmd, pages, nr_pages);
+
+ start_time = ktime_get();
+
+ put_back_pages(cmd, pages, nr_pages);
+
+ end_time = ktime_get();
+ gup->put_delta_usec = ktime_us_delta(end_time, start_time);
+
+unlock:
+ if (needs_mmap_lock)
+ mmap_read_unlock(current->mm);
+free_pages:
+ kvfree(pages);
+ return ret;
+}
+
+static long gup_test_ioctl(struct file *filep, unsigned int cmd,
+ unsigned long arg)
+{
+ struct gup_test gup;
+ int ret;
+
+ switch (cmd) {
+ case GUP_FAST_BENCHMARK:
+ case GUP_BENCHMARK:
+ case PIN_FAST_BENCHMARK:
+ case PIN_BENCHMARK:
+ case PIN_LONGTERM_BENCHMARK:
+ break;
+ default:
+ return -EINVAL;
+ }
+
+ if (copy_from_user(&gup, (void __user *)arg, sizeof(gup)))
+ return -EFAULT;
+
+ ret = __gup_test_ioctl(cmd, &gup);
+ if (ret)
+ return ret;
+
+ if (copy_to_user((void __user *)arg, &gup, sizeof(gup)))
+ return -EFAULT;
+
+ return 0;
+}
+
+static const struct file_operations gup_test_fops = {
+ .open = nonseekable_open,
+ .unlocked_ioctl = gup_test_ioctl,
+};
+
+static int gup_test_init(void)
+{
+ debugfs_create_file_unsafe("gup_test", 0600, NULL, NULL,
+ &gup_test_fops);
+
+ return 0;
+}
+
+late_initcall(gup_test_init);
--- a/mm/Kconfig~mm-gup_benchmark-rename-to-mm-gup_test
+++ a/mm/Kconfig
@@ -821,13 +821,18 @@ config PERCPU_STATS
information includes global and per chunk statistics, which can
be used to help understand percpu memory usage.
-config GUP_BENCHMARK
- bool "Enable infrastructure for get_user_pages() and related calls benchmarking"
+config GUP_TEST
+ bool "Enable infrastructure for get_user_pages()-related unit tests"
help
- Provides /sys/kernel/debug/gup_benchmark that helps with testing
- performance of get_user_pages() and related calls.
+ Provides /sys/kernel/debug/gup_test, which in turn provides a way
+ to make ioctl calls that can launch kernel-based unit tests for
+ the get_user_pages*() and pin_user_pages*() family of API calls.
- See tools/testing/selftests/vm/gup_benchmark.c
+ These tests include benchmark testing of the _fast variants of
+ get_user_pages*() and pin_user_pages*(), as well as smoke tests of
+ the non-_fast variants.
+
+ See tools/testing/selftests/vm/gup_test.c
config GUP_GET_PTE_LOW_HIGH
bool
--- a/mm/Makefile~mm-gup_benchmark-rename-to-mm-gup_test
+++ a/mm/Makefile
@@ -90,7 +90,7 @@ obj-$(CONFIG_PAGE_COUNTER) += page_count
obj-$(CONFIG_MEMCG) += memcontrol.o vmpressure.o
obj-$(CONFIG_MEMCG_SWAP) += swap_cgroup.o
obj-$(CONFIG_CGROUP_HUGETLB) += hugetlb_cgroup.o
-obj-$(CONFIG_GUP_BENCHMARK) += gup_benchmark.o
+obj-$(CONFIG_GUP_TEST) += gup_test.o
obj-$(CONFIG_MEMORY_FAILURE) += memory-failure.o
obj-$(CONFIG_HWPOISON_INJECT) += hwpoison-inject.o
obj-$(CONFIG_DEBUG_KMEMLEAK) += kmemleak.o
--- a/tools/testing/selftests/vm/config~mm-gup_benchmark-rename-to-mm-gup_test
+++ a/tools/testing/selftests/vm/config
@@ -3,4 +3,4 @@ CONFIG_USERFAULTFD=y
CONFIG_TEST_VMALLOC=m
CONFIG_DEVICE_PRIVATE=y
CONFIG_TEST_HMM=m
-CONFIG_GUP_BENCHMARK=y
+CONFIG_GUP_TEST=y
--- a/tools/testing/selftests/vm/.gitignore~mm-gup_benchmark-rename-to-mm-gup_test
+++ a/tools/testing/selftests/vm/.gitignore
@@ -15,7 +15,7 @@ userfaultfd
mlock-intersect-test
mlock-random-test
virtual_address_range
-gup_benchmark
+gup_test
va_128TBswitch
map_fixed_noreplace
write_to_hugetlbfs
--- a/tools/testing/selftests/vm/gup_benchmark.c
+++ /dev/null
@@ -1,143 +0,0 @@
-#include <fcntl.h>
-#include <stdio.h>
-#include <stdlib.h>
-#include <unistd.h>
-
-#include <sys/ioctl.h>
-#include <sys/mman.h>
-#include <sys/prctl.h>
-#include <sys/stat.h>
-#include <sys/types.h>
-
-#include <linux/types.h>
-
-#define MB (1UL << 20)
-#define PAGE_SIZE sysconf(_SC_PAGESIZE)
-
-#define GUP_FAST_BENCHMARK _IOWR('g', 1, struct gup_benchmark)
-#define GUP_BENCHMARK _IOWR('g', 2, struct gup_benchmark)
-
-/* Similar to above, but use FOLL_PIN instead of FOLL_GET. */
-#define PIN_FAST_BENCHMARK _IOWR('g', 3, struct gup_benchmark)
-#define PIN_BENCHMARK _IOWR('g', 4, struct gup_benchmark)
-#define PIN_LONGTERM_BENCHMARK _IOWR('g', 5, struct gup_benchmark)
-
-/* Just the flags we need, copied from mm.h: */
-#define FOLL_WRITE 0x01 /* check pte is writable */
-
-struct gup_benchmark {
- __u64 get_delta_usec;
- __u64 put_delta_usec;
- __u64 addr;
- __u64 size;
- __u32 nr_pages_per_call;
- __u32 flags;
- __u64 expansion[10]; /* For future use */
-};
-
-int main(int argc, char **argv)
-{
- struct gup_benchmark gup;
- unsigned long size = 128 * MB;
- int i, fd, filed, opt, nr_pages = 1, thp = -1, repeats = 1, write = 0;
- int cmd = GUP_FAST_BENCHMARK, flags = MAP_PRIVATE;
- char *file = "/dev/zero";
- char *p;
-
- while ((opt = getopt(argc, argv, "m:r:n:f:abtTLUuwSH")) != -1) {
- switch (opt) {
- case 'a':
- cmd = PIN_FAST_BENCHMARK;
- break;
- case 'b':
- cmd = PIN_BENCHMARK;
- break;
- case 'L':
- cmd = PIN_LONGTERM_BENCHMARK;
- break;
- case 'm':
- size = atoi(optarg) * MB;
- break;
- case 'r':
- repeats = atoi(optarg);
- break;
- case 'n':
- nr_pages = atoi(optarg);
- break;
- case 't':
- thp = 1;
- break;
- case 'T':
- thp = 0;
- break;
- case 'U':
- cmd = GUP_BENCHMARK;
- break;
- case 'u':
- cmd = GUP_FAST_BENCHMARK;
- break;
- case 'w':
- write = 1;
- break;
- case 'f':
- file = optarg;
- break;
- case 'S':
- flags &= ~MAP_PRIVATE;
- flags |= MAP_SHARED;
- break;
- case 'H':
- flags |= (MAP_HUGETLB | MAP_ANONYMOUS);
- break;
- default:
- return -1;
- }
- }
-
- filed = open(file, O_RDWR|O_CREAT);
- if (filed < 0) {
- perror("open");
- exit(filed);
- }
-
- gup.nr_pages_per_call = nr_pages;
- if (write)
- gup.flags |= FOLL_WRITE;
-
- fd = open("/sys/kernel/debug/gup_benchmark", O_RDWR);
- if (fd == -1) {
- perror("open");
- exit(1);
- }
-
- p = mmap(NULL, size, PROT_READ | PROT_WRITE, flags, filed, 0);
- if (p == MAP_FAILED) {
- perror("mmap");
- exit(1);
- }
- gup.addr = (unsigned long)p;
-
- if (thp == 1)
- madvise(p, size, MADV_HUGEPAGE);
- else if (thp == 0)
- madvise(p, size, MADV_NOHUGEPAGE);
-
- for (; (unsigned long)p < gup.addr + size; p += PAGE_SIZE)
- p[0] = 0;
-
- for (i = 0; i < repeats; i++) {
- gup.size = size;
- if (ioctl(fd, cmd, &gup)) {
- perror("ioctl");
- exit(1);
- }
-
- printf("Time: get:%lld put:%lld us", gup.get_delta_usec,
- gup.put_delta_usec);
- if (gup.size != size)
- printf(", truncated (size: %lld)", gup.size);
- printf("\n");
- }
-
- return 0;
-}
--- /dev/null
+++ a/tools/testing/selftests/vm/gup_test.c
@@ -0,0 +1,143 @@
+#include <fcntl.h>
+#include <stdio.h>
+#include <stdlib.h>
+#include <unistd.h>
+
+#include <sys/ioctl.h>
+#include <sys/mman.h>
+#include <sys/prctl.h>
+#include <sys/stat.h>
+#include <sys/types.h>
+
+#include <linux/types.h>
+
+#define MB (1UL << 20)
+#define PAGE_SIZE sysconf(_SC_PAGESIZE)
+
+#define GUP_FAST_BENCHMARK _IOWR('g', 1, struct gup_test)
+#define GUP_BENCHMARK _IOWR('g', 2, struct gup_test)
+
+/* Similar to above, but use FOLL_PIN instead of FOLL_GET. */
+#define PIN_FAST_BENCHMARK _IOWR('g', 3, struct gup_test)
+#define PIN_BENCHMARK _IOWR('g', 4, struct gup_test)
+#define PIN_LONGTERM_BENCHMARK _IOWR('g', 5, struct gup_test)
+
+/* Just the flags we need, copied from mm.h: */
+#define FOLL_WRITE 0x01 /* check pte is writable */
+
+struct gup_test {
+ __u64 get_delta_usec;
+ __u64 put_delta_usec;
+ __u64 addr;
+ __u64 size;
+ __u32 nr_pages_per_call;
+ __u32 flags;
+ __u64 expansion[10]; /* For future use */
+};
+
+int main(int argc, char **argv)
+{
+ struct gup_test gup;
+ unsigned long size = 128 * MB;
+ int i, fd, filed, opt, nr_pages = 1, thp = -1, repeats = 1, write = 0;
+ int cmd = GUP_FAST_BENCHMARK, flags = MAP_PRIVATE;
+ char *file = "/dev/zero";
+ char *p;
+
+ while ((opt = getopt(argc, argv, "m:r:n:f:abtTLUuwSH")) != -1) {
+ switch (opt) {
+ case 'a':
+ cmd = PIN_FAST_BENCHMARK;
+ break;
+ case 'b':
+ cmd = PIN_BENCHMARK;
+ break;
+ case 'L':
+ cmd = PIN_LONGTERM_BENCHMARK;
+ break;
+ case 'm':
+ size = atoi(optarg) * MB;
+ break;
+ case 'r':
+ repeats = atoi(optarg);
+ break;
+ case 'n':
+ nr_pages = atoi(optarg);
+ break;
+ case 't':
+ thp = 1;
+ break;
+ case 'T':
+ thp = 0;
+ break;
+ case 'U':
+ cmd = GUP_BENCHMARK;
+ break;
+ case 'u':
+ cmd = GUP_FAST_BENCHMARK;
+ break;
+ case 'w':
+ write = 1;
+ break;
+ case 'f':
+ file = optarg;
+ break;
+ case 'S':
+ flags &= ~MAP_PRIVATE;
+ flags |= MAP_SHARED;
+ break;
+ case 'H':
+ flags |= (MAP_HUGETLB | MAP_ANONYMOUS);
+ break;
+ default:
+ return -1;
+ }
+ }
+
+ filed = open(file, O_RDWR|O_CREAT);
+ if (filed < 0) {
+ perror("open");
+ exit(filed);
+ }
+
+ gup.nr_pages_per_call = nr_pages;
+ if (write)
+ gup.flags |= FOLL_WRITE;
+
+ fd = open("/sys/kernel/debug/gup_test", O_RDWR);
+ if (fd == -1) {
+ perror("open");
+ exit(1);
+ }
+
+ p = mmap(NULL, size, PROT_READ | PROT_WRITE, flags, filed, 0);
+ if (p == MAP_FAILED) {
+ perror("mmap");
+ exit(1);
+ }
+ gup.addr = (unsigned long)p;
+
+ if (thp == 1)
+ madvise(p, size, MADV_HUGEPAGE);
+ else if (thp == 0)
+ madvise(p, size, MADV_NOHUGEPAGE);
+
+ for (; (unsigned long)p < gup.addr + size; p += PAGE_SIZE)
+ p[0] = 0;
+
+ for (i = 0; i < repeats; i++) {
+ gup.size = size;
+ if (ioctl(fd, cmd, &gup)) {
+ perror("ioctl");
+ exit(1);
+ }
+
+ printf("Time: get:%lld put:%lld us", gup.get_delta_usec,
+ gup.put_delta_usec);
+ if (gup.size != size)
+ printf(", truncated (size: %lld)", gup.size);
+ printf("\n");
+ }
+
+ return 0;
+}
--- a/tools/testing/selftests/vm/Makefile~mm-gup_benchmark-rename-to-mm-gup_test
+++ a/tools/testing/selftests/vm/Makefile
@@ -23,7 +23,7 @@ MAKEFLAGS += --no-builtin-rules
CFLAGS = -Wall -I ../../../../usr/include $(EXTRA_CFLAGS)
LDLIBS = -lrt
TEST_GEN_FILES = compaction_test
-TEST_GEN_FILES += gup_benchmark
+TEST_GEN_FILES += gup_test
TEST_GEN_FILES += hmm-tests
TEST_GEN_FILES += hugepage-mmap
TEST_GEN_FILES += hugepage-shm
--- a/tools/testing/selftests/vm/run_vmtests~mm-gup_benchmark-rename-to-mm-gup_test
+++ a/tools/testing/selftests/vm/run_vmtests
@@ -124,9 +124,9 @@ else
fi
echo "--------------------------------------------"
-echo "running 'gup_benchmark -U' (normal/slow gup)"
+echo "running 'gup_test -U' (normal/slow gup)"
echo "--------------------------------------------"
-./gup_benchmark -U
+./gup_test -U
if [ $? -ne 0 ]; then
echo "[FAIL]"
exitcode=1
@@ -135,9 +135,9 @@ else
fi
echo "------------------------------------------"
-echo "running gup_benchmark -b (pin_user_pages)"
+echo "running gup_test -b (pin_user_pages)"
echo "------------------------------------------"
-./gup_benchmark -b
+./gup_test -b
if [ $? -ne 0 ]; then
echo "[FAIL]"
exitcode=1
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 033/200] selftests/vm: use a common gup_test.h
2020-12-15 3:02 incoming Andrew Morton
` (31 preceding siblings ...)
2020-12-15 3:05 ` [patch 032/200] mm/gup_benchmark: rename to mm/gup_test Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 034/200] selftests/vm: rename run_vmtests --> run_vmtests.sh Andrew Morton
` (167 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, corbet, jglisse, jhubbard, linux-mm, mm-commits, rcampbell,
shuah, torvalds
From: John Hubbard <jhubbard@nvidia.com>
Subject: selftests/vm: use a common gup_test.h
Avoid the need to copy-paste the gup_test ioctl commands and the struct
gup_test definition, between the kernel and the user space application, by
providing a new header file for these. This allows easier and safer
adding of new ioctl calls, as well as reducing the overall line count.
Details: The header file has to be able to compile independently, because
of the arguably unfortunate way that the Makefile is written: the Makefile
tries to build all of its prerequisites, when really it should be only
building the .c files, and leaving the other prerequisites (LOCAL_HDRS) as
pure dependencies.
That Makefile limitation is probably not worth fixing, but it explains why
one of the includes had to be moved into the new header file.
Also: simplify the ioctl struct (struct gup_test), by deleting the unused
__expansion[10] field. This sort of thing is what you might see in a
stable ABI, but this low-level, kernel-developer-oriented selftests/vm
system is very much not subject to ABI stability. So "expansion" and
"reserved" fields are unnecessary here.
Link: https://lkml.kernel.org/r/20201026064021.3545418-3-jhubbard@nvidia.com
Signed-off-by: John Hubbard <jhubbard@nvidia.com>
Cc: Jérôme Glisse <jglisse@redhat.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Shuah Khan <shuah@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/gup_test.c | 17 +----------------
mm/gup_test.h | 22 ++++++++++++++++++++++
tools/testing/selftests/vm/Makefile | 2 ++
tools/testing/selftests/vm/gup_test.c | 22 +---------------------
4 files changed, 26 insertions(+), 37 deletions(-)
--- a/mm/gup_test.c~selftests-vm-use-a-common-gup_testh
+++ a/mm/gup_test.c
@@ -4,22 +4,7 @@
#include <linux/uaccess.h>
#include <linux/ktime.h>
#include <linux/debugfs.h>
-
-#define GUP_FAST_BENCHMARK _IOWR('g', 1, struct gup_test)
-#define GUP_BENCHMARK _IOWR('g', 2, struct gup_test)
-#define PIN_FAST_BENCHMARK _IOWR('g', 3, struct gup_test)
-#define PIN_BENCHMARK _IOWR('g', 4, struct gup_test)
-#define PIN_LONGTERM_BENCHMARK _IOWR('g', 5, struct gup_test)
-
-struct gup_test {
- __u64 get_delta_usec;
- __u64 put_delta_usec;
- __u64 addr;
- __u64 size;
- __u32 nr_pages_per_call;
- __u32 flags;
- __u64 expansion[10]; /* For future use */
-};
+#include "gup_test.h"
static void put_back_pages(unsigned int cmd, struct page **pages,
unsigned long nr_pages)
--- /dev/null
+++ a/mm/gup_test.h
@@ -0,0 +1,22 @@
+/* SPDX-License-Identifier: GPL-2.0-or-later */
+#ifndef __GUP_TEST_H
+#define __GUP_TEST_H
+
+#include <linux/types.h>
+
+#define GUP_FAST_BENCHMARK _IOWR('g', 1, struct gup_test)
+#define GUP_BENCHMARK _IOWR('g', 2, struct gup_test)
+#define PIN_FAST_BENCHMARK _IOWR('g', 3, struct gup_test)
+#define PIN_BENCHMARK _IOWR('g', 4, struct gup_test)
+#define PIN_LONGTERM_BENCHMARK _IOWR('g', 5, struct gup_test)
+
+struct gup_test {
+ __u64 get_delta_usec;
+ __u64 put_delta_usec;
+ __u64 addr;
+ __u64 size;
+ __u32 nr_pages_per_call;
+ __u32 flags;
+};
+
+#endif /* __GUP_TEST_H */
--- a/tools/testing/selftests/vm/gup_test.c~selftests-vm-use-a-common-gup_testh
+++ a/tools/testing/selftests/vm/gup_test.c
@@ -2,39 +2,19 @@
#include <stdio.h>
#include <stdlib.h>
#include <unistd.h>
-
#include <sys/ioctl.h>
#include <sys/mman.h>
#include <sys/prctl.h>
#include <sys/stat.h>
#include <sys/types.h>
-
-#include <linux/types.h>
+#include "../../../../mm/gup_test.h"
#define MB (1UL << 20)
#define PAGE_SIZE sysconf(_SC_PAGESIZE)
-#define GUP_FAST_BENCHMARK _IOWR('g', 1, struct gup_test)
-#define GUP_BENCHMARK _IOWR('g', 2, struct gup_test)
-
-/* Similar to above, but use FOLL_PIN instead of FOLL_GET. */
-#define PIN_FAST_BENCHMARK _IOWR('g', 3, struct gup_test)
-#define PIN_BENCHMARK _IOWR('g', 4, struct gup_test)
-#define PIN_LONGTERM_BENCHMARK _IOWR('g', 5, struct gup_test)
-
/* Just the flags we need, copied from mm.h: */
#define FOLL_WRITE 0x01 /* check pte is writable */
-struct gup_test {
- __u64 get_delta_usec;
- __u64 put_delta_usec;
- __u64 addr;
- __u64 size;
- __u32 nr_pages_per_call;
- __u32 flags;
- __u64 expansion[10]; /* For future use */
-};
-
int main(int argc, char **argv)
{
struct gup_test gup;
--- a/tools/testing/selftests/vm/Makefile~selftests-vm-use-a-common-gup_testh
+++ a/tools/testing/selftests/vm/Makefile
@@ -134,3 +134,5 @@ endif
$(OUTPUT)/userfaultfd: LDLIBS += -lpthread
$(OUTPUT)/mlock-random-test: LDLIBS += -lcap
+
+$(OUTPUT)/gup_test: ../../../../mm/gup_test.h
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 034/200] selftests/vm: rename run_vmtests --> run_vmtests.sh
2020-12-15 3:02 incoming Andrew Morton
` (32 preceding siblings ...)
2020-12-15 3:05 ` [patch 033/200] selftests/vm: use a common gup_test.h Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 035/200] selftests/vm: minor cleanup: Makefile and gup_test.c Andrew Morton
` (166 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, corbet, jglisse, jhubbard, linux-mm, mm-commits, rcampbell,
shuah, torvalds
From: John Hubbard <jhubbard@nvidia.com>
Subject: selftests/vm: rename run_vmtests --> run_vmtests.sh
Rename to *.sh, in order to match the conventions of all of the other
items in selftest/vm.
The only reason not to use a .sh suffix a shell script like this, might be
to make it look more like a normal program, but that's not an issue here.
Link: https://lkml.kernel.org/r/20201026064021.3545418-4-jhubbard@nvidia.com
Signed-off-by: John Hubbard <jhubbard@nvidia.com>
Cc: Jérôme Glisse <jglisse@redhat.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Shuah Khan <shuah@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
tools/testing/selftests/vm/Makefile | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/tools/testing/selftests/vm/Makefile~selftests-vm-rename-run_vmtests-run_vmtestssh
+++ a/tools/testing/selftests/vm/Makefile
@@ -73,7 +73,7 @@ TEST_GEN_FILES += virtual_address_range
TEST_GEN_FILES += write_to_hugetlbfs
endif
-TEST_PROGS := run_vmtests
+TEST_PROGS := run_vmtests.sh
TEST_FILES := test_vmalloc.sh
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 035/200] selftests/vm: minor cleanup: Makefile and gup_test.c
2020-12-15 3:02 incoming Andrew Morton
` (33 preceding siblings ...)
2020-12-15 3:05 ` [patch 034/200] selftests/vm: rename run_vmtests --> run_vmtests.sh Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 036/200] selftests/vm: only some gup_test items are really benchmarks Andrew Morton
` (165 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, corbet, jglisse, jhubbard, linux-mm, mm-commits, rcampbell,
shuah, torvalds
From: John Hubbard <jhubbard@nvidia.com>
Subject: selftests/vm: minor cleanup: Makefile and gup_test.c
A few cleanups that don't deserve separate patches, but that also should
not clutter up other functional changes:
1. Remove an unnecessary #include <prctl.h>
2. Restore the sorted order of TEST_GEN_FILES.
3. Add -lpthread to the common LDLIBS, as it is harmless and several
tests use it. This gets rid of one special rule already.
Link: https://lkml.kernel.org/r/20201026064021.3545418-5-jhubbard@nvidia.com
Signed-off-by: John Hubbard <jhubbard@nvidia.com>
Cc: Jérôme Glisse <jglisse@redhat.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Shuah Khan <shuah@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
tools/testing/selftests/vm/Makefile | 10 ++++------
tools/testing/selftests/vm/gup_test.c | 1 -
2 files changed, 4 insertions(+), 7 deletions(-)
--- a/tools/testing/selftests/vm/gup_test.c~selftests-vm-minor-cleanup-makefile-and-gup_testc
+++ a/tools/testing/selftests/vm/gup_test.c
@@ -4,7 +4,6 @@
#include <unistd.h>
#include <sys/ioctl.h>
#include <sys/mman.h>
-#include <sys/prctl.h>
#include <sys/stat.h>
#include <sys/types.h>
#include "../../../../mm/gup_test.h"
--- a/tools/testing/selftests/vm/Makefile~selftests-vm-minor-cleanup-makefile-and-gup_testc
+++ a/tools/testing/selftests/vm/Makefile
@@ -21,14 +21,15 @@ MACHINE ?= $(shell echo $(uname_M) | sed
MAKEFLAGS += --no-builtin-rules
CFLAGS = -Wall -I ../../../../usr/include $(EXTRA_CFLAGS)
-LDLIBS = -lrt
+LDLIBS = -lrt -lpthread
TEST_GEN_FILES = compaction_test
TEST_GEN_FILES += gup_test
TEST_GEN_FILES += hmm-tests
TEST_GEN_FILES += hugepage-mmap
TEST_GEN_FILES += hugepage-shm
-TEST_GEN_FILES += map_hugetlb
+TEST_GEN_FILES += khugepaged
TEST_GEN_FILES += map_fixed_noreplace
+TEST_GEN_FILES += map_hugetlb
TEST_GEN_FILES += map_populate
TEST_GEN_FILES += mlock-random-test
TEST_GEN_FILES += mlock2-tests
@@ -37,7 +38,6 @@ TEST_GEN_FILES += on-fault-limit
TEST_GEN_FILES += thuge-gen
TEST_GEN_FILES += transhuge-stress
TEST_GEN_FILES += userfaultfd
-TEST_GEN_FILES += khugepaged
ifeq ($(ARCH),x86_64)
CAN_BUILD_I386 := $(shell ./../x86/check_cc.sh $(CC) ../x86/trivial_32bit_program.c -m32)
@@ -80,7 +80,7 @@ TEST_FILES := test_vmalloc.sh
KSFT_KHDR_INSTALL := 1
include ../lib.mk
-$(OUTPUT)/hmm-tests: LDLIBS += -lhugetlbfs -lpthread
+$(OUTPUT)/hmm-tests: LDLIBS += -lhugetlbfs
ifeq ($(ARCH),x86_64)
BINARIES_32 := $(patsubst %,$(OUTPUT)/%,$(BINARIES_32))
@@ -131,8 +131,6 @@ warn_32bit_failure:
endif
endif
-$(OUTPUT)/userfaultfd: LDLIBS += -lpthread
-
$(OUTPUT)/mlock-random-test: LDLIBS += -lcap
$(OUTPUT)/gup_test: ../../../../mm/gup_test.h
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 036/200] selftests/vm: only some gup_test items are really benchmarks
2020-12-15 3:02 incoming Andrew Morton
` (34 preceding siblings ...)
2020-12-15 3:05 ` [patch 035/200] selftests/vm: minor cleanup: Makefile and gup_test.c Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 037/200] selftests/vm: gup_test: introduce the dump_pages() sub-test Andrew Morton
` (164 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, corbet, jglisse, jhubbard, linux-mm, mm-commits, rcampbell,
shuah, torvalds
From: John Hubbard <jhubbard@nvidia.com>
Subject: selftests/vm: only some gup_test items are really benchmarks
Therefore, some minor cleanup and improvements are in order:
1. Rename the other items appropriately.
2. Stop reporting timing information on the non-benchmark items. It's
still being recorded and is available, but there's no point in
cluttering up the report with data that no one reasonably needs to
check.
3. Don't do iterations, for non-benchmark items.
4. Print out a shorter, more appropriate report for the non-benchmark
tests.
5. Add the command that was run, to the report. This really helps, as
there are quite a lot of options now.
6. Use a larger integer type for cmd, now that it's being compared
Otherwise it doesn't work, because in this case cmd is about 3 billion,
which is the perfect size for problems with signed vs unsigned int.
Link: https://lkml.kernel.org/r/20201026064021.3545418-6-jhubbard@nvidia.com
Signed-off-by: John Hubbard <jhubbard@nvidia.com>
Cc: Jérôme Glisse <jglisse@redhat.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Shuah Khan <shuah@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/core-api/pin_user_pages.rst | 2
mm/gup_test.c | 14 ++---
mm/gup_test.h | 8 +--
tools/testing/selftests/vm/gup_test.c | 47 ++++++++++++++++----
4 files changed, 51 insertions(+), 20 deletions(-)
--- a/Documentation/core-api/pin_user_pages.rst~selftests-vm-only-some-gup_test-items-are-really-benchmarks
+++ a/Documentation/core-api/pin_user_pages.rst
@@ -226,7 +226,7 @@ This file::
has the following new calls to exercise the new pin*() wrapper functions:
* PIN_FAST_BENCHMARK (./gup_test -a)
-* PIN_BENCHMARK (./gup_test -b)
+* PIN_BASIC_TEST (./gup_test -b)
You can monitor how many total dma-pinned pages have been acquired and released
since the system was booted, via two new /proc/vmstat entries: ::
--- a/mm/gup_test.c~selftests-vm-only-some-gup_test-items-are-really-benchmarks
+++ a/mm/gup_test.c
@@ -13,13 +13,13 @@ static void put_back_pages(unsigned int
switch (cmd) {
case GUP_FAST_BENCHMARK:
- case GUP_BENCHMARK:
+ case GUP_BASIC_TEST:
for (i = 0; i < nr_pages; i++)
put_page(pages[i]);
break;
case PIN_FAST_BENCHMARK:
- case PIN_BENCHMARK:
+ case PIN_BASIC_TEST:
case PIN_LONGTERM_BENCHMARK:
unpin_user_pages(pages, nr_pages);
break;
@@ -34,7 +34,7 @@ static void verify_dma_pinned(unsigned i
switch (cmd) {
case PIN_FAST_BENCHMARK:
- case PIN_BENCHMARK:
+ case PIN_BASIC_TEST:
case PIN_LONGTERM_BENCHMARK:
for (i = 0; i < nr_pages; i++) {
page = pages[i];
@@ -94,7 +94,7 @@ static int __gup_test_ioctl(unsigned int
nr = get_user_pages_fast(addr, nr, gup->flags,
pages + i);
break;
- case GUP_BENCHMARK:
+ case GUP_BASIC_TEST:
nr = get_user_pages(addr, nr, gup->flags, pages + i,
NULL);
break;
@@ -102,7 +102,7 @@ static int __gup_test_ioctl(unsigned int
nr = pin_user_pages_fast(addr, nr, gup->flags,
pages + i);
break;
- case PIN_BENCHMARK:
+ case PIN_BASIC_TEST:
nr = pin_user_pages(addr, nr, gup->flags, pages + i,
NULL);
break;
@@ -157,10 +157,10 @@ static long gup_test_ioctl(struct file *
switch (cmd) {
case GUP_FAST_BENCHMARK:
- case GUP_BENCHMARK:
case PIN_FAST_BENCHMARK:
- case PIN_BENCHMARK:
case PIN_LONGTERM_BENCHMARK:
+ case GUP_BASIC_TEST:
+ case PIN_BASIC_TEST:
break;
default:
return -EINVAL;
--- a/mm/gup_test.h~selftests-vm-only-some-gup_test-items-are-really-benchmarks
+++ a/mm/gup_test.h
@@ -5,10 +5,10 @@
#include <linux/types.h>
#define GUP_FAST_BENCHMARK _IOWR('g', 1, struct gup_test)
-#define GUP_BENCHMARK _IOWR('g', 2, struct gup_test)
-#define PIN_FAST_BENCHMARK _IOWR('g', 3, struct gup_test)
-#define PIN_BENCHMARK _IOWR('g', 4, struct gup_test)
-#define PIN_LONGTERM_BENCHMARK _IOWR('g', 5, struct gup_test)
+#define PIN_FAST_BENCHMARK _IOWR('g', 2, struct gup_test)
+#define PIN_LONGTERM_BENCHMARK _IOWR('g', 3, struct gup_test)
+#define GUP_BASIC_TEST _IOWR('g', 4, struct gup_test)
+#define PIN_BASIC_TEST _IOWR('g', 5, struct gup_test)
struct gup_test {
__u64 get_delta_usec;
--- a/tools/testing/selftests/vm/gup_test.c~selftests-vm-only-some-gup_test-items-are-really-benchmarks
+++ a/tools/testing/selftests/vm/gup_test.c
@@ -14,12 +14,30 @@
/* Just the flags we need, copied from mm.h: */
#define FOLL_WRITE 0x01 /* check pte is writable */
+static char *cmd_to_str(unsigned long cmd)
+{
+ switch (cmd) {
+ case GUP_FAST_BENCHMARK:
+ return "GUP_FAST_BENCHMARK";
+ case PIN_FAST_BENCHMARK:
+ return "PIN_FAST_BENCHMARK";
+ case PIN_LONGTERM_BENCHMARK:
+ return "PIN_LONGTERM_BENCHMARK";
+ case GUP_BASIC_TEST:
+ return "GUP_BASIC_TEST";
+ case PIN_BASIC_TEST:
+ return "PIN_BASIC_TEST";
+ }
+ return "Unknown command";
+}
+
int main(int argc, char **argv)
{
struct gup_test gup;
unsigned long size = 128 * MB;
int i, fd, filed, opt, nr_pages = 1, thp = -1, repeats = 1, write = 0;
- int cmd = GUP_FAST_BENCHMARK, flags = MAP_PRIVATE;
+ unsigned long cmd = GUP_FAST_BENCHMARK;
+ int flags = MAP_PRIVATE;
char *file = "/dev/zero";
char *p;
@@ -29,7 +47,7 @@ int main(int argc, char **argv)
cmd = PIN_FAST_BENCHMARK;
break;
case 'b':
- cmd = PIN_BENCHMARK;
+ cmd = PIN_BASIC_TEST;
break;
case 'L':
cmd = PIN_LONGTERM_BENCHMARK;
@@ -50,7 +68,7 @@ int main(int argc, char **argv)
thp = 0;
break;
case 'U':
- cmd = GUP_BENCHMARK;
+ cmd = GUP_BASIC_TEST;
break;
case 'u':
cmd = GUP_FAST_BENCHMARK;
@@ -104,18 +122,31 @@ int main(int argc, char **argv)
for (; (unsigned long)p < gup.addr + size; p += PAGE_SIZE)
p[0] = 0;
- for (i = 0; i < repeats; i++) {
+ /* Only report timing information on the *_BENCHMARK commands: */
+ if ((cmd == PIN_FAST_BENCHMARK) || (cmd == GUP_FAST_BENCHMARK) ||
+ (cmd == PIN_LONGTERM_BENCHMARK)) {
+ for (i = 0; i < repeats; i++) {
+ gup.size = size;
+ if (ioctl(fd, cmd, &gup))
+ perror("ioctl"), exit(1);
+
+ printf("%s: Time: get:%lld put:%lld us",
+ cmd_to_str(cmd), gup.get_delta_usec,
+ gup.put_delta_usec);
+ if (gup.size != size)
+ printf(", truncated (size: %lld)", gup.size);
+ printf("\n");
+ }
+ } else {
gup.size = size;
if (ioctl(fd, cmd, &gup)) {
perror("ioctl");
exit(1);
}
- printf("Time: get:%lld put:%lld us", gup.get_delta_usec,
- gup.put_delta_usec);
+ printf("%s: done\n", cmd_to_str(cmd));
if (gup.size != size)
- printf(", truncated (size: %lld)", gup.size);
- printf("\n");
+ printf("Truncated (size: %lld)\n", gup.size);
}
return 0;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 037/200] selftests/vm: gup_test: introduce the dump_pages() sub-test
2020-12-15 3:02 incoming Andrew Morton
` (35 preceding siblings ...)
2020-12-15 3:05 ` [patch 036/200] selftests/vm: only some gup_test items are really benchmarks Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 038/200] selftests/vm: run_vmtests.sh: update and clean up gup_test invocation Andrew Morton
` (163 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, corbet, jglisse, jhubbard, linux-mm, mm-commits, rcampbell,
shuah, torvalds
From: John Hubbard <jhubbard@nvidia.com>
Subject: selftests/vm: gup_test: introduce the dump_pages() sub-test
For quite a while, I was doing a quick hack to gup_test.c (previously,
gup_benchmark.c) whenever I wanted to try out my changes to dump_page().
This makes that hack unnecessary, and instead allows anyone to easily get
the same coverage from a user space program. That saves a lot of time
because you don't have to change the kernel, in order to test different
pages and options.
The new sub-test takes advantage of the existing gup_test infrastructure,
which already provides a simple user space program, some allocated user
space pages, an ioctl call, pinning of those pages (via either
get_user_pages or pin_user_pages) and a corresponding kernel-side test
invocation. There's not much more required, mainly just a couple of
inputs from the user.
In fact, the new test re-uses the existing command line options in order
to get various helpful combinations (THP or normal, _fast or slow gup, gup
vs. pup, and more).
New command line options are: which pages to dump, and what type of
"get/pin" to use.
In order to figure out which pages to dump, the logic is:
* If the user doesn't specify anything, the page 0 (the first page in
the address range that the program sets up for testing) is dumped.
* Or, the user can type up to 8 page indices anywhere on the command
line. If you type more than 8, then it uses the first 8 and ignores the
remaining items.
For example:
./gup_test -ct -F 1 0 19 0x1000
Meaning:
-c: dump pages sub-test
-t: use THP pages
-F 1: use pin_user_pages() instead of get_user_pages()
0 19 0x1000: dump pages 0, 19, and 4096
Link: https://lkml.kernel.org/r/20201026064021.3545418-7-jhubbard@nvidia.com
Signed-off-by: John Hubbard <jhubbard@nvidia.com>
Cc: Jérôme Glisse <jglisse@redhat.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Shuah Khan <shuah@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/Kconfig | 6 ++
mm/gup_test.c | 56 +++++++++++++++++++++++-
mm/gup_test.h | 10 ++++
tools/testing/selftests/vm/gup_test.c | 45 ++++++++++++++++++-
4 files changed, 113 insertions(+), 4 deletions(-)
--- a/mm/gup_test.c~selftests-vm-gup_test-introduce-the-dump_pages-sub-test
+++ a/mm/gup_test.c
@@ -7,7 +7,7 @@
#include "gup_test.h"
static void put_back_pages(unsigned int cmd, struct page **pages,
- unsigned long nr_pages)
+ unsigned long nr_pages, unsigned int gup_test_flags)
{
unsigned long i;
@@ -23,6 +23,15 @@ static void put_back_pages(unsigned int
case PIN_LONGTERM_BENCHMARK:
unpin_user_pages(pages, nr_pages);
break;
+ case DUMP_USER_PAGES_TEST:
+ if (gup_test_flags & GUP_TEST_FLAG_DUMP_PAGES_USE_PIN) {
+ unpin_user_pages(pages, nr_pages);
+ } else {
+ for (i = 0; i < nr_pages; i++)
+ put_page(pages[i]);
+
+ }
+ break;
}
}
@@ -49,6 +58,37 @@ static void verify_dma_pinned(unsigned i
}
}
+static void dump_pages_test(struct gup_test *gup, struct page **pages,
+ unsigned long nr_pages)
+{
+ unsigned int index_to_dump;
+ unsigned int i;
+
+ /*
+ * Zero out any user-supplied page index that is out of range. Remember:
+ * .which_pages[] contains a 1-based set of page indices.
+ */
+ for (i = 0; i < GUP_TEST_MAX_PAGES_TO_DUMP; i++) {
+ if (gup->which_pages[i] > nr_pages) {
+ pr_warn("ZEROING due to out of range: .which_pages[%u]: %u\n",
+ i, gup->which_pages[i]);
+ gup->which_pages[i] = 0;
+ }
+ }
+
+ for (i = 0; i < GUP_TEST_MAX_PAGES_TO_DUMP; i++) {
+ index_to_dump = gup->which_pages[i];
+
+ if (index_to_dump) {
+ index_to_dump--; // Decode from 1-based, to 0-based
+ pr_info("---- page #%u, starting from user virt addr: 0x%llx\n",
+ index_to_dump, gup->addr);
+ dump_page(pages[index_to_dump],
+ "gup_test: dump_pages() test");
+ }
+ }
+}
+
static int __gup_test_ioctl(unsigned int cmd,
struct gup_test *gup)
{
@@ -111,6 +151,14 @@ static int __gup_test_ioctl(unsigned int
gup->flags | FOLL_LONGTERM,
pages + i, NULL);
break;
+ case DUMP_USER_PAGES_TEST:
+ if (gup->flags & GUP_TEST_FLAG_DUMP_PAGES_USE_PIN)
+ nr = pin_user_pages(addr, nr, gup->flags,
+ pages + i, NULL);
+ else
+ nr = get_user_pages(addr, nr, gup->flags,
+ pages + i, NULL);
+ break;
default:
ret = -EINVAL;
goto unlock;
@@ -134,9 +182,12 @@ static int __gup_test_ioctl(unsigned int
*/
verify_dma_pinned(cmd, pages, nr_pages);
+ if (cmd == DUMP_USER_PAGES_TEST)
+ dump_pages_test(gup, pages, nr_pages);
+
start_time = ktime_get();
- put_back_pages(cmd, pages, nr_pages);
+ put_back_pages(cmd, pages, nr_pages, gup->flags);
end_time = ktime_get();
gup->put_delta_usec = ktime_us_delta(end_time, start_time);
@@ -161,6 +212,7 @@ static long gup_test_ioctl(struct file *
case PIN_LONGTERM_BENCHMARK:
case GUP_BASIC_TEST:
case PIN_BASIC_TEST:
+ case DUMP_USER_PAGES_TEST:
break;
default:
return -EINVAL;
--- a/mm/gup_test.h~selftests-vm-gup_test-introduce-the-dump_pages-sub-test
+++ a/mm/gup_test.h
@@ -9,6 +9,11 @@
#define PIN_LONGTERM_BENCHMARK _IOWR('g', 3, struct gup_test)
#define GUP_BASIC_TEST _IOWR('g', 4, struct gup_test)
#define PIN_BASIC_TEST _IOWR('g', 5, struct gup_test)
+#define DUMP_USER_PAGES_TEST _IOWR('g', 6, struct gup_test)
+
+#define GUP_TEST_MAX_PAGES_TO_DUMP 8
+
+#define GUP_TEST_FLAG_DUMP_PAGES_USE_PIN 0x1
struct gup_test {
__u64 get_delta_usec;
@@ -17,6 +22,11 @@ struct gup_test {
__u64 size;
__u32 nr_pages_per_call;
__u32 flags;
+ /*
+ * Each non-zero entry is the number of the page (1-based: first page is
+ * page 1, so that zero entries mean "do nothing") from the .addr base.
+ */
+ __u32 which_pages[GUP_TEST_MAX_PAGES_TO_DUMP];
};
#endif /* __GUP_TEST_H */
--- a/mm/Kconfig~selftests-vm-gup_test-introduce-the-dump_pages-sub-test
+++ a/mm/Kconfig
@@ -832,6 +832,12 @@ config GUP_TEST
get_user_pages*() and pin_user_pages*(), as well as smoke tests of
the non-_fast variants.
+ There is also a sub-test that allows running dump_page() on any
+ of up to eight pages (selected by command line args) within the
+ range of user-space addresses. These pages are either pinned via
+ pin_user_pages*(), or pinned via get_user_pages*(), as specified
+ by other command line arguments.
+
See tools/testing/selftests/vm/gup_test.c
config GUP_GET_PTE_LOW_HIGH
--- a/tools/testing/selftests/vm/gup_test.c~selftests-vm-gup_test-introduce-the-dump_pages-sub-test
+++ a/tools/testing/selftests/vm/gup_test.c
@@ -27,13 +27,15 @@ static char *cmd_to_str(unsigned long cm
return "GUP_BASIC_TEST";
case PIN_BASIC_TEST:
return "PIN_BASIC_TEST";
+ case DUMP_USER_PAGES_TEST:
+ return "DUMP_USER_PAGES_TEST";
}
return "Unknown command";
}
int main(int argc, char **argv)
{
- struct gup_test gup;
+ struct gup_test gup = { 0 };
unsigned long size = 128 * MB;
int i, fd, filed, opt, nr_pages = 1, thp = -1, repeats = 1, write = 0;
unsigned long cmd = GUP_FAST_BENCHMARK;
@@ -41,7 +43,7 @@ int main(int argc, char **argv)
char *file = "/dev/zero";
char *p;
- while ((opt = getopt(argc, argv, "m:r:n:f:abtTLUuwSH")) != -1) {
+ while ((opt = getopt(argc, argv, "m:r:n:F:f:abctTLUuwSH")) != -1) {
switch (opt) {
case 'a':
cmd = PIN_FAST_BENCHMARK;
@@ -52,6 +54,21 @@ int main(int argc, char **argv)
case 'L':
cmd = PIN_LONGTERM_BENCHMARK;
break;
+ case 'c':
+ cmd = DUMP_USER_PAGES_TEST;
+ /*
+ * Dump page 0 (index 1). May be overridden later, by
+ * user's non-option arguments.
+ *
+ * .which_pages is zero-based, so that zero can mean "do
+ * nothing".
+ */
+ gup.which_pages[0] = 1;
+ break;
+ case 'F':
+ /* strtol, so you can pass flags in hex form */
+ gup.flags = strtol(optarg, 0, 0);
+ break;
case 'm':
size = atoi(optarg) * MB;
break;
@@ -91,6 +108,30 @@ int main(int argc, char **argv)
}
}
+ if (optind < argc) {
+ int extra_arg_count = 0;
+ /*
+ * For example:
+ *
+ * ./gup_test -c 0 1 0x1001
+ *
+ * ...to dump pages 0, 1, and 4097
+ */
+
+ while ((optind < argc) &&
+ (extra_arg_count < GUP_TEST_MAX_PAGES_TO_DUMP)) {
+ /*
+ * Do the 1-based indexing here, so that the user can
+ * use normal 0-based indexing on the command line.
+ */
+ long page_index = strtol(argv[optind], 0, 0) + 1;
+
+ gup.which_pages[extra_arg_count] = page_index;
+ extra_arg_count++;
+ optind++;
+ }
+ }
+
filed = open(file, O_RDWR|O_CREAT);
if (filed < 0) {
perror("open");
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 038/200] selftests/vm: run_vmtests.sh: update and clean up gup_test invocation
2020-12-15 3:02 incoming Andrew Morton
` (36 preceding siblings ...)
2020-12-15 3:05 ` [patch 037/200] selftests/vm: gup_test: introduce the dump_pages() sub-test Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 039/200] selftests/vm: hmm-tests: remove the libhugetlbfs dependency Andrew Morton
` (162 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, corbet, jglisse, jhubbard, linux-mm, mm-commits, rcampbell,
shuah, torvalds
From: John Hubbard <jhubbard@nvidia.com>
Subject: selftests/vm: run_vmtests.sh: update and clean up gup_test invocation
Run benchmarks on the _fast variants of gup and pup, as originally
intended.
Run the new gup_test sub-test: dump pages. In addition to exercising the
dump_page() call, it also demonstrates the various options you can use to
specify which pages to dump, and how.
Link: https://lkml.kernel.org/r/20201026064021.3545418-8-jhubbard@nvidia.com
Signed-off-by: John Hubbard <jhubbard@nvidia.com>
Cc: Jérôme Glisse <jglisse@redhat.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Shuah Khan <shuah@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
tools/testing/selftests/vm/run_vmtests | 28 ++++++++++++++++-------
1 file changed, 20 insertions(+), 8 deletions(-)
--- a/tools/testing/selftests/vm/run_vmtests~selftests-vm-run_vmtestssh-update-and-clean-up-gup_test-invocation
+++ a/tools/testing/selftests/vm/run_vmtests
@@ -123,10 +123,10 @@ else
echo "[PASS]"
fi
-echo "--------------------------------------------"
-echo "running 'gup_test -U' (normal/slow gup)"
-echo "--------------------------------------------"
-./gup_test -U
+echo "------------------------------------------------------"
+echo "running: gup_test -u # get_user_pages_fast() benchmark"
+echo "------------------------------------------------------"
+./gup_test -u
if [ $? -ne 0 ]; then
echo "[FAIL]"
exitcode=1
@@ -134,10 +134,22 @@ else
echo "[PASS]"
fi
-echo "------------------------------------------"
-echo "running gup_test -b (pin_user_pages)"
-echo "------------------------------------------"
-./gup_test -b
+echo "------------------------------------------------------"
+echo "running: gup_test -a # pin_user_pages_fast() benchmark"
+echo "------------------------------------------------------"
+./gup_test -a
+if [ $? -ne 0 ]; then
+ echo "[FAIL]"
+ exitcode=1
+else
+ echo "[PASS]"
+fi
+
+echo "------------------------------------------------------------"
+echo "# Dump pages 0, 19, and 4096, using pin_user_pages:"
+echo "running: gup_test -ct -F 0x1 0 19 0x1000 # dump_page() test"
+echo "------------------------------------------------------------"
+./gup_test -ct -F 0x1 0 19 0x1000
if [ $? -ne 0 ]; then
echo "[FAIL]"
exitcode=1
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 039/200] selftests/vm: hmm-tests: remove the libhugetlbfs dependency
2020-12-15 3:02 incoming Andrew Morton
` (37 preceding siblings ...)
2020-12-15 3:05 ` [patch 038/200] selftests/vm: run_vmtests.sh: update and clean up gup_test invocation Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 040/200] selftests/vm: 2x speedup for run_vmtests.sh Andrew Morton
` (161 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, corbet, jglisse, jhubbard, linux-mm, mm-commits, rcampbell,
shuah, torvalds
From: John Hubbard <jhubbard@nvidia.com>
Subject: selftests/vm: hmm-tests: remove the libhugetlbfs dependency
HMM selftests are incredibly useful, but they are only effective if people
actually build and run them. All the other tests in selftests/vm can be
built with very standard, always-available libraries: libpthread, librt.
The hmm-tests.c program, on the other hand, requires something that is
(much) less readily available: libhugetlbfs. And so the build will
typically fail for many developers.
A simple attempt to install libhugetlbfs will also run into complications
on some common distros these days: Fedora and Arch Linux (yes, Arch AUR
has it, but that's fragile, as always with AUR). The library is not
maintained actively enough at the moment, for distros to deal with it. I
had to build it from source, for Fedora, and that didn't go too smoothly
either.
It turns out that, out of 21 tests in hmm-tests.c, only 2 actually require
functionality from libhugetlbfs. Therefore, if libhugetlbfs is missing,
simply ifdef those two tests out and allow the developer to at least have
the other 19 tests, if they don't want to pause to work through the above
issues. Also issue a warning, so that it's clear that there is an
imperfection in the build.
In order to do that, a tiny shell script (check_config.sh) runs a quick
compile (not link, that's too prone to false failures with library paths),
and basically, if the compiler doesn't find hugetlbfs.h in its standard
locations, then the script concludes that libhugetlbfs is not available.
The output is in two files, one for inclusion in hmm-test.c
(local_config.h), and one for inclusion in the Makefile (local_config.mk).
Link: https://lkml.kernel.org/r/20201026064021.3545418-9-jhubbard@nvidia.com
Signed-off-by: John Hubbard <jhubbard@nvidia.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Jérôme Glisse <jglisse@redhat.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Shuah Khan <shuah@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 24 +++++++++++++-
tools/testing/selftests/vm/check_config.sh | 31 +++++++++++++++++++
tools/testing/selftests/vm/hmm-tests.c | 10 +++++-
4 files changed, 63 insertions(+), 3 deletions(-)
--- /dev/null
+++ a/tools/testing/selftests/vm/check_config.sh
@@ -0,0 +1,31 @@
+#!/bin/sh
+# SPDX-License-Identifier: GPL-2.0
+#
+# Probe for libraries and create header files to record the results. Both C
+# header files and Makefile include fragments are created.
+
+OUTPUT_H_FILE=local_config.h
+OUTPUT_MKFILE=local_config.mk
+
+# libhugetlbfs
+tmpname=$(mktemp)
+tmpfile_c=${tmpname}.c
+tmpfile_o=${tmpname}.o
+
+echo "#include <sys/types.h>" > $tmpfile_c
+echo "#include <hugetlbfs.h>" >> $tmpfile_c
+echo "int func(void) { return 0; }" >> $tmpfile_c
+
+CC=${1:?"Usage: $0 <compiler> # example compiler: gcc"}
+$CC -c $tmpfile_c -o $tmpfile_o >/dev/null 2>&1
+
+if [ -f $tmpfile_o ]; then
+ echo "#define LOCAL_CONFIG_HAVE_LIBHUGETLBFS 1" > $OUTPUT_H_FILE
+ echo "HMM_EXTRA_LIBS = -lhugetlbfs" > $OUTPUT_MKFILE
+else
+ echo "// No libhugetlbfs support found" > $OUTPUT_H_FILE
+ echo "# No libhugetlbfs support found, so:" > $OUTPUT_MKFILE
+ echo "HMM_EXTRA_LIBS = " >> $OUTPUT_MKFILE
+fi
+
+rm ${tmpname}.*
--- a/tools/testing/selftests/vm/.gitignore~selftests-vm-hmm-tests-remove-the-libhugetlbfs-dependency
+++ a/tools/testing/selftests/vm/.gitignore
@@ -20,3 +20,4 @@ va_128TBswitch
map_fixed_noreplace
write_to_hugetlbfs
hmm-tests
+local_config.*
--- a/tools/testing/selftests/vm/hmm-tests.c~selftests-vm-hmm-tests-remove-the-libhugetlbfs-dependency
+++ a/tools/testing/selftests/vm/hmm-tests.c
@@ -21,12 +21,16 @@
#include <strings.h>
#include <time.h>
#include <pthread.h>
-#include <hugetlbfs.h>
#include <sys/types.h>
#include <sys/stat.h>
#include <sys/mman.h>
#include <sys/ioctl.h>
+#include "./local_config.h"
+#ifdef LOCAL_CONFIG_HAVE_LIBHUGETLBFS
+#include <hugetlbfs.h>
+#endif
+
/*
* This is a private UAPI to the kernel test module so it isn't exported
* in the usual include/uapi/... directory.
@@ -662,6 +666,7 @@ TEST_F(hmm, anon_write_huge)
hmm_buffer_free(buffer);
}
+#ifdef LOCAL_CONFIG_HAVE_LIBHUGETLBFS
/*
* Write huge TLBFS page.
*/
@@ -720,6 +725,7 @@ TEST_F(hmm, anon_write_hugetlbfs)
buffer->ptr = NULL;
hmm_buffer_free(buffer);
}
+#endif /* LOCAL_CONFIG_HAVE_LIBHUGETLBFS */
/*
* Read mmap'ed file memory.
@@ -1336,6 +1342,7 @@ TEST_F(hmm2, snapshot)
hmm_buffer_free(buffer);
}
+#ifdef LOCAL_CONFIG_HAVE_LIBHUGETLBFS
/*
* Test the hmm_range_fault() HMM_PFN_PMD flag for large pages that
* should be mapped by a large page table entry.
@@ -1411,6 +1418,7 @@ TEST_F(hmm, compound)
buffer->ptr = NULL;
hmm_buffer_free(buffer);
}
+#endif /* LOCAL_CONFIG_HAVE_LIBHUGETLBFS */
/*
* Test two devices reading the same memory (double mapped).
--- a/tools/testing/selftests/vm/Makefile~selftests-vm-hmm-tests-remove-the-libhugetlbfs-dependency
+++ a/tools/testing/selftests/vm/Makefile
@@ -1,5 +1,8 @@
# SPDX-License-Identifier: GPL-2.0
# Makefile for vm selftests
+
+include local_config.mk
+
uname_M := $(shell uname -m 2>/dev/null || echo not)
MACHINE ?= $(shell echo $(uname_M) | sed -e 's/aarch64.*/arm64/')
@@ -80,8 +83,6 @@ TEST_FILES := test_vmalloc.sh
KSFT_KHDR_INSTALL := 1
include ../lib.mk
-$(OUTPUT)/hmm-tests: LDLIBS += -lhugetlbfs
-
ifeq ($(ARCH),x86_64)
BINARIES_32 := $(patsubst %,$(OUTPUT)/%,$(BINARIES_32))
BINARIES_64 := $(patsubst %,$(OUTPUT)/%,$(BINARIES_64))
@@ -134,3 +135,22 @@ endif
$(OUTPUT)/mlock-random-test: LDLIBS += -lcap
$(OUTPUT)/gup_test: ../../../../mm/gup_test.h
+
+$(OUTPUT)/hmm-tests: local_config.h
+
+# HMM_EXTRA_LIBS may get set in local_config.mk, or it may be left empty.
+$(OUTPUT)/hmm-tests: LDLIBS += $(HMM_EXTRA_LIBS)
+
+local_config.mk local_config.h: check_config.sh
+ /bin/sh ./check_config.sh $(CC)
+
+EXTRA_CLEAN += local_config.mk local_config.h
+
+ifeq ($(HMM_EXTRA_LIBS),)
+all: warn_missing_hugelibs
+
+warn_missing_hugelibs:
+ @echo ; \
+ echo "Warning: missing libhugetlbfs support. Some HMM tests will be skipped." ; \
+ echo
+endif
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 040/200] selftests/vm: 2x speedup for run_vmtests.sh
2020-12-15 3:02 incoming Andrew Morton
` (38 preceding siblings ...)
2020-12-15 3:05 ` [patch 039/200] selftests/vm: hmm-tests: remove the libhugetlbfs dependency Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 041/200] mm/gup_test.c: mark gup_test_init as __init function Andrew Morton
` (160 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, jhubbard, linux-mm, mm-commits, rppt, shuah, torvalds
From: John Hubbard <jhubbard@nvidia.com>
Subject: selftests/vm: 2x speedup for run_vmtests.sh
Each invocation of userfaultfd for "anon" and "shmem" was taking about
6.5 sec to run, contributing to an overall run time of about 22 sec for
run_vmtests.sh.
Reduce the size and bounce input values to the userfaultfd invocation
within run_vmtests.sh, enough to get each invocation down to about 1.0
sec. This should still provide a reasonable smoke test, while staying
within a nominal time budget of around 1 second or so per test. And this
brings the overall running time of run_vmtests.sh down to 11 second.
Link: https://lkml.kernel.org/r/20201026064021.3545418-10-jhubbard@nvidia.com
Signed-off-by: John Hubbard <jhubbard@nvidia.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Shuah Khan <shuah@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
tools/testing/selftests/vm/run_vmtests | 4 ++--
1 file changed, 2 insertions(+), 2 deletions(-)
--- a/tools/testing/selftests/vm/run_vmtests~selftests-vm-2x-speedup-for-run_vmtestssh
+++ a/tools/testing/selftests/vm/run_vmtests
@@ -160,7 +160,7 @@ fi
echo "-------------------"
echo "running userfaultfd"
echo "-------------------"
-./userfaultfd anon 128 32
+./userfaultfd anon 20 16
if [ $? -ne 0 ]; then
echo "[FAIL]"
exitcode=1
@@ -185,7 +185,7 @@ rm -f $mnt/ufd_test_file
echo "-------------------------"
echo "running userfaultfd_shmem"
echo "-------------------------"
-./userfaultfd shmem 128 32
+./userfaultfd shmem 20 16
if [ $? -ne 0 ]; then
echo "[FAIL]"
exitcode=1
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 041/200] mm/gup_test.c: mark gup_test_init as __init function
2020-12-15 3:02 incoming Andrew Morton
` (39 preceding siblings ...)
2020-12-15 3:05 ` [patch 040/200] selftests/vm: 2x speedup for run_vmtests.sh Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 042/200] mm/gup_test: GUP_TEST depends on DEBUG_FS Andrew Morton
` (159 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, jgg, jhubbard, linux-mm, mm-commits, rcampbell,
song.bao.hua, torvalds
From: Barry Song <song.bao.hua@hisilicon.com>
Subject: mm/gup_test.c: mark gup_test_init as __init function
gup_test_init() is only called during initialization, mark it as __init to
save some memory.
Link: https://lkml.kernel.org/r/20201103081016.16532-1-song.bao.hua@hisilicon.com
Signed-off-by: Barry Song <song.bao.hua@hisilicon.com>
Reviewed-by: Jason Gunthorpe <jgg@nvidia.com>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/gup_test.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/gup_test.c~mm-gup_benchmark-mark-gup_benchmark_init-as-__init-function
+++ a/mm/gup_test.c
@@ -236,7 +236,7 @@ static const struct file_operations gup_
.unlocked_ioctl = gup_test_ioctl,
};
-static int gup_test_init(void)
+static int __init gup_test_init(void)
{
debugfs_create_file_unsafe("gup_test", 0600, NULL, NULL,
&gup_test_fops);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 042/200] mm/gup_test: GUP_TEST depends on DEBUG_FS
2020-12-15 3:02 incoming Andrew Morton
` (40 preceding siblings ...)
2020-12-15 3:05 ` [patch 041/200] mm/gup_test.c: mark gup_test_init as __init function Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 043/200] mm/gup: reorganize internal_get_user_pages_fast() Andrew Morton
` (158 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, jhubbard, john.garry, linux-mm, mm-commits, rcampbell,
rdunlap, song.bao.hua, torvalds
From: Barry Song <song.bao.hua@hisilicon.com>
Subject: mm/gup_test: GUP_TEST depends on DEBUG_FS
Without DEBUG_FS, all the code in gup_benchmark becomes meaningless.
For sure kernel provides debugfs stub while DEBUG_FS is disabled, but
the point here is that GUP_TEST can do nothing without DEBUG_FS.
[song.bao.hua@hisilicon.com: add comment as a prompt to users as commented by John and Randy]
Link: https://lkml.kernel.org/r/20201108083732.15336-1-song.bao.hua@hisilicon.com
Link: https://lkml.kernel.org/r/20201104100552.20156-1-song.bao.hua@hisilicon.com
Signed-off-by: Barry Song <song.bao.hua@hisilicon.com>
Suggested-by: John Garry <john.garry@huawei.com>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Acked-by: Randy Dunlap <rdunlap@infradead.org>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/Kconfig | 4 ++++
1 file changed, 4 insertions(+)
--- a/mm/Kconfig~mm-gup_benchmark-gup_benchmark-depends-on-debug_fs
+++ a/mm/Kconfig
@@ -823,6 +823,7 @@ config PERCPU_STATS
config GUP_TEST
bool "Enable infrastructure for get_user_pages()-related unit tests"
+ depends on DEBUG_FS
help
Provides /sys/kernel/debug/gup_test, which in turn provides a way
to make ioctl calls that can launch kernel-based unit tests for
@@ -840,6 +841,9 @@ config GUP_TEST
See tools/testing/selftests/vm/gup_test.c
+comment "GUP_TEST needs to have DEBUG_FS enabled"
+ depends on !GUP_TEST && !DEBUG_FS
+
config GUP_GET_PTE_LOW_HIGH
bool
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 043/200] mm/gup: reorganize internal_get_user_pages_fast()
2020-12-15 3:02 incoming Andrew Morton
` (41 preceding siblings ...)
2020-12-15 3:05 ` [patch 042/200] mm/gup_test: GUP_TEST depends on DEBUG_FS Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 044/200] mm/gup: prevent gup_fast from racing with COW during fork Andrew Morton
` (157 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, jack, jgg, jhubbard, linux-mm, mm-commits, peterx, torvalds
From: Jason Gunthorpe <jgg@nvidia.com>
Subject: mm/gup: reorganize internal_get_user_pages_fast()
Patch series "Add a seqcount between gup_fast and copy_page_range()", v4.
As discussed and suggested by Linus use a seqcount to close the small race
between gup_fast and copy_page_range().
Ahmed confirms that raw_write_seqcount_begin() is the correct API to use
in this case and it doesn't trigger any lockdeps.
I was able to test it using two threads, one forking and the other using
ibv_reg_mr() to trigger GUP fast. Modifying copy_page_range() to sleep
made the window large enough to reliably hit to test the logic.
This patch (of 2):
The next patch in this series makes the lockless flow a little more
complex, so move the entire block into a new function and remove a level
of indention. Tidy a bit of cruft:
- addr is always the same as start, so use start
- Use the modern check_add_overflow() for computing end = start + len
- nr_pinned/pages << PAGE_SHIFT needs the LHS to be unsigned long to
avoid shift overflow, make the variables unsigned long to avoid coding
casts in both places. nr_pinned was missing its cast
- The handling of ret and nr_pinned can be streamlined a bit
No functional change.
Link: https://lkml.kernel.org/r/0-v4-908497cf359a+4782-gup_fork_jgg@nvidia.com
Link: https://lkml.kernel.org/r/1-v4-908497cf359a+4782-gup_fork_jgg@nvidia.com
Signed-off-by: Jason Gunthorpe <jgg@nvidia.com>
Reviewed-by: Jan Kara <jack@suse.cz>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Reviewed-by: Peter Xu <peterx@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/gup.c | 101 ++++++++++++++++++++++++++++-------------------------
1 file changed, 55 insertions(+), 46 deletions(-)
--- a/mm/gup.c~mm-reorganize-internal_get_user_pages_fast
+++ a/mm/gup.c
@@ -2677,13 +2677,43 @@ static int __gup_longterm_unlocked(unsig
return ret;
}
-static int internal_get_user_pages_fast(unsigned long start, int nr_pages,
+static unsigned long lockless_pages_from_mm(unsigned long start,
+ unsigned long end,
+ unsigned int gup_flags,
+ struct page **pages)
+{
+ unsigned long flags;
+ int nr_pinned = 0;
+
+ if (!IS_ENABLED(CONFIG_HAVE_FAST_GUP) ||
+ !gup_fast_permitted(start, end))
+ return 0;
+
+ /*
+ * Disable interrupts. The nested form is used, in order to allow full,
+ * general purpose use of this routine.
+ *
+ * With interrupts disabled, we block page table pages from being freed
+ * from under us. See struct mmu_table_batch comments in
+ * include/asm-generic/tlb.h for more details.
+ *
+ * We do not adopt an rcu_read_lock() here as we also want to block IPIs
+ * that come from THPs splitting.
+ */
+ local_irq_save(flags);
+ gup_pgd_range(start, end, gup_flags, pages, &nr_pinned);
+ local_irq_restore(flags);
+ return nr_pinned;
+}
+
+static int internal_get_user_pages_fast(unsigned long start,
+ unsigned long nr_pages,
unsigned int gup_flags,
struct page **pages)
{
- unsigned long addr, len, end;
- unsigned long flags;
- int nr_pinned = 0, ret = 0;
+ unsigned long len, end;
+ unsigned long nr_pinned;
+ int ret;
if (WARN_ON_ONCE(gup_flags & ~(FOLL_WRITE | FOLL_LONGTERM |
FOLL_FORCE | FOLL_PIN | FOLL_GET |
@@ -2697,54 +2727,33 @@ static int internal_get_user_pages_fast(
might_lock_read(¤t->mm->mmap_lock);
start = untagged_addr(start) & PAGE_MASK;
- addr = start;
- len = (unsigned long) nr_pages << PAGE_SHIFT;
- end = start + len;
-
- if (end <= start)
+ len = nr_pages << PAGE_SHIFT;
+ if (check_add_overflow(start, len, &end))
return 0;
if (unlikely(!access_ok((void __user *)start, len)))
return -EFAULT;
- /*
- * Disable interrupts. The nested form is used, in order to allow
- * full, general purpose use of this routine.
- *
- * With interrupts disabled, we block page table pages from being
- * freed from under us. See struct mmu_table_batch comments in
- * include/asm-generic/tlb.h for more details.
- *
- * We do not adopt an rcu_read_lock(.) here as we also want to
- * block IPIs that come from THPs splitting.
- */
- if (IS_ENABLED(CONFIG_HAVE_FAST_GUP) && gup_fast_permitted(start, end)) {
- unsigned long fast_flags = gup_flags;
-
- local_irq_save(flags);
- gup_pgd_range(addr, end, fast_flags, pages, &nr_pinned);
- local_irq_restore(flags);
- ret = nr_pinned;
- }
-
- if (nr_pinned < nr_pages && !(gup_flags & FOLL_FAST_ONLY)) {
- /* Try to get the remaining pages with get_user_pages */
- start += nr_pinned << PAGE_SHIFT;
- pages += nr_pinned;
-
- ret = __gup_longterm_unlocked(start, nr_pages - nr_pinned,
- gup_flags, pages);
-
- /* Have to be a bit careful with return values */
- if (nr_pinned > 0) {
- if (ret < 0)
- ret = nr_pinned;
- else
- ret += nr_pinned;
- }
+ nr_pinned = lockless_pages_from_mm(start, end, gup_flags, pages);
+ if (nr_pinned == nr_pages || gup_flags & FOLL_FAST_ONLY)
+ return nr_pinned;
+
+ /* Slow path: try to get the remaining pages with get_user_pages */
+ start += nr_pinned << PAGE_SHIFT;
+ pages += nr_pinned;
+ ret = __gup_longterm_unlocked(start, nr_pages - nr_pinned, gup_flags,
+ pages);
+ if (ret < 0) {
+ /*
+ * The caller has to unpin the pages we already pinned so
+ * returning -errno is not an option
+ */
+ if (nr_pinned)
+ return nr_pinned;
+ return ret;
}
-
- return ret;
+ return ret + nr_pinned;
}
+
/**
* get_user_pages_fast_only() - pin user pages in memory
* @start: starting user address
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 044/200] mm/gup: prevent gup_fast from racing with COW during fork
2020-12-15 3:02 incoming Andrew Morton
` (42 preceding siblings ...)
2020-12-15 3:05 ` [patch 043/200] mm/gup: reorganize internal_get_user_pages_fast() Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 045/200] mm/gup: remove the vma allocation from gup_longterm_locked() Andrew Morton
` (156 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: a.darwish, aarcange, akpm, aneesh.kumar, hch, hughd, jack, jannh,
jgg, jhubbard, kirill, ktkhai, leonro, linux-mm, mhocko,
mm-commits, oleg, peterx, torvalds
From: Jason Gunthorpe <jgg@nvidia.com>
Subject: mm/gup: prevent gup_fast from racing with COW during fork
Since commit 70e806e4e645 ("mm: Do early cow for pinned pages during
fork() for ptes") pages under a FOLL_PIN will not be write protected
during COW for fork. This means that pages returned from
pin_user_pages(FOLL_WRITE) should not become write protected while the pin
is active.
However, there is a small race where get_user_pages_fast(FOLL_PIN) can
establish a FOLL_PIN at the same time copy_present_page() is write
protecting it:
CPU 0 CPU 1
get_user_pages_fast()
internal_get_user_pages_fast()
copy_page_range()
pte_alloc_map_lock()
copy_present_page()
atomic_read(has_pinned) == 0
page_maybe_dma_pinned() == false
atomic_set(has_pinned, 1);
gup_pgd_range()
gup_pte_range()
pte_t pte = gup_get_pte(ptep)
pte_access_permitted(pte)
try_grab_compound_head()
pte = pte_wrprotect(pte)
set_pte_at();
pte_unmap_unlock()
// GUP now returns with a write protected page
The first attempt to resolve this by using the write protect caused
problems (and was missing a barrrier), see commit f3c64eda3e50 ("mm: avoid
early COW write protect games during fork()")
Instead wrap copy_p4d_range() with the write side of a seqcount and check
the read side around gup_pgd_range(). If there is a collision then
get_user_pages_fast() fails and falls back to slow GUP.
Slow GUP is safe against this race because copy_page_range() is only
called while holding the exclusive side of the mmap_lock on the src
mm_struct.
[akpm@linux-foundation.org: coding style fixes]
Link: https://lkml.kernel.org/r/2-v4-908497cf359a+4782-gup_fork_jgg@nvidia.com
Fixes: f3c64eda3e50 ("mm: avoid early COW write protect games during fork()")
Signed-off-by: Jason Gunthorpe <jgg@nvidia.com>
Suggested-by: Linus Torvalds <torvalds@linux-foundation.org>
Link: https://lore.kernel.org/r/CAHk-=wi=iCnYCARbPGjkVJu9eyYeZ13N64tZYLdOB8CP5Q_PLw@mail.gmail.com
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Reviewed-by: Jan Kara <jack@suse.cz>
Reviewed-by: Peter Xu <peterx@redhat.com>
Acked-by: "Ahmed S. Darwish" <a.darwish@linutronix.de> [seqcount_t parts]
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>
Cc: Christoph Hellwig <hch@lst.de>
Cc: Hugh Dickins <hughd@google.com>
Cc: Jann Horn <jannh@google.com>
Cc: Kirill Shutemov <kirill@shutemov.name>
Cc: Kirill Tkhai <ktkhai@virtuozzo.com>
Cc: Leon Romanovsky <leonro@nvidia.com>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Oleg Nesterov <oleg@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/x86/kernel/tboot.c | 1 +
drivers/firmware/efi/efi.c | 1 +
include/linux/mm_types.h | 8 ++++++++
kernel/fork.c | 1 +
mm/gup.c | 18 ++++++++++++++++++
mm/init-mm.c | 1 +
mm/memory.c | 13 ++++++++++++-
7 files changed, 42 insertions(+), 1 deletion(-)
--- a/arch/x86/kernel/tboot.c~mm-prevent-gup_fast-from-racing-with-cow-during-fork
+++ a/arch/x86/kernel/tboot.c
@@ -93,6 +93,7 @@ static struct mm_struct tboot_mm = {
.pgd = swapper_pg_dir,
.mm_users = ATOMIC_INIT(2),
.mm_count = ATOMIC_INIT(1),
+ .write_protect_seq = SEQCNT_ZERO(tboot_mm.write_protect_seq),
MMAP_LOCK_INITIALIZER(init_mm)
.page_table_lock = __SPIN_LOCK_UNLOCKED(init_mm.page_table_lock),
.mmlist = LIST_HEAD_INIT(init_mm.mmlist),
--- a/drivers/firmware/efi/efi.c~mm-prevent-gup_fast-from-racing-with-cow-during-fork
+++ a/drivers/firmware/efi/efi.c
@@ -57,6 +57,7 @@ struct mm_struct efi_mm = {
.mm_rb = RB_ROOT,
.mm_users = ATOMIC_INIT(2),
.mm_count = ATOMIC_INIT(1),
+ .write_protect_seq = SEQCNT_ZERO(efi_mm.write_protect_seq),
MMAP_LOCK_INITIALIZER(efi_mm)
.page_table_lock = __SPIN_LOCK_UNLOCKED(efi_mm.page_table_lock),
.mmlist = LIST_HEAD_INIT(efi_mm.mmlist),
--- a/include/linux/mm_types.h~mm-prevent-gup_fast-from-racing-with-cow-during-fork
+++ a/include/linux/mm_types.h
@@ -14,6 +14,7 @@
#include <linux/uprobes.h>
#include <linux/page-flags-layout.h>
#include <linux/workqueue.h>
+#include <linux/seqlock.h>
#include <asm/mmu.h>
@@ -446,6 +447,13 @@ struct mm_struct {
*/
atomic_t has_pinned;
+ /**
+ * @write_protect_seq: Locked when any thread is write
+ * protecting pages mapped by this mm to enforce a later COW,
+ * for instance during page table copying for fork().
+ */
+ seqcount_t write_protect_seq;
+
#ifdef CONFIG_MMU
atomic_long_t pgtables_bytes; /* PTE page table pages */
#endif
--- a/kernel/fork.c~mm-prevent-gup_fast-from-racing-with-cow-during-fork
+++ a/kernel/fork.c
@@ -1007,6 +1007,7 @@ static struct mm_struct *mm_init(struct
mm->vmacache_seqnum = 0;
atomic_set(&mm->mm_users, 1);
atomic_set(&mm->mm_count, 1);
+ seqcount_init(&mm->write_protect_seq);
mmap_init_lock(mm);
INIT_LIST_HEAD(&mm->mmlist);
mm->core_state = NULL;
--- a/mm/gup.c~mm-prevent-gup_fast-from-racing-with-cow-during-fork
+++ a/mm/gup.c
@@ -2684,11 +2684,18 @@ static unsigned long lockless_pages_from
{
unsigned long flags;
int nr_pinned = 0;
+ unsigned seq;
if (!IS_ENABLED(CONFIG_HAVE_FAST_GUP) ||
!gup_fast_permitted(start, end))
return 0;
+ if (gup_flags & FOLL_PIN) {
+ seq = raw_read_seqcount(¤t->mm->write_protect_seq);
+ if (seq & 1)
+ return 0;
+ }
+
/*
* Disable interrupts. The nested form is used, in order to allow full,
* general purpose use of this routine.
@@ -2703,6 +2710,17 @@ static unsigned long lockless_pages_from
local_irq_save(flags);
gup_pgd_range(start, end, gup_flags, pages, &nr_pinned);
local_irq_restore(flags);
+
+ /*
+ * When pinning pages for DMA there could be a concurrent write protect
+ * from fork() via copy_page_range(), in this case always fail fast GUP.
+ */
+ if (gup_flags & FOLL_PIN) {
+ if (read_seqcount_retry(¤t->mm->write_protect_seq, seq)) {
+ unpin_user_pages(pages, nr_pinned);
+ return 0;
+ }
+ }
return nr_pinned;
}
--- a/mm/init-mm.c~mm-prevent-gup_fast-from-racing-with-cow-during-fork
+++ a/mm/init-mm.c
@@ -31,6 +31,7 @@ struct mm_struct init_mm = {
.pgd = swapper_pg_dir,
.mm_users = ATOMIC_INIT(2),
.mm_count = ATOMIC_INIT(1),
+ .write_protect_seq = SEQCNT_ZERO(init_mm.write_protect_seq),
MMAP_LOCK_INITIALIZER(init_mm)
.page_table_lock = __SPIN_LOCK_UNLOCKED(init_mm.page_table_lock),
.arg_lock = __SPIN_LOCK_UNLOCKED(init_mm.arg_lock),
--- a/mm/memory.c~mm-prevent-gup_fast-from-racing-with-cow-during-fork
+++ a/mm/memory.c
@@ -1171,6 +1171,15 @@ copy_page_range(struct vm_area_struct *d
mmu_notifier_range_init(&range, MMU_NOTIFY_PROTECTION_PAGE,
0, src_vma, src_mm, addr, end);
mmu_notifier_invalidate_range_start(&range);
+ /*
+ * Disabling preemption is not needed for the write side, as
+ * the read side doesn't spin, but goes to the mmap_lock.
+ *
+ * Use the raw variant of the seqcount_t write API to avoid
+ * lockdep complaining about preemptibility.
+ */
+ mmap_assert_write_locked(src_mm);
+ raw_write_seqcount_begin(&src_mm->write_protect_seq);
}
ret = 0;
@@ -1187,8 +1196,10 @@ copy_page_range(struct vm_area_struct *d
}
} while (dst_pgd++, src_pgd++, addr = next, addr != end);
- if (is_cow)
+ if (is_cow) {
+ raw_write_seqcount_end(&src_mm->write_protect_seq);
mmu_notifier_invalidate_range_end(&range);
+ }
return ret;
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 045/200] mm/gup: remove the vma allocation from gup_longterm_locked()
2020-12-15 3:02 incoming Andrew Morton
` (43 preceding siblings ...)
2020-12-15 3:05 ` [patch 044/200] mm/gup: prevent gup_fast from racing with COW during fork Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 046/200] mm/gup: combine put_compound_head() and unpin_user_page() Andrew Morton
` (155 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, dan.j.williams, ira.weiny, jgg, jhubbard, linux-mm,
mm-commits, pasha.tatashin, torvalds
From: Jason Gunthorpe <jgg@nvidia.com>
Subject: mm/gup: remove the vma allocation from gup_longterm_locked()
Long ago there wasn't a FOLL_LONGTERM flag so this DAX check was done by
post-processing the VMA list.
These days it is trivial to just check each VMA to see if it is DAX before
processing it inside __get_user_pages() and return failure if a DAX VMA is
encountered with FOLL_LONGTERM.
Removing the allocation of the VMA list is a significant speed up for many
call sites.
Add an IS_ENABLED to vma_is_fsdax so that code generation is unchanged
when DAX is compiled out.
Remove the dummy version of __gup_longterm_locked() as !CONFIG_CMA already
makes memalloc_nocma_save(), check_and_migrate_cma_pages(), and
memalloc_nocma_restore() into a NOP.
Link: https://lkml.kernel.org/r/0-v1-5551df3ed12e+b8-gup_dax_speedup_jgg@nvidia.com
Signed-off-by: Jason Gunthorpe <jgg@nvidia.com>
Reviewed-by: Ira Weiny <ira.weiny@intel.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Pavel Tatashin <pasha.tatashin@soleen.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/fs.h | 2 -
mm/gup.c | 83 +++++++------------------------------------
2 files changed, 16 insertions(+), 69 deletions(-)
--- a/include/linux/fs.h~mm-gup-remove-the-vma-allocation-from-gup_longterm_locked
+++ a/include/linux/fs.h
@@ -3230,7 +3230,7 @@ static inline bool vma_is_fsdax(struct v
{
struct inode *inode;
- if (!vma->vm_file)
+ if (!IS_ENABLED(CONFIG_FS_DAX) || !vma->vm_file)
return false;
if (!vma_is_dax(vma))
return false;
--- a/mm/gup.c~mm-gup-remove-the-vma-allocation-from-gup_longterm_locked
+++ a/mm/gup.c
@@ -923,6 +923,9 @@ static int check_vma_flags(struct vm_are
if (gup_flags & FOLL_ANON && !vma_is_anonymous(vma))
return -EFAULT;
+ if ((gup_flags & FOLL_LONGTERM) && vma_is_fsdax(vma))
+ return -EOPNOTSUPP;
+
if (write) {
if (!(vm_flags & VM_WRITE)) {
if (!(gup_flags & FOLL_FORCE))
@@ -1060,10 +1063,14 @@ static long __get_user_pages(struct mm_s
goto next_page;
}
- if (!vma || check_vma_flags(vma, gup_flags)) {
+ if (!vma) {
ret = -EFAULT;
goto out;
}
+ ret = check_vma_flags(vma, gup_flags);
+ if (ret)
+ goto out;
+
if (is_vm_hugetlb_page(vma)) {
i = follow_hugetlb_page(mm, vma, pages, vmas,
&start, &nr_pages, i,
@@ -1567,26 +1574,6 @@ struct page *get_dump_page(unsigned long
}
#endif /* CONFIG_ELF_CORE */
-#if defined(CONFIG_FS_DAX) || defined (CONFIG_CMA)
-static bool check_dax_vmas(struct vm_area_struct **vmas, long nr_pages)
-{
- long i;
- struct vm_area_struct *vma_prev = NULL;
-
- for (i = 0; i < nr_pages; i++) {
- struct vm_area_struct *vma = vmas[i];
-
- if (vma == vma_prev)
- continue;
-
- vma_prev = vma;
-
- if (vma_is_fsdax(vma))
- return true;
- }
- return false;
-}
-
#ifdef CONFIG_CMA
static long check_and_migrate_cma_pages(struct mm_struct *mm,
unsigned long start,
@@ -1705,63 +1692,23 @@ static long __gup_longterm_locked(struct
struct vm_area_struct **vmas,
unsigned int gup_flags)
{
- struct vm_area_struct **vmas_tmp = vmas;
unsigned long flags = 0;
- long rc, i;
+ long rc;
- if (gup_flags & FOLL_LONGTERM) {
- if (!pages)
- return -EINVAL;
-
- if (!vmas_tmp) {
- vmas_tmp = kcalloc(nr_pages,
- sizeof(struct vm_area_struct *),
- GFP_KERNEL);
- if (!vmas_tmp)
- return -ENOMEM;
- }
+ if (gup_flags & FOLL_LONGTERM)
flags = memalloc_nocma_save();
- }
- rc = __get_user_pages_locked(mm, start, nr_pages, pages,
- vmas_tmp, NULL, gup_flags);
+ rc = __get_user_pages_locked(mm, start, nr_pages, pages, vmas, NULL,
+ gup_flags);
if (gup_flags & FOLL_LONGTERM) {
- if (rc < 0)
- goto out;
-
- if (check_dax_vmas(vmas_tmp, rc)) {
- if (gup_flags & FOLL_PIN)
- unpin_user_pages(pages, rc);
- else
- for (i = 0; i < rc; i++)
- put_page(pages[i]);
- rc = -EOPNOTSUPP;
- goto out;
- }
-
- rc = check_and_migrate_cma_pages(mm, start, rc, pages,
- vmas_tmp, gup_flags);
-out:
+ if (rc > 0)
+ rc = check_and_migrate_cma_pages(mm, start, rc, pages,
+ vmas, gup_flags);
memalloc_nocma_restore(flags);
}
-
- if (vmas_tmp != vmas)
- kfree(vmas_tmp);
return rc;
}
-#else /* !CONFIG_FS_DAX && !CONFIG_CMA */
-static __always_inline long __gup_longterm_locked(struct mm_struct *mm,
- unsigned long start,
- unsigned long nr_pages,
- struct page **pages,
- struct vm_area_struct **vmas,
- unsigned int flags)
-{
- return __get_user_pages_locked(mm, start, nr_pages, pages, vmas,
- NULL, flags);
-}
-#endif /* CONFIG_FS_DAX || CONFIG_CMA */
static bool is_valid_gup_flags(unsigned int gup_flags)
{
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 046/200] mm/gup: combine put_compound_head() and unpin_user_page()
2020-12-15 3:02 incoming Andrew Morton
` (44 preceding siblings ...)
2020-12-15 3:05 ` [patch 045/200] mm/gup: remove the vma allocation from gup_longterm_locked() Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 047/200] mm: handle zone device pages in release_pages() Andrew Morton
` (154 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, corbet, dan.j.williams, david, hch, ira.weiny, jack,
jane.chu, jgg, jhubbard, joao.m.martins, kirill.shutemov,
linux-mm, mhocko, mike.kravetz, mm-commits, shuah, songmuchun,
torvalds, vbabka, willy
From: Jason Gunthorpe <jgg@nvidia.com>
Subject: mm/gup: combine put_compound_head() and unpin_user_page()
These functions accomplish the same thing but have different
implementations.
unpin_user_page() has a bug where it calls mod_node_page_state() after
calling put_page() which creates a risk that the page could have been
hot-uplugged from the system.
Fix this by using put_compound_head() as the only implementation.
__unpin_devmap_managed_user_page() and related can be deleted as well in
favour of the simpler, but slower, version in put_compound_head() that has
an extra atomic page_ref_sub, but always calls put_page() which internally
contains the special devmap code.
Move put_compound_head() to be directly after try_grab_compound_head() so
people can find it in future.
Link: https://lkml.kernel.org/r/0-v1-6730d4ee0d32+40e6-gup_combine_put_jgg@nvidia.com
Fixes: 1970dc6f5226 ("mm/gup: /proc/vmstat: pin_user_pages (FOLL_PIN) reporting")
Signed-off-by: Jason Gunthorpe <jgg@nvidia.com>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Reviewed-by: Ira Weiny <ira.weiny@intel.com>
Reviewed-by: Jan Kara <jack@suse.cz>
CC: Joao Martins <joao.m.martins@oracle.com>
CC: Jonathan Corbet <corbet@lwn.net>
CC: Dan Williams <dan.j.williams@intel.com>
CC: Dave Chinner <david@fromorbit.com>
CC: Christoph Hellwig <hch@infradead.org>
CC: Jane Chu <jane.chu@oracle.com>
CC: "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>
CC: Michal Hocko <mhocko@suse.com>
CC: Mike Kravetz <mike.kravetz@oracle.com>
CC: Shuah Khan <shuah@kernel.org>
CC: Muchun Song <songmuchun@bytedance.com>
CC: Vlastimil Babka <vbabka@suse.cz>
CC: Matthew Wilcox <willy@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/gup.c | 103 +++++++++++------------------------------------------
1 file changed, 23 insertions(+), 80 deletions(-)
--- a/mm/gup.c~mm-up-combine-put_compound_head-and-unpin_user_page
+++ a/mm/gup.c
@@ -123,6 +123,28 @@ static __maybe_unused struct page *try_g
return NULL;
}
+static void put_compound_head(struct page *page, int refs, unsigned int flags)
+{
+ if (flags & FOLL_PIN) {
+ mod_node_page_state(page_pgdat(page), NR_FOLL_PIN_RELEASED,
+ refs);
+
+ if (hpage_pincount_available(page))
+ hpage_pincount_sub(page, refs);
+ else
+ refs *= GUP_PIN_COUNTING_BIAS;
+ }
+
+ VM_BUG_ON_PAGE(page_ref_count(page) < refs, page);
+ /*
+ * Calling put_page() for each ref is unnecessarily slow. Only the last
+ * ref needs a put_page().
+ */
+ if (refs > 1)
+ page_ref_sub(page, refs - 1);
+ put_page(page);
+}
+
/**
* try_grab_page() - elevate a page's refcount by a flag-dependent amount
*
@@ -177,41 +199,6 @@ bool __must_check try_grab_page(struct p
return true;
}
-#ifdef CONFIG_DEV_PAGEMAP_OPS
-static bool __unpin_devmap_managed_user_page(struct page *page)
-{
- int count, refs = 1;
-
- if (!page_is_devmap_managed(page))
- return false;
-
- if (hpage_pincount_available(page))
- hpage_pincount_sub(page, 1);
- else
- refs = GUP_PIN_COUNTING_BIAS;
-
- count = page_ref_sub_return(page, refs);
-
- mod_node_page_state(page_pgdat(page), NR_FOLL_PIN_RELEASED, 1);
- /*
- * devmap page refcounts are 1-based, rather than 0-based: if
- * refcount is 1, then the page is free and the refcount is
- * stable because nobody holds a reference on the page.
- */
- if (count == 1)
- free_devmap_managed_page(page);
- else if (!count)
- __put_page(page);
-
- return true;
-}
-#else
-static bool __unpin_devmap_managed_user_page(struct page *page)
-{
- return false;
-}
-#endif /* CONFIG_DEV_PAGEMAP_OPS */
-
/**
* unpin_user_page() - release a dma-pinned page
* @page: pointer to page to be released
@@ -223,28 +210,7 @@ static bool __unpin_devmap_managed_user_
*/
void unpin_user_page(struct page *page)
{
- int refs = 1;
-
- page = compound_head(page);
-
- /*
- * For devmap managed pages we need to catch refcount transition from
- * GUP_PIN_COUNTING_BIAS to 1, when refcount reach one it means the
- * page is free and we need to inform the device driver through
- * callback. See include/linux/memremap.h and HMM for details.
- */
- if (__unpin_devmap_managed_user_page(page))
- return;
-
- if (hpage_pincount_available(page))
- hpage_pincount_sub(page, 1);
- else
- refs = GUP_PIN_COUNTING_BIAS;
-
- if (page_ref_sub_and_test(page, refs))
- __put_page(page);
-
- mod_node_page_state(page_pgdat(page), NR_FOLL_PIN_RELEASED, 1);
+ put_compound_head(compound_head(page), 1, FOLL_PIN);
}
EXPORT_SYMBOL(unpin_user_page);
@@ -2009,29 +1975,6 @@ EXPORT_SYMBOL(get_user_pages_unlocked);
* This code is based heavily on the PowerPC implementation by Nick Piggin.
*/
#ifdef CONFIG_HAVE_FAST_GUP
-
-static void put_compound_head(struct page *page, int refs, unsigned int flags)
-{
- if (flags & FOLL_PIN) {
- mod_node_page_state(page_pgdat(page), NR_FOLL_PIN_RELEASED,
- refs);
-
- if (hpage_pincount_available(page))
- hpage_pincount_sub(page, refs);
- else
- refs *= GUP_PIN_COUNTING_BIAS;
- }
-
- VM_BUG_ON_PAGE(page_ref_count(page) < refs, page);
- /*
- * Calling put_page() for each ref is unnecessarily slow. Only the last
- * ref needs a put_page().
- */
- if (refs > 1)
- page_ref_sub(page, refs - 1);
- put_page(page);
-}
-
#ifdef CONFIG_GUP_GET_PTE_LOW_HIGH
/*
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 047/200] mm: handle zone device pages in release_pages()
2020-12-15 3:02 incoming Andrew Morton
` (45 preceding siblings ...)
2020-12-15 3:05 ` [patch 046/200] mm/gup: combine put_compound_head() and unpin_user_page() Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:05 ` [patch 048/200] mm/swapfile.c: use helper function swap_count() in add_swap_count_continuation() Andrew Morton
` (153 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, apopple, dan.j.williams, hch, jgg, jglisse, jhubbard,
linux-mm, mm-commits, rcampbell, torvalds, willy
From: Ralph Campbell <rcampbell@nvidia.com>
Subject: mm: handle zone device pages in release_pages()
release_pages() is an optimized, inlined version of __put_pages() except
that zone device struct pages that are not page_is_devmap_managed() (i.e.,
memory_type MEMORY_DEVICE_GENERIC and MEMORY_DEVICE_PCI_P2PDMA), fall
through to the code that could return the zone device page to the page
allocator instead of adjusting the pgmap reference count.
Clearly these type of pages are not having the reference count decremented
to zero via release_pages() or page allocation problems would be seen.
Just to be safe, handle the 1 to zero case in release_pages() like
__put_page() does.
Link: https://lkml.kernel.org/r/20201021194733.11530-1-rcampbell@nvidia.com
Signed-off-by: Ralph Campbell <rcampbell@nvidia.com>
Reviewed-by: Christoph Hellwig <hch@lst.de>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Alistair Popple <apopple@nvidia.com>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: Matthew Wilcox <willy@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/swap.c | 3 +++
1 file changed, 3 insertions(+)
--- a/mm/swap.c~mm-handle-zone-device-pages-in-release_pages
+++ a/mm/swap.c
@@ -909,6 +909,9 @@ void release_pages(struct page **pages,
put_devmap_managed_page(page);
continue;
}
+ if (put_page_testzero(page))
+ put_dev_pagemap(page->pgmap);
+ continue;
}
if (!put_page_testzero(page))
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 048/200] mm/swapfile.c: use helper function swap_count() in add_swap_count_continuation()
2020-12-15 3:02 incoming Andrew Morton
` (46 preceding siblings ...)
2020-12-15 3:05 ` [patch 047/200] mm: handle zone device pages in release_pages() Andrew Morton
@ 2020-12-15 3:05 ` Andrew Morton
2020-12-15 3:06 ` [patch 049/200] mm/swap_state: skip meaningless swap cache readahead when ra_info.win == 0 Andrew Morton
` (152 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:05 UTC (permalink / raw)
To: akpm, linmiaohe, linux-mm, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/swapfile.c: use helper function swap_count() in add_swap_count_continuation()
Commit 570a335b8e22 ("swap_info: swap count continuations") introduced the
func add_swap_count_continuation() but forgot to use the helper function
swap_count() introduced by commit 355cfa73ddff ("mm: modify swap_map and
add SWAP_HAS_CACHE flag").
Link: https://lkml.kernel.org/r/20201009134306.18033-1-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Andrew Morton <akpm@linux-foundation.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/swapfile.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/swapfile.c~mm-swapfilec-use-helper-function-swap_count-in-add_swap_count_continuation
+++ a/mm/swapfile.c
@@ -3613,7 +3613,7 @@ int add_swap_count_continuation(swp_entr
ci = lock_cluster(si, offset);
- count = si->swap_map[offset] & ~SWAP_HAS_CACHE;
+ count = swap_count(si->swap_map[offset]);
if ((count & ~COUNT_CONTINUED) != SWAP_MAP_MAX) {
/*
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 049/200] mm/swap_state: skip meaningless swap cache readahead when ra_info.win == 0
2020-12-15 3:02 incoming Andrew Morton
` (47 preceding siblings ...)
2020-12-15 3:05 ` [patch 048/200] mm/swapfile.c: use helper function swap_count() in add_swap_count_continuation() Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 050/200] mm/swapfile.c: remove unnecessary out label in __swap_duplicate() Andrew Morton
` (151 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, hughd, linmiaohe, linux-mm, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/swap_state: skip meaningless swap cache readahead when ra_info.win == 0
swap_ra_info() may leave ra_info untouched in non_swap_entry() case as
page table lock is not held. In this case, we have ra_info.nr_pte == 0
and it is meaningless to continue with swap cache readahead. Skip such
ops by init ra_info.win = 1.
[akpm@linux-foundation.org: clean up struct init]
Link: https://lkml.kernel.org/r/20201009133059.58407-1-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Hugh Dickins <hughd@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/swap_state.c | 4 +++-
1 file changed, 3 insertions(+), 1 deletion(-)
--- a/mm/swap_state.c~mm-swap_state-skip-meaningless-swap-cache-readahead-when-ra_infowin-==-0
+++ a/mm/swap_state.c
@@ -839,7 +839,9 @@ static struct page *swap_vma_readahead(s
swp_entry_t entry;
unsigned int i;
bool page_allocated;
- struct vma_swap_readahead ra_info = {0,};
+ struct vma_swap_readahead ra_info = {
+ .win = 1,
+ };
swap_ra_info(vmf, &ra_info);
if (ra_info.win == 1)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 050/200] mm/swapfile.c: remove unnecessary out label in __swap_duplicate()
2020-12-15 3:02 incoming Andrew Morton
` (48 preceding siblings ...)
2020-12-15 3:06 ` [patch 049/200] mm/swap_state: skip meaningless swap cache readahead when ra_info.win == 0 Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 051/200] mm/swapfile.c: use memset to fill the swap_map with SWAP_HAS_CACHE Andrew Morton
` (150 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, linmiaohe, linux-mm, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/swapfile.c: remove unnecessary out label in __swap_duplicate()
When the code went to the out label, it must have p == NULL. So what out
label really does is redundant if check and return err. We should Remove
this unnecessary out label because it does not handle resource free and so
on.
Link: https://lkml.kernel.org/r/20201009130337.29698-1-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Andrew Morton <akpm@linux-foundation.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/swapfile.c | 5 ++---
1 file changed, 2 insertions(+), 3 deletions(-)
--- a/mm/swapfile.c~mm-swapfilec-remove-unnecessary-out-label-in-__swap_duplicate
+++ a/mm/swapfile.c
@@ -3445,11 +3445,11 @@ static int __swap_duplicate(swp_entry_t
unsigned long offset;
unsigned char count;
unsigned char has_cache;
- int err = -EINVAL;
+ int err;
p = get_swap_device(entry);
if (!p)
- goto out;
+ return -EINVAL;
offset = swp_offset(entry);
ci = lock_cluster_or_swap_info(p, offset);
@@ -3496,7 +3496,6 @@ static int __swap_duplicate(swp_entry_t
unlock_out:
unlock_cluster_or_swap_info(p, ci);
-out:
if (p)
put_swap_device(p);
return err;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 051/200] mm/swapfile.c: use memset to fill the swap_map with SWAP_HAS_CACHE
2020-12-15 3:02 incoming Andrew Morton
` (49 preceding siblings ...)
2020-12-15 3:06 ` [patch 050/200] mm/swapfile.c: remove unnecessary out label in __swap_duplicate() Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 052/200] mm: remove pagevec_lookup_range_nr_tag() Andrew Morton
` (149 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, hughd, linmiaohe, linux-mm, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/swapfile.c: use memset to fill the swap_map with SWAP_HAS_CACHE
We could use helper memset to fill the swap_map with SWAP_HAS_CACHE instead
of a direct loop here to simplify the code. Also we can remove the local
variable i and map this way.
Link: https://lkml.kernel.org/r/20200921122224.7139-1-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Cc: Hugh Dickins <hughd@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/swapfile.c | 7 ++-----
1 file changed, 2 insertions(+), 5 deletions(-)
--- a/mm/swapfile.c~mm-swap-use-memset-to-fill-the-swap_map-with-swap_has_cache
+++ a/mm/swapfile.c
@@ -975,8 +975,7 @@ static int swap_alloc_cluster(struct swa
{
unsigned long idx;
struct swap_cluster_info *ci;
- unsigned long offset, i;
- unsigned char *map;
+ unsigned long offset;
/*
* Should not even be attempting cluster allocations when huge
@@ -996,9 +995,7 @@ static int swap_alloc_cluster(struct swa
alloc_cluster(si, idx);
cluster_set_count_flag(ci, SWAPFILE_CLUSTER, CLUSTER_FLAG_HUGE);
- map = si->swap_map + offset;
- for (i = 0; i < SWAPFILE_CLUSTER; i++)
- map[i] = SWAP_HAS_CACHE;
+ memset(si->swap_map + offset, SWAP_HAS_CACHE, SWAPFILE_CLUSTER);
unlock_cluster(ci);
swap_range_alloc(si, offset, SWAPFILE_CLUSTER);
*slot = swp_entry(si->type, offset);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 052/200] mm: remove pagevec_lookup_range_nr_tag()
2020-12-15 3:02 incoming Andrew Morton
` (50 preceding siblings ...)
2020-12-15 3:06 ` [patch 051/200] mm/swapfile.c: use memset to fill the swap_map with SWAP_HAS_CACHE Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 053/200] mm/shmem.c: make shmem_mapping() inline Andrew Morton
` (148 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, jlayton, linux-mm, mm-commits, torvalds, willy
From: Jeff Layton <jlayton@kernel.org>
Subject: mm: remove pagevec_lookup_range_nr_tag()
With the merge of 2e1692966034 ("ceph: have ceph_writepages_start call
pagevec_lookup_range_tag"), nothing calls this anymore.
Link: https://lkml.kernel.org/r/20201021193926.101474-1-jlayton@kernel.org
Signed-off-by: Jeff Layton <jlayton@kernel.org>
Reviewed-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/pagevec.h | 3 ---
mm/swap.c | 9 ---------
2 files changed, 12 deletions(-)
--- a/include/linux/pagevec.h~mm-remove-pagevec_lookup_range_nr_tag
+++ a/include/linux/pagevec.h
@@ -43,9 +43,6 @@ static inline unsigned pagevec_lookup(st
unsigned pagevec_lookup_range_tag(struct pagevec *pvec,
struct address_space *mapping, pgoff_t *index, pgoff_t end,
xa_mark_t tag);
-unsigned pagevec_lookup_range_nr_tag(struct pagevec *pvec,
- struct address_space *mapping, pgoff_t *index, pgoff_t end,
- xa_mark_t tag, unsigned max_pages);
static inline unsigned pagevec_lookup_tag(struct pagevec *pvec,
struct address_space *mapping, pgoff_t *index, xa_mark_t tag)
{
--- a/mm/swap.c~mm-remove-pagevec_lookup_range_nr_tag
+++ a/mm/swap.c
@@ -1167,15 +1167,6 @@ unsigned pagevec_lookup_range_tag(struct
}
EXPORT_SYMBOL(pagevec_lookup_range_tag);
-unsigned pagevec_lookup_range_nr_tag(struct pagevec *pvec,
- struct address_space *mapping, pgoff_t *index, pgoff_t end,
- xa_mark_t tag, unsigned max_pages)
-{
- pvec->nr = find_get_pages_range_tag(mapping, index, end, tag,
- min_t(unsigned int, max_pages, PAGEVEC_SIZE), pvec->pages);
- return pagevec_count(pvec);
-}
-EXPORT_SYMBOL(pagevec_lookup_range_nr_tag);
/*
* Perform any setup for the swap system
*/
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 053/200] mm/shmem.c: make shmem_mapping() inline
2020-12-15 3:02 incoming Andrew Morton
` (51 preceding siblings ...)
2020-12-15 3:06 ` [patch 052/200] mm: remove pagevec_lookup_range_nr_tag() Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 054/200] tmpfs: fix Documentation nits Andrew Morton
` (147 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, hughd, linux-mm, mm-commits, sh_def, torvalds, vbabka
From: Hui Su <sh_def@163.com>
Subject: mm/shmem.c: make shmem_mapping() inline
shmem_mapping() isn't worth an out-of-line call from any callsite.
So make it inline by
- make shmem_aops global
- export shmem_aops
- inline the shmem_mapping()
and replace the direct call 'shmem_aops' with shmem_mapping()
in shmem.c.
Link: https://lkml.kernel.org/r/20201115165207.GA265355@rlk
Signed-off-by: Hui Su <sh_def@163.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Cc: Hugh Dickins <hughd@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/shmem_fs.h | 6 +++++-
mm/shmem.c | 16 ++++++----------
2 files changed, 11 insertions(+), 11 deletions(-)
--- a/include/linux/shmem_fs.h~mm-shmemc-make-shmem_mapping-inline
+++ a/include/linux/shmem_fs.h
@@ -67,7 +67,11 @@ extern unsigned long shmem_get_unmapped_
unsigned long len, unsigned long pgoff, unsigned long flags);
extern int shmem_lock(struct file *file, int lock, struct user_struct *user);
#ifdef CONFIG_SHMEM
-extern bool shmem_mapping(struct address_space *mapping);
+extern const struct address_space_operations shmem_aops;
+static inline bool shmem_mapping(struct address_space *mapping)
+{
+ return mapping->a_ops == &shmem_aops;
+}
#else
static inline bool shmem_mapping(struct address_space *mapping)
{
--- a/mm/shmem.c~mm-shmemc-make-shmem_mapping-inline
+++ a/mm/shmem.c
@@ -246,7 +246,7 @@ static inline void shmem_inode_unacct_bl
}
static const struct super_operations shmem_ops;
-static const struct address_space_operations shmem_aops;
+const struct address_space_operations shmem_aops;
static const struct file_operations shmem_file_operations;
static const struct inode_operations shmem_inode_operations;
static const struct inode_operations shmem_dir_inode_operations;
@@ -1152,7 +1152,7 @@ static void shmem_evict_inode(struct ino
struct shmem_inode_info *info = SHMEM_I(inode);
struct shmem_sb_info *sbinfo = SHMEM_SB(inode->i_sb);
- if (inode->i_mapping->a_ops == &shmem_aops) {
+ if (shmem_mapping(inode->i_mapping)) {
shmem_unacct_size(info->flags, inode->i_size);
inode->i_size = 0;
shmem_truncate_range(inode, 0, (loff_t)-1);
@@ -1858,7 +1858,7 @@ repeat:
}
/* shmem_symlink() */
- if (mapping->a_ops != &shmem_aops)
+ if (!shmem_mapping(mapping))
goto alloc_nohuge;
if (shmem_huge == SHMEM_HUGE_DENY || sgp_huge == SGP_NOHUGE)
goto alloc_nohuge;
@@ -2352,11 +2352,6 @@ static struct inode *shmem_get_inode(str
return inode;
}
-bool shmem_mapping(struct address_space *mapping)
-{
- return mapping->a_ops == &shmem_aops;
-}
-
static int shmem_mfill_atomic_pte(struct mm_struct *dst_mm,
pmd_t *dst_pmd,
struct vm_area_struct *dst_vma,
@@ -3865,7 +3860,7 @@ static void shmem_destroy_inodecache(voi
kmem_cache_destroy(shmem_inode_cachep);
}
-static const struct address_space_operations shmem_aops = {
+const struct address_space_operations shmem_aops = {
.writepage = shmem_writepage,
.set_page_dirty = __set_page_dirty_no_writeback,
#ifdef CONFIG_TMPFS
@@ -3877,6 +3872,7 @@ static const struct address_space_operat
#endif
.error_remove_page = generic_error_remove_page,
};
+EXPORT_SYMBOL(shmem_aops);
static const struct file_operations shmem_file_operations = {
.mmap = shmem_mmap,
@@ -4312,7 +4308,7 @@ struct page *shmem_read_mapping_page_gfp
struct page *page;
int error;
- BUG_ON(mapping->a_ops != &shmem_aops);
+ BUG_ON(!shmem_mapping(mapping));
error = shmem_getpage_gfp(inode, index, &page, SGP_CACHE,
gfp, NULL, NULL, NULL);
if (error)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 054/200] tmpfs: fix Documentation nits
2020-12-15 3:02 incoming Andrew Morton
` (52 preceding siblings ...)
2020-12-15 3:06 ` [patch 053/200] mm/shmem.c: make shmem_mapping() inline Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 055/200] mm: memcontrol: add file_thp, shmem_thp to memory.stat Andrew Morton
` (146 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, chris, hughd, linux-mm, mm-commits, rdunlap, torvalds
From: Randy Dunlap <rdunlap@infradead.org>
Subject: tmpfs: fix Documentation nits
Fix a typo, punctuation, use uppercase for CPUs, and limit
tmpfs to keeping only its files in virtual memory (phrasing).
Link: https://lkml.kernel.org/r/20201202010934.18566-1-rdunlap@infradead.org
Signed-off-by: Randy Dunlap <rdunlap@infradead.org>
Acked-by: Hugh Dickins <hughd@google.com>
Cc: Chris Down <chris@chrisdown.name>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/filesystems/tmpfs.rst | 8 ++++----
1 file changed, 4 insertions(+), 4 deletions(-)
--- a/Documentation/filesystems/tmpfs.rst~tmpfs-fix-documentation-nits
+++ a/Documentation/filesystems/tmpfs.rst
@@ -4,7 +4,7 @@
Tmpfs
=====
-Tmpfs is a file system which keeps all files in virtual memory.
+Tmpfs is a file system which keeps all of its files in virtual memory.
Everything in tmpfs is temporary in the sense that no files will be
@@ -35,7 +35,7 @@ tmpfs has the following uses:
memory.
This mount does not depend on CONFIG_TMPFS. If CONFIG_TMPFS is not
- set, the user visible part of tmpfs is not build. But the internal
+ set, the user visible part of tmpfs is not built. But the internal
mechanisms are always present.
2) glibc 2.2 and above expects tmpfs to be mounted at /dev/shm for
@@ -50,7 +50,7 @@ tmpfs has the following uses:
This mount is _not_ needed for SYSV shared memory. The internal
mount is used for that. (In the 2.3 kernel versions it was
necessary to mount the predecessor of tmpfs (shm fs) to use SYSV
- shared memory)
+ shared memory.)
3) Some people (including me) find it very convenient to mount it
e.g. on /tmp and /var/tmp and have a big swap partition. And now
@@ -83,7 +83,7 @@ If nr_blocks=0 (or size=0), blocks will
if nr_inodes=0, inodes will not be limited. It is generally unwise to
mount with such options, since it allows any user with write access to
use up all the memory on the machine; but enhances the scalability of
-that instance in a system with many cpus making intensive use of it.
+that instance in a system with many CPUs making intensive use of it.
tmpfs has a mount option to set the NUMA memory allocation policy for
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 055/200] mm: memcontrol: add file_thp, shmem_thp to memory.stat
2020-12-15 3:02 incoming Andrew Morton
` (53 preceding siblings ...)
2020-12-15 3:06 ` [patch 054/200] tmpfs: fix Documentation nits Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 056/200] mm: memcontrol: remove unused mod_memcg_obj_state() Andrew Morton
` (145 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, hannes, linux-mm, mhocko, mm-commits, riel, rientjes,
shakeelb, songliubraving, torvalds
From: Johannes Weiner <hannes@cmpxchg.org>
Subject: mm: memcontrol: add file_thp, shmem_thp to memory.stat
As huge page usage in the page cache and for shmem files proliferates in
our production environment, the performance monitoring team has asked for
per-cgroup stats on those pages.
We already track and export anon_thp per cgroup. We already track file
THP and shmem THP per node, so making them per-cgroup is only a matter of
switching from node to lruvec counters. All callsites are in places where
the pages are charged and locked, so page->memcg is stable.
[hannes@cmpxchg.org: add documentation]
Link: https://lkml.kernel.org/r/20201026174029.GC548555@cmpxchg.org
Link: https://lkml.kernel.org/r/20201022151844.489337-1-hannes@cmpxchg.org
Signed-off-by: Johannes Weiner <hannes@cmpxchg.org>
Reviewed-by: Rik van Riel <riel@surriel.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Acked-by: David Rientjes <rientjes@google.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Acked-by: Song Liu <songliubraving@fb.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/admin-guide/cgroup-v2.rst | 8 ++++++++
mm/filemap.c | 4 ++--
mm/huge_memory.c | 4 ++--
mm/khugepaged.c | 4 ++--
mm/memcontrol.c | 6 +++++-
mm/shmem.c | 2 +-
6 files changed, 20 insertions(+), 8 deletions(-)
--- a/Documentation/admin-guide/cgroup-v2.rst~mm-memcontrol-add-file_thp-shmem_thp-to-memorystat
+++ a/Documentation/admin-guide/cgroup-v2.rst
@@ -1300,6 +1300,14 @@ PAGE_SIZE multiple when read back.
Amount of memory used in anonymous mappings backed by
transparent hugepages
+ file_thp
+ Amount of cached filesystem data backed by transparent
+ hugepages
+
+ shmem_thp
+ Amount of shm, tmpfs, shared anonymous mmap()s backed by
+ transparent hugepages
+
inactive_anon, active_anon, inactive_file, active_file, unevictable
Amount of memory, swap-backed and filesystem-backed,
on the internal memory management lists used by the
--- a/mm/filemap.c~mm-memcontrol-add-file_thp-shmem_thp-to-memorystat
+++ a/mm/filemap.c
@@ -204,9 +204,9 @@ static void unaccount_page_cache_page(st
if (PageSwapBacked(page)) {
__mod_lruvec_page_state(page, NR_SHMEM, -nr);
if (PageTransHuge(page))
- __dec_node_page_state(page, NR_SHMEM_THPS);
+ __dec_lruvec_page_state(page, NR_SHMEM_THPS);
} else if (PageTransHuge(page)) {
- __dec_node_page_state(page, NR_FILE_THPS);
+ __dec_lruvec_page_state(page, NR_FILE_THPS);
filemap_nr_thps_dec(mapping);
}
--- a/mm/huge_memory.c~mm-memcontrol-add-file_thp-shmem_thp-to-memorystat
+++ a/mm/huge_memory.c
@@ -2710,9 +2710,9 @@ int split_huge_page_to_list(struct page
spin_unlock(&ds_queue->split_queue_lock);
if (mapping) {
if (PageSwapBacked(head))
- __dec_node_page_state(head, NR_SHMEM_THPS);
+ __dec_lruvec_page_state(head, NR_SHMEM_THPS);
else
- __dec_node_page_state(head, NR_FILE_THPS);
+ __dec_lruvec_page_state(head, NR_FILE_THPS);
}
__split_huge_page(page, list, end, flags);
--- a/mm/khugepaged.c~mm-memcontrol-add-file_thp-shmem_thp-to-memorystat
+++ a/mm/khugepaged.c
@@ -1845,9 +1845,9 @@ out_unlock:
}
if (is_shmem)
- __inc_node_page_state(new_page, NR_SHMEM_THPS);
+ __inc_lruvec_page_state(new_page, NR_SHMEM_THPS);
else {
- __inc_node_page_state(new_page, NR_FILE_THPS);
+ __inc_lruvec_page_state(new_page, NR_FILE_THPS);
filemap_nr_thps_inc(mapping);
}
--- a/mm/memcontrol.c~mm-memcontrol-add-file_thp-shmem_thp-to-memorystat
+++ a/mm/memcontrol.c
@@ -1512,6 +1512,8 @@ static struct memory_stat memory_stats[]
* constant(e.g. powerpc).
*/
{ "anon_thp", 0, NR_ANON_THPS },
+ { "file_thp", 0, NR_FILE_THPS },
+ { "shmem_thp", 0, NR_SHMEM_THPS },
#endif
{ "inactive_anon", PAGE_SIZE, NR_INACTIVE_ANON },
{ "active_anon", PAGE_SIZE, NR_ACTIVE_ANON },
@@ -1542,7 +1544,9 @@ static int __init memory_stats_init(void
for (i = 0; i < ARRAY_SIZE(memory_stats); i++) {
#ifdef CONFIG_TRANSPARENT_HUGEPAGE
- if (memory_stats[i].idx == NR_ANON_THPS)
+ if (memory_stats[i].idx == NR_ANON_THPS ||
+ memory_stats[i].idx == NR_FILE_THPS ||
+ memory_stats[i].idx == NR_SHMEM_THPS)
memory_stats[i].ratio = HPAGE_PMD_SIZE;
#endif
VM_BUG_ON(!memory_stats[i].ratio);
--- a/mm/shmem.c~mm-memcontrol-add-file_thp-shmem_thp-to-memorystat
+++ a/mm/shmem.c
@@ -713,7 +713,7 @@ next:
}
if (PageTransHuge(page)) {
count_vm_event(THP_FILE_ALLOC);
- __inc_node_page_state(page, NR_SHMEM_THPS);
+ __inc_lruvec_page_state(page, NR_SHMEM_THPS);
}
mapping->nrpages += nr;
__mod_lruvec_page_state(page, NR_FILE_PAGES, nr);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 056/200] mm: memcontrol: remove unused mod_memcg_obj_state()
2020-12-15 3:02 incoming Andrew Morton
` (54 preceding siblings ...)
2020-12-15 3:06 ` [patch 055/200] mm: memcontrol: add file_thp, shmem_thp to memory.stat Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 057/200] mm: memcontrol: eliminate redundant check in __mem_cgroup_insert_exceeded() Andrew Morton
` (144 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, chris, cl, guro, hannes, iamjoonsoo.kim, laoar.shao,
linux-mm, mhocko, mm-commits, penberg, rientjes, shakeelb,
songmuchun, torvalds, vbabka, vdavydov.dev
From: Muchun Song <songmuchun@bytedance.com>
Subject: mm: memcontrol: remove unused mod_memcg_obj_state()
Since commit:
991e7673859e ("mm: memcontrol: account kernel stack per node")
There is no user of the mod_memcg_obj_state(). This patch just remove it.
Also rework type of the idx parameter of the mod_objcg_state() from int
to enum node_stat_item.
Link: https://lkml.kernel.org/r/20201013153504.92602-1-songmuchun@bytedance.com
Signed-off-by: Muchun Song <songmuchun@bytedance.com>
Acked-by: Roman Gushchin <guro@fb.com>
Acked-by: David Rientjes <rientjes@google.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Vladimir Davydov <vdavydov.dev@gmail.com>
Cc: Christopher Lameter <cl@linux.com>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Yafang Shao <laoar.shao@gmail.com>
Cc: Chris Down <chris@chrisdown.name>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/memcontrol.h | 6 ------
mm/memcontrol.c | 11 -----------
mm/slab.h | 4 ++--
3 files changed, 2 insertions(+), 19 deletions(-)
--- a/include/linux/memcontrol.h~mm-memcontrol-remove-unused-mod_memcg_obj_state
+++ a/include/linux/memcontrol.h
@@ -798,8 +798,6 @@ void __mod_lruvec_state(struct lruvec *l
int val);
void __mod_lruvec_slab_state(void *p, enum node_stat_item idx, int val);
-void mod_memcg_obj_state(void *p, int idx, int val);
-
static inline void mod_lruvec_slab_state(void *p, enum node_stat_item idx,
int val)
{
@@ -1255,10 +1253,6 @@ static inline void mod_lruvec_slab_state
mod_node_page_state(page_pgdat(page), idx, val);
}
-static inline void mod_memcg_obj_state(void *p, int idx, int val)
-{
-}
-
static inline
unsigned long mem_cgroup_soft_limit_reclaim(pg_data_t *pgdat, int order,
gfp_t gfp_mask,
--- a/mm/memcontrol.c~mm-memcontrol-remove-unused-mod_memcg_obj_state
+++ a/mm/memcontrol.c
@@ -882,17 +882,6 @@ void __mod_lruvec_slab_state(void *p, en
rcu_read_unlock();
}
-void mod_memcg_obj_state(void *p, int idx, int val)
-{
- struct mem_cgroup *memcg;
-
- rcu_read_lock();
- memcg = mem_cgroup_from_obj(p);
- if (memcg)
- mod_memcg_state(memcg, idx, val);
- rcu_read_unlock();
-}
-
/**
* __count_memcg_events - account VM events in a cgroup
* @memcg: the memory cgroup
--- a/mm/slab.h~mm-memcontrol-remove-unused-mod_memcg_obj_state
+++ a/mm/slab.h
@@ -204,7 +204,7 @@ ssize_t slabinfo_write(struct file *file
void __kmem_cache_free_bulk(struct kmem_cache *, size_t, void **);
int __kmem_cache_alloc_bulk(struct kmem_cache *, gfp_t, size_t, void **);
-static inline int cache_vmstat_idx(struct kmem_cache *s)
+static inline enum node_stat_item cache_vmstat_idx(struct kmem_cache *s)
{
return (s->flags & SLAB_RECLAIM_ACCOUNT) ?
NR_SLAB_RECLAIMABLE_B : NR_SLAB_UNRECLAIMABLE_B;
@@ -304,7 +304,7 @@ static inline bool memcg_slab_pre_alloc_
static inline void mod_objcg_state(struct obj_cgroup *objcg,
struct pglist_data *pgdat,
- int idx, int nr)
+ enum node_stat_item idx, int nr)
{
struct mem_cgroup *memcg;
struct lruvec *lruvec;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 057/200] mm: memcontrol: eliminate redundant check in __mem_cgroup_insert_exceeded()
2020-12-15 3:02 incoming Andrew Morton
` (55 preceding siblings ...)
2020-12-15 3:06 ` [patch 056/200] mm: memcontrol: remove unused mod_memcg_obj_state() Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 058/200] mm: memcg/slab: fix return of child memcg objcg for root memcg Andrew Morton
` (143 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, hannes, linmiaohe, linux-mm, mhocko, mm-commits, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm: memcontrol: eliminate redundant check in __mem_cgroup_insert_exceeded()
The mz->usage_in_excess >= mz_node->usage_in_excess check is exactly the
else case of mz->usage_in_excess < mz_node->usage_in_excess. So we could
replace else if (mz->usage_in_excess >= mz_node->usage_in_excess) with
else equally. Also drop the comment which doesn't really explain much.
Link: https://lkml.kernel.org/r/20201012131607.10656-1-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memcontrol.c | 9 ++-------
1 file changed, 2 insertions(+), 7 deletions(-)
--- a/mm/memcontrol.c~mm-memcontrol-eliminate-redundant-check-in-__mem_cgroup_insert_exceeded
+++ a/mm/memcontrol.c
@@ -623,14 +623,9 @@ static void __mem_cgroup_insert_exceeded
if (mz->usage_in_excess < mz_node->usage_in_excess) {
p = &(*p)->rb_left;
rightmost = false;
- }
-
- /*
- * We can't avoid mem cgroups that are over their soft
- * limit by the same amount
- */
- else if (mz->usage_in_excess >= mz_node->usage_in_excess)
+ } else {
p = &(*p)->rb_right;
+ }
}
if (rightmost)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 058/200] mm: memcg/slab: fix return of child memcg objcg for root memcg
2020-12-15 3:02 incoming Andrew Morton
` (56 preceding siblings ...)
2020-12-15 3:06 ` [patch 057/200] mm: memcontrol: eliminate redundant check in __mem_cgroup_insert_exceeded() Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 059/200] mm: memcg/slab: fix use after free in obj_cgroup_charge Andrew Morton
` (142 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, areber, chris, christian.brauner, elver, esyr, guro, hannes,
iamjoonsoo.kim, keescook, laoar.shao, linux-mm, mhocko, mingo,
mm-commits, peterz, shakeelb, songmuchun, surenb, tglx, torvalds,
vdavydov.dev
From: Muchun Song <songmuchun@bytedance.com>
Subject: mm: memcg/slab: fix return of child memcg objcg for root memcg
Consider the following memcg hierarchy.
root
/ \
A B
If we failed to get the reference on objcg of memcg A, the
get_obj_cgroup_from_current can return the wrong objcg for the root
memcg.
Link: https://lkml.kernel.org/r/20201029164429.58703-1-songmuchun@bytedance.com
Fixes: bf4f059954dc ("mm: memcg/slab: obj_cgroup API")
Signed-off-by: Muchun Song <songmuchun@bytedance.com>
Acked-by: Roman Gushchin <guro@fb.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Vladimir Davydov <vdavydov.dev@gmail.com>
Cc: Shakeel Butt <shakeelb@google.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Yafang Shao <laoar.shao@gmail.com>
Cc: Chris Down <chris@chrisdown.name>
Cc: Christian Brauner <christian.brauner@ubuntu.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Ingo Molnar <mingo@kernel.org>
Cc: Kees Cook <keescook@chromium.org>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Eugene Syromiatnikov <esyr@redhat.com>
Cc: Suren Baghdasaryan <surenb@google.com>
Cc: Adrian Reber <areber@redhat.com>
Cc: Marco Elver <elver@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memcontrol.c | 1 +
1 file changed, 1 insertion(+)
--- a/mm/memcontrol.c~mm-memcg-slab-fix-return-child-memcg-objcg-for-root-memcg
+++ a/mm/memcontrol.c
@@ -2975,6 +2975,7 @@ __always_inline struct obj_cgroup *get_o
objcg = rcu_dereference(memcg->objcg);
if (objcg && obj_cgroup_tryget(objcg))
break;
+ objcg = NULL;
}
rcu_read_unlock();
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 059/200] mm: memcg/slab: fix use after free in obj_cgroup_charge
2020-12-15 3:02 incoming Andrew Morton
` (57 preceding siblings ...)
2020-12-15 3:06 ` [patch 058/200] mm: memcg/slab: fix return of child memcg objcg for root memcg Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 060/200] mm/rmap: always do TTU_IGNORE_ACCESS Andrew Morton
` (141 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, chris, christian.brauner, guro, hannes, iamjoonsoo.kim,
laoar.shao, linux-mm, mhocko, mm-commits, shakeelb, songmuchun,
torvalds, vdavydov.dev
From: Muchun Song <songmuchun@bytedance.com>
Subject: mm: memcg/slab: fix use after free in obj_cgroup_charge
The rcu_read_lock/unlock only can guarantee that the memcg will not be
freed, but it cannot guarantee the success of css_get to memcg.
If the whole process of a cgroup offlining is completed between reading a
objcg->memcg pointer and bumping the css reference on another CPU, and
there are exactly 0 external references to this memory cgroup (how we get
to the obj_cgroup_charge() then?), css_get() can change the ref counter
from 0 back to 1.
Link: https://lkml.kernel.org/r/20201028035013.99711-2-songmuchun@bytedance.com
Fixes: bf4f059954dc ("mm: memcg/slab: obj_cgroup API")
Signed-off-by: Muchun Song <songmuchun@bytedance.com>
Acked-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Vladimir Davydov <vdavydov.dev@gmail.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Yafang Shao <laoar.shao@gmail.com>
Cc: Chris Down <chris@chrisdown.name>
Cc: Christian Brauner <christian.brauner@ubuntu.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memcontrol.c | 4 +++-
1 file changed, 3 insertions(+), 1 deletion(-)
--- a/mm/memcontrol.c~mm-memcg-slab-fix-use-after-free-in-obj_cgroup_charge
+++ a/mm/memcontrol.c
@@ -3235,8 +3235,10 @@ int obj_cgroup_charge(struct obj_cgroup
* independently later.
*/
rcu_read_lock();
+retry:
memcg = obj_cgroup_memcg(objcg);
- css_get(&memcg->css);
+ if (unlikely(!css_tryget(&memcg->css)))
+ goto retry;
rcu_read_unlock();
nr_pages = size >> PAGE_SHIFT;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 060/200] mm/rmap: always do TTU_IGNORE_ACCESS
2020-12-15 3:02 incoming Andrew Morton
` (58 preceding siblings ...)
2020-12-15 3:06 ` [patch 059/200] mm: memcg/slab: fix use after free in obj_cgroup_charge Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 061/200] mm/memcg: update page struct member in comments Andrew Morton
` (140 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: aarcange, akpm, dan.j.williams, hannes, hughd, jglisse, linux-mm,
mhocko, mm-commits, shakeelb, torvalds, vbabka
From: Shakeel Butt <shakeelb@google.com>
Subject: mm/rmap: always do TTU_IGNORE_ACCESS
Since commit 369ea8242c0f ("mm/rmap: update to new mmu_notifier semantic
v2"), the code to check the secondary MMU's page table access bit is
broken for !(TTU_IGNORE_ACCESS) because the page is unmapped from the
secondary MMU's page table before the check. More specifically for those
secondary MMUs which unmap the memory in
mmu_notifier_invalidate_range_start() like kvm.
However memory reclaim is the only user of !(TTU_IGNORE_ACCESS) or the
absence of TTU_IGNORE_ACCESS and it explicitly performs the page table
access check before trying to unmap the page. So, at worst the reclaim
will miss accesses in a very short window if we remove page table access
check in unmapping code.
There is an unintented consequence of !(TTU_IGNORE_ACCESS) for the memcg
reclaim. From memcg reclaim the page_referenced() only account the
accesses from the processes which are in the same memcg of the target page
but the unmapping code is considering accesses from all the processes, so,
decreasing the effectiveness of memcg reclaim.
The simplest solution is to always assume TTU_IGNORE_ACCESS in unmapping
code.
Link: https://lkml.kernel.org/r/20201104231928.1494083-1-shakeelb@google.com
Fixes: 369ea8242c0f ("mm/rmap: update to new mmu_notifier semantic v2")
Signed-off-by: Shakeel Butt <shakeelb@google.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Cc: Hugh Dickins <hughd@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/rmap.h | 1 -
mm/huge_memory.c | 2 +-
mm/memory-failure.c | 2 +-
mm/memory_hotplug.c | 2 +-
mm/migrate.c | 8 +++-----
mm/rmap.c | 9 ---------
mm/vmscan.c | 14 +++++---------
7 files changed, 11 insertions(+), 27 deletions(-)
--- a/include/linux/rmap.h~mm-rmap-always-do-ttu_ignore_access
+++ a/include/linux/rmap.h
@@ -91,7 +91,6 @@ enum ttu_flags {
TTU_SPLIT_HUGE_PMD = 0x4, /* split huge PMD if any */
TTU_IGNORE_MLOCK = 0x8, /* ignore mlock */
- TTU_IGNORE_ACCESS = 0x10, /* don't age */
TTU_IGNORE_HWPOISON = 0x20, /* corrupted page is recoverable */
TTU_BATCH_FLUSH = 0x40, /* Batch TLB flushes where possible
* and caller guarantees they will
--- a/mm/huge_memory.c~mm-rmap-always-do-ttu_ignore_access
+++ a/mm/huge_memory.c
@@ -2321,7 +2321,7 @@ void vma_adjust_trans_huge(struct vm_are
static void unmap_page(struct page *page)
{
- enum ttu_flags ttu_flags = TTU_IGNORE_MLOCK | TTU_IGNORE_ACCESS |
+ enum ttu_flags ttu_flags = TTU_IGNORE_MLOCK |
TTU_RMAP_LOCKED | TTU_SPLIT_HUGE_PMD;
bool unmap_success;
--- a/mm/memory-failure.c~mm-rmap-always-do-ttu_ignore_access
+++ a/mm/memory-failure.c
@@ -989,7 +989,7 @@ static int get_hwpoison_page(struct page
static bool hwpoison_user_mappings(struct page *p, unsigned long pfn,
int flags, struct page **hpagep)
{
- enum ttu_flags ttu = TTU_IGNORE_MLOCK | TTU_IGNORE_ACCESS;
+ enum ttu_flags ttu = TTU_IGNORE_MLOCK;
struct address_space *mapping;
LIST_HEAD(tokill);
bool unmap_success = true;
--- a/mm/memory_hotplug.c~mm-rmap-always-do-ttu_ignore_access
+++ a/mm/memory_hotplug.c
@@ -1304,7 +1304,7 @@ do_migrate_range(unsigned long start_pfn
if (WARN_ON(PageLRU(page)))
isolate_lru_page(page);
if (page_mapped(page))
- try_to_unmap(page, TTU_IGNORE_MLOCK | TTU_IGNORE_ACCESS);
+ try_to_unmap(page, TTU_IGNORE_MLOCK);
continue;
}
--- a/mm/migrate.c~mm-rmap-always-do-ttu_ignore_access
+++ a/mm/migrate.c
@@ -1122,8 +1122,7 @@ static int __unmap_and_move(struct page
/* Establish migration ptes */
VM_BUG_ON_PAGE(PageAnon(page) && !PageKsm(page) && !anon_vma,
page);
- try_to_unmap(page,
- TTU_MIGRATION|TTU_IGNORE_MLOCK|TTU_IGNORE_ACCESS);
+ try_to_unmap(page, TTU_MIGRATION|TTU_IGNORE_MLOCK);
page_was_mapped = 1;
}
@@ -1329,8 +1328,7 @@ static int unmap_and_move_huge_page(new_
if (page_mapped(hpage)) {
bool mapping_locked = false;
- enum ttu_flags ttu = TTU_MIGRATION|TTU_IGNORE_MLOCK|
- TTU_IGNORE_ACCESS;
+ enum ttu_flags ttu = TTU_MIGRATION|TTU_IGNORE_MLOCK;
if (!PageAnon(hpage)) {
/*
@@ -2688,7 +2686,7 @@ static void migrate_vma_prepare(struct m
*/
static void migrate_vma_unmap(struct migrate_vma *migrate)
{
- int flags = TTU_MIGRATION | TTU_IGNORE_MLOCK | TTU_IGNORE_ACCESS;
+ int flags = TTU_MIGRATION | TTU_IGNORE_MLOCK;
const unsigned long npages = migrate->npages;
const unsigned long start = migrate->start;
unsigned long addr, i, restore = 0;
--- a/mm/rmap.c~mm-rmap-always-do-ttu_ignore_access
+++ a/mm/rmap.c
@@ -1533,15 +1533,6 @@ static bool try_to_unmap_one(struct page
goto discard;
}
- if (!(flags & TTU_IGNORE_ACCESS)) {
- if (ptep_clear_flush_young_notify(vma, address,
- pvmw.pte)) {
- ret = false;
- page_vma_mapped_walk_done(&pvmw);
- break;
- }
- }
-
/* Nuke the page table entry. */
flush_cache_page(vma, address, pte_pfn(*pvmw.pte));
if (should_defer_flush(mm, flags)) {
--- a/mm/vmscan.c~mm-rmap-always-do-ttu_ignore_access
+++ a/mm/vmscan.c
@@ -1072,7 +1072,6 @@ static void page_check_dirty_writeback(s
static unsigned int shrink_page_list(struct list_head *page_list,
struct pglist_data *pgdat,
struct scan_control *sc,
- enum ttu_flags ttu_flags,
struct reclaim_stat *stat,
bool ignore_references)
{
@@ -1297,7 +1296,7 @@ static unsigned int shrink_page_list(str
* processes. Try to unmap it here.
*/
if (page_mapped(page)) {
- enum ttu_flags flags = ttu_flags | TTU_BATCH_FLUSH;
+ enum ttu_flags flags = TTU_BATCH_FLUSH;
bool was_swapbacked = PageSwapBacked(page);
if (unlikely(PageTransHuge(page)))
@@ -1514,7 +1513,7 @@ unsigned int reclaim_clean_pages_from_li
}
nr_reclaimed = shrink_page_list(&clean_pages, zone->zone_pgdat, &sc,
- TTU_IGNORE_ACCESS, &stat, true);
+ &stat, true);
list_splice(&clean_pages, page_list);
mod_node_page_state(zone->zone_pgdat, NR_ISOLATED_FILE,
-(long)nr_reclaimed);
@@ -1958,8 +1957,7 @@ shrink_inactive_list(unsigned long nr_to
if (nr_taken == 0)
return 0;
- nr_reclaimed = shrink_page_list(&page_list, pgdat, sc, 0,
- &stat, false);
+ nr_reclaimed = shrink_page_list(&page_list, pgdat, sc, &stat, false);
spin_lock_irq(&pgdat->lru_lock);
@@ -2131,8 +2129,7 @@ unsigned long reclaim_pages(struct list_
nr_reclaimed += shrink_page_list(&node_page_list,
NODE_DATA(nid),
- &sc, 0,
- &dummy_stat, false);
+ &sc, &dummy_stat, false);
while (!list_empty(&node_page_list)) {
page = lru_to_page(&node_page_list);
list_del(&page->lru);
@@ -2145,8 +2142,7 @@ unsigned long reclaim_pages(struct list_
if (!list_empty(&node_page_list)) {
nr_reclaimed += shrink_page_list(&node_page_list,
NODE_DATA(nid),
- &sc, 0,
- &dummy_stat, false);
+ &sc, &dummy_stat, false);
while (!list_empty(&node_page_list)) {
page = lru_to_page(&node_page_list);
list_del(&page->lru);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 061/200] mm/memcg: update page struct member in comments
2020-12-15 3:02 incoming Andrew Morton
` (59 preceding siblings ...)
2020-12-15 3:06 ` [patch 060/200] mm/rmap: always do TTU_IGNORE_ACCESS Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 062/200] mm: memcg: fix obsolete code comments Andrew Morton
` (139 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, alex.shi, guro, hannes, linux-mm, mhocko, mm-commits,
torvalds, vdavydov.dev
From: Alex Shi <alex.shi@linux.alibaba.com>
Subject: mm/memcg: update page struct member in comments
The page->mem_cgroup member is replaced by memcg_data, and add a helper
page_memcg() for it. Need to update comments to avoid confusing.
Link: https://lkml.kernel.org/r/1491c150-1cc0-6062-08ea-9c891548a3bc@linux.alibaba.com
Signed-off-by: Alex Shi <alex.shi@linux.alibaba.com>
Acked-by: Roman Gushchin <guro@fb.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Vladimir Davydov <vdavydov.dev@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memcontrol.c | 4 ++--
1 file changed, 2 insertions(+), 2 deletions(-)
--- a/mm/memcontrol.c~mm-memcg-update-page-struct-member-in-comments
+++ a/mm/memcontrol.c
@@ -1324,7 +1324,7 @@ int mem_cgroup_scan_tasks(struct mem_cgr
* @page: the page
* @pgdat: pgdat of the page
*
- * This function relies on page->mem_cgroup being stable - see the
+ * This function relies on page's memcg being stable - see the
* access rules in commit_charge().
*/
struct lruvec *mem_cgroup_page_lruvec(struct page *page, struct pglist_data *pgdat)
@@ -2879,7 +2879,7 @@ static void commit_charge(struct page *p
{
VM_BUG_ON_PAGE(page->mem_cgroup, page);
/*
- * Any of the following ensures page->mem_cgroup stability:
+ * Any of the following ensures page's memcg stability:
*
* - the page lock
* - LRU isolation
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 062/200] mm: memcg: fix obsolete code comments
2020-12-15 3:02 incoming Andrew Morton
` (60 preceding siblings ...)
2020-12-15 3:06 ` [patch 061/200] mm/memcg: update page struct member in comments Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 063/200] mm: memcg: deprecate the non-hierarchical mode Andrew Morton
` (138 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, guro, hannes, linux-mm, mhocko, mm-commits, shakeelb,
torvalds
From: Roman Gushchin <guro@fb.com>
Subject: mm: memcg: fix obsolete code comments
This patch fixes/removes some obsolete comments in the code related
to the kernel memory accounting:
- kmem_cache->memcg_params.memcg_caches has been removed
by commit 9855609bde03 ("mm: memcg/slab: use a single set of
kmem_caches for all accounted allocations")
- memcg->kmemcg_id is not used as a gate for kmem accounting since
commit 0b8f73e10428 ("mm: memcontrol: clean up alloc, online,
offline, free functions")
Link: https://lkml.kernel.org/r/20201110184615.311974-1-guro@fb.com
Signed-off-by: Roman Gushchin <guro@fb.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Cc: Michal Hocko <mhocko@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/memcontrol.h | 6 ++----
mm/memcontrol.c | 6 ------
2 files changed, 2 insertions(+), 10 deletions(-)
--- a/include/linux/memcontrol.h~mm-memcg-fix-obsolete-code-comments
+++ a/include/linux/memcontrol.h
@@ -296,7 +296,6 @@ struct mem_cgroup {
int tcpmem_pressure;
#ifdef CONFIG_MEMCG_KMEM
- /* Index in the kmem_cache->memcg_params.memcg_caches array */
int kmemcg_id;
enum memcg_kmem_state kmem_state;
struct obj_cgroup __rcu *objcg;
@@ -1562,9 +1561,8 @@ static inline void memcg_kmem_uncharge(s
}
/*
- * helper for accessing a memcg's index. It will be used as an index in the
- * child cache array in kmem_cache, and also to derive its name. This function
- * will return -1 when this is not a kmem-limited memcg.
+ * A helper for accessing memcg's kmem_id, used for getting
+ * corresponding LRU lists.
*/
static inline int memcg_cache_id(struct mem_cgroup *memcg)
{
--- a/mm/memcontrol.c~mm-memcg-fix-obsolete-code-comments
+++ a/mm/memcontrol.c
@@ -3703,12 +3703,6 @@ static int memcg_online_kmem(struct mem_
static_branch_enable(&memcg_kmem_enabled_key);
- /*
- * A memory cgroup is considered kmem-online as soon as it gets
- * kmemcg_id. Setting the id after enabling static branching will
- * guarantee no one starts accounting before all call sites are
- * patched.
- */
memcg->kmemcg_id = memcg_id;
memcg->kmem_state = KMEM_ONLINE;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 063/200] mm: memcg: deprecate the non-hierarchical mode
2020-12-15 3:02 incoming Andrew Morton
` (61 preceding siblings ...)
2020-12-15 3:06 ` [patch 062/200] mm: memcg: fix obsolete code comments Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 064/200] docs: cgroup-v1: reflect the deprecation of " Andrew Morton
` (137 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, guro, hannes, linux-mm, mhocko, mm-commits, rientjes,
shakeelb, tj, torvalds
From: Roman Gushchin <guro@fb.com>
Subject: mm: memcg: deprecate the non-hierarchical mode
Patch series "mm: memcg: deprecate cgroup v1 non-hierarchical mode", v1.
The non-hierarchical cgroup v1 mode is a legacy of early days
of the memory controller and doesn't bring any value today.
However, it complicates the code and creates many edge cases
all over the memory controller code.
It's a good time to deprecate it completely. This patchset removes
the internal logic, adjusts the user interface and updates
the documentation. The alt patch removes some bits of the cgroup
core code, which become obsolete.
Michal Hocko said:
: All that we know today is that we have a warning in place to complain
: loudly when somebody relies on use_hierarchy=0 with a deeper hierarchy.
: For all those years we have seen _zero_ reports that would describe a
: sensible usecase.
:
: Moreover we (SUSE) have backported this warning into old distribution
: kernels (since 3.0 based kernels) to extend the coverage and didn't hear
: even for users who adopt new kernels only very slowly. The only report we
: have seen so far was a LTP test suite which doesn't really reflect any
: real life usecase.
This patch (of 3):
The non-hierarchical cgroup v1 mode is a legacy of early days of the
memory controller and doesn't bring any value today. However, it
complicates the code and creates many edge cases all over the memory
controller code.
It's a good time to deprecate it completely.
Functionally this patch enabled is by default for all cgroups and forbids
switching it off. Nothing changes if cgroup v2 is used: hierarchical mode
was enforced from scratch.
To protect the ABI memory.use_hierarchy interface is preserved with a
limited functionality: reading always returns "1", writing of "1" passes
silently, writing of any other value fails with -EINVAL and a warning to
dmesg (on the first occasion).
Link: https://lkml.kernel.org/r/20201110220800.929549-1-guro@fb.com
Link: https://lkml.kernel.org/r/20201110220800.929549-2-guro@fb.com
Signed-off-by: Roman Gushchin <guro@fb.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Acked-by: David Rientjes <rientjes@google.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Cc: Tejun Heo <tj@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/memcontrol.h | 7 --
kernel/cgroup/cgroup.c | 5 -
mm/memcontrol.c | 90 +++++------------------------------
3 files changed, 13 insertions(+), 89 deletions(-)
--- a/include/linux/memcontrol.h~mm-memcg-deprecate-the-non-hierarchical-mode
+++ a/include/linux/memcontrol.h
@@ -235,11 +235,6 @@ struct mem_cgroup {
struct vmpressure vmpressure;
/*
- * Should the accounting and control be hierarchical, per subtree?
- */
- bool use_hierarchy;
-
- /*
* Should the OOM killer kill all belonging tasks, had it kill one?
*/
bool oom_group;
@@ -588,8 +583,6 @@ static inline bool mem_cgroup_is_descend
{
if (root == memcg)
return true;
- if (!root->use_hierarchy)
- return false;
return cgroup_is_descendant(memcg->css.cgroup, root->css.cgroup);
}
--- a/kernel/cgroup/cgroup.c~mm-memcg-deprecate-the-non-hierarchical-mode
+++ a/kernel/cgroup/cgroup.c
@@ -281,9 +281,6 @@ bool cgroup_ssid_enabled(int ssid)
* - cpuset: a task can be moved into an empty cpuset, and again it takes
* masks of ancestors.
*
- * - memcg: use_hierarchy is on by default and the cgroup file for the flag
- * is not created.
- *
* - blkcg: blk-throttle becomes properly hierarchical.
*
* - debug: disallowed on the default hierarchy.
@@ -5156,8 +5153,6 @@ static struct cgroup_subsys_state *css_c
cgroup_parent(parent)) {
pr_warn("%s (%d) created nested cgroup for controller \"%s\" which has incomplete hierarchy support. Nested cgroups may change behavior in the future.\n",
current->comm, current->pid, ss->name);
- if (!strcmp(ss->name, "memory"))
- pr_warn("\"memory\" requires setting use_hierarchy to 1 on the root\n");
ss->warned_broken_hierarchy = true;
}
--- a/mm/memcontrol.c~mm-memcg-deprecate-the-non-hierarchical-mode
+++ a/mm/memcontrol.c
@@ -1141,12 +1141,6 @@ struct mem_cgroup *mem_cgroup_iter(struc
if (prev && !reclaim)
pos = prev;
- if (!root->use_hierarchy && root != root_mem_cgroup) {
- if (prev)
- goto out;
- return root;
- }
-
rcu_read_lock();
if (reclaim) {
@@ -1226,7 +1220,6 @@ struct mem_cgroup *mem_cgroup_iter(struc
out_unlock:
rcu_read_unlock();
-out:
if (prev && prev != root)
css_put(&prev->css);
@@ -3461,10 +3454,7 @@ unsigned long mem_cgroup_soft_limit_recl
}
/*
- * Test whether @memcg has children, dead or alive. Note that this
- * function doesn't care whether @memcg has use_hierarchy enabled and
- * returns %true if there are child csses according to the cgroup
- * hierarchy. Testing use_hierarchy is the caller's responsibility.
+ * Test whether @memcg has children, dead or alive.
*/
static inline bool memcg_has_children(struct mem_cgroup *memcg)
{
@@ -3524,37 +3514,20 @@ static ssize_t mem_cgroup_force_empty_wr
static u64 mem_cgroup_hierarchy_read(struct cgroup_subsys_state *css,
struct cftype *cft)
{
- return mem_cgroup_from_css(css)->use_hierarchy;
+ return 1;
}
static int mem_cgroup_hierarchy_write(struct cgroup_subsys_state *css,
struct cftype *cft, u64 val)
{
- int retval = 0;
- struct mem_cgroup *memcg = mem_cgroup_from_css(css);
- struct mem_cgroup *parent_memcg = mem_cgroup_from_css(memcg->css.parent);
-
- if (memcg->use_hierarchy == val)
+ if (val == 1)
return 0;
- /*
- * If parent's use_hierarchy is set, we can't make any modifications
- * in the child subtrees. If it is unset, then the change can
- * occur, provided the current cgroup has no children.
- *
- * For the root cgroup, parent_mem is NULL, we allow value to be
- * set if there are no children.
- */
- if ((!parent_memcg || !parent_memcg->use_hierarchy) &&
- (val == 1 || val == 0)) {
- if (!memcg_has_children(memcg))
- memcg->use_hierarchy = val;
- else
- retval = -EBUSY;
- } else
- retval = -EINVAL;
+ pr_warn_once("Non-hierarchical mode is deprecated. "
+ "Please report your usecase to linux-mm@kvack.org if you "
+ "depend on this functionality.\n");
- return retval;
+ return -EINVAL;
}
static unsigned long mem_cgroup_usage(struct mem_cgroup *memcg, bool swap)
@@ -3742,8 +3715,6 @@ static void memcg_offline_kmem(struct me
child = mem_cgroup_from_css(css);
BUG_ON(child->kmemcg_id != kmemcg_id);
child->kmemcg_id = parent->kmemcg_id;
- if (!memcg->use_hierarchy)
- break;
}
rcu_read_unlock();
@@ -5334,38 +5305,22 @@ mem_cgroup_css_alloc(struct cgroup_subsy
if (parent) {
memcg->swappiness = mem_cgroup_swappiness(parent);
memcg->oom_kill_disable = parent->oom_kill_disable;
- }
- if (!parent) {
- page_counter_init(&memcg->memory, NULL);
- page_counter_init(&memcg->swap, NULL);
- page_counter_init(&memcg->kmem, NULL);
- page_counter_init(&memcg->tcpmem, NULL);
- } else if (parent->use_hierarchy) {
- memcg->use_hierarchy = true;
+
page_counter_init(&memcg->memory, &parent->memory);
page_counter_init(&memcg->swap, &parent->swap);
page_counter_init(&memcg->kmem, &parent->kmem);
page_counter_init(&memcg->tcpmem, &parent->tcpmem);
} else {
- page_counter_init(&memcg->memory, &root_mem_cgroup->memory);
- page_counter_init(&memcg->swap, &root_mem_cgroup->swap);
- page_counter_init(&memcg->kmem, &root_mem_cgroup->kmem);
- page_counter_init(&memcg->tcpmem, &root_mem_cgroup->tcpmem);
- /*
- * Deeper hierachy with use_hierarchy == false doesn't make
- * much sense so let cgroup subsystem know about this
- * unfortunate state in our controller.
- */
- if (parent != root_mem_cgroup)
- memory_cgrp_subsys.broken_hierarchy = true;
- }
+ page_counter_init(&memcg->memory, NULL);
+ page_counter_init(&memcg->swap, NULL);
+ page_counter_init(&memcg->kmem, NULL);
+ page_counter_init(&memcg->tcpmem, NULL);
- /* The following stuff does not apply to the root */
- if (!parent) {
root_mem_cgroup = memcg;
return &memcg->css;
}
+ /* The following stuff does not apply to the root */
error = memcg_online_kmem(memcg);
if (error)
goto fail;
@@ -6202,24 +6157,6 @@ static void mem_cgroup_move_task(void)
}
#endif
-/*
- * Cgroup retains root cgroups across [un]mount cycles making it necessary
- * to verify whether we're attached to the default hierarchy on each mount
- * attempt.
- */
-static void mem_cgroup_bind(struct cgroup_subsys_state *root_css)
-{
- /*
- * use_hierarchy is forced on the default hierarchy. cgroup core
- * guarantees that @root doesn't have any children, so turning it
- * on for the root memcg is enough.
- */
- if (cgroup_subsys_on_dfl(memory_cgrp_subsys))
- root_mem_cgroup->use_hierarchy = true;
- else
- root_mem_cgroup->use_hierarchy = false;
-}
-
static int seq_puts_memcg_tunable(struct seq_file *m, unsigned long value)
{
if (value == PAGE_COUNTER_MAX)
@@ -6557,7 +6494,6 @@ struct cgroup_subsys memory_cgrp_subsys
.can_attach = mem_cgroup_can_attach,
.cancel_attach = mem_cgroup_cancel_attach,
.post_attach = mem_cgroup_move_task,
- .bind = mem_cgroup_bind,
.dfl_cftypes = memory_files,
.legacy_cftypes = mem_cgroup_legacy_files,
.early_init = 0,
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 064/200] docs: cgroup-v1: reflect the deprecation of the non-hierarchical mode
2020-12-15 3:02 incoming Andrew Morton
` (62 preceding siblings ...)
2020-12-15 3:06 ` [patch 063/200] mm: memcg: deprecate the non-hierarchical mode Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 065/200] cgroup: remove obsoleted broken_hierarchy and warned_broken_hierarchy Andrew Morton
` (136 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, guro, hannes, linux-mm, mhocko, mm-commits, rientjes,
shakeelb, tj, torvalds
From: Roman Gushchin <guro@fb.com>
Subject: docs: cgroup-v1: reflect the deprecation of the non-hierarchical mode
Update cgroup v1 docs after the deprecation of the non-hierarchical mode
of the memory controller.
Link: https://lkml.kernel.org/r/20201110220800.929549-3-guro@fb.com
Signed-off-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Acked-by: David Rientjes <rientjes@google.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Cc: Tejun Heo <tj@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/admin-guide/cgroup-v1/memcg_test.rst | 8 --
Documentation/admin-guide/cgroup-v1/memory.rst | 42 +++--------
2 files changed, 17 insertions(+), 33 deletions(-)
--- a/Documentation/admin-guide/cgroup-v1/memcg_test.rst~docs-cgroup-v1-reflect-the-deprecation-of-the-non-hierarchical-mode
+++ a/Documentation/admin-guide/cgroup-v1/memcg_test.rst
@@ -219,13 +219,11 @@ Under below explanation, we assume CONFI
This is an easy way to test page migration, too.
-9.5 mkdir/rmdir
----------------
+9.5 nested cgroups
+------------------
- When using hierarchy, mkdir/rmdir test should be done.
- Use tests like the following::
+ Use tests like the following for testing nested cgroups::
- echo 1 >/opt/cgroup/01/memory/use_hierarchy
mkdir /opt/cgroup/01/child_a
mkdir /opt/cgroup/01/child_b
--- a/Documentation/admin-guide/cgroup-v1/memory.rst~docs-cgroup-v1-reflect-the-deprecation-of-the-non-hierarchical-mode
+++ a/Documentation/admin-guide/cgroup-v1/memory.rst
@@ -77,6 +77,8 @@ Brief summary of control files.
memory.soft_limit_in_bytes set/show soft limit of memory usage
memory.stat show various statistics
memory.use_hierarchy set/show hierarchical account enabled
+ This knob is deprecated and shouldn't be
+ used.
memory.force_empty trigger forced page reclaim
memory.pressure_level set memory pressure notifications
memory.swappiness set/show swappiness parameter of vmscan
@@ -495,16 +497,13 @@ cgroup might have some charge associated
tasks have migrated away from it. (because we charge against pages, not
against tasks.)
-We move the stats to root (if use_hierarchy==0) or parent (if
-use_hierarchy==1), and no change on the charge except uncharging
+We move the stats to parent, and no change on the charge except uncharging
from the child.
Charges recorded in swap information is not updated at removal of cgroup.
Recorded information is discarded and a cgroup which uses swap (swapcache)
will be charged as a new owner of it.
-About use_hierarchy, see Section 6.
-
5. Misc. interfaces
===================
@@ -527,8 +526,6 @@ About use_hierarchy, see Section 6.
write will still return success. In this case, it is expected that
memory.kmem.usage_in_bytes == memory.usage_in_bytes.
- About use_hierarchy, see Section 6.
-
5.2 stat file
-------------
@@ -675,32 +672,21 @@ hierarchy::
d e
In the diagram above, with hierarchical accounting enabled, all memory
-usage of e, is accounted to its ancestors up until the root (i.e, c and root),
-that has memory.use_hierarchy enabled. If one of the ancestors goes over its
-limit, the reclaim algorithm reclaims from the tasks in the ancestor and the
-children of the ancestor.
-
-6.1 Enabling hierarchical accounting and reclaim
-------------------------------------------------
+usage of e, is accounted to its ancestors up until the root (i.e, c and root).
+If one of the ancestors goes over its limit, the reclaim algorithm reclaims
+from the tasks in the ancestor and the children of the ancestor.
+
+6.1 Hierarchical accounting and reclaim
+---------------------------------------
+
+Hierarchical accounting is enabled by default. Disabling the hierarchical
+accounting is deprecated. An attempt to do it will result in a failure
+and a warning printed to dmesg.
-A memory cgroup by default disables the hierarchy feature. Support
-can be enabled by writing 1 to memory.use_hierarchy file of the root cgroup::
+For compatibility reasons writing 1 to memory.use_hierarchy will always pass::
# echo 1 > memory.use_hierarchy
-The feature can be disabled by::
-
- # echo 0 > memory.use_hierarchy
-
-NOTE1:
- Enabling/disabling will fail if either the cgroup already has other
- cgroups created below it, or if the parent cgroup has use_hierarchy
- enabled.
-
-NOTE2:
- When panic_on_oom is set to "2", the whole system will panic in
- case of an OOM event in any cgroup.
-
7. Soft limits
==============
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 065/200] cgroup: remove obsoleted broken_hierarchy and warned_broken_hierarchy
2020-12-15 3:02 incoming Andrew Morton
` (63 preceding siblings ...)
2020-12-15 3:06 ` [patch 064/200] docs: cgroup-v1: reflect the deprecation of " Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:06 ` [patch 066/200] mm/page_counter: use page_counter_read in page_counter_set_max Andrew Morton
` (135 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, guro, hannes, linux-mm, mhocko, mm-commits, rientjes,
shakeelb, tj, torvalds
From: Roman Gushchin <guro@fb.com>
Subject: cgroup: remove obsoleted broken_hierarchy and warned_broken_hierarchy
With the deprecation of the non-hierarchical mode of the memory controller
there are no more examples of broken hierarchies left.
Let's remove the cgroup core code which was supposed to print warnings
about creating of broken hierarchies.
Link: https://lkml.kernel.org/r/20201110220800.929549-4-guro@fb.com
Signed-off-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Acked-by: David Rientjes <rientjes@google.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Tejun Heo <tj@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/cgroup-defs.h | 15 ---------------
kernel/cgroup/cgroup.c | 7 -------
2 files changed, 22 deletions(-)
--- a/include/linux/cgroup-defs.h~cgroup-remove-obsoleted-broken_hierarchy-and-warned_broken_hierarchy
+++ a/include/linux/cgroup-defs.h
@@ -668,21 +668,6 @@ struct cgroup_subsys {
*/
bool threaded:1;
- /*
- * If %false, this subsystem is properly hierarchical -
- * configuration, resource accounting and restriction on a parent
- * cgroup cover those of its children. If %true, hierarchy support
- * is broken in some ways - some subsystems ignore hierarchy
- * completely while others are only implemented half-way.
- *
- * It's now disallowed to create nested cgroups if the subsystem is
- * broken and cgroup core will emit a warning message on such
- * cases. Eventually, all subsystems will be made properly
- * hierarchical and this will go away.
- */
- bool broken_hierarchy:1;
- bool warned_broken_hierarchy:1;
-
/* the following two fields are initialized automtically during boot */
int id;
const char *name;
--- a/kernel/cgroup/cgroup.c~cgroup-remove-obsoleted-broken_hierarchy-and-warned_broken_hierarchy
+++ a/kernel/cgroup/cgroup.c
@@ -5149,13 +5149,6 @@ static struct cgroup_subsys_state *css_c
if (err)
goto err_list_del;
- if (ss->broken_hierarchy && !ss->warned_broken_hierarchy &&
- cgroup_parent(parent)) {
- pr_warn("%s (%d) created nested cgroup for controller \"%s\" which has incomplete hierarchy support. Nested cgroups may change behavior in the future.\n",
- current->comm, current->pid, ss->name);
- ss->warned_broken_hierarchy = true;
- }
-
return css;
err_list_del:
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 066/200] mm/page_counter: use page_counter_read in page_counter_set_max
2020-12-15 3:02 incoming Andrew Morton
` (64 preceding siblings ...)
2020-12-15 3:06 ` [patch 065/200] cgroup: remove obsoleted broken_hierarchy and warned_broken_hierarchy Andrew Morton
@ 2020-12-15 3:06 ` Andrew Morton
2020-12-15 3:07 ` [patch 067/200] mm: memcg: remove obsolete memcg_has_children() Andrew Morton
` (134 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:06 UTC (permalink / raw)
To: akpm, linux-mm, mm-commits, pankaj.gupta, sh_def, torvalds
From: Hui Su <sh_def@163.com>
Subject: mm/page_counter: use page_counter_read in page_counter_set_max
Use page_counter_read() in page_counter_set_max().
Link: https://lkml.kernel.org/r/20201113141048.GA178922@rlk
Signed-off-by: Hui Su <sh_def@163.com>
Reviewed-by: Pankaj Gupta <pankaj.gupta@cloud.ionos.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_counter.c | 4 ++--
1 file changed, 2 insertions(+), 2 deletions(-)
--- a/mm/page_counter.c~mm-page_counter-use-page_counter_read-in-page_counter_set_max
+++ a/mm/page_counter.c
@@ -183,14 +183,14 @@ int page_counter_set_max(struct page_cou
* the limit, so if it sees the old limit, we see the
* modified counter and retry.
*/
- usage = atomic_long_read(&counter->usage);
+ usage = page_counter_read(counter);
if (usage > nr_pages)
return -EBUSY;
old = xchg(&counter->max, nr_pages);
- if (atomic_long_read(&counter->usage) <= usage)
+ if (page_counter_read(counter) <= usage)
return 0;
counter->max = old;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 067/200] mm: memcg: remove obsolete memcg_has_children()
2020-12-15 3:02 incoming Andrew Morton
` (65 preceding siblings ...)
2020-12-15 3:06 ` [patch 066/200] mm/page_counter: use page_counter_read in page_counter_set_max Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 3:07 ` [patch 068/200] mm: memcg/slab: rename *_lruvec_slab_state to *_lruvec_kmem_state Andrew Morton
` (133 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, guro, hannes, linux-mm, lukas.bulwahn, mhocko, mm-commits,
natechancellor, torvalds
From: Lukas Bulwahn <lukas.bulwahn@gmail.com>
Subject: mm: memcg: remove obsolete memcg_has_children()
Commit 2ef1bf118c40 ("mm: memcg: deprecate the non-hierarchical mode")
removed the only use of memcg_has_children() in
mem_cgroup_hierarchy_write() as part of the feature deprecation.
Hence, since then, make CC=clang W=1 warns:
mm/memcontrol.c:3421:20:
warning: unused function 'memcg_has_children' [-Wunused-function]
Simply remove this obsolete unused function.
Link: https://lkml.kernel.org/r/20201116055043.20886-1-lukas.bulwahn@gmail.com
Signed-off-by: Lukas Bulwahn <lukas.bulwahn@gmail.com>
Acked-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Nathan Chancellor <natechancellor@gmail.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memcontrol.c | 13 -------------
1 file changed, 13 deletions(-)
--- a/mm/memcontrol.c~mm-memcg-remove-obsolete-memcg_has_children
+++ a/mm/memcontrol.c
@@ -3454,19 +3454,6 @@ unsigned long mem_cgroup_soft_limit_recl
}
/*
- * Test whether @memcg has children, dead or alive.
- */
-static inline bool memcg_has_children(struct mem_cgroup *memcg)
-{
- bool ret;
-
- rcu_read_lock();
- ret = css_next_child(NULL, &memcg->css);
- rcu_read_unlock();
- return ret;
-}
-
-/*
* Reclaims as many pages from the given memcg as possible.
*
* Caller is responsible for holding css reference for memcg.
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 068/200] mm: memcg/slab: rename *_lruvec_slab_state to *_lruvec_kmem_state
2020-12-15 3:02 incoming Andrew Morton
` (66 preceding siblings ...)
2020-12-15 3:07 ` [patch 067/200] mm: memcg: remove obsolete memcg_has_children() Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 3:07 ` [patch 069/200] mm: memcontrol: sssign boolean values to a bool variable Andrew Morton
` (132 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, guro, hannes, linux-mm, mm-commits, shakeelb, songmuchun,
torvalds
From: Muchun Song <songmuchun@bytedance.com>
Subject: mm: memcg/slab: rename *_lruvec_slab_state to *_lruvec_kmem_state
The *_lruvec_slab_state is also suitable for pages allocated from buddy,
not just for the slab objects. But the function name seems to tell us
that only slab object is applicable. So we can rename the keyword of slab
to kmem.
Link: https://lkml.kernel.org/r/20201117085249.24319-1-songmuchun@bytedance.com
Signed-off-by: Muchun Song <songmuchun@bytedance.com>
Acked-by: Roman Gushchin <guro@fb.com>
Reviewed-by: Shakeel Butt <shakeelb@google.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/memcontrol.h | 18 +++++++++---------
kernel/fork.c | 2 +-
mm/memcontrol.c | 2 +-
mm/workingset.c | 8 ++++----
4 files changed, 15 insertions(+), 15 deletions(-)
--- a/include/linux/memcontrol.h~mm-memcg-slab-rename-_lruvec_slab_state-to-_lruvec_kmem_state
+++ a/include/linux/memcontrol.h
@@ -788,15 +788,15 @@ void __mod_memcg_lruvec_state(struct lru
int val);
void __mod_lruvec_state(struct lruvec *lruvec, enum node_stat_item idx,
int val);
-void __mod_lruvec_slab_state(void *p, enum node_stat_item idx, int val);
+void __mod_lruvec_kmem_state(void *p, enum node_stat_item idx, int val);
-static inline void mod_lruvec_slab_state(void *p, enum node_stat_item idx,
+static inline void mod_lruvec_kmem_state(void *p, enum node_stat_item idx,
int val)
{
unsigned long flags;
local_irq_save(flags);
- __mod_lruvec_slab_state(p, idx, val);
+ __mod_lruvec_kmem_state(p, idx, val);
local_irq_restore(flags);
}
@@ -1229,7 +1229,7 @@ static inline void mod_lruvec_page_state
mod_node_page_state(page_pgdat(page), idx, val);
}
-static inline void __mod_lruvec_slab_state(void *p, enum node_stat_item idx,
+static inline void __mod_lruvec_kmem_state(void *p, enum node_stat_item idx,
int val)
{
struct page *page = virt_to_head_page(p);
@@ -1237,7 +1237,7 @@ static inline void __mod_lruvec_slab_sta
__mod_node_page_state(page_pgdat(page), idx, val);
}
-static inline void mod_lruvec_slab_state(void *p, enum node_stat_item idx,
+static inline void mod_lruvec_kmem_state(void *p, enum node_stat_item idx,
int val)
{
struct page *page = virt_to_head_page(p);
@@ -1332,14 +1332,14 @@ static inline void __dec_lruvec_page_sta
__mod_lruvec_page_state(page, idx, -1);
}
-static inline void __inc_lruvec_slab_state(void *p, enum node_stat_item idx)
+static inline void __inc_lruvec_kmem_state(void *p, enum node_stat_item idx)
{
- __mod_lruvec_slab_state(p, idx, 1);
+ __mod_lruvec_kmem_state(p, idx, 1);
}
-static inline void __dec_lruvec_slab_state(void *p, enum node_stat_item idx)
+static inline void __dec_lruvec_kmem_state(void *p, enum node_stat_item idx)
{
- __mod_lruvec_slab_state(p, idx, -1);
+ __mod_lruvec_kmem_state(p, idx, -1);
}
/* idx can be of type enum memcg_stat_item or node_stat_item */
--- a/kernel/fork.c~mm-memcg-slab-rename-_lruvec_slab_state-to-_lruvec_kmem_state
+++ a/kernel/fork.c
@@ -385,7 +385,7 @@ static void account_kernel_stack(struct
mod_lruvec_page_state(vm->pages[0], NR_KERNEL_STACK_KB,
account * (THREAD_SIZE / 1024));
else
- mod_lruvec_slab_state(stack, NR_KERNEL_STACK_KB,
+ mod_lruvec_kmem_state(stack, NR_KERNEL_STACK_KB,
account * (THREAD_SIZE / 1024));
}
--- a/mm/memcontrol.c~mm-memcg-slab-rename-_lruvec_slab_state-to-_lruvec_kmem_state
+++ a/mm/memcontrol.c
@@ -853,7 +853,7 @@ void __mod_lruvec_state(struct lruvec *l
__mod_memcg_lruvec_state(lruvec, idx, val);
}
-void __mod_lruvec_slab_state(void *p, enum node_stat_item idx, int val)
+void __mod_lruvec_kmem_state(void *p, enum node_stat_item idx, int val)
{
pg_data_t *pgdat = page_pgdat(virt_to_page(p));
struct mem_cgroup *memcg;
--- a/mm/workingset.c~mm-memcg-slab-rename-_lruvec_slab_state-to-_lruvec_kmem_state
+++ a/mm/workingset.c
@@ -445,12 +445,12 @@ void workingset_update_node(struct xa_no
if (node->count && node->count == node->nr_values) {
if (list_empty(&node->private_list)) {
list_lru_add(&shadow_nodes, &node->private_list);
- __inc_lruvec_slab_state(node, WORKINGSET_NODES);
+ __inc_lruvec_kmem_state(node, WORKINGSET_NODES);
}
} else {
if (!list_empty(&node->private_list)) {
list_lru_del(&shadow_nodes, &node->private_list);
- __dec_lruvec_slab_state(node, WORKINGSET_NODES);
+ __dec_lruvec_kmem_state(node, WORKINGSET_NODES);
}
}
}
@@ -544,7 +544,7 @@ static enum lru_status shadow_lru_isolat
}
list_lru_isolate(lru, item);
- __dec_lruvec_slab_state(node, WORKINGSET_NODES);
+ __dec_lruvec_kmem_state(node, WORKINGSET_NODES);
spin_unlock(lru_lock);
@@ -559,7 +559,7 @@ static enum lru_status shadow_lru_isolat
goto out_invalid;
mapping->nrexceptional -= node->nr_values;
xa_delete_node(node, workingset_update_node);
- __inc_lruvec_slab_state(node, WORKINGSET_NODERECLAIM);
+ __inc_lruvec_kmem_state(node, WORKINGSET_NODERECLAIM);
out_invalid:
xa_unlock_irq(&mapping->i_pages);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 069/200] mm: memcontrol: sssign boolean values to a bool variable
2020-12-15 3:02 incoming Andrew Morton
` (67 preceding siblings ...)
2020-12-15 3:07 ` [patch 068/200] mm: memcg/slab: rename *_lruvec_slab_state to *_lruvec_kmem_state Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 3:07 ` [patch 070/200] mm/memcg: remove incorrect comment Andrew Morton
` (131 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, hannes, jrdr.linux, kaixuxia, linux-mm, mhocko, mm-commits,
tencent_os_robot, torvalds, vdavydov.dev
From: Kaixu Xia <kaixuxia@tencent.com>
Subject: mm: memcontrol: sssign boolean values to a bool variable
Fix the following coccinelle warnings:
./mm/memcontrol.c:7341:2-22: WARNING: Assignment of 0/1 to bool variable
./mm/memcontrol.c:7343:2-22: WARNING: Assignment of 0/1 to bool variable
Link: https://lkml.kernel.org/r/1604737495-6418-1-git-send-email-kaixuxia@tencent.com
Signed-off-by: Kaixu Xia <kaixuxia@tencent.com>
Reported-by: Tosk Robot <tencent_os_robot@tencent.com>
Acked-by: Souptick Joarder <jrdr.linux@gmail.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Vladimir Davydov <vdavydov.dev@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memcontrol.c | 4 ++--
1 file changed, 2 insertions(+), 2 deletions(-)
--- a/mm/memcontrol.c~mm-memcontrol-assign-boolean-values-to-a-bool-variable
+++ a/mm/memcontrol.c
@@ -7262,9 +7262,9 @@ bool mem_cgroup_swap_full(struct page *p
static int __init setup_swap_account(char *s)
{
if (!strcmp(s, "1"))
- cgroup_memory_noswap = 0;
+ cgroup_memory_noswap = false;
else if (!strcmp(s, "0"))
- cgroup_memory_noswap = 1;
+ cgroup_memory_noswap = true;
return 1;
}
__setup("swapaccount=", setup_swap_account);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 070/200] mm/memcg: remove incorrect comment
2020-12-15 3:02 incoming Andrew Morton
` (68 preceding siblings ...)
2020-12-15 3:07 ` [patch 069/200] mm: memcontrol: sssign boolean values to a bool variable Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 3:07 ` [patch 071/200] mm: move lruvec stats update functions to vmstat.h Andrew Morton
` (130 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, alex.shi, hannes, linux-mm, mhocko, mm-commits, torvalds,
vdavydov.dev
From: Alex Shi <alex.shi@linux.alibaba.com>
Subject: mm/memcg: remove incorrect comment
Swapcache readahead pages are charged before being used, so it is unlikely
that they will be migrated before charging. Remove the incorrect comment.
Link: https://lkml.kernel.org/r/1605864930-49405-1-git-send-email-alex.shi@linux.alibaba.com
Signed-off-by: Alex Shi <alex.shi@linux.alibaba.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Vladimir Davydov <vdavydov.dev@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memcontrol.c | 1 -
1 file changed, 1 deletion(-)
--- a/mm/memcontrol.c~mm-memcg-remove-incorrect-comments
+++ a/mm/memcontrol.c
@@ -6903,7 +6903,6 @@ void mem_cgroup_migrate(struct page *old
if (newpage->mem_cgroup)
return;
- /* Swapcache readahead pages can get replaced before being charged */
memcg = oldpage->mem_cgroup;
if (!memcg)
return;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 071/200] mm: move lruvec stats update functions to vmstat.h
2020-12-15 3:02 incoming Andrew Morton
` (69 preceding siblings ...)
2020-12-15 3:07 ` [patch 070/200] mm/memcg: remove incorrect comment Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 3:07 ` [patch 072/200] mm: memcontrol: account pagetables per node Andrew Morton
` (129 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, guro, hannes, linux-mm, mhocko, mm-commits, shakeelb,
torvalds
From: Shakeel Butt <shakeelb@google.com>
Subject: mm: move lruvec stats update functions to vmstat.h
Patch series "memcg: add pagetable comsumption to memory.stat", v2.
Many workloads consumes significant amount of memory in pagetables. One
specific use-case is the user space network driver which mmaps the
application memory to provide zero copy transfer. This driver can consume
a large amount memory in page tables. This patch series exposes the
pagetable comsumption for each memory cgroup.
This patch (of 2):
This does not change any functionality and only move the functions which
update the lruvec stats to vmstat.h from memcontrol.h. The main reason
for this patch is to be able to use these functions in the page table
contructor function which is defined in mm.h and we can not include the
memcontrol.h in that file. Also this is a better place for this interface
in general. The lruvec abstraction, while invented for memcg, isn't
specific to memcg at all.
Link: https://lkml.kernel.org/r/20201130212541.2781790-2-shakeelb@google.com
Signed-off-by: Shakeel Butt <shakeelb@google.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Acked-by: Roman Gushchin <guro@fb.com>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/memcontrol.h | 111 -----------------------------------
include/linux/vmstat.h | 104 ++++++++++++++++++++++++++++++++
mm/memcontrol.c | 17 +++++
3 files changed, 121 insertions(+), 111 deletions(-)
--- a/include/linux/memcontrol.h~mm-move-lruvec-stats-update-functions-to-vmstath
+++ a/include/linux/memcontrol.h
@@ -786,8 +786,6 @@ static inline unsigned long lruvec_page_
void __mod_memcg_lruvec_state(struct lruvec *lruvec, enum node_stat_item idx,
int val);
-void __mod_lruvec_state(struct lruvec *lruvec, enum node_stat_item idx,
- int val);
void __mod_lruvec_kmem_state(void *p, enum node_stat_item idx, int val);
static inline void mod_lruvec_kmem_state(void *p, enum node_stat_item idx,
@@ -810,43 +808,6 @@ static inline void mod_memcg_lruvec_stat
local_irq_restore(flags);
}
-static inline void mod_lruvec_state(struct lruvec *lruvec,
- enum node_stat_item idx, int val)
-{
- unsigned long flags;
-
- local_irq_save(flags);
- __mod_lruvec_state(lruvec, idx, val);
- local_irq_restore(flags);
-}
-
-static inline void __mod_lruvec_page_state(struct page *page,
- enum node_stat_item idx, int val)
-{
- struct page *head = compound_head(page); /* rmap on tail pages */
- pg_data_t *pgdat = page_pgdat(page);
- struct lruvec *lruvec;
-
- /* Untracked pages have no memcg, no lruvec. Update only the node */
- if (!head->mem_cgroup) {
- __mod_node_page_state(pgdat, idx, val);
- return;
- }
-
- lruvec = mem_cgroup_lruvec(head->mem_cgroup, pgdat);
- __mod_lruvec_state(lruvec, idx, val);
-}
-
-static inline void mod_lruvec_page_state(struct page *page,
- enum node_stat_item idx, int val)
-{
- unsigned long flags;
-
- local_irq_save(flags);
- __mod_lruvec_page_state(page, idx, val);
- local_irq_restore(flags);
-}
-
unsigned long mem_cgroup_soft_limit_reclaim(pg_data_t *pgdat, int order,
gfp_t gfp_mask,
unsigned long *total_scanned);
@@ -1205,30 +1166,6 @@ static inline void __mod_memcg_lruvec_st
{
}
-static inline void __mod_lruvec_state(struct lruvec *lruvec,
- enum node_stat_item idx, int val)
-{
- __mod_node_page_state(lruvec_pgdat(lruvec), idx, val);
-}
-
-static inline void mod_lruvec_state(struct lruvec *lruvec,
- enum node_stat_item idx, int val)
-{
- mod_node_page_state(lruvec_pgdat(lruvec), idx, val);
-}
-
-static inline void __mod_lruvec_page_state(struct page *page,
- enum node_stat_item idx, int val)
-{
- __mod_node_page_state(page_pgdat(page), idx, val);
-}
-
-static inline void mod_lruvec_page_state(struct page *page,
- enum node_stat_item idx, int val)
-{
- mod_node_page_state(page_pgdat(page), idx, val);
-}
-
static inline void __mod_lruvec_kmem_state(void *p, enum node_stat_item idx,
int val)
{
@@ -1308,30 +1245,6 @@ static inline void __dec_memcg_page_stat
__mod_memcg_page_state(page, idx, -1);
}
-static inline void __inc_lruvec_state(struct lruvec *lruvec,
- enum node_stat_item idx)
-{
- __mod_lruvec_state(lruvec, idx, 1);
-}
-
-static inline void __dec_lruvec_state(struct lruvec *lruvec,
- enum node_stat_item idx)
-{
- __mod_lruvec_state(lruvec, idx, -1);
-}
-
-static inline void __inc_lruvec_page_state(struct page *page,
- enum node_stat_item idx)
-{
- __mod_lruvec_page_state(page, idx, 1);
-}
-
-static inline void __dec_lruvec_page_state(struct page *page,
- enum node_stat_item idx)
-{
- __mod_lruvec_page_state(page, idx, -1);
-}
-
static inline void __inc_lruvec_kmem_state(void *p, enum node_stat_item idx)
{
__mod_lruvec_kmem_state(p, idx, 1);
@@ -1370,30 +1283,6 @@ static inline void dec_memcg_page_state(
mod_memcg_page_state(page, idx, -1);
}
-static inline void inc_lruvec_state(struct lruvec *lruvec,
- enum node_stat_item idx)
-{
- mod_lruvec_state(lruvec, idx, 1);
-}
-
-static inline void dec_lruvec_state(struct lruvec *lruvec,
- enum node_stat_item idx)
-{
- mod_lruvec_state(lruvec, idx, -1);
-}
-
-static inline void inc_lruvec_page_state(struct page *page,
- enum node_stat_item idx)
-{
- mod_lruvec_page_state(page, idx, 1);
-}
-
-static inline void dec_lruvec_page_state(struct page *page,
- enum node_stat_item idx)
-{
- mod_lruvec_page_state(page, idx, -1);
-}
-
static inline struct lruvec *parent_lruvec(struct lruvec *lruvec)
{
struct mem_cgroup *memcg;
--- a/include/linux/vmstat.h~mm-move-lruvec-stats-update-functions-to-vmstath
+++ a/include/linux/vmstat.h
@@ -450,4 +450,108 @@ static inline const char *vm_event_name(
}
#endif /* CONFIG_VM_EVENT_COUNTERS || CONFIG_MEMCG */
+#ifdef CONFIG_MEMCG
+
+void __mod_lruvec_state(struct lruvec *lruvec, enum node_stat_item idx,
+ int val);
+
+static inline void mod_lruvec_state(struct lruvec *lruvec,
+ enum node_stat_item idx, int val)
+{
+ unsigned long flags;
+
+ local_irq_save(flags);
+ __mod_lruvec_state(lruvec, idx, val);
+ local_irq_restore(flags);
+}
+
+void __mod_lruvec_page_state(struct page *page,
+ enum node_stat_item idx, int val);
+
+static inline void mod_lruvec_page_state(struct page *page,
+ enum node_stat_item idx, int val)
+{
+ unsigned long flags;
+
+ local_irq_save(flags);
+ __mod_lruvec_page_state(page, idx, val);
+ local_irq_restore(flags);
+}
+
+#else
+
+static inline void __mod_lruvec_state(struct lruvec *lruvec,
+ enum node_stat_item idx, int val)
+{
+ __mod_node_page_state(lruvec_pgdat(lruvec), idx, val);
+}
+
+static inline void mod_lruvec_state(struct lruvec *lruvec,
+ enum node_stat_item idx, int val)
+{
+ mod_node_page_state(lruvec_pgdat(lruvec), idx, val);
+}
+
+static inline void __mod_lruvec_page_state(struct page *page,
+ enum node_stat_item idx, int val)
+{
+ __mod_node_page_state(page_pgdat(page), idx, val);
+}
+
+static inline void mod_lruvec_page_state(struct page *page,
+ enum node_stat_item idx, int val)
+{
+ mod_node_page_state(page_pgdat(page), idx, val);
+}
+
+#endif /* CONFIG_MEMCG */
+
+static inline void __inc_lruvec_state(struct lruvec *lruvec,
+ enum node_stat_item idx)
+{
+ __mod_lruvec_state(lruvec, idx, 1);
+}
+
+static inline void __dec_lruvec_state(struct lruvec *lruvec,
+ enum node_stat_item idx)
+{
+ __mod_lruvec_state(lruvec, idx, -1);
+}
+
+static inline void __inc_lruvec_page_state(struct page *page,
+ enum node_stat_item idx)
+{
+ __mod_lruvec_page_state(page, idx, 1);
+}
+
+static inline void __dec_lruvec_page_state(struct page *page,
+ enum node_stat_item idx)
+{
+ __mod_lruvec_page_state(page, idx, -1);
+}
+
+static inline void inc_lruvec_state(struct lruvec *lruvec,
+ enum node_stat_item idx)
+{
+ mod_lruvec_state(lruvec, idx, 1);
+}
+
+static inline void dec_lruvec_state(struct lruvec *lruvec,
+ enum node_stat_item idx)
+{
+ mod_lruvec_state(lruvec, idx, -1);
+}
+
+static inline void inc_lruvec_page_state(struct page *page,
+ enum node_stat_item idx)
+{
+ mod_lruvec_page_state(page, idx, 1);
+}
+
+static inline void dec_lruvec_page_state(struct page *page,
+ enum node_stat_item idx)
+{
+ mod_lruvec_page_state(page, idx, -1);
+}
+
#endif /* _LINUX_VMSTAT_H */
--- a/mm/memcontrol.c~mm-move-lruvec-stats-update-functions-to-vmstath
+++ a/mm/memcontrol.c
@@ -853,6 +853,23 @@ void __mod_lruvec_state(struct lruvec *l
__mod_memcg_lruvec_state(lruvec, idx, val);
}
+void __mod_lruvec_page_state(struct page *page, enum node_stat_item idx,
+ int val)
+{
+ struct page *head = compound_head(page); /* rmap on tail pages */
+ pg_data_t *pgdat = page_pgdat(page);
+ struct lruvec *lruvec;
+
+ /* Untracked pages have no memcg, no lruvec. Update only the node */
+ if (!head->mem_cgroup) {
+ __mod_node_page_state(pgdat, idx, val);
+ return;
+ }
+
+ lruvec = mem_cgroup_lruvec(head->mem_cgroup, pgdat);
+ __mod_lruvec_state(lruvec, idx, val);
+}
+
void __mod_lruvec_kmem_state(void *p, enum node_stat_item idx, int val)
{
pg_data_t *pgdat = page_pgdat(virt_to_page(p));
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 072/200] mm: memcontrol: account pagetables per node
2020-12-15 3:02 incoming Andrew Morton
` (70 preceding siblings ...)
2020-12-15 3:07 ` [patch 071/200] mm: move lruvec stats update functions to vmstat.h Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 3:07 ` [patch 073/200] xen/unpopulated-alloc: consolidate pgmap manipulation Andrew Morton
` (128 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, guro, hannes, linux-mm, mhocko, mm-commits, shakeelb,
torvalds
From: Shakeel Butt <shakeelb@google.com>
Subject: mm: memcontrol: account pagetables per node
For many workloads, pagetable consumption is significant and it makes
sense to expose it in the memory.stat for the memory cgroups. However at
the moment, the pagetables are accounted per-zone. Converting them to
per-node and using the right interface will correctly account for the
memory cgroups as well.
[akpm@linux-foundation.org: export __mod_lruvec_page_state to modules for arch/mips/kvm/]
Link: https://lkml.kernel.org/r/20201130212541.2781790-3-shakeelb@google.com
Signed-off-by: Shakeel Butt <shakeelb@google.com>
Acked-by: Johannes Weiner <hannes@cmpxchg.org>
Acked-by: Roman Gushchin <guro@fb.com>
Cc: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/admin-guide/cgroup-v2.rst | 3 +++
arch/nds32/mm/mm-nds32.c | 6 +++---
drivers/base/node.c | 2 +-
fs/proc/meminfo.c | 2 +-
include/linux/mm.h | 8 ++++----
include/linux/mmzone.h | 2 +-
mm/memcontrol.c | 2 ++
mm/page_alloc.c | 6 +++---
mm/vmstat.c | 2 +-
9 files changed, 19 insertions(+), 14 deletions(-)
--- a/arch/nds32/mm/mm-nds32.c~mm-memcontrol-account-pagetables-per-node
+++ a/arch/nds32/mm/mm-nds32.c
@@ -34,8 +34,8 @@ pgd_t *pgd_alloc(struct mm_struct *mm)
cpu_dcache_wb_range((unsigned long)new_pgd,
(unsigned long)new_pgd +
PTRS_PER_PGD * sizeof(pgd_t));
- inc_zone_page_state(virt_to_page((unsigned long *)new_pgd),
- NR_PAGETABLE);
+ inc_lruvec_page_state(virt_to_page((unsigned long *)new_pgd),
+ NR_PAGETABLE);
return new_pgd;
}
@@ -59,7 +59,7 @@ void pgd_free(struct mm_struct *mm, pgd_
pte = pmd_page(*pmd);
pmd_clear(pmd);
- dec_zone_page_state(virt_to_page((unsigned long *)pgd), NR_PAGETABLE);
+ dec_lruvec_page_state(virt_to_page((unsigned long *)pgd), NR_PAGETABLE);
pte_free(mm, pte);
mm_dec_nr_ptes(mm);
pmd_free(mm, pmd);
--- a/Documentation/admin-guide/cgroup-v2.rst~mm-memcontrol-account-pagetables-per-node
+++ a/Documentation/admin-guide/cgroup-v2.rst
@@ -1274,6 +1274,9 @@ PAGE_SIZE multiple when read back.
kernel_stack
Amount of memory allocated to kernel stacks.
+ pagetables
+ Amount of memory allocated for page tables.
+
percpu(npn)
Amount of memory used for storing per-cpu kernel
data structures.
--- a/drivers/base/node.c~mm-memcontrol-account-pagetables-per-node
+++ a/drivers/base/node.c
@@ -450,7 +450,7 @@ static ssize_t node_read_meminfo(struct
#ifdef CONFIG_SHADOW_CALL_STACK
nid, node_page_state(pgdat, NR_KERNEL_SCS_KB),
#endif
- nid, K(sum_zone_node_page_state(nid, NR_PAGETABLE)),
+ nid, K(node_page_state(pgdat, NR_PAGETABLE)),
nid, 0UL,
nid, K(sum_zone_node_page_state(nid, NR_BOUNCE)),
nid, K(node_page_state(pgdat, NR_WRITEBACK_TEMP)),
--- a/fs/proc/meminfo.c~mm-memcontrol-account-pagetables-per-node
+++ a/fs/proc/meminfo.c
@@ -107,7 +107,7 @@ static int meminfo_proc_show(struct seq_
global_node_page_state(NR_KERNEL_SCS_KB));
#endif
show_val_kb(m, "PageTables: ",
- global_zone_page_state(NR_PAGETABLE));
+ global_node_page_state(NR_PAGETABLE));
show_val_kb(m, "NFS_Unstable: ", 0);
show_val_kb(m, "Bounce: ",
--- a/include/linux/mm.h~mm-memcontrol-account-pagetables-per-node
+++ a/include/linux/mm.h
@@ -2203,7 +2203,7 @@ static inline bool pgtable_pte_page_ctor
if (!ptlock_init(page))
return false;
__SetPageTable(page);
- inc_zone_page_state(page, NR_PAGETABLE);
+ inc_lruvec_page_state(page, NR_PAGETABLE);
return true;
}
@@ -2211,7 +2211,7 @@ static inline void pgtable_pte_page_dtor
{
ptlock_free(page);
__ClearPageTable(page);
- dec_zone_page_state(page, NR_PAGETABLE);
+ dec_lruvec_page_state(page, NR_PAGETABLE);
}
#define pte_offset_map_lock(mm, pmd, address, ptlp) \
@@ -2298,7 +2298,7 @@ static inline bool pgtable_pmd_page_ctor
if (!pmd_ptlock_init(page))
return false;
__SetPageTable(page);
- inc_zone_page_state(page, NR_PAGETABLE);
+ inc_lruvec_page_state(page, NR_PAGETABLE);
return true;
}
@@ -2306,7 +2306,7 @@ static inline void pgtable_pmd_page_dtor
{
pmd_ptlock_free(page);
__ClearPageTable(page);
- dec_zone_page_state(page, NR_PAGETABLE);
+ dec_lruvec_page_state(page, NR_PAGETABLE);
}
/*
--- a/include/linux/mmzone.h~mm-memcontrol-account-pagetables-per-node
+++ a/include/linux/mmzone.h
@@ -152,7 +152,6 @@ enum zone_stat_item {
NR_ZONE_UNEVICTABLE,
NR_ZONE_WRITE_PENDING, /* Count of dirty, writeback and unstable pages */
NR_MLOCK, /* mlock()ed pages found and moved off LRU */
- NR_PAGETABLE, /* used for pagetables */
/* Second 128 byte cacheline */
NR_BOUNCE,
#if IS_ENABLED(CONFIG_ZSMALLOC)
@@ -207,6 +206,7 @@ enum node_stat_item {
#if IS_ENABLED(CONFIG_SHADOW_CALL_STACK)
NR_KERNEL_SCS_KB, /* measured in KiB */
#endif
+ NR_PAGETABLE, /* used for pagetables */
NR_VM_NODE_STAT_ITEMS
};
--- a/mm/memcontrol.c~mm-memcontrol-account-pagetables-per-node
+++ a/mm/memcontrol.c
@@ -869,6 +869,7 @@ void __mod_lruvec_page_state(struct page
lruvec = mem_cgroup_lruvec(head->mem_cgroup, pgdat);
__mod_lruvec_state(lruvec, idx, val);
}
+EXPORT_SYMBOL(__mod_lruvec_page_state);
void __mod_lruvec_kmem_state(void *p, enum node_stat_item idx, int val)
{
@@ -1493,6 +1494,7 @@ static struct memory_stat memory_stats[]
{ "anon", PAGE_SIZE, NR_ANON_MAPPED },
{ "file", PAGE_SIZE, NR_FILE_PAGES },
{ "kernel_stack", 1024, NR_KERNEL_STACK_KB },
+ { "pagetables", PAGE_SIZE, NR_PAGETABLE },
{ "percpu", 1, MEMCG_PERCPU_B },
{ "sock", PAGE_SIZE, MEMCG_SOCK },
{ "shmem", PAGE_SIZE, NR_SHMEM },
--- a/mm/page_alloc.c~mm-memcontrol-account-pagetables-per-node
+++ a/mm/page_alloc.c
@@ -5465,7 +5465,7 @@ void show_free_areas(unsigned int filter
global_node_page_state_pages(NR_SLAB_UNRECLAIMABLE_B),
global_node_page_state(NR_FILE_MAPPED),
global_node_page_state(NR_SHMEM),
- global_zone_page_state(NR_PAGETABLE),
+ global_node_page_state(NR_PAGETABLE),
global_zone_page_state(NR_BOUNCE),
global_zone_page_state(NR_FREE_PAGES),
free_pcp,
@@ -5497,6 +5497,7 @@ void show_free_areas(unsigned int filter
#ifdef CONFIG_SHADOW_CALL_STACK
" shadow_call_stack:%lukB"
#endif
+ " pagetables:%lukB"
" all_unreclaimable? %s"
"\n",
pgdat->node_id,
@@ -5522,6 +5523,7 @@ void show_free_areas(unsigned int filter
#ifdef CONFIG_SHADOW_CALL_STACK
node_page_state(pgdat, NR_KERNEL_SCS_KB),
#endif
+ K(node_page_state(pgdat, NR_PAGETABLE)),
pgdat->kswapd_failures >= MAX_RECLAIM_RETRIES ?
"yes" : "no");
}
@@ -5553,7 +5555,6 @@ void show_free_areas(unsigned int filter
" present:%lukB"
" managed:%lukB"
" mlocked:%lukB"
- " pagetables:%lukB"
" bounce:%lukB"
" free_pcp:%lukB"
" local_pcp:%ukB"
@@ -5574,7 +5575,6 @@ void show_free_areas(unsigned int filter
K(zone->present_pages),
K(zone_managed_pages(zone)),
K(zone_page_state(zone, NR_MLOCK)),
- K(zone_page_state(zone, NR_PAGETABLE)),
K(zone_page_state(zone, NR_BOUNCE)),
K(free_pcp),
K(this_cpu_read(zone->pageset->pcp.count)),
--- a/mm/vmstat.c~mm-memcontrol-account-pagetables-per-node
+++ a/mm/vmstat.c
@@ -1157,7 +1157,6 @@ const char * const vmstat_text[] = {
"nr_zone_unevictable",
"nr_zone_write_pending",
"nr_mlock",
- "nr_page_table_pages",
"nr_bounce",
#if IS_ENABLED(CONFIG_ZSMALLOC)
"nr_zspages",
@@ -1215,6 +1214,7 @@ const char * const vmstat_text[] = {
#if IS_ENABLED(CONFIG_SHADOW_CALL_STACK)
"nr_shadow_call_stack",
#endif
+ "nr_page_table_pages",
/* enum writeback_stat_item counters */
"nr_dirty_threshold",
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 073/200] xen/unpopulated-alloc: consolidate pgmap manipulation
2020-12-15 3:02 incoming Andrew Morton
` (71 preceding siblings ...)
2020-12-15 3:07 ` [patch 072/200] mm: memcontrol: account pagetables per node Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 3:07 ` [patch 074/200] kselftests: vm: add mremap tests Andrew Morton
` (127 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, boris.ostrovsky, dan.j.williams, jgross, linux-mm,
mm-commits, sstabellini, torvalds
From: Dan Williams <dan.j.williams@intel.com>
Subject: xen/unpopulated-alloc: consolidate pgmap manipulation
Cleanup fill_list() to keep all the pgmap manipulations in a single
location of the function. Update the exit unwind path accordingly.
Link: http://lore.kernel.org/r/6186fa28-d123-12db-6171-a75cb6e615a5@oracle.com
Link: https://lkml.kernel.org/r/160272253442.3136502.16683842453317773487.stgit@dwillia2-desk3.amr.corp.intel.com
Signed-off-by: Dan Williams <dan.j.williams@intel.com>
Reported-by: Boris Ostrovsky <boris.ostrovsky@oracle.com>
Cc: Juergen Gross <jgross@suse.com>
Cc: Stefano Stabellini <sstabellini@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/xen/unpopulated-alloc.c | 14 +++++++-------
1 file changed, 7 insertions(+), 7 deletions(-)
--- a/drivers/xen/unpopulated-alloc.c~xen-unpopulated-alloc-consolidate-pgmap-manipulation
+++ a/drivers/xen/unpopulated-alloc.c
@@ -27,11 +27,6 @@ static int fill_list(unsigned int nr_pag
if (!res)
return -ENOMEM;
- pgmap = kzalloc(sizeof(*pgmap), GFP_KERNEL);
- if (!pgmap)
- goto err_pgmap;
-
- pgmap->type = MEMORY_DEVICE_GENERIC;
res->name = "Xen scratch";
res->flags = IORESOURCE_MEM | IORESOURCE_BUSY;
@@ -43,6 +38,11 @@ static int fill_list(unsigned int nr_pag
goto err_resource;
}
+ pgmap = kzalloc(sizeof(*pgmap), GFP_KERNEL);
+ if (!pgmap)
+ goto err_pgmap;
+
+ pgmap->type = MEMORY_DEVICE_GENERIC;
pgmap->range = (struct range) {
.start = res->start,
.end = res->end,
@@ -92,10 +92,10 @@ static int fill_list(unsigned int nr_pag
return 0;
err_memremap:
- release_resource(res);
-err_resource:
kfree(pgmap);
err_pgmap:
+ release_resource(res);
+err_resource:
kfree(res);
return ret;
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 074/200] kselftests: vm: add mremap tests
2020-12-15 3:02 incoming Andrew Morton
` (72 preceding siblings ...)
2020-12-15 3:07 ` [patch 073/200] xen/unpopulated-alloc: consolidate pgmap manipulation Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 3:07 ` [patch 075/200] mm: speedup mremap on 1GB or larger regions Andrew Morton
` (126 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, almasrymina, aneesh.kumar, anshuman.khandual, arnd, bgeffon,
bp, catalin.marinas, christian.brauner, dave.hansen, frederic,
gshan, hnaveed, hpa, jhubbard, justin.he, kaleshsingh, keescook,
kirill.shutemov, krzk, linux-mm, linuxram, lokeshgidra,
mark.rutland, masahiroy, mhiramat, minchan, mingo, mm-commits,
peterz, rcampbell, rppt, samitolvanen, sandipan, shuah, sjpark,
steven.price, surenb, tglx, torvalds, will, ziy
From: Kalesh Singh <kaleshsingh@google.com>
Subject: kselftests: vm: add mremap tests
Patch series "Speed up mremap on large regions", v4.
mremap time can be optimized by moving entries at the PMD/PUD level if the
source and destination addresses are PMD/PUD-aligned and PMD/PUD-sized.
Enable moving at the PMD and PUD levels on arm64 and x86. Other
architectures where this type of move is supported and known to be safe
can also opt-in to these optimizations by enabling HAVE_MOVE_PMD and
HAVE_MOVE_PUD.
Observed Performance Improvements for remapping a PUD-aligned 1GB-sized
region on x86 and arm64:
- HAVE_MOVE_PMD is already enabled on x86 : N/A
- Enabling HAVE_MOVE_PUD on x86 : ~13x speed up
- Enabling HAVE_MOVE_PMD on arm64 : ~ 8x speed up
- Enabling HAVE_MOVE_PUD on arm64 : ~19x speed up
Altogether, HAVE_MOVE_PMD and HAVE_MOVE_PUD
give a total of ~150x speed up on arm64.
This patch (of 4):
Test mremap on regions of various sizes and alignments and validate data
after remapping. Also provide total time for remapping the region which
is useful for performance comparison of the mremap optimizations that move
pages at the PMD/PUD levels if HAVE_MOVE_PMD and/or HAVE_MOVE_PUD are
enabled.
Link: https://lkml.kernel.org/r/20201014005320.2233162-1-kaleshsingh@google.com
Link: https://lkml.kernel.org/r/20201014005320.2233162-2-kaleshsingh@google.com
Signed-off-by: Kalesh Singh <kaleshsingh@google.com>
Reviewed-by: John Hubbard <jhubbard@nvidia.com>
Cc: Shuah Khan <shuah@kernel.org>
Cc: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Cc: Suren Baghdasaryan <surenb@google.com>
Cc: Minchan Kim <minchan@google.com>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Borislav Petkov <bp@alien8.de>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Will Deacon <will@kernel.org>
Cc: Peter Zijlstra (Intel) <peterz@infradead.org>
Cc: Kees Cook <keescook@chromium.org>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Sami Tolvanen <samitolvanen@google.com>
Cc: Masahiro Yamada <masahiroy@kernel.org>
Cc: Krzysztof Kozlowski <krzk@kernel.org>
Cc: Frederic Weisbecker <frederic@kernel.org>
Cc: Hassan Naveed <hnaveed@wavecomp.com>
Cc: Christian Brauner <christian.brauner@ubuntu.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Mark Rutland <mark.rutland@arm.com>
Cc: Gavin Shan <gshan@redhat.com>
Cc: Mike Rapoport <rppt@kernel.org>
Cc: Steven Price <steven.price@arm.com>
Cc: Jia He <justin.he@arm.com>
Cc: Ram Pai <linuxram@us.ibm.com>
Cc: Sandipan Das <sandipan@linux.ibm.com>
Cc: Zi Yan <ziy@nvidia.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Dave Hansen <dave.hansen@intel.com>
Cc: Brian Geffon <bgeffon@google.com>
Cc: Masami Hiramatsu <mhiramat@kernel.org>
Cc: SeongJae Park <sjpark@amazon.de>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 1
tools/testing/selftests/vm/mremap_test.c | 344 +++++++++++++++++++++
tools/testing/selftests/vm/run_vmtests | 11
4 files changed, 357 insertions(+)
--- a/tools/testing/selftests/vm/.gitignore~kselftests-vm-add-mremap-tests
+++ a/tools/testing/selftests/vm/.gitignore
@@ -8,6 +8,7 @@ thuge-gen
compaction_test
mlock2-tests
mremap_dontunmap
+mremap_test
on-fault-limit
transhuge-stress
protection_keys
--- a/tools/testing/selftests/vm/Makefile~kselftests-vm-add-mremap-tests
+++ a/tools/testing/selftests/vm/Makefile
@@ -37,6 +37,7 @@ TEST_GEN_FILES += map_populate
TEST_GEN_FILES += mlock-random-test
TEST_GEN_FILES += mlock2-tests
TEST_GEN_FILES += mremap_dontunmap
+TEST_GEN_FILES += mremap_test
TEST_GEN_FILES += on-fault-limit
TEST_GEN_FILES += thuge-gen
TEST_GEN_FILES += transhuge-stress
--- /dev/null
+++ a/tools/testing/selftests/vm/mremap_test.c
@@ -0,0 +1,344 @@
+// SPDX-License-Identifier: GPL-2.0
+/*
+ * Copyright 2020 Google LLC
+ */
+#define _GNU_SOURCE
+
+#include <errno.h>
+#include <stdlib.h>
+#include <string.h>
+#include <sys/mman.h>
+#include <time.h>
+
+#include "../kselftest.h"
+
+#define EXPECT_SUCCESS 0
+#define EXPECT_FAILURE 1
+#define NON_OVERLAPPING 0
+#define OVERLAPPING 1
+#define NS_PER_SEC 1000000000ULL
+#define VALIDATION_DEFAULT_THRESHOLD 4 /* 4MB */
+#define VALIDATION_NO_THRESHOLD 0 /* Verify the entire region */
+
+#define ARRAY_SIZE(x) (sizeof(x) / sizeof((x)[0]))
+#define MIN(X, Y) ((X) < (Y) ? (X) : (Y))
+
+struct config {
+ unsigned long long src_alignment;
+ unsigned long long dest_alignment;
+ unsigned long long region_size;
+ int overlapping;
+};
+
+struct test {
+ const char *name;
+ struct config config;
+ int expect_failure;
+};
+
+enum {
+ _1KB = 1ULL << 10, /* 1KB -> not page aligned */
+ _4KB = 4ULL << 10,
+ _8KB = 8ULL << 10,
+ _1MB = 1ULL << 20,
+ _2MB = 2ULL << 20,
+ _4MB = 4ULL << 20,
+ _1GB = 1ULL << 30,
+ _2GB = 2ULL << 30,
+ PTE = _4KB,
+ PMD = _2MB,
+ PUD = _1GB,
+};
+
+#define MAKE_TEST(source_align, destination_align, size, \
+ overlaps, should_fail, test_name) \
+{ \
+ .name = test_name, \
+ .config = { \
+ .src_alignment = source_align, \
+ .dest_alignment = destination_align, \
+ .region_size = size, \
+ .overlapping = overlaps, \
+ }, \
+ .expect_failure = should_fail \
+}
+
+/*
+ * Returns the start address of the mapping on success, else returns
+ * NULL on failure.
+ */
+static void *get_source_mapping(struct config c)
+{
+ unsigned long long addr = 0ULL;
+ void *src_addr = NULL;
+retry:
+ addr += c.src_alignment;
+ src_addr = mmap((void *) addr, c.region_size, PROT_READ | PROT_WRITE,
+ MAP_FIXED | MAP_ANONYMOUS | MAP_SHARED, -1, 0);
+ if (src_addr == MAP_FAILED) {
+ if (errno == EPERM)
+ goto retry;
+ goto error;
+ }
+ /*
+ * Check that the address is aligned to the specified alignment.
+ * Addresses which have alignments that are multiples of that
+ * specified are not considered valid. For instance, 1GB address is
+ * 2MB-aligned, however it will not be considered valid for a
+ * requested alignment of 2MB. This is done to reduce coincidental
+ * alignment in the tests.
+ */
+ if (((unsigned long long) src_addr & (c.src_alignment - 1)) ||
+ !((unsigned long long) src_addr & c.src_alignment))
+ goto retry;
+
+ if (!src_addr)
+ goto error;
+
+ return src_addr;
+error:
+ ksft_print_msg("Failed to map source region: %s\n",
+ strerror(errno));
+ return NULL;
+}
+
+/* Returns the time taken for the remap on success else returns -1. */
+static long long remap_region(struct config c, unsigned int threshold_mb,
+ char pattern_seed)
+{
+ void *addr, *src_addr, *dest_addr;
+ unsigned long long i;
+ struct timespec t_start = {0, 0}, t_end = {0, 0};
+ long long start_ns, end_ns, align_mask, ret, offset;
+ unsigned long long threshold;
+
+ if (threshold_mb == VALIDATION_NO_THRESHOLD)
+ threshold = c.region_size;
+ else
+ threshold = MIN(threshold_mb * _1MB, c.region_size);
+
+ src_addr = get_source_mapping(c);
+ if (!src_addr) {
+ ret = -1;
+ goto out;
+ }
+
+ /* Set byte pattern */
+ srand(pattern_seed);
+ for (i = 0; i < threshold; i++)
+ memset((char *) src_addr + i, (char) rand(), 1);
+
+ /* Mask to zero out lower bits of address for alignment */
+ align_mask = ~(c.dest_alignment - 1);
+ /* Offset of destination address from the end of the source region */
+ offset = (c.overlapping) ? -c.dest_alignment : c.dest_alignment;
+ addr = (void *) (((unsigned long long) src_addr + c.region_size
+ + offset) & align_mask);
+
+ /* See comment in get_source_mapping() */
+ if (!((unsigned long long) addr & c.dest_alignment))
+ addr = (void *) ((unsigned long long) addr | c.dest_alignment);
+
+ clock_gettime(CLOCK_MONOTONIC, &t_start);
+ dest_addr = mremap(src_addr, c.region_size, c.region_size,
+ MREMAP_MAYMOVE|MREMAP_FIXED, (char *) addr);
+ clock_gettime(CLOCK_MONOTONIC, &t_end);
+
+ if (dest_addr == MAP_FAILED) {
+ ksft_print_msg("mremap failed: %s\n", strerror(errno));
+ ret = -1;
+ goto clean_up_src;
+ }
+
+ /* Verify byte pattern after remapping */
+ srand(pattern_seed);
+ for (i = 0; i < threshold; i++) {
+ char c = (char) rand();
+
+ if (((char *) dest_addr)[i] != c) {
+ ksft_print_msg("Data after remap doesn't match at offset %d\n",
+ i);
+ ksft_print_msg("Expected: %#x\t Got: %#x\n", c & 0xff,
+ ((char *) dest_addr)[i] & 0xff);
+ ret = -1;
+ goto clean_up_dest;
+ }
+ }
+
+ start_ns = t_start.tv_sec * NS_PER_SEC + t_start.tv_nsec;
+ end_ns = t_end.tv_sec * NS_PER_SEC + t_end.tv_nsec;
+ ret = end_ns - start_ns;
+
+/*
+ * Since the destination address is specified using MREMAP_FIXED, subsequent
+ * mremap will unmap any previous mapping at the address range specified by
+ * dest_addr and region_size. This significantly affects the remap time of
+ * subsequent tests. So we clean up mappings after each test.
+ */
+clean_up_dest:
+ munmap(dest_addr, c.region_size);
+clean_up_src:
+ munmap(src_addr, c.region_size);
+out:
+ return ret;
+}
+
+static void run_mremap_test_case(struct test test_case, int *failures,
+ unsigned int threshold_mb,
+ unsigned int pattern_seed)
+{
+ long long remap_time = remap_region(test_case.config, threshold_mb,
+ pattern_seed);
+
+ if (remap_time < 0) {
+ if (test_case.expect_failure)
+ ksft_test_result_pass("%s\n\tExpected mremap failure\n",
+ test_case.name);
+ else {
+ ksft_test_result_fail("%s\n", test_case.name);
+ *failures += 1;
+ }
+ } else {
+ /*
+ * Comparing mremap time is only applicable if entire region
+ * was faulted in.
+ */
+ if (threshold_mb == VALIDATION_NO_THRESHOLD ||
+ test_case.config.region_size <= threshold_mb * _1MB)
+ ksft_test_result_pass("%s\n\tmremap time: %12lldns\n",
+ test_case.name, remap_time);
+ else
+ ksft_test_result_pass("%s\n", test_case.name);
+ }
+}
+
+static void usage(const char *cmd)
+{
+ fprintf(stderr,
+ "Usage: %s [[-t <threshold_mb>] [-p <pattern_seed>]]\n"
+ "-t\t only validate threshold_mb of the remapped region\n"
+ " \t if 0 is supplied no threshold is used; all tests\n"
+ " \t are run and remapped regions validated fully.\n"
+ " \t The default threshold used is 4MB.\n"
+ "-p\t provide a seed to generate the random pattern for\n"
+ " \t validating the remapped region.\n", cmd);
+}
+
+static int parse_args(int argc, char **argv, unsigned int *threshold_mb,
+ unsigned int *pattern_seed)
+{
+ const char *optstr = "t:p:";
+ int opt;
+
+ while ((opt = getopt(argc, argv, optstr)) != -1) {
+ switch (opt) {
+ case 't':
+ *threshold_mb = atoi(optarg);
+ break;
+ case 'p':
+ *pattern_seed = atoi(optarg);
+ break;
+ default:
+ usage(argv[0]);
+ return -1;
+ }
+ }
+
+ if (optind < argc) {
+ usage(argv[0]);
+ return -1;
+ }
+
+ return 0;
+}
+
+int main(int argc, char **argv)
+{
+ int failures = 0;
+ int i, run_perf_tests;
+ unsigned int threshold_mb = VALIDATION_DEFAULT_THRESHOLD;
+ unsigned int pattern_seed;
+ time_t t;
+
+ pattern_seed = (unsigned int) time(&t);
+
+ if (parse_args(argc, argv, &threshold_mb, &pattern_seed) < 0)
+ exit(EXIT_FAILURE);
+
+ ksft_print_msg("Test configs:\n\tthreshold_mb=%u\n\tpattern_seed=%u\n\n",
+ threshold_mb, pattern_seed);
+
+ struct test test_cases[] = {
+ /* Expected mremap failures */
+ MAKE_TEST(_4KB, _4KB, _4KB, OVERLAPPING, EXPECT_FAILURE,
+ "mremap - Source and Destination Regions Overlapping"),
+ MAKE_TEST(_4KB, _1KB, _4KB, NON_OVERLAPPING, EXPECT_FAILURE,
+ "mremap - Destination Address Misaligned (1KB-aligned)"),
+ MAKE_TEST(_1KB, _4KB, _4KB, NON_OVERLAPPING, EXPECT_FAILURE,
+ "mremap - Source Address Misaligned (1KB-aligned)"),
+
+ /* Src addr PTE aligned */
+ MAKE_TEST(PTE, PTE, _8KB, NON_OVERLAPPING, EXPECT_SUCCESS,
+ "8KB mremap - Source PTE-aligned, Destination PTE-aligned"),
+
+ /* Src addr 1MB aligned */
+ MAKE_TEST(_1MB, PTE, _2MB, NON_OVERLAPPING, EXPECT_SUCCESS,
+ "2MB mremap - Source 1MB-aligned, Destination PTE-aligned"),
+ MAKE_TEST(_1MB, _1MB, _2MB, NON_OVERLAPPING, EXPECT_SUCCESS,
+ "2MB mremap - Source 1MB-aligned, Destination 1MB-aligned"),
+
+ /* Src addr PMD aligned */
+ MAKE_TEST(PMD, PTE, _4MB, NON_OVERLAPPING, EXPECT_SUCCESS,
+ "4MB mremap - Source PMD-aligned, Destination PTE-aligned"),
+ MAKE_TEST(PMD, _1MB, _4MB, NON_OVERLAPPING, EXPECT_SUCCESS,
+ "4MB mremap - Source PMD-aligned, Destination 1MB-aligned"),
+ MAKE_TEST(PMD, PMD, _4MB, NON_OVERLAPPING, EXPECT_SUCCESS,
+ "4MB mremap - Source PMD-aligned, Destination PMD-aligned"),
+
+ /* Src addr PUD aligned */
+ MAKE_TEST(PUD, PTE, _2GB, NON_OVERLAPPING, EXPECT_SUCCESS,
+ "2GB mremap - Source PUD-aligned, Destination PTE-aligned"),
+ MAKE_TEST(PUD, _1MB, _2GB, NON_OVERLAPPING, EXPECT_SUCCESS,
+ "2GB mremap - Source PUD-aligned, Destination 1MB-aligned"),
+ MAKE_TEST(PUD, PMD, _2GB, NON_OVERLAPPING, EXPECT_SUCCESS,
+ "2GB mremap - Source PUD-aligned, Destination PMD-aligned"),
+ MAKE_TEST(PUD, PUD, _2GB, NON_OVERLAPPING, EXPECT_SUCCESS,
+ "2GB mremap - Source PUD-aligned, Destination PUD-aligned"),
+ };
+
+ struct test perf_test_cases[] = {
+ /*
+ * mremap 1GB region - Page table level aligned time
+ * comparison.
+ */
+ MAKE_TEST(PTE, PTE, _1GB, NON_OVERLAPPING, EXPECT_SUCCESS,
+ "1GB mremap - Source PTE-aligned, Destination PTE-aligned"),
+ MAKE_TEST(PMD, PMD, _1GB, NON_OVERLAPPING, EXPECT_SUCCESS,
+ "1GB mremap - Source PMD-aligned, Destination PMD-aligned"),
+ MAKE_TEST(PUD, PUD, _1GB, NON_OVERLAPPING, EXPECT_SUCCESS,
+ "1GB mremap - Source PUD-aligned, Destination PUD-aligned"),
+ };
+
+ run_perf_tests = (threshold_mb == VALIDATION_NO_THRESHOLD) ||
+ (threshold_mb * _1MB >= _1GB);
+
+ ksft_set_plan(ARRAY_SIZE(test_cases) + (run_perf_tests ?
+ ARRAY_SIZE(perf_test_cases) : 0));
+
+ for (i = 0; i < ARRAY_SIZE(test_cases); i++)
+ run_mremap_test_case(test_cases[i], &failures, threshold_mb,
+ pattern_seed);
+
+ if (run_perf_tests) {
+ ksft_print_msg("\n%s\n",
+ "mremap HAVE_MOVE_PMD/PUD optimization time comparison for 1GB region:");
+ for (i = 0; i < ARRAY_SIZE(perf_test_cases); i++)
+ run_mremap_test_case(perf_test_cases[i], &failures,
+ threshold_mb, pattern_seed);
+ }
+
+ if (failures > 0)
+ ksft_exit_fail();
+ else
+ ksft_exit_pass();
+}
--- a/tools/testing/selftests/vm/run_vmtests~kselftests-vm-add-mremap-tests
+++ a/tools/testing/selftests/vm/run_vmtests
@@ -253,6 +253,17 @@ else
echo "[PASS]"
fi
+echo "-------------------"
+echo "running mremap_test"
+echo "-------------------"
+./mremap_test
+if [ $? -ne 0 ]; then
+ echo "[FAIL]"
+ exitcode=1
+else
+ echo "[PASS]"
+fi
+
echo "-----------------"
echo "running thuge-gen"
echo "-----------------"
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 075/200] mm: speedup mremap on 1GB or larger regions
2020-12-15 3:02 incoming Andrew Morton
` (73 preceding siblings ...)
2020-12-15 3:07 ` [patch 074/200] kselftests: vm: add mremap tests Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 19:52 ` Linus Torvalds
2020-12-15 3:07 ` [patch 076/200] arm64: mremap speedup - enable HAVE_MOVE_PUD Andrew Morton
` (125 subsequent siblings)
200 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, almasrymina, aneesh.kumar, anshuman.khandual, arnd, bgeffon,
bp, catalin.marinas, christian.brauner, dave.hansen, frederic,
gshan, hnaveed, hpa, jhubbard, justin.he, kaleshsingh, keescook,
kirill.shutemov, krzk, linux-mm, linuxram, lkp, lokeshgidra,
mark.rutland, masahiroy, mhiramat, minchan, mingo, mm-commits,
peterz, rcampbell, rppt, samitolvanen, sandipan, shuah, sjpark,
steven.price, surenb, tglx, torvalds, will, ziy
From: Kalesh Singh <kaleshsingh@google.com>
Subject: mm: speedup mremap on 1GB or larger regions
Android needs to move large memory regions for garbage collection. The GC
requires moving physical pages of multi-gigabyte heap using mremap.
During this move, the application threads have to be paused for
correctness. It is critical to keep this pause as short as possible to
avoid jitters during user interaction.
Optimize mremap for >= 1GB-sized regions by moving at the PUD/PGD level if
the source and destination addresses are PUD-aligned. For
CONFIG_PGTABLE_LEVELS == 3, moving at the PUD level in effect moves PGD
entries, since the PUD entry is “folded back” onto the PGD entry. Add
HAVE_MOVE_PUD so that architectures where moving at the PUD level isn't
supported/tested can turn this off by not selecting the config.
Link: https://lkml.kernel.org/r/20201014005320.2233162-4-kaleshsingh@google.com
Signed-off-by: Kalesh Singh <kaleshsingh@google.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Reported-by: kernel test robot <lkp@intel.com>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Brian Geffon <bgeffon@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Christian Brauner <christian.brauner@ubuntu.com>
Cc: Dave Hansen <dave.hansen@intel.com>
Cc: Frederic Weisbecker <frederic@kernel.org>
Cc: Gavin Shan <gshan@redhat.com>
Cc: Hassan Naveed <hnaveed@wavecomp.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jia He <justin.he@arm.com>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Kees Cook <keescook@chromium.org>
Cc: Krzysztof Kozlowski <krzk@kernel.org>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: Mark Rutland <mark.rutland@arm.com>
Cc: Masahiro Yamada <masahiroy@kernel.org>
Cc: Masami Hiramatsu <mhiramat@kernel.org>
Cc: Mike Rapoport <rppt@kernel.org>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Minchan Kim <minchan@google.com>
Cc: Peter Zijlstra (Intel) <peterz@infradead.org>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Ram Pai <linuxram@us.ibm.com>
Cc: Sami Tolvanen <samitolvanen@google.com>
Cc: Sandipan Das <sandipan@linux.ibm.com>
Cc: SeongJae Park <sjpark@amazon.de>
Cc: Shuah Khan <shuah@kernel.org>
Cc: Steven Price <steven.price@arm.com>
Cc: Suren Baghdasaryan <surenb@google.com>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Will Deacon <will@kernel.org>
Cc: Zi Yan <ziy@nvidia.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/Kconfig | 7 +
mm/mremap.c | 230 ++++++++++++++++++++++++++++++++++++++++---------
2 files changed, 197 insertions(+), 40 deletions(-)
--- a/arch/Kconfig~mm-speedup-mremap-on-1gb-or-larger-regions
+++ a/arch/Kconfig
@@ -648,6 +648,13 @@ config HAVE_IRQ_TIME_ACCOUNTING
Archs need to ensure they use a high enough resolution clock to
support irq time accounting and then call enable_sched_clock_irqtime().
+config HAVE_MOVE_PUD
+ bool
+ help
+ Architectures that select this are able to move page tables at the
+ PUD level. If there are only 3 page table levels, the move effectively
+ happens at the PGD level.
+
config HAVE_MOVE_PMD
bool
help
--- a/mm/mremap.c~mm-speedup-mremap-on-1gb-or-larger-regions
+++ a/mm/mremap.c
@@ -30,12 +30,11 @@
#include "internal.h"
-static pmd_t *get_old_pmd(struct mm_struct *mm, unsigned long addr)
+static pud_t *get_old_pud(struct mm_struct *mm, unsigned long addr)
{
pgd_t *pgd;
p4d_t *p4d;
pud_t *pud;
- pmd_t *pmd;
pgd = pgd_offset(mm, addr);
if (pgd_none_or_clear_bad(pgd))
@@ -49,6 +48,18 @@ static pmd_t *get_old_pmd(struct mm_stru
if (pud_none_or_clear_bad(pud))
return NULL;
+ return pud;
+}
+
+static pmd_t *get_old_pmd(struct mm_struct *mm, unsigned long addr)
+{
+ pud_t *pud;
+ pmd_t *pmd;
+
+ pud = get_old_pud(mm, addr);
+ if (!pud)
+ return NULL;
+
pmd = pmd_offset(pud, addr);
if (pmd_none(*pmd))
return NULL;
@@ -56,19 +67,27 @@ static pmd_t *get_old_pmd(struct mm_stru
return pmd;
}
-static pmd_t *alloc_new_pmd(struct mm_struct *mm, struct vm_area_struct *vma,
+static pud_t *alloc_new_pud(struct mm_struct *mm, struct vm_area_struct *vma,
unsigned long addr)
{
pgd_t *pgd;
p4d_t *p4d;
- pud_t *pud;
- pmd_t *pmd;
pgd = pgd_offset(mm, addr);
p4d = p4d_alloc(mm, pgd, addr);
if (!p4d)
return NULL;
- pud = pud_alloc(mm, p4d, addr);
+
+ return pud_alloc(mm, p4d, addr);
+}
+
+static pmd_t *alloc_new_pmd(struct mm_struct *mm, struct vm_area_struct *vma,
+ unsigned long addr)
+{
+ pud_t *pud;
+ pmd_t *pmd;
+
+ pud = alloc_new_pud(mm, vma, addr);
if (!pud)
return NULL;
@@ -249,14 +268,148 @@ static bool move_normal_pmd(struct vm_ar
return true;
}
+#else
+static inline bool move_normal_pmd(struct vm_area_struct *vma,
+ unsigned long old_addr, unsigned long new_addr, pmd_t *old_pmd,
+ pmd_t *new_pmd)
+{
+ return false;
+}
#endif
+#ifdef CONFIG_HAVE_MOVE_PUD
+static bool move_normal_pud(struct vm_area_struct *vma, unsigned long old_addr,
+ unsigned long new_addr, pud_t *old_pud, pud_t *new_pud)
+{
+ spinlock_t *old_ptl, *new_ptl;
+ struct mm_struct *mm = vma->vm_mm;
+ pud_t pud;
+
+ /*
+ * The destination pud shouldn't be established, free_pgtables()
+ * should have released it.
+ */
+ if (WARN_ON_ONCE(!pud_none(*new_pud)))
+ return false;
+
+ /*
+ * We don't have to worry about the ordering of src and dst
+ * ptlocks because exclusive mmap_lock prevents deadlock.
+ */
+ old_ptl = pud_lock(vma->vm_mm, old_pud);
+ new_ptl = pud_lockptr(mm, new_pud);
+ if (new_ptl != old_ptl)
+ spin_lock_nested(new_ptl, SINGLE_DEPTH_NESTING);
+
+ /* Clear the pud */
+ pud = *old_pud;
+ pud_clear(old_pud);
+
+ VM_BUG_ON(!pud_none(*new_pud));
+
+ /* Set the new pud */
+ set_pud_at(mm, new_addr, new_pud, pud);
+ flush_tlb_range(vma, old_addr, old_addr + PUD_SIZE);
+ if (new_ptl != old_ptl)
+ spin_unlock(new_ptl);
+ spin_unlock(old_ptl);
+
+ return true;
+}
+#else
+static inline bool move_normal_pud(struct vm_area_struct *vma,
+ unsigned long old_addr, unsigned long new_addr, pud_t *old_pud,
+ pud_t *new_pud)
+{
+ return false;
+}
+#endif
+
+enum pgt_entry {
+ NORMAL_PMD,
+ HPAGE_PMD,
+ NORMAL_PUD,
+};
+
+/*
+ * Returns an extent of the corresponding size for the pgt_entry specified if
+ * valid. Else returns a smaller extent bounded by the end of the source and
+ * destination pgt_entry.
+ */
+static unsigned long get_extent(enum pgt_entry entry, unsigned long old_addr,
+ unsigned long old_end, unsigned long new_addr)
+{
+ unsigned long next, extent, mask, size;
+
+ switch (entry) {
+ case HPAGE_PMD:
+ case NORMAL_PMD:
+ mask = PMD_MASK;
+ size = PMD_SIZE;
+ break;
+ case NORMAL_PUD:
+ mask = PUD_MASK;
+ size = PUD_SIZE;
+ break;
+ default:
+ BUILD_BUG();
+ break;
+ }
+
+ next = (old_addr + size) & mask;
+ /* even if next overflowed, extent below will be ok */
+ extent = (next > old_end) ? old_end - old_addr : next - old_addr;
+ next = (new_addr + size) & mask;
+ if (extent > next - new_addr)
+ extent = next - new_addr;
+ return extent;
+}
+
+/*
+ * Attempts to speedup the move by moving entry at the level corresponding to
+ * pgt_entry. Returns true if the move was successful, else false.
+ */
+static bool move_pgt_entry(enum pgt_entry entry, struct vm_area_struct *vma,
+ unsigned long old_addr, unsigned long new_addr,
+ void *old_entry, void *new_entry, bool need_rmap_locks)
+{
+ bool moved = false;
+
+ /* See comment in move_ptes() */
+ if (need_rmap_locks)
+ take_rmap_locks(vma);
+
+ switch (entry) {
+ case NORMAL_PMD:
+ moved = move_normal_pmd(vma, old_addr, new_addr, old_entry,
+ new_entry);
+ break;
+ case NORMAL_PUD:
+ moved = move_normal_pud(vma, old_addr, new_addr, old_entry,
+ new_entry);
+ break;
+ case HPAGE_PMD:
+ moved = IS_ENABLED(CONFIG_TRANSPARENT_HUGEPAGE) &&
+ move_huge_pmd(vma, old_addr, new_addr, old_entry,
+ new_entry);
+ break;
+ default:
+ WARN_ON_ONCE(1);
+ break;
+ }
+
+ if (need_rmap_locks)
+ drop_rmap_locks(vma);
+
+ return moved;
+}
+
unsigned long move_page_tables(struct vm_area_struct *vma,
unsigned long old_addr, struct vm_area_struct *new_vma,
unsigned long new_addr, unsigned long len,
bool need_rmap_locks)
{
- unsigned long extent, next, old_end;
+ unsigned long extent, old_end;
struct mmu_notifier_range range;
pmd_t *old_pmd, *new_pmd;
@@ -269,53 +422,50 @@ unsigned long move_page_tables(struct vm
for (; old_addr < old_end; old_addr += extent, new_addr += extent) {
cond_resched();
- next = (old_addr + PMD_SIZE) & PMD_MASK;
- /* even if next overflowed, extent below will be ok */
- extent = next - old_addr;
- if (extent > old_end - old_addr)
- extent = old_end - old_addr;
- next = (new_addr + PMD_SIZE) & PMD_MASK;
- if (extent > next - new_addr)
- extent = next - new_addr;
+ /*
+ * If extent is PUD-sized try to speed up the move by moving at the
+ * PUD level if possible.
+ */
+ extent = get_extent(NORMAL_PUD, old_addr, old_end, new_addr);
+ if (IS_ENABLED(CONFIG_HAVE_MOVE_PUD) && extent == PUD_SIZE) {
+ pud_t *old_pud, *new_pud;
+
+ old_pud = get_old_pud(vma->vm_mm, old_addr);
+ if (!old_pud)
+ continue;
+ new_pud = alloc_new_pud(vma->vm_mm, vma, new_addr);
+ if (!new_pud)
+ break;
+ if (move_pgt_entry(NORMAL_PUD, vma, old_addr, new_addr,
+ old_pud, new_pud, need_rmap_locks))
+ continue;
+ }
+
+ extent = get_extent(NORMAL_PMD, old_addr, old_end, new_addr);
old_pmd = get_old_pmd(vma->vm_mm, old_addr);
if (!old_pmd)
continue;
new_pmd = alloc_new_pmd(vma->vm_mm, vma, new_addr);
if (!new_pmd)
break;
- if (is_swap_pmd(*old_pmd) || pmd_trans_huge(*old_pmd) || pmd_devmap(*old_pmd)) {
- if (extent == HPAGE_PMD_SIZE) {
- bool moved;
- /* See comment in move_ptes() */
- if (need_rmap_locks)
- take_rmap_locks(vma);
- moved = move_huge_pmd(vma, old_addr, new_addr,
- old_pmd, new_pmd);
- if (need_rmap_locks)
- drop_rmap_locks(vma);
- if (moved)
- continue;
- }
+ if (is_swap_pmd(*old_pmd) || pmd_trans_huge(*old_pmd) ||
+ pmd_devmap(*old_pmd)) {
+ if (extent == HPAGE_PMD_SIZE &&
+ move_pgt_entry(HPAGE_PMD, vma, old_addr, new_addr,
+ old_pmd, new_pmd, need_rmap_locks))
+ continue;
split_huge_pmd(vma, old_pmd, old_addr);
if (pmd_trans_unstable(old_pmd))
continue;
- } else if (extent == PMD_SIZE) {
-#ifdef CONFIG_HAVE_MOVE_PMD
+ } else if (IS_ENABLED(CONFIG_HAVE_MOVE_PMD) &&
+ extent == PMD_SIZE) {
/*
* If the extent is PMD-sized, try to speed the move by
* moving at the PMD level if possible.
*/
- bool moved;
-
- if (need_rmap_locks)
- take_rmap_locks(vma);
- moved = move_normal_pmd(vma, old_addr, new_addr,
- old_pmd, new_pmd);
- if (need_rmap_locks)
- drop_rmap_locks(vma);
- if (moved)
+ if (move_pgt_entry(NORMAL_PMD, vma, old_addr, new_addr,
+ old_pmd, new_pmd, need_rmap_locks))
continue;
-#endif
}
if (pte_alloc(new_vma->vm_mm, new_pmd))
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 076/200] arm64: mremap speedup - enable HAVE_MOVE_PUD
2020-12-15 3:02 incoming Andrew Morton
` (74 preceding siblings ...)
2020-12-15 3:07 ` [patch 075/200] mm: speedup mremap on 1GB or larger regions Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 3:07 ` [patch 077/200] x86: mremap speedup - Enable HAVE_MOVE_PUD Andrew Morton
` (124 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, almasrymina, aneesh.kumar, anshuman.khandual, arnd, bgeffon,
bp, catalin.marinas, christian.brauner, dave.hansen, frederic,
gshan, hnaveed, hpa, jhubbard, justin.he, kaleshsingh, keescook,
kirill.shutemov, krzk, linux-mm, linuxram, lokeshgidra,
mark.rutland, masahiroy, mhiramat, minchan, mingo, mm-commits,
peterz, rcampbell, rppt, samitolvanen, sandipan, shuah, sjpark,
steven.price, surenb, tglx, torvalds, will, ziy
From: Kalesh Singh <kaleshsingh@google.com>
Subject: arm64: mremap speedup - enable HAVE_MOVE_PUD
HAVE_MOVE_PUD enables remapping pages at the PUD level if both the source
and destination addresses are PUD-aligned.
With HAVE_MOVE_PUD enabled it can be inferred that there is approximately
a 19x improvement in performance on arm64. (See data below).
------- Test Results ---------
The following results were obtained using a 5.4 kernel, by remapping a
PUD-aligned, 1GB sized region to a PUD-aligned destination. The results
from 10 iterations of the test are given below:
Total mremap times for 1GB data on arm64. All times are in nanoseconds.
Control HAVE_MOVE_PUD
1247761 74271
1219896 46771
1094792 59687
1227760 48385
1043698 76666
1101771 50365
1159896 52500
1143594 75261
1025833 61354
1078125 48697
1134312.6 59395.7 <-- Mean time in nanoseconds
A 1GB mremap completion time drops from ~1.1 milliseconds to ~59
microseconds on arm64. (~19x speed up).
Link: https://lkml.kernel.org/r/20201014005320.2233162-5-kaleshsingh@google.com
Signed-off-by: Kalesh Singh <kaleshsingh@google.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Will Deacon <will@kernel.org>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Brian Geffon <bgeffon@google.com>
Cc: Christian Brauner <christian.brauner@ubuntu.com>
Cc: Dave Hansen <dave.hansen@intel.com>
Cc: Frederic Weisbecker <frederic@kernel.org>
Cc: Gavin Shan <gshan@redhat.com>
Cc: Hassan Naveed <hnaveed@wavecomp.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jia He <justin.he@arm.com>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Kees Cook <keescook@chromium.org>
Cc: Krzysztof Kozlowski <krzk@kernel.org>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: Mark Rutland <mark.rutland@arm.com>
Cc: Masahiro Yamada <masahiroy@kernel.org>
Cc: Masami Hiramatsu <mhiramat@kernel.org>
Cc: Mike Rapoport <rppt@kernel.org>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Minchan Kim <minchan@google.com>
Cc: Peter Zijlstra (Intel) <peterz@infradead.org>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Ram Pai <linuxram@us.ibm.com>
Cc: Sami Tolvanen <samitolvanen@google.com>
Cc: Sandipan Das <sandipan@linux.ibm.com>
Cc: SeongJae Park <sjpark@amazon.de>
Cc: Shuah Khan <shuah@kernel.org>
Cc: Steven Price <steven.price@arm.com>
Cc: Suren Baghdasaryan <surenb@google.com>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Zi Yan <ziy@nvidia.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/arm64/Kconfig | 1 +
arch/arm64/include/asm/pgtable.h | 1 +
2 files changed, 2 insertions(+)
--- a/arch/arm64/include/asm/pgtable.h~arm64-mremap-speedup-enable-have_move_pud
+++ a/arch/arm64/include/asm/pgtable.h
@@ -462,6 +462,7 @@ static inline pmd_t pmd_mkdevmap(pmd_t p
#define pfn_pud(pfn,prot) __pud(__phys_to_pud_val((phys_addr_t)(pfn) << PAGE_SHIFT) | pgprot_val(prot))
#define set_pmd_at(mm, addr, pmdp, pmd) set_pte_at(mm, addr, (pte_t *)pmdp, pmd_pte(pmd))
+#define set_pud_at(mm, addr, pudp, pud) set_pte_at(mm, addr, (pte_t *)pudp, pud_pte(pud))
#define __p4d_to_phys(p4d) __pte_to_phys(p4d_pte(p4d))
#define __phys_to_p4d_val(phys) __phys_to_pte_val(phys)
--- a/arch/arm64/Kconfig~arm64-mremap-speedup-enable-have_move_pud
+++ a/arch/arm64/Kconfig
@@ -125,6 +125,7 @@ config ARM64
select HANDLE_DOMAIN_IRQ
select HARDIRQS_SW_RESEND
select HAVE_MOVE_PMD
+ select HAVE_MOVE_PUD
select HAVE_PCI
select HAVE_ACPI_APEI if (ACPI && EFI)
select HAVE_ALIGNED_STRUCT_PAGE if SLUB
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 077/200] x86: mremap speedup - Enable HAVE_MOVE_PUD
2020-12-15 3:02 incoming Andrew Morton
` (75 preceding siblings ...)
2020-12-15 3:07 ` [patch 076/200] arm64: mremap speedup - enable HAVE_MOVE_PUD Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 3:07 ` [patch 078/200] mm: cleanup: remove unused tsk arg from __access_remote_vm Andrew Morton
` (123 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, almasrymina, aneesh.kumar, anshuman.khandual, arnd, bgeffon,
bp, catalin.marinas, christian.brauner, dave.hansen, frederic,
gshan, hnaveed, hpa, jhubbard, justin.he, kaleshsingh, keescook,
kirill.shutemov, krzk, linux-mm, linuxram, lokeshgidra,
mark.rutland, masahiroy, mhiramat, minchan, mingo, mm-commits,
peterz, rcampbell, rppt, samitolvanen, sandipan, shuah, sjpark,
steven.price, surenb, tglx, torvalds, will, ziy
From: Kalesh Singh <kaleshsingh@google.com>
Subject: x86: mremap speedup - Enable HAVE_MOVE_PUD
HAVE_MOVE_PUD enables remapping pages at the PUD level if both the
source and destination addresses are PUD-aligned.
With HAVE_MOVE_PUD enabled it can be inferred that there is approximately
a 13x improvement in performance on x86. (See data below).
------- Test Results ---------
The following results were obtained using a 5.4 kernel, by remapping
a PUD-aligned, 1GB sized region to a PUD-aligned destination.
The results from 10 iterations of the test are given below:
Total mremap times for 1GB data on x86. All times are in nanoseconds.
Control HAVE_MOVE_PUD
180394 15089
235728 14056
238931 25741
187330 13838
241742 14187
177925 14778
182758 14728
160872 14418
205813 15107
245722 13998
205721.5 15594 <-- Mean time in nanoseconds
A 1GB mremap completion time drops from ~205 microseconds
to ~15 microseconds on x86. (~13x speed up).
Link: https://lkml.kernel.org/r/20201014005320.2233162-6-kaleshsingh@google.com
Signed-off-by: Kalesh Singh <kaleshsingh@google.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Acked-by: Ingo Molnar <mingo@redhat.com>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: H. Peter Anvin <hpa@zytor.com>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.ibm.com>
Cc: Anshuman Khandual <anshuman.khandual@arm.com>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Brian Geffon <bgeffon@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Christian Brauner <christian.brauner@ubuntu.com>
Cc: Dave Hansen <dave.hansen@intel.com>
Cc: Frederic Weisbecker <frederic@kernel.org>
Cc: Gavin Shan <gshan@redhat.com>
Cc: Hassan Naveed <hnaveed@wavecomp.com>
Cc: Jia He <justin.he@arm.com>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Kees Cook <keescook@chromium.org>
Cc: Krzysztof Kozlowski <krzk@kernel.org>
Cc: Lokesh Gidra <lokeshgidra@google.com>
Cc: Mark Rutland <mark.rutland@arm.com>
Cc: Masahiro Yamada <masahiroy@kernel.org>
Cc: Masami Hiramatsu <mhiramat@kernel.org>
Cc: Mike Rapoport <rppt@kernel.org>
Cc: Mina Almasry <almasrymina@google.com>
Cc: Minchan Kim <minchan@google.com>
Cc: Peter Zijlstra (Intel) <peterz@infradead.org>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Ram Pai <linuxram@us.ibm.com>
Cc: Sami Tolvanen <samitolvanen@google.com>
Cc: Sandipan Das <sandipan@linux.ibm.com>
Cc: SeongJae Park <sjpark@amazon.de>
Cc: Shuah Khan <shuah@kernel.org>
Cc: Steven Price <steven.price@arm.com>
Cc: Suren Baghdasaryan <surenb@google.com>
Cc: Will Deacon <will@kernel.org>
Cc: Zi Yan <ziy@nvidia.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/x86/Kconfig | 1 +
1 file changed, 1 insertion(+)
--- a/arch/x86/Kconfig~x86-mremap-speedup-enable-have_move_pud
+++ a/arch/x86/Kconfig
@@ -199,6 +199,7 @@ config X86
select HAVE_MIXED_BREAKPOINTS_REGS
select HAVE_MOD_ARCH_SPECIFIC
select HAVE_MOVE_PMD
+ select HAVE_MOVE_PUD
select HAVE_NMI
select HAVE_OPROFILE
select HAVE_OPTPROBES
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 078/200] mm: cleanup: remove unused tsk arg from __access_remote_vm
2020-12-15 3:02 incoming Andrew Morton
` (76 preceding siblings ...)
2020-12-15 3:07 ` [patch 077/200] x86: mremap speedup - Enable HAVE_MOVE_PUD Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 3:07 ` [patch 079/200] mm/mapping_dirty_helpers: enhance the kernel-doc markups Andrew Morton
` (122 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, jhubbard, linux-mm, mm-commits, oleg, rppt, torvalds
From: John Hubbard <jhubbard@nvidia.com>
Subject: mm: cleanup: remove unused tsk arg from __access_remote_vm
Despite a comment that said that page fault accounting would be charged to
whatever task_struct* was passed into __access_remote_vm(), the tsk
argument was actually unused.
Making page fault accounting actually use this task struct is quite a
project, so there is no point in keeping the tsk argument.
Delete both the comment, and the argument.
[rppt@linux.ibm.com: changelog addition]
Link: https://lkml.kernel.org/r/20201026074137.4147787-1-jhubbard@nvidia.com
Signed-off-by: John Hubbard <jhubbard@nvidia.com>
Reviewed-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Oleg Nesterov <oleg@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/mm.h | 4 ++--
kernel/ptrace.c | 2 +-
mm/memory.c | 11 +++++------
mm/nommu.c | 8 ++++----
4 files changed, 12 insertions(+), 13 deletions(-)
--- a/include/linux/mm.h~mm-cleanup-remove-unused-tsk-arg-from-__access_remote_vm
+++ a/include/linux/mm.h
@@ -1716,8 +1716,8 @@ extern int access_process_vm(struct task
void *buf, int len, unsigned int gup_flags);
extern int access_remote_vm(struct mm_struct *mm, unsigned long addr,
void *buf, int len, unsigned int gup_flags);
-extern int __access_remote_vm(struct task_struct *tsk, struct mm_struct *mm,
- unsigned long addr, void *buf, int len, unsigned int gup_flags);
+extern int __access_remote_vm(struct mm_struct *mm, unsigned long addr,
+ void *buf, int len, unsigned int gup_flags);
long get_user_pages_remote(struct mm_struct *mm,
unsigned long start, unsigned long nr_pages,
--- a/kernel/ptrace.c~mm-cleanup-remove-unused-tsk-arg-from-__access_remote_vm
+++ a/kernel/ptrace.c
@@ -57,7 +57,7 @@ int ptrace_access_vm(struct task_struct
return 0;
}
- ret = __access_remote_vm(tsk, mm, addr, buf, len, gup_flags);
+ ret = __access_remote_vm(mm, addr, buf, len, gup_flags);
mmput(mm);
return ret;
--- a/mm/memory.c~mm-cleanup-remove-unused-tsk-arg-from-__access_remote_vm
+++ a/mm/memory.c
@@ -4885,11 +4885,10 @@ EXPORT_SYMBOL_GPL(generic_access_phys);
#endif
/*
- * Access another process' address space as given in mm. If non-NULL, use the
- * given task for page fault accounting.
+ * Access another process' address space as given in mm.
*/
-int __access_remote_vm(struct task_struct *tsk, struct mm_struct *mm,
- unsigned long addr, void *buf, int len, unsigned int gup_flags)
+int __access_remote_vm(struct mm_struct *mm, unsigned long addr, void *buf,
+ int len, unsigned int gup_flags)
{
struct vm_area_struct *vma;
void *old_buf = buf;
@@ -4966,7 +4965,7 @@ int __access_remote_vm(struct task_struc
int access_remote_vm(struct mm_struct *mm, unsigned long addr,
void *buf, int len, unsigned int gup_flags)
{
- return __access_remote_vm(NULL, mm, addr, buf, len, gup_flags);
+ return __access_remote_vm(mm, addr, buf, len, gup_flags);
}
/*
@@ -4984,7 +4983,7 @@ int access_process_vm(struct task_struct
if (!mm)
return 0;
- ret = __access_remote_vm(tsk, mm, addr, buf, len, gup_flags);
+ ret = __access_remote_vm(mm, addr, buf, len, gup_flags);
mmput(mm);
--- a/mm/nommu.c~mm-cleanup-remove-unused-tsk-arg-from-__access_remote_vm
+++ a/mm/nommu.c
@@ -1675,8 +1675,8 @@ void filemap_map_pages(struct vm_fault *
}
EXPORT_SYMBOL(filemap_map_pages);
-int __access_remote_vm(struct task_struct *tsk, struct mm_struct *mm,
- unsigned long addr, void *buf, int len, unsigned int gup_flags)
+int __access_remote_vm(struct mm_struct *mm, unsigned long addr, void *buf,
+ int len, unsigned int gup_flags)
{
struct vm_area_struct *vma;
int write = gup_flags & FOLL_WRITE;
@@ -1722,7 +1722,7 @@ int __access_remote_vm(struct task_struc
int access_remote_vm(struct mm_struct *mm, unsigned long addr,
void *buf, int len, unsigned int gup_flags)
{
- return __access_remote_vm(NULL, mm, addr, buf, len, gup_flags);
+ return __access_remote_vm(mm, addr, buf, len, gup_flags);
}
/*
@@ -1741,7 +1741,7 @@ int access_process_vm(struct task_struct
if (!mm)
return 0;
- len = __access_remote_vm(tsk, mm, addr, buf, len, gup_flags);
+ len = __access_remote_vm(mm, addr, buf, len, gup_flags);
mmput(mm);
return len;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 079/200] mm/mapping_dirty_helpers: enhance the kernel-doc markups
2020-12-15 3:02 incoming Andrew Morton
` (77 preceding siblings ...)
2020-12-15 3:07 ` [patch 078/200] mm: cleanup: remove unused tsk arg from __access_remote_vm Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 3:07 ` [patch 080/200] mm/page_vma_mapped.c: add colon to fix kernel-doc markups error for check_pte Andrew Morton
` (121 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, alex.shi, corbet, linux-mm, mm-commits, rdunlap, torvalds
From: Alex Shi <alex.shi@linux.alibaba.com>
Subject: mm/mapping_dirty_helpers: enhance the kernel-doc markups
Add and change parameter explanation for wp_pte and clean_record_pte, to
avoid W1 warning:
mm/mapping_dirty_helpers.c:34: warning: Function parameter or member
'end' not described in 'wp_pte'
mm/mapping_dirty_helpers.c:88: warning: Function parameter or member
'end' not described in 'clean_record_pte'
Link: https://lkml.kernel.org/r/1605605088-30668-2-git-send-email-alex.shi@linux.alibaba.com
Signed-off-by: Alex Shi <alex.shi@linux.alibaba.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Randy Dunlap <rdunlap@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/mapping_dirty_helpers.c | 6 ++++--
1 file changed, 4 insertions(+), 2 deletions(-)
--- a/mm/mapping_dirty_helpers.c~mm-mapping_dirty_helpers-enhance-the-kernel-doc-markups
+++ a/mm/mapping_dirty_helpers.c
@@ -23,7 +23,8 @@ struct wp_walk {
/**
* wp_pte - Write-protect a pte
* @pte: Pointer to the pte
- * @addr: The virtual page address
+ * @addr: The start of protecting virtual address
+ * @end: The end of protecting virtual address
* @walk: pagetable walk callback argument
*
* The function write-protects a pte and records the range in
@@ -74,7 +75,8 @@ struct clean_walk {
* clean_record_pte - Clean a pte and record its address space offset in a
* bitmap
* @pte: Pointer to the pte
- * @addr: The virtual page address
+ * @addr: The start of virtual address to be clean
+ * @end: The end of virtual address to be clean
* @walk: pagetable walk callback argument
*
* The function cleans a pte and records the range in
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 080/200] mm/page_vma_mapped.c: add colon to fix kernel-doc markups error for check_pte
2020-12-15 3:02 incoming Andrew Morton
` (78 preceding siblings ...)
2020-12-15 3:07 ` [patch 079/200] mm/mapping_dirty_helpers: enhance the kernel-doc markups Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 3:07 ` [patch 081/200] mm: mmap_lock: add tracepoints around lock acquisition Andrew Morton
` (120 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, alex.shi, corbet, linux-mm, mm-commits, rdunlap, torvalds
From: Alex Shi <alex.shi@linux.alibaba.com>
Subject: mm/page_vma_mapped.c: add colon to fix kernel-doc markups error for check_pte
check_pte() needs a correct colon for kernel-doc markup, otherwise, gcc
has the following warning for W=1, mm/page_vma_mapped.c:86: warning:
Function parameter or member 'pvmw' not described in 'check_pte'
Link: https://lkml.kernel.org/r/1605597167-25145-1-git-send-email-alex.shi@linux.alibaba.com
Signed-off-by: Alex Shi <alex.shi@linux.alibaba.com>
Cc: Randy Dunlap <rdunlap@infradead.org>
Cc: Jonathan Corbet <corbet@lwn.net>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_vma_mapped.c | 9 +++++----
1 file changed, 5 insertions(+), 4 deletions(-)
--- a/mm/page_vma_mapped.c~mm-add-colon-to-fix-kernel-doc-markups-error-for-check_pte
+++ a/mm/page_vma_mapped.c
@@ -66,18 +66,19 @@ static inline bool pfn_is_match(struct p
/**
* check_pte - check if @pvmw->page is mapped at the @pvmw->pte
+ * @pvmw: page_vma_mapped_walk struct, includes a pair pte and page for checking
*
* page_vma_mapped_walk() found a place where @pvmw->page is *potentially*
* mapped. check_pte() has to validate this.
*
- * @pvmw->pte may point to empty PTE, swap PTE or PTE pointing to arbitrary
- * page.
+ * pvmw->pte may point to empty PTE, swap PTE or PTE pointing to
+ * arbitrary page.
*
* If PVMW_MIGRATION flag is set, returns true if @pvmw->pte contains migration
* entry that points to @pvmw->page or any subpage in case of THP.
*
- * If PVMW_MIGRATION flag is not set, returns true if @pvmw->pte points to
- * @pvmw->page or any subpage in case of THP.
+ * If PVMW_MIGRATION flag is not set, returns true if pvmw->pte points to
+ * pvmw->page or any subpage in case of THP.
*
* Otherwise, return false.
*
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 081/200] mm: mmap_lock: add tracepoints around lock acquisition
2020-12-15 3:02 incoming Andrew Morton
` (79 preceding siblings ...)
2020-12-15 3:07 ` [patch 080/200] mm/page_vma_mapped.c: add colon to fix kernel-doc markups error for check_pte Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 3:07 ` [patch 082/200] sparc: fix handling of page table constructor failure Andrew Morton
` (119 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, axelrasmussen, chinwen.chang, daniel.m.jordan, dbueso,
jannh, laoar.shao, ldufour, linux-mm, mingo, mm-commits, rientjes,
rostedt, torvalds, vbabka, walken
From: Axel Rasmussen <axelrasmussen@google.com>
Subject: mm: mmap_lock: add tracepoints around lock acquisition
The goal of these tracepoints is to be able to debug lock contention
issues. This lock is acquired on most (all?) mmap / munmap / page fault
operations, so a multi-threaded process which does a lot of these can
experience significant contention.
We trace just before we start acquisition, when the acquisition returns
(whether it succeeded or not), and when the lock is released (or
downgraded). The events are broken out by lock type (read / write).
The events are also broken out by memcg path. For container-based
workloads, users often think of several processes in a memcg as a single
logical "task", so collecting statistics at this level is useful.
The end goal is to get latency information. This isn't directly included
in the trace events. Instead, users are expected to compute the time
between "start locking" and "acquire returned", using e.g. synthetic
events or BPF. The benefit we get from this is simpler code.
Because we use tracepoint_enabled() to decide whether or not to trace,
this patch has effectively no overhead unless tracepoints are enabled at
runtime. If tracepoints are enabled, there is a performance impact, but
how much depends on exactly what e.g. the BPF program does.
[axelrasmussen@google.com: fix use-after-free race and css ref leak in tracepoints]
Link: https://lkml.kernel.org/r/20201130233504.3725241-1-axelrasmussen@google.com
[axelrasmussen@google.com: v3]
Link: https://lkml.kernel.org/r/20201207213358.573750-1-axelrasmussen@google.com
[rostedt@goodmis.org: in-depth examples of tracepoint_enabled() usage, and per-cpu-per-context buffer design]
Link: https://lkml.kernel.org/r/20201105211739.568279-2-axelrasmussen@google.com
Signed-off-by: Axel Rasmussen <axelrasmussen@google.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Daniel Jordan <daniel.m.jordan@oracle.com>
Cc: Jann Horn <jannh@google.com>
Cc: Chinwen Chang <chinwen.chang@mediatek.com>
Cc: Davidlohr Bueso <dbueso@suse.de>
Cc: David Rientjes <rientjes@google.com>
Cc: Laurent Dufour <ldufour@linux.ibm.com>
Cc: Yafang Shao <laoar.shao@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/mmap_lock.h | 94 +++++++++++
include/trace/events/mmap_lock.h | 107 +++++++++++++
mm/Makefile | 2
mm/mmap_lock.c | 230 +++++++++++++++++++++++++++++
4 files changed, 427 insertions(+), 6 deletions(-)
--- a/include/linux/mmap_lock.h~mmap_lock-add-tracepoints-around-lock-acquisition
+++ a/include/linux/mmap_lock.h
@@ -1,11 +1,65 @@
#ifndef _LINUX_MMAP_LOCK_H
#define _LINUX_MMAP_LOCK_H
+#include <linux/lockdep.h>
+#include <linux/mm_types.h>
#include <linux/mmdebug.h>
+#include <linux/rwsem.h>
+#include <linux/tracepoint-defs.h>
+#include <linux/types.h>
#define MMAP_LOCK_INITIALIZER(name) \
.mmap_lock = __RWSEM_INITIALIZER((name).mmap_lock),
+DECLARE_TRACEPOINT(mmap_lock_start_locking);
+DECLARE_TRACEPOINT(mmap_lock_acquire_returned);
+DECLARE_TRACEPOINT(mmap_lock_released);
+
+#ifdef CONFIG_TRACING
+
+void __mmap_lock_do_trace_start_locking(struct mm_struct *mm, bool write);
+void __mmap_lock_do_trace_acquire_returned(struct mm_struct *mm, bool write,
+ bool success);
+void __mmap_lock_do_trace_released(struct mm_struct *mm, bool write);
+
+static inline void __mmap_lock_trace_start_locking(struct mm_struct *mm,
+ bool write)
+{
+ if (tracepoint_enabled(mmap_lock_start_locking))
+ __mmap_lock_do_trace_start_locking(mm, write);
+}
+
+static inline void __mmap_lock_trace_acquire_returned(struct mm_struct *mm,
+ bool write, bool success)
+{
+ if (tracepoint_enabled(mmap_lock_acquire_returned))
+ __mmap_lock_do_trace_acquire_returned(mm, write, success);
+}
+
+static inline void __mmap_lock_trace_released(struct mm_struct *mm, bool write)
+{
+ if (tracepoint_enabled(mmap_lock_released))
+ __mmap_lock_do_trace_released(mm, write);
+}
+
+#else /* !CONFIG_TRACING */
+
+static inline void __mmap_lock_trace_start_locking(struct mm_struct *mm,
+ bool write)
+{
+}
+
+static inline void __mmap_lock_trace_acquire_returned(struct mm_struct *mm,
+ bool write, bool success)
+{
+}
+
+static inline void __mmap_lock_trace_released(struct mm_struct *mm, bool write)
+{
+}
+
+#endif /* CONFIG_TRACING */
+
static inline void mmap_init_lock(struct mm_struct *mm)
{
init_rwsem(&mm->mmap_lock);
@@ -13,57 +67,86 @@ static inline void mmap_init_lock(struct
static inline void mmap_write_lock(struct mm_struct *mm)
{
+ __mmap_lock_trace_start_locking(mm, true);
down_write(&mm->mmap_lock);
+ __mmap_lock_trace_acquire_returned(mm, true, true);
}
static inline void mmap_write_lock_nested(struct mm_struct *mm, int subclass)
{
+ __mmap_lock_trace_start_locking(mm, true);
down_write_nested(&mm->mmap_lock, subclass);
+ __mmap_lock_trace_acquire_returned(mm, true, true);
}
static inline int mmap_write_lock_killable(struct mm_struct *mm)
{
- return down_write_killable(&mm->mmap_lock);
+ int ret;
+
+ __mmap_lock_trace_start_locking(mm, true);
+ ret = down_write_killable(&mm->mmap_lock);
+ __mmap_lock_trace_acquire_returned(mm, true, ret == 0);
+ return ret;
}
static inline bool mmap_write_trylock(struct mm_struct *mm)
{
- return down_write_trylock(&mm->mmap_lock) != 0;
+ bool ret;
+
+ __mmap_lock_trace_start_locking(mm, true);
+ ret = down_write_trylock(&mm->mmap_lock) != 0;
+ __mmap_lock_trace_acquire_returned(mm, true, ret);
+ return ret;
}
static inline void mmap_write_unlock(struct mm_struct *mm)
{
up_write(&mm->mmap_lock);
+ __mmap_lock_trace_released(mm, true);
}
static inline void mmap_write_downgrade(struct mm_struct *mm)
{
downgrade_write(&mm->mmap_lock);
+ __mmap_lock_trace_acquire_returned(mm, false, true);
}
static inline void mmap_read_lock(struct mm_struct *mm)
{
+ __mmap_lock_trace_start_locking(mm, false);
down_read(&mm->mmap_lock);
+ __mmap_lock_trace_acquire_returned(mm, false, true);
}
static inline int mmap_read_lock_killable(struct mm_struct *mm)
{
- return down_read_killable(&mm->mmap_lock);
+ int ret;
+
+ __mmap_lock_trace_start_locking(mm, false);
+ ret = down_read_killable(&mm->mmap_lock);
+ __mmap_lock_trace_acquire_returned(mm, false, ret == 0);
+ return ret;
}
static inline bool mmap_read_trylock(struct mm_struct *mm)
{
- return down_read_trylock(&mm->mmap_lock) != 0;
+ bool ret;
+
+ __mmap_lock_trace_start_locking(mm, false);
+ ret = down_read_trylock(&mm->mmap_lock) != 0;
+ __mmap_lock_trace_acquire_returned(mm, false, ret);
+ return ret;
}
static inline void mmap_read_unlock(struct mm_struct *mm)
{
up_read(&mm->mmap_lock);
+ __mmap_lock_trace_released(mm, false);
}
static inline bool mmap_read_trylock_non_owner(struct mm_struct *mm)
{
- if (down_read_trylock(&mm->mmap_lock)) {
+ if (mmap_read_trylock(mm)) {
rwsem_release(&mm->mmap_lock.dep_map, _RET_IP_);
return true;
}
@@ -73,6 +156,7 @@ static inline bool mmap_read_trylock_non
static inline void mmap_read_unlock_non_owner(struct mm_struct *mm)
{
up_read_non_owner(&mm->mmap_lock);
+ __mmap_lock_trace_released(mm, false);
}
static inline void mmap_assert_locked(struct mm_struct *mm)
--- /dev/null
+++ a/include/trace/events/mmap_lock.h
@@ -0,0 +1,107 @@
+/* SPDX-License-Identifier: GPL-2.0 */
+#undef TRACE_SYSTEM
+#define TRACE_SYSTEM mmap_lock
+
+#if !defined(_TRACE_MMAP_LOCK_H) || defined(TRACE_HEADER_MULTI_READ)
+#define _TRACE_MMAP_LOCK_H
+
+#include <linux/tracepoint.h>
+#include <linux/types.h>
+
+struct mm_struct;
+
+extern int trace_mmap_lock_reg(void);
+extern void trace_mmap_lock_unreg(void);
+
+TRACE_EVENT_FN(mmap_lock_start_locking,
+
+ TP_PROTO(struct mm_struct *mm, const char *memcg_path, bool write),
+
+ TP_ARGS(mm, memcg_path, write),
+
+ TP_STRUCT__entry(
+ __field(struct mm_struct *, mm)
+ __string(memcg_path, memcg_path)
+ __field(bool, write)
+ ),
+
+ TP_fast_assign(
+ __entry->mm = mm;
+ __assign_str(memcg_path, memcg_path);
+ __entry->write = write;
+ ),
+
+ TP_printk(
+ "mm=%p memcg_path=%s write=%s\n",
+ __entry->mm,
+ __get_str(memcg_path),
+ __entry->write ? "true" : "false"
+ ),
+
+ trace_mmap_lock_reg, trace_mmap_lock_unreg
+);
+
+TRACE_EVENT_FN(mmap_lock_acquire_returned,
+
+ TP_PROTO(struct mm_struct *mm, const char *memcg_path, bool write,
+ bool success),
+
+ TP_ARGS(mm, memcg_path, write, success),
+
+ TP_STRUCT__entry(
+ __field(struct mm_struct *, mm)
+ __string(memcg_path, memcg_path)
+ __field(bool, write)
+ __field(bool, success)
+ ),
+
+ TP_fast_assign(
+ __entry->mm = mm;
+ __assign_str(memcg_path, memcg_path);
+ __entry->write = write;
+ __entry->success = success;
+ ),
+
+ TP_printk(
+ "mm=%p memcg_path=%s write=%s success=%s\n",
+ __entry->mm,
+ __get_str(memcg_path),
+ __entry->write ? "true" : "false",
+ __entry->success ? "true" : "false"
+ ),
+
+ trace_mmap_lock_reg, trace_mmap_lock_unreg
+);
+
+TRACE_EVENT_FN(mmap_lock_released,
+
+ TP_PROTO(struct mm_struct *mm, const char *memcg_path, bool write),
+
+ TP_ARGS(mm, memcg_path, write),
+
+ TP_STRUCT__entry(
+ __field(struct mm_struct *, mm)
+ __string(memcg_path, memcg_path)
+ __field(bool, write)
+ ),
+
+ TP_fast_assign(
+ __entry->mm = mm;
+ __assign_str(memcg_path, memcg_path);
+ __entry->write = write;
+ ),
+
+ TP_printk(
+ "mm=%p memcg_path=%s write=%s\n",
+ __entry->mm,
+ __get_str(memcg_path),
+ __entry->write ? "true" : "false"
+ ),
+
+ trace_mmap_lock_reg, trace_mmap_lock_unreg
+);
+
+#endif /* _TRACE_MMAP_LOCK_H */
+
+/* This part must be outside protection */
+#include <trace/define_trace.h>
--- a/mm/Makefile~mmap_lock-add-tracepoints-around-lock-acquisition
+++ a/mm/Makefile
@@ -52,7 +52,7 @@ obj-y := filemap.o mempool.o oom_kill.
mm_init.o percpu.o slab_common.o \
compaction.o vmacache.o \
interval_tree.o list_lru.o workingset.o \
- debug.o gup.o $(mmu-y)
+ debug.o gup.o mmap_lock.o $(mmu-y)
# Give 'page_alloc' its own module-parameter namespace
page-alloc-y := page_alloc.o
--- /dev/null
+++ a/mm/mmap_lock.c
@@ -0,0 +1,230 @@
+// SPDX-License-Identifier: GPL-2.0
+#define CREATE_TRACE_POINTS
+#include <trace/events/mmap_lock.h>
+
+#include <linux/mm.h>
+#include <linux/cgroup.h>
+#include <linux/memcontrol.h>
+#include <linux/mmap_lock.h>
+#include <linux/mutex.h>
+#include <linux/percpu.h>
+#include <linux/rcupdate.h>
+#include <linux/smp.h>
+#include <linux/trace_events.h>
+
+EXPORT_TRACEPOINT_SYMBOL(mmap_lock_start_locking);
+EXPORT_TRACEPOINT_SYMBOL(mmap_lock_acquire_returned);
+EXPORT_TRACEPOINT_SYMBOL(mmap_lock_released);
+
+#ifdef CONFIG_MEMCG
+
+/*
+ * Our various events all share the same buffer (because we don't want or need
+ * to allocate a set of buffers *per event type*), so we need to protect against
+ * concurrent _reg() and _unreg() calls, and count how many _reg() calls have
+ * been made.
+ */
+static DEFINE_MUTEX(reg_lock);
+static int reg_refcount; /* Protected by reg_lock. */
+
+/*
+ * Size of the buffer for memcg path names. Ignoring stack trace support,
+ * trace_events_hist.c uses MAX_FILTER_STR_VAL for this, so we also use it.
+ */
+#define MEMCG_PATH_BUF_SIZE MAX_FILTER_STR_VAL
+
+/*
+ * How many contexts our trace events might be called in: normal, softirq, irq,
+ * and NMI.
+ */
+#define CONTEXT_COUNT 4
+
+static DEFINE_PER_CPU(char __rcu *, memcg_path_buf);
+static char **tmp_bufs;
+static DEFINE_PER_CPU(int, memcg_path_buf_idx);
+
+/* Called with reg_lock held. */
+static void free_memcg_path_bufs(void)
+{
+ int cpu;
+ char **old = tmp_bufs;
+
+ for_each_possible_cpu(cpu) {
+ *(old++) = rcu_dereference_protected(
+ per_cpu(memcg_path_buf, cpu),
+ lockdep_is_held(®_lock));
+ rcu_assign_pointer(per_cpu(memcg_path_buf, cpu), NULL);
+ }
+
+ /* Wait for inflight memcg_path_buf users to finish. */
+ synchronize_rcu();
+
+ old = tmp_bufs;
+ for_each_possible_cpu(cpu) {
+ kfree(*(old++));
+ }
+
+ kfree(tmp_bufs);
+ tmp_bufs = NULL;
+}
+
+int trace_mmap_lock_reg(void)
+{
+ int cpu;
+ char *new;
+
+ mutex_lock(®_lock);
+
+ /* If the refcount is going 0->1, proceed with allocating buffers. */
+ if (reg_refcount++)
+ goto out;
+
+ tmp_bufs = kmalloc_array(num_possible_cpus(), sizeof(*tmp_bufs),
+ GFP_KERNEL);
+ if (tmp_bufs == NULL)
+ goto out_fail;
+
+ for_each_possible_cpu(cpu) {
+ new = kmalloc(MEMCG_PATH_BUF_SIZE * CONTEXT_COUNT, GFP_KERNEL);
+ if (new == NULL)
+ goto out_fail_free;
+ rcu_assign_pointer(per_cpu(memcg_path_buf, cpu), new);
+ /* Don't need to wait for inflights, they'd have gotten NULL. */
+ }
+
+out:
+ mutex_unlock(®_lock);
+ return 0;
+
+out_fail_free:
+ free_memcg_path_bufs();
+out_fail:
+ /* Since we failed, undo the earlier ref increment. */
+ --reg_refcount;
+
+ mutex_unlock(®_lock);
+ return -ENOMEM;
+}
+
+void trace_mmap_lock_unreg(void)
+{
+ mutex_lock(®_lock);
+
+ /* If the refcount is going 1->0, proceed with freeing buffers. */
+ if (--reg_refcount)
+ goto out;
+
+ free_memcg_path_bufs();
+
+out:
+ mutex_unlock(®_lock);
+}
+
+static inline char *get_memcg_path_buf(void)
+{
+ char *buf;
+ int idx;
+
+ rcu_read_lock();
+ buf = rcu_dereference(*this_cpu_ptr(&memcg_path_buf));
+ if (buf == NULL) {
+ rcu_read_unlock();
+ return NULL;
+ }
+ idx = this_cpu_add_return(memcg_path_buf_idx, MEMCG_PATH_BUF_SIZE) -
+ MEMCG_PATH_BUF_SIZE;
+ return &buf[idx];
+}
+
+static inline void put_memcg_path_buf(void)
+{
+ this_cpu_sub(memcg_path_buf_idx, MEMCG_PATH_BUF_SIZE);
+ rcu_read_unlock();
+}
+
+/*
+ * Write the given mm_struct's memcg path to a percpu buffer, and return a
+ * pointer to it. If the path cannot be determined, or no buffer was available
+ * (because the trace event is being unregistered), NULL is returned.
+ *
+ * Note: buffers are allocated per-cpu to avoid locking, so preemption must be
+ * disabled by the caller before calling us, and re-enabled only after the
+ * caller is done with the pointer.
+ *
+ * The caller must call put_memcg_path_buf() once the buffer is no longer
+ * needed. This must be done while preemption is still disabled.
+ */
+static const char *get_mm_memcg_path(struct mm_struct *mm)
+{
+ char *buf = NULL;
+ struct mem_cgroup *memcg = get_mem_cgroup_from_mm(mm);
+
+ if (memcg == NULL)
+ goto out;
+ if (unlikely(memcg->css.cgroup == NULL))
+ goto out_put;
+
+ buf = get_memcg_path_buf();
+ if (buf == NULL)
+ goto out_put;
+
+ cgroup_path(memcg->css.cgroup, buf, MEMCG_PATH_BUF_SIZE);
+
+out_put:
+ css_put(&memcg->css);
+out:
+ return buf;
+}
+
+#define TRACE_MMAP_LOCK_EVENT(type, mm, ...) \
+ do { \
+ const char *memcg_path; \
+ preempt_disable(); \
+ memcg_path = get_mm_memcg_path(mm); \
+ trace_mmap_lock_##type(mm, \
+ memcg_path != NULL ? memcg_path : "", \
+ ##__VA_ARGS__); \
+ if (likely(memcg_path != NULL)) \
+ put_memcg_path_buf(); \
+ preempt_enable(); \
+ } while (0)
+
+#else /* !CONFIG_MEMCG */
+
+int trace_mmap_lock_reg(void)
+{
+ return 0;
+}
+
+void trace_mmap_lock_unreg(void)
+{
+}
+
+#define TRACE_MMAP_LOCK_EVENT(type, mm, ...) \
+ trace_mmap_lock_##type(mm, "", ##__VA_ARGS__)
+
+#endif /* CONFIG_MEMCG */
+
+/*
+ * Trace calls must be in a separate file, as otherwise there's a circular
+ * dependency between linux/mmap_lock.h and trace/events/mmap_lock.h.
+ */
+
+void __mmap_lock_do_trace_start_locking(struct mm_struct *mm, bool write)
+{
+ TRACE_MMAP_LOCK_EVENT(start_locking, mm, write);
+}
+EXPORT_SYMBOL(__mmap_lock_do_trace_start_locking);
+
+void __mmap_lock_do_trace_acquire_returned(struct mm_struct *mm, bool write,
+ bool success)
+{
+ TRACE_MMAP_LOCK_EVENT(acquire_returned, mm, write, success);
+}
+EXPORT_SYMBOL(__mmap_lock_do_trace_acquire_returned);
+
+void __mmap_lock_do_trace_released(struct mm_struct *mm, bool write)
+{
+ TRACE_MMAP_LOCK_EVENT(released, mm, write);
+}
+EXPORT_SYMBOL(__mmap_lock_do_trace_released);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 082/200] sparc: fix handling of page table constructor failure
2020-12-15 3:02 incoming Andrew Morton
` (80 preceding siblings ...)
2020-12-15 3:07 ` [patch 081/200] mm: mmap_lock: add tracepoints around lock acquisition Andrew Morton
@ 2020-12-15 3:07 ` Andrew Morton
2020-12-15 3:08 ` [patch 083/200] mm: move free_unref_page to mm/internal.h Andrew Morton
` (118 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:07 UTC (permalink / raw)
To: akpm, davem, david, linux-mm, mm-commits, rppt, torvalds, vbabka,
willy
From: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Subject: sparc: fix handling of page table constructor failure
The page has just been allocated, so its refcount is 1. free_unref_page()
is for use on pages which have a zero refcount. Use __free_page() like
the other implementations of pte_alloc_one().
Link: https://lkml.kernel.org/r/20201125034655.27687-1-willy@infradead.org
Fixes: 1ae9ae5f7df7 ("sparc: handle pgtable_page_ctor() fail")
Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Reviewed-by: David Hildenbrand <david@redhat.com>
Reviewed-by: Mike Rapoport <rppt@linux.ibm.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Cc: David Miller <davem@davemloft.net>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/sparc/mm/init_64.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/arch/sparc/mm/init_64.c~sparc-fix-handling-of-page-table-constructor-failure
+++ a/arch/sparc/mm/init_64.c
@@ -2894,7 +2894,7 @@ pgtable_t pte_alloc_one(struct mm_struct
if (!page)
return NULL;
if (!pgtable_pte_page_ctor(page)) {
- free_unref_page(page);
+ __free_page(page);
return NULL;
}
return (pte_t *) page_address(page);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 083/200] mm: move free_unref_page to mm/internal.h
2020-12-15 3:02 incoming Andrew Morton
` (81 preceding siblings ...)
2020-12-15 3:07 ` [patch 082/200] sparc: fix handling of page table constructor failure Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-15 3:08 ` [patch 084/200] mm/mremap: account memory on do_munmap() failure Andrew Morton
` (117 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, david, linux-mm, mm-commits, rppt, torvalds, vbabka, willy
From: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Subject: mm: move free_unref_page to mm/internal.h
Code outside mm/ should not be calling free_unref_page(). Also move
free_unref_page_list().
Link: https://lkml.kernel.org/r/20201125034655.27687-2-willy@infradead.org
Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Reviewed-by: David Hildenbrand <david@redhat.com>
Reviewed-by: Mike Rapoport <rppt@linux.ibm.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/gfp.h | 2 --
mm/internal.h | 3 +++
2 files changed, 3 insertions(+), 2 deletions(-)
--- a/include/linux/gfp.h~mm-move-free_unref_page-to-mm-internalh
+++ a/include/linux/gfp.h
@@ -580,8 +580,6 @@ void * __meminit alloc_pages_exact_nid(i
extern void __free_pages(struct page *page, unsigned int order);
extern void free_pages(unsigned long addr, unsigned int order);
-extern void free_unref_page(struct page *page);
-extern void free_unref_page_list(struct list_head *list);
struct page_frag_cache;
extern void __page_frag_cache_drain(struct page *page, unsigned int count);
--- a/mm/internal.h~mm-move-free_unref_page-to-mm-internalh
+++ a/mm/internal.h
@@ -199,6 +199,9 @@ extern void post_alloc_hook(struct page
gfp_t gfp_flags);
extern int user_min_free_kbytes;
+extern void free_unref_page(struct page *page);
+extern void free_unref_page_list(struct list_head *list);
+
extern void zone_pcp_update(struct zone *zone);
extern void zone_pcp_reset(struct zone *zone);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 084/200] mm/mremap: account memory on do_munmap() failure
2020-12-15 3:02 incoming Andrew Morton
` (82 preceding siblings ...)
2020-12-15 3:08 ` [patch 083/200] mm: move free_unref_page to mm/internal.h Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-15 3:08 ` [patch 085/200] mm/mremap: for MREMAP_DONTUNMAP check security_vm_enough_memory_mm() Andrew Morton
` (116 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, bgeffon, catalin.marinas, dan.carpenter, dan.j.williams,
dave.jiang, dima, hughd, jgg, jhubbard, kirill.shutemov, linux-mm,
linux, luto, mike.kravetz, minchan, mingo, mm-commits, rcampbell,
tglx, torvalds, tsbogend, vbabka, viro, vishal.l.verma, will
From: Dmitry Safonov <dima@arista.com>
Subject: mm/mremap: account memory on do_munmap() failure
Patch series "mremap: move_vma() fixes".
This patch (of 6):
move_vma() copies VMA without adding it to account, then unmaps old part
of VMA. On failure it unmaps the new VMA. With hacks accounting in
munmap is disabled as it's a copy of existing VMA.
Account the memory on munmap() failure which was previously copied into
a new VMA.
Link: https://lkml.kernel.org/r/20201013013416.390574-1-dima@arista.com
Link: https://lkml.kernel.org/r/20201013013416.390574-2-dima@arista.com
Fixes: commit e2ea83742133 ("[PATCH] mremap: move_vma fixes and cleanup")
Signed-off-by: Dmitry Safonov <dima@arista.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Andy Lutomirski <luto@kernel.org>
Cc: Brian Geffon <bgeffon@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: Dave Jiang <dave.jiang@intel.com>
Cc: Hugh Dickins <hughd@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Minchan Kim <minchan@kernel.org>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vishal Verma <vishal.l.verma@intel.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Will Deacon <will@kernel.org>
Cc: Dan Carpenter <dan.carpenter@oracle.com>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/mremap.c | 3 ++-
1 file changed, 2 insertions(+), 1 deletion(-)
--- a/mm/mremap.c~mm-mremap-account-memory-on-do_munmap-failure
+++ a/mm/mremap.c
@@ -600,7 +600,8 @@ static unsigned long move_vma(struct vm_
if (do_munmap(mm, old_addr, old_len, uf_unmap) < 0) {
/* OOM: unable to split vma, just get accounts right */
- vm_unacct_memory(excess >> PAGE_SHIFT);
+ if (vm_flags & VM_ACCOUNT)
+ vm_acct_memory(new_len >> PAGE_SHIFT);
excess = 0;
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 085/200] mm/mremap: for MREMAP_DONTUNMAP check security_vm_enough_memory_mm()
2020-12-15 3:02 incoming Andrew Morton
` (83 preceding siblings ...)
2020-12-15 3:08 ` [patch 084/200] mm/mremap: account memory on do_munmap() failure Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-15 3:08 ` [patch 086/200] mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio Andrew Morton
` (115 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, bgeffon, catalin.marinas, dan.carpenter, dan.j.williams,
dave.jiang, dima, hughd, jgg, jhubbard, kirill.shutemov, linux-mm,
linux, luto, mike.kravetz, minchan, mingo, mm-commits, rcampbell,
tglx, torvalds, tsbogend, vbabka, viro, vishal.l.verma, will
From: Dmitry Safonov <dima@arista.com>
Subject: mm/mremap: for MREMAP_DONTUNMAP check security_vm_enough_memory_mm()
Currently memory is accounted post-mremap() with MREMAP_DONTUNMAP, which
may break overcommit policy. So, check if there's enough memory before
doing actual VMA copy.
Don't unset VM_ACCOUNT on MREMAP_DONTUNMAP. By semantics, such mremap()
is actually a memory allocation. That also simplifies the error-path a
little.
Also, as it's memory allocation on success don't reset hiwater_vm value.
Link: https://lkml.kernel.org/r/20201013013416.390574-3-dima@arista.com
Fixes: commit e346b3813067 ("mm/mremap: add MREMAP_DONTUNMAP to mremap()")
Signed-off-by: Dmitry Safonov <dima@arista.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Andy Lutomirski <luto@kernel.org>
Cc: Brian Geffon <bgeffon@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Dan Carpenter <dan.carpenter@oracle.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: Dave Jiang <dave.jiang@intel.com>
Cc: Hugh Dickins <hughd@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Minchan Kim <minchan@kernel.org>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vishal Verma <vishal.l.verma@intel.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/mremap.c | 36 +++++++++++++-----------------------
1 file changed, 13 insertions(+), 23 deletions(-)
--- a/mm/mremap.c~mm-mremap-for-mremap_dontunmap-check-security_vm_enough_memory_mm
+++ a/mm/mremap.c
@@ -515,11 +515,19 @@ static unsigned long move_vma(struct vm_
if (err)
return err;
+ if (unlikely(flags & MREMAP_DONTUNMAP && vm_flags & VM_ACCOUNT)) {
+ if (security_vm_enough_memory_mm(mm, new_len >> PAGE_SHIFT))
+ return -ENOMEM;
+ }
+
new_pgoff = vma->vm_pgoff + ((old_addr - vma->vm_start) >> PAGE_SHIFT);
new_vma = copy_vma(&vma, new_addr, new_len, new_pgoff,
&need_rmap_locks);
- if (!new_vma)
+ if (!new_vma) {
+ if (unlikely(flags & MREMAP_DONTUNMAP && vm_flags & VM_ACCOUNT))
+ vm_unacct_memory(new_len >> PAGE_SHIFT);
return -ENOMEM;
+ }
moved_len = move_page_tables(vma, old_addr, new_vma, new_addr, old_len,
need_rmap_locks);
@@ -548,7 +556,7 @@ static unsigned long move_vma(struct vm_
}
/* Conceal VM_ACCOUNT so old reservation is not undone */
- if (vm_flags & VM_ACCOUNT) {
+ if (vm_flags & VM_ACCOUNT && !(flags & MREMAP_DONTUNMAP)) {
vma->vm_flags &= ~VM_ACCOUNT;
excess = vma->vm_end - vma->vm_start - old_len;
if (old_addr > vma->vm_start &&
@@ -573,34 +581,16 @@ static unsigned long move_vma(struct vm_
untrack_pfn_moved(vma);
if (unlikely(!err && (flags & MREMAP_DONTUNMAP))) {
- if (vm_flags & VM_ACCOUNT) {
- /* Always put back VM_ACCOUNT since we won't unmap */
- vma->vm_flags |= VM_ACCOUNT;
-
- vm_acct_memory(new_len >> PAGE_SHIFT);
- }
-
- /*
- * VMAs can actually be merged back together in copy_vma
- * calling merge_vma. This can happen with anonymous vmas
- * which have not yet been faulted, so if we were to consider
- * this VMA split we'll end up adding VM_ACCOUNT on the
- * next VMA, which is completely unrelated if this VMA
- * was re-merged.
- */
- if (split && new_vma == vma)
- split = 0;
-
/* We always clear VM_LOCKED[ONFAULT] on the old vma */
vma->vm_flags &= VM_LOCKED_CLEAR_MASK;
/* Because we won't unmap we don't need to touch locked_vm */
- goto out;
+ return new_addr;
}
if (do_munmap(mm, old_addr, old_len, uf_unmap) < 0) {
/* OOM: unable to split vma, just get accounts right */
- if (vm_flags & VM_ACCOUNT)
+ if (vm_flags & VM_ACCOUNT && !(flags & MREMAP_DONTUNMAP))
vm_acct_memory(new_len >> PAGE_SHIFT);
excess = 0;
}
@@ -609,7 +599,7 @@ static unsigned long move_vma(struct vm_
mm->locked_vm += new_len >> PAGE_SHIFT;
*locked = true;
}
-out:
+
mm->hiwater_vm = hiwater_vm;
/* Restore VM_ACCOUNT if one or two pieces of vma left */
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 086/200] mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio
2020-12-15 3:02 incoming Andrew Morton
` (84 preceding siblings ...)
2020-12-15 3:08 ` [patch 085/200] mm/mremap: for MREMAP_DONTUNMAP check security_vm_enough_memory_mm() Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-28 17:59 ` Brian Geffon
2020-12-15 3:08 ` [patch 087/200] vm_ops: rename .split() callback to .may_split() Andrew Morton
` (114 subsequent siblings)
200 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, bgeffon, catalin.marinas, dan.carpenter, dan.j.williams,
dave.jiang, dima, hughd, jgg, jhubbard, kirill.shutemov, linux-mm,
linux, luto, mike.kravetz, minchan, mingo, mm-commits, rcampbell,
tglx, torvalds, tsbogend, vbabka, viro, vishal.l.verma, will
From: Dmitry Safonov <dima@arista.com>
Subject: mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio
As kernel expect to see only one of such mappings, any further operations
on the VMA-copy may be unexpected by the kernel. Maybe it's being on the
safe side, but there doesn't seem to be any expected use-case for this, so
restrict it now.
Link: https://lkml.kernel.org/r/20201013013416.390574-4-dima@arista.com
Fixes: commit e346b3813067 ("mm/mremap: add MREMAP_DONTUNMAP to mremap()")
Signed-off-by: Dmitry Safonov <dima@arista.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Andy Lutomirski <luto@kernel.org>
Cc: Brian Geffon <bgeffon@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Dan Carpenter <dan.carpenter@oracle.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: Dave Jiang <dave.jiang@intel.com>
Cc: Hugh Dickins <hughd@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Minchan Kim <minchan@kernel.org>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vishal Verma <vishal.l.verma@intel.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 2 +-
fs/aio.c | 5 ++++-
include/linux/mm.h | 2 +-
mm/mmap.c | 6 +++++-
mm/mremap.c | 2 +-
5 files changed, 12 insertions(+), 5 deletions(-)
--- a/arch/x86/kernel/cpu/resctrl/pseudo_lock.c~mremap-dont-allow-mremap_dontunmap-on-special_mappings-and-aio
+++ a/arch/x86/kernel/cpu/resctrl/pseudo_lock.c
@@ -1458,7 +1458,7 @@ static int pseudo_lock_dev_release(struc
return 0;
}
-static int pseudo_lock_dev_mremap(struct vm_area_struct *area)
+static int pseudo_lock_dev_mremap(struct vm_area_struct *area, unsigned long flags)
{
/* Not supported */
return -EINVAL;
--- a/fs/aio.c~mremap-dont-allow-mremap_dontunmap-on-special_mappings-and-aio
+++ a/fs/aio.c
@@ -324,13 +324,16 @@ static void aio_free_ring(struct kioctx
}
}
-static int aio_ring_mremap(struct vm_area_struct *vma)
+static int aio_ring_mremap(struct vm_area_struct *vma, unsigned long flags)
{
struct file *file = vma->vm_file;
struct mm_struct *mm = vma->vm_mm;
struct kioctx_table *table;
int i, res = -EINVAL;
+ if (flags & MREMAP_DONTUNMAP)
+ return -EINVAL;
+
spin_lock(&mm->ioctx_lock);
rcu_read_lock();
table = rcu_dereference(mm->ioctx_table);
--- a/include/linux/mm.h~mremap-dont-allow-mremap_dontunmap-on-special_mappings-and-aio
+++ a/include/linux/mm.h
@@ -558,7 +558,7 @@ struct vm_operations_struct {
void (*open)(struct vm_area_struct * area);
void (*close)(struct vm_area_struct * area);
int (*split)(struct vm_area_struct * area, unsigned long addr);
- int (*mremap)(struct vm_area_struct * area);
+ int (*mremap)(struct vm_area_struct *area, unsigned long flags);
vm_fault_t (*fault)(struct vm_fault *vmf);
vm_fault_t (*huge_fault)(struct vm_fault *vmf,
enum page_entry_size pe_size);
--- a/mm/mmap.c~mremap-dont-allow-mremap_dontunmap-on-special_mappings-and-aio
+++ a/mm/mmap.c
@@ -3405,10 +3405,14 @@ static const char *special_mapping_name(
return ((struct vm_special_mapping *)vma->vm_private_data)->name;
}
-static int special_mapping_mremap(struct vm_area_struct *new_vma)
+static int special_mapping_mremap(struct vm_area_struct *new_vma,
+ unsigned long flags)
{
struct vm_special_mapping *sm = new_vma->vm_private_data;
+ if (flags & MREMAP_DONTUNMAP)
+ return -EINVAL;
+
if (WARN_ON_ONCE(current->mm != new_vma->vm_mm))
return -EFAULT;
--- a/mm/mremap.c~mremap-dont-allow-mremap_dontunmap-on-special_mappings-and-aio
+++ a/mm/mremap.c
@@ -534,7 +534,7 @@ static unsigned long move_vma(struct vm_
if (moved_len < old_len) {
err = -ENOMEM;
} else if (vma->vm_ops && vma->vm_ops->mremap) {
- err = vma->vm_ops->mremap(new_vma);
+ err = vma->vm_ops->mremap(new_vma, flags);
}
if (unlikely(err)) {
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 087/200] vm_ops: rename .split() callback to .may_split()
2020-12-15 3:02 incoming Andrew Morton
` (85 preceding siblings ...)
2020-12-15 3:08 ` [patch 086/200] mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-15 3:08 ` [patch 088/200] mremap: check if it's possible to split original vma Andrew Morton
` (113 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, bgeffon, catalin.marinas, dan.carpenter, dan.j.williams,
dave.jiang, dima, hughd, jgg, jhubbard, kirill.shutemov, linux-mm,
linux, luto, mike.kravetz, minchan, mingo, mm-commits, rcampbell,
tglx, torvalds, tsbogend, vbabka, viro, vishal.l.verma, will
From: Dmitry Safonov <dima@arista.com>
Subject: vm_ops: rename .split() callback to .may_split()
Rename the callback to reflect that it's not called *on* or *after* split,
but rather some time before the splitting to check if it's possible.
Link: https://lkml.kernel.org/r/20201013013416.390574-5-dima@arista.com
Signed-off-by: Dmitry Safonov <dima@arista.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Andy Lutomirski <luto@kernel.org>
Cc: Brian Geffon <bgeffon@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Dan Carpenter <dan.carpenter@oracle.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: Dave Jiang <dave.jiang@intel.com>
Cc: Hugh Dickins <hughd@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Minchan Kim <minchan@kernel.org>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vishal Verma <vishal.l.verma@intel.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/dax/device.c | 4 ++--
include/linux/mm.h | 3 ++-
ipc/shm.c | 8 ++++----
mm/hugetlb.c | 2 +-
mm/mmap.c | 4 ++--
5 files changed, 11 insertions(+), 10 deletions(-)
--- a/drivers/dax/device.c~vm_ops-rename-split-callback-to-may_split
+++ a/drivers/dax/device.c
@@ -256,7 +256,7 @@ static vm_fault_t dev_dax_fault(struct v
return dev_dax_huge_fault(vmf, PE_SIZE_PTE);
}
-static int dev_dax_split(struct vm_area_struct *vma, unsigned long addr)
+static int dev_dax_may_split(struct vm_area_struct *vma, unsigned long addr)
{
struct file *filp = vma->vm_file;
struct dev_dax *dev_dax = filp->private_data;
@@ -277,7 +277,7 @@ static unsigned long dev_dax_pagesize(st
static const struct vm_operations_struct dax_vm_ops = {
.fault = dev_dax_fault,
.huge_fault = dev_dax_huge_fault,
- .split = dev_dax_split,
+ .may_split = dev_dax_may_split,
.pagesize = dev_dax_pagesize,
};
--- a/include/linux/mm.h~vm_ops-rename-split-callback-to-may_split
+++ a/include/linux/mm.h
@@ -557,7 +557,8 @@ enum page_entry_size {
struct vm_operations_struct {
void (*open)(struct vm_area_struct * area);
void (*close)(struct vm_area_struct * area);
- int (*split)(struct vm_area_struct * area, unsigned long addr);
+ /* Called any time before splitting to check if it's allowed */
+ int (*may_split)(struct vm_area_struct *area, unsigned long addr);
int (*mremap)(struct vm_area_struct *area, unsigned long flags);
vm_fault_t (*fault)(struct vm_fault *vmf);
vm_fault_t (*huge_fault)(struct vm_fault *vmf,
--- a/ipc/shm.c~vm_ops-rename-split-callback-to-may_split
+++ a/ipc/shm.c
@@ -434,13 +434,13 @@ static vm_fault_t shm_fault(struct vm_fa
return sfd->vm_ops->fault(vmf);
}
-static int shm_split(struct vm_area_struct *vma, unsigned long addr)
+static int shm_may_split(struct vm_area_struct *vma, unsigned long addr)
{
struct file *file = vma->vm_file;
struct shm_file_data *sfd = shm_file_data(file);
- if (sfd->vm_ops->split)
- return sfd->vm_ops->split(vma, addr);
+ if (sfd->vm_ops->may_split)
+ return sfd->vm_ops->may_split(vma, addr);
return 0;
}
@@ -582,7 +582,7 @@ static const struct vm_operations_struct
.open = shm_open, /* callback for a new vm-area open */
.close = shm_close, /* callback for when the vm-area is released */
.fault = shm_fault,
- .split = shm_split,
+ .may_split = shm_may_split,
.pagesize = shm_pagesize,
#if defined(CONFIG_NUMA)
.set_policy = shm_set_policy,
--- a/mm/hugetlb.c~vm_ops-rename-split-callback-to-may_split
+++ a/mm/hugetlb.c
@@ -3673,7 +3673,7 @@ const struct vm_operations_struct hugetl
.fault = hugetlb_vm_op_fault,
.open = hugetlb_vm_op_open,
.close = hugetlb_vm_op_close,
- .split = hugetlb_vm_op_split,
+ .may_split = hugetlb_vm_op_split,
.pagesize = hugetlb_vm_op_pagesize,
};
--- a/mm/mmap.c~vm_ops-rename-split-callback-to-may_split
+++ a/mm/mmap.c
@@ -2731,8 +2731,8 @@ int __split_vma(struct mm_struct *mm, st
struct vm_area_struct *new;
int err;
- if (vma->vm_ops && vma->vm_ops->split) {
- err = vma->vm_ops->split(vma, addr);
+ if (vma->vm_ops && vma->vm_ops->may_split) {
+ err = vma->vm_ops->may_split(vma, addr);
if (err)
return err;
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 088/200] mremap: check if it's possible to split original vma
2020-12-15 3:02 incoming Andrew Morton
` (86 preceding siblings ...)
2020-12-15 3:08 ` [patch 087/200] vm_ops: rename .split() callback to .may_split() Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-15 3:08 ` [patch 089/200] mm: forbid splitting special mappings Andrew Morton
` (112 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, bgeffon, catalin.marinas, dan.carpenter, dan.j.williams,
dave.jiang, dima, hughd, jgg, jhubbard, kirill.shutemov, linux-mm,
linux, luto, mike.kravetz, minchan, mingo, mm-commits, rcampbell,
tglx, torvalds, tsbogend, vbabka, viro, vishal.l.verma, will
From: Dmitry Safonov <dima@arista.com>
Subject: mremap: check if it's possible to split original vma
If original VMA can't be split at the desired address, do_munmap() will
fail and leave both new-copied VMA and old VMA. De-facto it's
MREMAP_DONTUNMAP behaviour, which is unexpected.
Currently, it may fail such way for hugetlbfs and dax device mappings.
Minimize such unpleasant situations to OOM by checking .may_split() before
attempting to create a VMA copy.
Link: https://lkml.kernel.org/r/20201013013416.390574-6-dima@arista.com
Signed-off-by: Dmitry Safonov <dima@arista.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Andy Lutomirski <luto@kernel.org>
Cc: Brian Geffon <bgeffon@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Dan Carpenter <dan.carpenter@oracle.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: Dave Jiang <dave.jiang@intel.com>
Cc: Hugh Dickins <hughd@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Minchan Kim <minchan@kernel.org>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vishal Verma <vishal.l.verma@intel.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/mremap.c | 11 ++++++++++-
1 file changed, 10 insertions(+), 1 deletion(-)
--- a/mm/mremap.c~mremap-check-if-its-possible-to-split-original-vma
+++ a/mm/mremap.c
@@ -493,7 +493,7 @@ static unsigned long move_vma(struct vm_
unsigned long excess = 0;
unsigned long hiwater_vm;
int split = 0;
- int err;
+ int err = 0;
bool need_rmap_locks;
/*
@@ -503,6 +503,15 @@ static unsigned long move_vma(struct vm_
if (mm->map_count >= sysctl_max_map_count - 3)
return -ENOMEM;
+ if (vma->vm_ops && vma->vm_ops->may_split) {
+ if (vma->vm_start != old_addr)
+ err = vma->vm_ops->may_split(vma, old_addr);
+ if (!err && vma->vm_end != old_addr + old_len)
+ err = vma->vm_ops->may_split(vma, old_addr + old_len);
+ if (err)
+ return err;
+ }
+
/*
* Advise KSM to break any KSM pages in the area to be moved:
* it would be confusing if they were to turn up at the new
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 089/200] mm: forbid splitting special mappings
2020-12-15 3:02 incoming Andrew Morton
` (87 preceding siblings ...)
2020-12-15 3:08 ` [patch 088/200] mremap: check if it's possible to split original vma Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-15 3:08 ` [patch 090/200] mm: track mmu notifiers in fs_reclaim_acquire/release Andrew Morton
` (111 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, bgeffon, catalin.marinas, dan.carpenter, dan.j.williams,
dave.jiang, dima, hughd, jgg, jhubbard, kirill.shutemov, linux-mm,
linux, luto, mike.kravetz, minchan, mingo, mm-commits, rcampbell,
tglx, torvalds, tsbogend, vbabka, viro, vishal.l.verma, will
From: Dmitry Safonov <dima@arista.com>
Subject: mm: forbid splitting special mappings
Don't allow splitting of vm_special_mapping's. It affects vdso/vvar
areas. Uprobes have only one page in xol_area so they aren't affected.
Those restrictions were enforced by checks in .mremap() callbacks.
Restrict resizing with generic .split() callback.
Link: https://lkml.kernel.org/r/20201013013416.390574-7-dima@arista.com
Signed-off-by: Dmitry Safonov <dima@arista.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Andy Lutomirski <luto@kernel.org>
Cc: Brian Geffon <bgeffon@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Dan Carpenter <dan.carpenter@oracle.com>
Cc: Dan Williams <dan.j.williams@intel.com>
Cc: Dave Jiang <dave.jiang@intel.com>
Cc: Hugh Dickins <hughd@google.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jason Gunthorpe <jgg@ziepe.ca>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Minchan Kim <minchan@kernel.org>
Cc: Ralph Campbell <rcampbell@nvidia.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vishal Verma <vishal.l.verma@intel.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/arm/kernel/vdso.c | 9 -------
arch/arm64/kernel/vdso.c | 41 +++---------------------------------
arch/mips/vdso/genvdso.c | 4 ---
arch/s390/kernel/vdso.c | 11 ---------
arch/x86/entry/vdso/vma.c | 17 --------------
mm/mmap.c | 12 ++++++++++
6 files changed, 17 insertions(+), 77 deletions(-)
--- a/arch/arm64/kernel/vdso.c~mm-forbid-splitting-special-mappings
+++ a/arch/arm64/kernel/vdso.c
@@ -78,17 +78,9 @@ static union {
} vdso_data_store __page_aligned_data;
struct vdso_data *vdso_data = vdso_data_store.data;
-static int __vdso_remap(enum vdso_abi abi,
- const struct vm_special_mapping *sm,
- struct vm_area_struct *new_vma)
-{
- unsigned long new_size = new_vma->vm_end - new_vma->vm_start;
- unsigned long vdso_size = vdso_info[abi].vdso_code_end -
- vdso_info[abi].vdso_code_start;
-
- if (vdso_size != new_size)
- return -EINVAL;
-
+static int vdso_mremap(const struct vm_special_mapping *sm,
+ struct vm_area_struct *new_vma)
+{
current->mm->context.vdso = (void *)new_vma->vm_start;
return 0;
@@ -219,17 +211,6 @@ static vm_fault_t vvar_fault(const struc
return vmf_insert_pfn(vma, vmf->address, pfn);
}
-static int vvar_mremap(const struct vm_special_mapping *sm,
- struct vm_area_struct *new_vma)
-{
- unsigned long new_size = new_vma->vm_end - new_vma->vm_start;
-
- if (new_size != VVAR_NR_PAGES * PAGE_SIZE)
- return -EINVAL;
-
- return 0;
-}
-
static int __setup_additional_pages(enum vdso_abi abi,
struct mm_struct *mm,
struct linux_binprm *bprm,
@@ -280,12 +261,6 @@ up_fail:
/*
* Create and map the vectors page for AArch32 tasks.
*/
-static int aarch32_vdso_mremap(const struct vm_special_mapping *sm,
- struct vm_area_struct *new_vma)
-{
- return __vdso_remap(VDSO_ABI_AA32, sm, new_vma);
-}
-
enum aarch32_map {
AA32_MAP_VECTORS, /* kuser helpers */
AA32_MAP_SIGPAGE,
@@ -308,11 +283,10 @@ static struct vm_special_mapping aarch32
[AA32_MAP_VVAR] = {
.name = "[vvar]",
.fault = vvar_fault,
- .mremap = vvar_mremap,
},
[AA32_MAP_VDSO] = {
.name = "[vdso]",
- .mremap = aarch32_vdso_mremap,
+ .mremap = vdso_mremap,
},
};
@@ -453,12 +427,6 @@ out:
}
#endif /* CONFIG_COMPAT */
-static int vdso_mremap(const struct vm_special_mapping *sm,
- struct vm_area_struct *new_vma)
-{
- return __vdso_remap(VDSO_ABI_AA64, sm, new_vma);
-}
-
enum aarch64_map {
AA64_MAP_VVAR,
AA64_MAP_VDSO,
@@ -468,7 +436,6 @@ static struct vm_special_mapping aarch64
[AA64_MAP_VVAR] = {
.name = "[vvar]",
.fault = vvar_fault,
- .mremap = vvar_mremap,
},
[AA64_MAP_VDSO] = {
.name = "[vdso]",
--- a/arch/arm/kernel/vdso.c~mm-forbid-splitting-special-mappings
+++ a/arch/arm/kernel/vdso.c
@@ -50,15 +50,6 @@ static const struct vm_special_mapping v
static int vdso_mremap(const struct vm_special_mapping *sm,
struct vm_area_struct *new_vma)
{
- unsigned long new_size = new_vma->vm_end - new_vma->vm_start;
- unsigned long vdso_size;
-
- /* without VVAR page */
- vdso_size = (vdso_total_pages - 1) << PAGE_SHIFT;
-
- if (vdso_size != new_size)
- return -EINVAL;
-
current->mm->context.vdso = new_vma->vm_start;
return 0;
--- a/arch/mips/vdso/genvdso.c~mm-forbid-splitting-special-mappings
+++ a/arch/mips/vdso/genvdso.c
@@ -263,10 +263,6 @@ int main(int argc, char **argv)
fprintf(out_file, " const struct vm_special_mapping *sm,\n");
fprintf(out_file, " struct vm_area_struct *new_vma)\n");
fprintf(out_file, "{\n");
- fprintf(out_file, " unsigned long new_size =\n");
- fprintf(out_file, " new_vma->vm_end - new_vma->vm_start;\n");
- fprintf(out_file, " if (vdso_image.size != new_size)\n");
- fprintf(out_file, " return -EINVAL;\n");
fprintf(out_file, " current->mm->context.vdso =\n");
fprintf(out_file, " (void *)(new_vma->vm_start);\n");
fprintf(out_file, " return 0;\n");
--- a/arch/s390/kernel/vdso.c~mm-forbid-splitting-special-mappings
+++ a/arch/s390/kernel/vdso.c
@@ -61,17 +61,8 @@ static vm_fault_t vdso_fault(const struc
static int vdso_mremap(const struct vm_special_mapping *sm,
struct vm_area_struct *vma)
{
- unsigned long vdso_pages;
-
- vdso_pages = vdso64_pages;
-
- if ((vdso_pages << PAGE_SHIFT) != vma->vm_end - vma->vm_start)
- return -EINVAL;
-
- if (WARN_ON_ONCE(current->mm != vma->vm_mm))
- return -EFAULT;
-
current->mm->context.vdso_base = vma->vm_start;
+
return 0;
}
--- a/arch/x86/entry/vdso/vma.c~mm-forbid-splitting-special-mappings
+++ a/arch/x86/entry/vdso/vma.c
@@ -89,30 +89,14 @@ static void vdso_fix_landing(const struc
static int vdso_mremap(const struct vm_special_mapping *sm,
struct vm_area_struct *new_vma)
{
- unsigned long new_size = new_vma->vm_end - new_vma->vm_start;
const struct vdso_image *image = current->mm->context.vdso_image;
- if (image->size != new_size)
- return -EINVAL;
-
vdso_fix_landing(image, new_vma);
current->mm->context.vdso = (void __user *)new_vma->vm_start;
return 0;
}
-static int vvar_mremap(const struct vm_special_mapping *sm,
- struct vm_area_struct *new_vma)
-{
- const struct vdso_image *image = new_vma->vm_mm->context.vdso_image;
- unsigned long new_size = new_vma->vm_end - new_vma->vm_start;
-
- if (new_size != -image->sym_vvar_start)
- return -EINVAL;
-
- return 0;
-}
-
#ifdef CONFIG_TIME_NS
static struct page *find_timens_vvar_page(struct vm_area_struct *vma)
{
@@ -252,7 +236,6 @@ static const struct vm_special_mapping v
static const struct vm_special_mapping vvar_mapping = {
.name = "[vvar]",
.fault = vvar_fault,
- .mremap = vvar_mremap,
};
/*
--- a/mm/mmap.c~mm-forbid-splitting-special-mappings
+++ a/mm/mmap.c
@@ -3422,6 +3422,17 @@ static int special_mapping_mremap(struct
return 0;
}
+static int special_mapping_split(struct vm_area_struct *vma, unsigned long addr)
+{
+ /*
+ * Forbid splitting special mappings - kernel has expectations over
+ * the number of pages in mapping. Together with VM_DONTEXPAND
+ * the size of vma should stay the same over the special mapping's
+ * lifetime.
+ */
+ return -EINVAL;
+}
+
static const struct vm_operations_struct special_mapping_vmops = {
.close = special_mapping_close,
.fault = special_mapping_fault,
@@ -3429,6 +3440,7 @@ static const struct vm_operations_struct
.name = special_mapping_name,
/* vDSO code relies that VVAR can't be accessed remotely */
.access = NULL,
+ .may_split = special_mapping_split,
};
static const struct vm_operations_struct legacy_special_mapping_vmops = {
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 090/200] mm: track mmu notifiers in fs_reclaim_acquire/release
2020-12-15 3:02 incoming Andrew Morton
` (88 preceding siblings ...)
2020-12-15 3:08 ` [patch 089/200] mm: forbid splitting special mappings Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-15 3:08 ` [patch 091/200] mm: extract might_alloc() debug check Andrew Morton
` (110 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, bigeasy, cai, christian.koenig, cl, daniel.vetter,
daniel.vetter, david, iamjoonsoo.kim, jgg, jgg, linux-mm, longman,
maarten.lankhorst, mathieu.desnoyers, mingo, mingo, mm-commits,
paulmck, penberg, peterz, rdunlap, rientjes, tglx, thomas_os,
torvalds, vbabka, walken, will, willy
From: Daniel Vetter <daniel.vetter@ffwll.ch>
Subject: mm: track mmu notifiers in fs_reclaim_acquire/release
fs_reclaim_acquire/release nicely catch recursion issues when allocating
GFP_KERNEL memory against shrinkers (which gpu drivers tend to use to keep
the excessive caches in check). For mmu notifier recursions we do have
lockdep annotations since 23b68395c7c7 ("mm/mmu_notifiers: add a lockdep
map for invalidate_range_start/end").
But these only fire if a path actually results in some pte invalidation -
for most small allocations that's very rarely the case. The other trouble
is that pte invalidation can happen any time when __GFP_RECLAIM is set.
Which means only really GFP_ATOMIC is a safe choice, GFP_NOIO isn't good
enough to avoid potential mmu notifier recursion.
I was pondering whether we should just do the general annotation, but
there's always the risk for false positives. Plus I'm assuming that the
core fs and io code is a lot better reviewed and tested than random mmu
notifier code in drivers. Hence why I decide to only annotate for that
specific case.
Furthermore even if we'd create a lockdep map for direct reclaim, we'd
still need to explicit pull in the mmu notifier map - there's a lot more
places that do pte invalidation than just direct reclaim, these two
contexts arent the same.
Note that the mmu notifiers needing their own independent lockdep map is
also the reason we can't hold them from fs_reclaim_acquire to
fs_reclaim_release - it would nest with the acquistion in the pte
invalidation code, causing a lockdep splat. And we can't remove the
annotations from pte invalidation and all the other places since they're
called from many other places than page reclaim. Hence we can only do the
equivalent of might_lock, but on the raw lockdep map.
With this we can also remove the lockdep priming added in 66204f1d2d1b
("mm/mmu_notifiers: prime lockdep") since the new annotations are strictly
more powerful.
Link: https://lkml.kernel.org/r/20201125162532.1299794-2-daniel.vetter@ffwll.ch
Signed-off-by: Daniel Vetter <daniel.vetter@intel.com>
Reviewed-by: Jason Gunthorpe <jgg@nvidia.com>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Qian Cai <cai@lca.pw>
Cc: Thomas Hellström (Intel) <thomas_os@shipmail.org>
Cc: Jason Gunthorpe <jgg@mellanox.com>
Cc: Maarten Lankhorst <maarten.lankhorst@linux.intel.com>
Cc: Christian König <christian.koenig@amd.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Christoph Lameter <cl@linux.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@kernel.org>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Mathieu Desnoyers <mathieu.desnoyers@efficios.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Paul E. McKenney <paulmck@kernel.org>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Peter Zijlstra (Intel) <peterz@infradead.org>
Cc: Randy Dunlap <rdunlap@infradead.org>
Cc: Sebastian Andrzej Siewior <bigeasy@linutronix.de>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Waiman Long <longman@redhat.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/mmu_notifier.c | 7 -------
mm/page_alloc.c | 31 ++++++++++++++++++++-----------
2 files changed, 20 insertions(+), 18 deletions(-)
--- a/mm/mmu_notifier.c~mm-track-mmu-notifiers-in-fs_reclaim_acquire-release
+++ a/mm/mmu_notifier.c
@@ -612,13 +612,6 @@ int __mmu_notifier_register(struct mmu_n
mmap_assert_write_locked(mm);
BUG_ON(atomic_read(&mm->mm_users) <= 0);
- if (IS_ENABLED(CONFIG_LOCKDEP)) {
- fs_reclaim_acquire(GFP_KERNEL);
- lock_map_acquire(&__mmu_notifier_invalidate_range_start_map);
- lock_map_release(&__mmu_notifier_invalidate_range_start_map);
- fs_reclaim_release(GFP_KERNEL);
- }
-
if (!mm->notifier_subscriptions) {
/*
* kmalloc cannot be called under mm_take_all_locks(), but we
--- a/mm/page_alloc.c~mm-track-mmu-notifiers-in-fs_reclaim_acquire-release
+++ a/mm/page_alloc.c
@@ -57,6 +57,7 @@
#include <trace/events/oom.h>
#include <linux/prefetch.h>
#include <linux/mm_inline.h>
+#include <linux/mmu_notifier.h>
#include <linux/migrate.h>
#include <linux/hugetlb.h>
#include <linux/sched/rt.h>
@@ -4264,10 +4265,8 @@ should_compact_retry(struct alloc_contex
static struct lockdep_map __fs_reclaim_map =
STATIC_LOCKDEP_MAP_INIT("fs_reclaim", &__fs_reclaim_map);
-static bool __need_fs_reclaim(gfp_t gfp_mask)
+static bool __need_reclaim(gfp_t gfp_mask)
{
- gfp_mask = current_gfp_context(gfp_mask);
-
/* no reclaim without waiting on it */
if (!(gfp_mask & __GFP_DIRECT_RECLAIM))
return false;
@@ -4276,10 +4275,6 @@ static bool __need_fs_reclaim(gfp_t gfp_
if (current->flags & PF_MEMALLOC)
return false;
- /* We're only interested __GFP_FS allocations for now */
- if (!(gfp_mask & __GFP_FS))
- return false;
-
if (gfp_mask & __GFP_NOLOCKDEP)
return false;
@@ -4298,15 +4293,29 @@ void __fs_reclaim_release(void)
void fs_reclaim_acquire(gfp_t gfp_mask)
{
- if (__need_fs_reclaim(gfp_mask))
- __fs_reclaim_acquire();
+ gfp_mask = current_gfp_context(gfp_mask);
+
+ if (__need_reclaim(gfp_mask)) {
+ if (gfp_mask & __GFP_FS)
+ __fs_reclaim_acquire();
+
+#ifdef CONFIG_MMU_NOTIFIER
+ lock_map_acquire(&__mmu_notifier_invalidate_range_start_map);
+ lock_map_release(&__mmu_notifier_invalidate_range_start_map);
+#endif
+
+ }
}
EXPORT_SYMBOL_GPL(fs_reclaim_acquire);
void fs_reclaim_release(gfp_t gfp_mask)
{
- if (__need_fs_reclaim(gfp_mask))
- __fs_reclaim_release();
+ gfp_mask = current_gfp_context(gfp_mask);
+
+ if (__need_reclaim(gfp_mask)) {
+ if (gfp_mask & __GFP_FS)
+ __fs_reclaim_release();
+ }
}
EXPORT_SYMBOL_GPL(fs_reclaim_release);
#endif
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 091/200] mm: extract might_alloc() debug check
2020-12-15 3:02 incoming Andrew Morton
` (89 preceding siblings ...)
2020-12-15 3:08 ` [patch 090/200] mm: track mmu notifiers in fs_reclaim_acquire/release Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-15 3:08 ` [patch 092/200] locking/selftests: add testcases for fs_reclaim Andrew Morton
` (109 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, bigeasy, cai, christian.koenig, cl, daniel.vetter,
daniel.vetter, david, iamjoonsoo.kim, jgg, jgg, linux-mm, longman,
maarten.lankhorst, mathieu.desnoyers, mingo, mingo, mm-commits,
paulmck, penberg, peterz, rdunlap, rientjes, tglx, thomas_os,
torvalds, vbabka, walken, will, willy
From: Daniel Vetter <daniel.vetter@ffwll.ch>
Subject: mm: extract might_alloc() debug check
Extracted from slab.h, which seems to have the most complete version
including the correct might_sleep() check. Roll it out to slob.c.
Motivated by a discussion with Paul about possibly changing call_rcu
behaviour to allocate memory, but only roughly every 500th call.
There are a lot fewer places in the kernel that care about whether
allocating memory is allowed or not (due to deadlocks with reclaim code)
than places that care whether sleeping is allowed. But debugging these
also tends to be a lot harder, so nice descriptive checks could come in
handy. I might have some use eventually for annotations in drivers/gpu.
Note that unlike fs_reclaim_acquire/release gfpflags_allow_blocking does
not consult the PF_MEMALLOC flags. But there is no flag equivalent for
GFP_NOWAIT, hence this check can't go wrong due to
memalloc_no*_save/restore contexts. Willy is working on a patch series
which might change this:
https://lore.kernel.org/linux-mm/20200625113122.7540-7-willy@infradead.org/
I think best would be if that updates gfpflags_allow_blocking(), since
there's a ton of callers all over the place for that already.
Link: https://lkml.kernel.org/r/20201125162532.1299794-3-daniel.vetter@ffwll.ch
Signed-off-by: Daniel Vetter <daniel.vetter@intel.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Paul E. McKenney <paulmck@kernel.org>
Reviewed-by: Jason Gunthorpe <jgg@nvidia.com>
Cc. Randy Dunlap <rdunlap@infradead.org>
Cc: Paul E. McKenney <paulmck@kernel.org>
Cc: Christoph Lameter <cl@linux.com>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: David Rientjes <rientjes@google.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Ingo Molnar <mingo@kernel.org>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Mathieu Desnoyers <mathieu.desnoyers@efficios.com>
Cc: Sebastian Andrzej Siewior <bigeasy@linutronix.de>
Cc: Michel Lespinasse <walken@google.com>
Cc: Daniel Vetter <daniel.vetter@ffwll.ch>
Cc: Waiman Long <longman@redhat.com>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Randy Dunlap <rdunlap@infradead.org>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Qian Cai <cai@lca.pw>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Christian König <christian.koenig@amd.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Jason Gunthorpe <jgg@mellanox.com>
Cc: Maarten Lankhorst <maarten.lankhorst@linux.intel.com>
Cc: Thomas Hellström (Intel) <thomas_os@shipmail.org>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/sched/mm.h | 16 ++++++++++++++++
mm/slab.h | 5 +----
mm/slob.c | 6 ++----
3 files changed, 19 insertions(+), 8 deletions(-)
--- a/include/linux/sched/mm.h~mm-extract-might_alloc-debug-check
+++ a/include/linux/sched/mm.h
@@ -181,6 +181,22 @@ static inline void fs_reclaim_release(gf
#endif
/**
+ * might_alloc - Mark possible allocation sites
+ * @gfp_mask: gfp_t flags that would be used to allocate
+ *
+ * Similar to might_sleep() and other annotations, this can be used in functions
+ * that might allocate, but often don't. Compiles to nothing without
+ * CONFIG_LOCKDEP. Includes a conditional might_sleep() if @gfp allows blocking.
+ */
+static inline void might_alloc(gfp_t gfp_mask)
+{
+ fs_reclaim_acquire(gfp_mask);
+ fs_reclaim_release(gfp_mask);
+
+ might_sleep_if(gfpflags_allow_blocking(gfp_mask));
+}
+
+/**
* memalloc_noio_save - Marks implicit GFP_NOIO allocation scope.
*
* This functions marks the beginning of the GFP_NOIO allocation scope.
--- a/mm/slab.h~mm-extract-might_alloc-debug-check
+++ a/mm/slab.h
@@ -510,10 +510,7 @@ static inline struct kmem_cache *slab_pr
{
flags &= gfp_allowed_mask;
- fs_reclaim_acquire(flags);
- fs_reclaim_release(flags);
-
- might_sleep_if(gfpflags_allow_blocking(flags));
+ might_alloc(flags);
if (should_failslab(s, flags))
return NULL;
--- a/mm/slob.c~mm-extract-might_alloc-debug-check
+++ a/mm/slob.c
@@ -474,8 +474,7 @@ __do_kmalloc_node(size_t size, gfp_t gfp
gfp &= gfp_allowed_mask;
- fs_reclaim_acquire(gfp);
- fs_reclaim_release(gfp);
+ might_alloc(gfp);
if (size < PAGE_SIZE - minalign) {
int align = minalign;
@@ -597,8 +596,7 @@ static void *slob_alloc_node(struct kmem
flags &= gfp_allowed_mask;
- fs_reclaim_acquire(flags);
- fs_reclaim_release(flags);
+ might_alloc(flags);
if (c->size < PAGE_SIZE) {
b = slob_alloc(c->size, flags, c->align, node, 0);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 092/200] locking/selftests: add testcases for fs_reclaim
2020-12-15 3:02 incoming Andrew Morton
` (90 preceding siblings ...)
2020-12-15 3:08 ` [patch 091/200] mm: extract might_alloc() debug check Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-15 3:08 ` [patch 093/200] mm/vmalloc.c:__vmalloc_area_node(): avoid 32-bit overflow Andrew Morton
` (108 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, bigeasy, cai, christian.koenig, cl, daniel.vetter,
daniel.vetter, david, iamjoonsoo.kim, jgg, jgg, linux-mm, longman,
maarten.lankhorst, mathieu.desnoyers, mingo, mingo, mm-commits,
paulmck, penberg, peterz, rdunlap, rientjes, tglx, thomas_os,
torvalds, vbabka, walken, will, willy
From: Daniel Vetter <daniel.vetter@ffwll.ch>
Subject: locking/selftests: add testcases for fs_reclaim
Since I butchered this I figured better to make sure we have testcases for
this now. Since we only have a locking context for __GFP_FS that's the
only thing we're testing right now.
Link: https://lkml.kernel.org/r/20201125162532.1299794-4-daniel.vetter@ffwll.ch
Signed-off-by: Daniel Vetter <daniel.vetter@intel.com>
Acked-by: Peter Zijlstra (Intel) <peterz@infradead.org>
Cc: Dave Chinner <david@fromorbit.com>
Cc: Qian Cai <cai@lca.pw>
Cc: Thomas Hellström (Intel) <thomas_os@shipmail.org>
Cc: Jason Gunthorpe <jgg@mellanox.com>
Cc: Maarten Lankhorst <maarten.lankhorst@linux.intel.com>
Cc: Christian König <christian.koenig@amd.com>
Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Will Deacon <will@kernel.org>
Cc: Christoph Lameter <cl@linux.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ingo Molnar <mingo@kernel.org>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Mathieu Desnoyers <mathieu.desnoyers@efficios.com>
Cc: Michel Lespinasse <walken@google.com>
Cc: Paul E. McKenney <paulmck@kernel.org>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Randy Dunlap <rdunlap@infradead.org>
Cc: Sebastian Andrzej Siewior <bigeasy@linutronix.de>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Waiman Long <longman@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
lib/locking-selftest.c | 47 +++++++++++++++++++++++++++++++++++++++
1 file changed, 47 insertions(+)
--- a/lib/locking-selftest.c~locking-selftests-add-testcases-for-fs_reclaim
+++ a/lib/locking-selftest.c
@@ -15,6 +15,7 @@
#include <linux/mutex.h>
#include <linux/ww_mutex.h>
#include <linux/sched.h>
+#include <linux/sched/mm.h>
#include <linux/delay.h>
#include <linux/lockdep.h>
#include <linux/spinlock.h>
@@ -2357,6 +2358,50 @@ static void queued_read_lock_tests(void)
pr_cont("\n");
}
+static void fs_reclaim_correct_nesting(void)
+{
+ fs_reclaim_acquire(GFP_KERNEL);
+ might_alloc(GFP_NOFS);
+ fs_reclaim_release(GFP_KERNEL);
+}
+
+static void fs_reclaim_wrong_nesting(void)
+{
+ fs_reclaim_acquire(GFP_KERNEL);
+ might_alloc(GFP_KERNEL);
+ fs_reclaim_release(GFP_KERNEL);
+}
+
+static void fs_reclaim_protected_nesting(void)
+{
+ unsigned int flags;
+
+ fs_reclaim_acquire(GFP_KERNEL);
+ flags = memalloc_nofs_save();
+ might_alloc(GFP_KERNEL);
+ memalloc_nofs_restore(flags);
+ fs_reclaim_release(GFP_KERNEL);
+}
+
+static void fs_reclaim_tests(void)
+{
+ printk(" --------------------\n");
+ printk(" | fs_reclaim tests |\n");
+ printk(" --------------------\n");
+
+ print_testname("correct nesting");
+ dotest(fs_reclaim_correct_nesting, SUCCESS, 0);
+ pr_cont("\n");
+
+ print_testname("wrong nesting");
+ dotest(fs_reclaim_wrong_nesting, FAILURE, 0);
+ pr_cont("\n");
+
+ print_testname("protected nesting");
+ dotest(fs_reclaim_protected_nesting, SUCCESS, 0);
+ pr_cont("\n");
+}
+
void locking_selftest(void)
{
/*
@@ -2478,6 +2523,8 @@ void locking_selftest(void)
if (IS_ENABLED(CONFIG_QUEUED_RWLOCKS))
queued_read_lock_tests();
+ fs_reclaim_tests();
+
if (unexpected_testcase_failures) {
printk("-----------------------------------------------------------------\n");
debug_locks = 0;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 093/200] mm/vmalloc.c:__vmalloc_area_node(): avoid 32-bit overflow
2020-12-15 3:02 incoming Andrew Morton
` (91 preceding siblings ...)
2020-12-15 3:08 ` [patch 092/200] locking/selftests: add testcases for fs_reclaim Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-15 3:08 ` [patch 094/200] mm/vmalloc: use free_vm_area() if an allocation fails Andrew Morton
` (107 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, hsinhuiwu, linux-mm, mm-commits, torvalds, willy
From: Andrew Morton <akpm@linux-foundation.org>
Subject: mm/vmalloc.c:__vmalloc_area_node(): avoid 32-bit overflow
With a machine with 3 TB (more than 2 TB memory). If you use vmalloc to
allocate > 2 TB memory, the array_size below will be overflowed.
The array_size is an unsigned int and can only be used to allocate less
than 2 TB memory. If you pass 2*1028*1028*1024*1024 = 2 * 2^40 in the
argument of vmalloc. The array_size will become 2*2^31 = 2^32. The 2^32
cannot be store with a 32 bit integer.
The fix is to change the type of array_size to unsigned long.
[akpm@linux-foundation.org: rework for current mainline]
Link: https://bugzilla.kernel.org/show_bug.cgi?id=210023
Reported-by: <hsinhuiwu@gmail.com>
Cc: Matthew Wilcox <willy@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmalloc.c | 4 +++-
1 file changed, 3 insertions(+), 1 deletion(-)
--- a/mm/vmalloc.c~mm-vmallocc-__vmalloc_area_node-avoid-32-bit-overflow
+++ a/mm/vmalloc.c
@@ -2461,9 +2461,11 @@ static void *__vmalloc_area_node(struct
{
const gfp_t nested_gfp = (gfp_mask & GFP_RECLAIM_MASK) | __GFP_ZERO;
unsigned int nr_pages = get_vm_area_size(area) >> PAGE_SHIFT;
- unsigned int array_size = nr_pages * sizeof(struct page *), i;
+ unsigned long array_size;
+ unsigned int i;
struct page **pages;
+ array_size = (unsigned long)nr_pages * sizeof(struct page *);
gfp_mask |= __GFP_NOWARN;
if (!(gfp_mask & (GFP_DMA | GFP_DMA32)))
gfp_mask |= __GFP_HIGHMEM;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 094/200] mm/vmalloc: use free_vm_area() if an allocation fails
2020-12-15 3:02 incoming Andrew Morton
` (92 preceding siblings ...)
2020-12-15 3:08 ` [patch 093/200] mm/vmalloc.c:__vmalloc_area_node(): avoid 32-bit overflow Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-15 3:08 ` [patch 095/200] mm/vmalloc: rework the drain logic Andrew Morton
` (106 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, hdanton, linux-mm, mhocko, minchan, mm-commits,
oleksiy.avramchenko, rostedt, torvalds, urezki, willy, ying.huang
From: "Uladzislau Rezki (Sony)" <urezki@gmail.com>
Subject: mm/vmalloc: use free_vm_area() if an allocation fails
There is a dedicated and separate function that finds and removes a
continuous kernel virtual area. As a final step it also releases the
"area", a descriptor of corresponding vm_struct.
Use free_vmap_area() in the __vmalloc_node_range() instead of open coded
steps which are exactly the same, to perform a cleanup.
Link: https://lkml.kernel.org/r/20201116220033.1837-1-urezki@gmail.com
Signed-off-by: Uladzislau Rezki (Sony) <urezki@gmail.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Oleksiy Avramchenko <oleksiy.avramchenko@sonymobile.com>
Cc: Minchan Kim <minchan@kernel.org>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: "Huang, Ying" <ying.huang@intel.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmalloc.c | 3 +--
1 file changed, 1 insertion(+), 2 deletions(-)
--- a/mm/vmalloc.c~mm-vmalloc-use-free_vm_area-if-an-allocation-fails
+++ a/mm/vmalloc.c
@@ -2479,8 +2479,7 @@ static void *__vmalloc_area_node(struct
}
if (!pages) {
- remove_vm_area(area->addr);
- kfree(area);
+ free_vm_area(area);
return NULL;
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 095/200] mm/vmalloc: rework the drain logic
2020-12-15 3:02 incoming Andrew Morton
` (93 preceding siblings ...)
2020-12-15 3:08 ` [patch 094/200] mm/vmalloc: use free_vm_area() if an allocation fails Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-15 3:08 ` [patch 096/200] mm/vmalloc: add 'align' parameter explanation for pvm_determine_end_from_reverse Andrew Morton
` (105 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, hdanton, huang.ying.caritas, linux-mm, mhocko, minchan,
mm-commits, oleksiy.avramchenko, rostedt, torvalds, urezki, willy
From: "Uladzislau Rezki (Sony)" <urezki@gmail.com>
Subject: mm/vmalloc: rework the drain logic
A current "lazy drain" model suffers from at least two issues.
First one is related to the unsorted list of vmap areas, thus in order to
identify the [min:max] range of areas to be drained, it requires a full
list scan. What is a time consuming if the list is too long.
Second one and as a next step is about merging all fragments with a free
space. What is also a time consuming because it has to iterate over
entire list which holds outstanding lazy areas.
See below the "preemptirqsoff" tracer that illustrates a high latency. It
is ~24676us. Our workloads like audio and video are effected by such long
latency:
<snip>
tracer: preemptirqsoff
preemptirqsoff latency trace v1.1.5 on 4.9.186-perf+
--------------------------------------------------------------------
latency: 24676 us, #4/4, CPU#1 | (M:preempt VP:0, KP:0, SP:0 HP:0 P:8)
-----------------
| task: crtc_commit:112-261 (uid:0 nice:0 policy:1 rt_prio:16)
-----------------
=> started at: __purge_vmap_area_lazy
=> ended at: __purge_vmap_area_lazy
_------=> CPU#
/ _-----=> irqs-off
| / _----=> need-resched
|| / _---=> hardirq/softirq
||| / _--=> preempt-depth
|||| / delay
cmd pid ||||| time | caller
\ / ||||| \ | /
crtc_com-261 1...1 1us*: _raw_spin_lock <-__purge_vmap_area_lazy
[...]
crtc_com-261 1...1 24675us : _raw_spin_unlock <-__purge_vmap_area_lazy
crtc_com-261 1...1 24677us : trace_preempt_on <-__purge_vmap_area_lazy
crtc_com-261 1...1 24683us : <stack trace>
=> free_vmap_area_noflush
=> remove_vm_area
=> __vunmap
=> vfree
=> drm_property_free_blob
=> drm_mode_object_unreference
=> drm_property_unreference_blob
=> __drm_atomic_helper_crtc_destroy_state
=> sde_crtc_destroy_state
=> drm_atomic_state_default_clear
=> drm_atomic_state_clear
=> drm_atomic_state_free
=> complete_commit
=> _msm_drm_commit_work_cb
=> kthread_worker_fn
=> kthread
=> ret_from_fork
<snip>
To address those two issues we can redesign a purging of the outstanding
lazy areas. Instead of queuing vmap areas to the list, we replace it by
the separate rb-tree. In hat case an area is located in the tree/list in
ascending order. It will give us below advantages:
a) Outstanding vmap areas are merged creating bigger coalesced blocks,
thus it becomes less fragmented.
b) It is possible to calculate a flush range [min:max] without scanning
all elements. It is O(1) access time or complexity;
c) The final merge of areas with the rb-tree that represents a free
space is faster because of (a). As a result the lock contention is
also reduced.
Link: https://lkml.kernel.org/r/20201116220033.1837-2-urezki@gmail.com
Signed-off-by: Uladzislau Rezki (Sony) <urezki@gmail.com>
Cc: Hillf Danton <hdanton@sina.com>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Oleksiy Avramchenko <oleksiy.avramchenko@sonymobile.com>
Cc: Steven Rostedt <rostedt@goodmis.org>
Cc: Minchan Kim <minchan@kernel.org>
Cc: huang ying <huang.ying.caritas@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/vmalloc.h | 8 +--
mm/vmalloc.c | 90 +++++++++++++++++++++-----------------
2 files changed, 53 insertions(+), 45 deletions(-)
--- a/include/linux/vmalloc.h~mm-vmalloc-rework-the-drain-logic
+++ a/include/linux/vmalloc.h
@@ -72,16 +72,14 @@ struct vmap_area {
struct list_head list; /* address sorted list */
/*
- * The following three variables can be packed, because
- * a vmap_area object is always one of the three states:
+ * The following two variables can be packed, because
+ * a vmap_area object can be either:
* 1) in "free" tree (root is vmap_area_root)
- * 2) in "busy" tree (root is free_vmap_area_root)
- * 3) in purge list (head is vmap_purge_list)
+ * 2) or "busy" tree (root is free_vmap_area_root)
*/
union {
unsigned long subtree_max_size; /* in "free" tree */
struct vm_struct *vm; /* in "busy" tree */
- struct llist_node purge_list; /* in purge list */
};
};
--- a/mm/vmalloc.c~mm-vmalloc-rework-the-drain-logic
+++ a/mm/vmalloc.c
@@ -413,10 +413,13 @@ static DEFINE_SPINLOCK(vmap_area_lock);
static DEFINE_SPINLOCK(free_vmap_area_lock);
/* Export for kexec only */
LIST_HEAD(vmap_area_list);
-static LLIST_HEAD(vmap_purge_list);
static struct rb_root vmap_area_root = RB_ROOT;
static bool vmap_initialized __read_mostly;
+static struct rb_root purge_vmap_area_root = RB_ROOT;
+static LIST_HEAD(purge_vmap_area_list);
+static DEFINE_SPINLOCK(purge_vmap_area_lock);
+
/*
* This kmem_cache is used for vmap_area objects. Instead of
* allocating from slab we reuse an object from this cache to
@@ -820,10 +823,17 @@ insert:
if (!merged)
link_va(va, root, parent, link, head);
- /*
- * Last step is to check and update the tree.
- */
- augment_tree_propagate_from(va);
+ return va;
+}
+
+static __always_inline struct vmap_area *
+merge_or_add_vmap_area_augment(struct vmap_area *va,
+ struct rb_root *root, struct list_head *head)
+{
+ va = merge_or_add_vmap_area(va, root, head);
+ if (va)
+ augment_tree_propagate_from(va);
+
return va;
}
@@ -1138,7 +1148,7 @@ static void free_vmap_area(struct vmap_a
* Insert/Merge it back to the free tree/list.
*/
spin_lock(&free_vmap_area_lock);
- merge_or_add_vmap_area(va, &free_vmap_area_root, &free_vmap_area_list);
+ merge_or_add_vmap_area_augment(va, &free_vmap_area_root, &free_vmap_area_list);
spin_unlock(&free_vmap_area_lock);
}
@@ -1326,32 +1336,32 @@ void set_iounmap_nonlazy(void)
static bool __purge_vmap_area_lazy(unsigned long start, unsigned long end)
{
unsigned long resched_threshold;
- struct llist_node *valist;
- struct vmap_area *va;
- struct vmap_area *n_va;
+ struct list_head local_pure_list;
+ struct vmap_area *va, *n_va;
lockdep_assert_held(&vmap_purge_lock);
- valist = llist_del_all(&vmap_purge_list);
- if (unlikely(valist == NULL))
+ spin_lock(&purge_vmap_area_lock);
+ purge_vmap_area_root = RB_ROOT;
+ list_replace_init(&purge_vmap_area_list, &local_pure_list);
+ spin_unlock(&purge_vmap_area_lock);
+
+ if (unlikely(list_empty(&local_pure_list)))
return false;
- /*
- * TODO: to calculate a flush range without looping.
- * The list can be up to lazy_max_pages() elements.
- */
- llist_for_each_entry(va, valist, purge_list) {
- if (va->va_start < start)
- start = va->va_start;
- if (va->va_end > end)
- end = va->va_end;
- }
+ start = min(start,
+ list_first_entry(&local_pure_list,
+ struct vmap_area, list)->va_start);
+
+ end = max(end,
+ list_last_entry(&local_pure_list,
+ struct vmap_area, list)->va_end);
flush_tlb_kernel_range(start, end);
resched_threshold = lazy_max_pages() << 1;
spin_lock(&free_vmap_area_lock);
- llist_for_each_entry_safe(va, n_va, valist, purge_list) {
+ list_for_each_entry_safe(va, n_va, &local_pure_list, list) {
unsigned long nr = (va->va_end - va->va_start) >> PAGE_SHIFT;
unsigned long orig_start = va->va_start;
unsigned long orig_end = va->va_end;
@@ -1361,8 +1371,8 @@ static bool __purge_vmap_area_lazy(unsig
* detached and there is no need to "unlink" it from
* anything.
*/
- va = merge_or_add_vmap_area(va, &free_vmap_area_root,
- &free_vmap_area_list);
+ va = merge_or_add_vmap_area_augment(va, &free_vmap_area_root,
+ &free_vmap_area_list);
if (!va)
continue;
@@ -1419,9 +1429,15 @@ static void free_vmap_area_noflush(struc
nr_lazy = atomic_long_add_return((va->va_end - va->va_start) >>
PAGE_SHIFT, &vmap_lazy_nr);
- /* After this point, we may free va at any time */
- llist_add(&va->purge_list, &vmap_purge_list);
+ /*
+ * Merge or place it to the purge tree/list.
+ */
+ spin_lock(&purge_vmap_area_lock);
+ merge_or_add_vmap_area(va,
+ &purge_vmap_area_root, &purge_vmap_area_list);
+ spin_unlock(&purge_vmap_area_lock);
+ /* After this point, we may free va at any time */
if (unlikely(nr_lazy > lazy_max_pages()))
try_purge_vmap_area_lazy();
}
@@ -3351,8 +3367,8 @@ recovery:
while (area--) {
orig_start = vas[area]->va_start;
orig_end = vas[area]->va_end;
- va = merge_or_add_vmap_area(vas[area], &free_vmap_area_root,
- &free_vmap_area_list);
+ va = merge_or_add_vmap_area_augment(vas[area], &free_vmap_area_root,
+ &free_vmap_area_list);
if (va)
kasan_release_vmalloc(orig_start, orig_end,
va->va_start, va->va_end);
@@ -3401,8 +3417,8 @@ err_free_shadow:
for (area = 0; area < nr_vms; area++) {
orig_start = vas[area]->va_start;
orig_end = vas[area]->va_end;
- va = merge_or_add_vmap_area(vas[area], &free_vmap_area_root,
- &free_vmap_area_list);
+ va = merge_or_add_vmap_area_augment(vas[area], &free_vmap_area_root,
+ &free_vmap_area_list);
if (va)
kasan_release_vmalloc(orig_start, orig_end,
va->va_start, va->va_end);
@@ -3482,18 +3498,15 @@ static void show_numa_info(struct seq_fi
static void show_purge_info(struct seq_file *m)
{
- struct llist_node *head;
struct vmap_area *va;
- head = READ_ONCE(vmap_purge_list.first);
- if (head == NULL)
- return;
-
- llist_for_each_entry(va, head, purge_list) {
+ spin_lock(&purge_vmap_area_lock);
+ list_for_each_entry(va, &purge_vmap_area_list, list) {
seq_printf(m, "0x%pK-0x%pK %7ld unpurged vm_area\n",
(void *)va->va_start, (void *)va->va_end,
va->va_end - va->va_start);
}
+ spin_unlock(&purge_vmap_area_lock);
}
static int s_show(struct seq_file *m, void *p)
@@ -3551,10 +3564,7 @@ static int s_show(struct seq_file *m, vo
seq_putc(m, '\n');
/*
- * As a final step, dump "unpurged" areas. Note,
- * that entire "/proc/vmallocinfo" output will not
- * be address sorted, because the purge list is not
- * sorted.
+ * As a final step, dump "unpurged" areas.
*/
if (list_is_last(&va->list, &vmap_area_list))
show_purge_info(m);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 096/200] mm/vmalloc: add 'align' parameter explanation for pvm_determine_end_from_reverse
2020-12-15 3:02 incoming Andrew Morton
` (94 preceding siblings ...)
2020-12-15 3:08 ` [patch 095/200] mm/vmalloc: rework the drain logic Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-15 3:08 ` [patch 097/200] mm/vmalloc.c: remove unnecessary return statement Andrew Morton
` (104 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, alex.shi, corbet, linux-mm, mm-commits, rdunlap, torvalds
From: Alex Shi <alex.shi@linux.alibaba.com>
Subject: mm/vmalloc: add 'align' parameter explanation for pvm_determine_end_from_reverse
Kernel-doc markup has a issue on pvm_determine_end_from_reverse:
mm/vmalloc.c:3145: warning: Function parameter or member 'align' not
described in 'pvm_determine_end_from_reverse'
Add a explanation for it to remove the warning.
Link: https://lkml.kernel.org/r/1605605088-30668-3-git-send-email-alex.shi@linux.alibaba.com
Signed-off-by: Alex Shi <alex.shi@linux.alibaba.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Randy Dunlap <rdunlap@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmalloc.c | 1 +
1 file changed, 1 insertion(+)
--- a/mm/vmalloc.c~mm-vmalloc-add-align-parameter-explanation-for-pvm_determine_end_from_reverse
+++ a/mm/vmalloc.c
@@ -3151,6 +3151,7 @@ pvm_find_va_enclose_addr(unsigned long a
* @va:
* in - the VA we start the search(reverse order);
* out - the VA with the highest aligned end address.
+ * @align: alignment for required highest address
*
* Returns: determined end address within vmap_area
*/
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 097/200] mm/vmalloc.c: remove unnecessary return statement
2020-12-15 3:02 incoming Andrew Morton
` (95 preceding siblings ...)
2020-12-15 3:08 ` [patch 096/200] mm/vmalloc: add 'align' parameter explanation for pvm_determine_end_from_reverse Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-15 3:08 ` [patch 098/200] mm/vmalloc: Fix unlock order in s_stop() Andrew Morton
` (103 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, baolin.wang, linux-mm, mm-commits, torvalds
From: Baolin Wang <baolin.wang@linux.alibaba.com>
Subject: mm/vmalloc.c: remove unnecessary return statement
Remove unnecessary return statement for void function.
Link: https://lkml.kernel.org/r/ca23f89259c80c3562700ae6e227b2815a195853.1606891153.git.baolin.wang@linux.alibaba.com
Signed-off-by: Baolin Wang <baolin.wang@linux.alibaba.com>
Reviewed-by: Andrew Morton <akpm@linux-foundation.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmalloc.c | 1 -
1 file changed, 1 deletion(-)
--- a/mm/vmalloc.c~mm-vmalloc-remove-unnecessary-return-statement
+++ a/mm/vmalloc.c
@@ -2291,7 +2291,6 @@ static void __vunmap(const void *addr, i
}
kfree(area);
- return;
}
static inline void __vfree_deferred(const void *addr)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 098/200] mm/vmalloc: Fix unlock order in s_stop()
2020-12-15 3:02 incoming Andrew Morton
` (96 preceding siblings ...)
2020-12-15 3:08 ` [patch 097/200] mm/vmalloc.c: remove unnecessary return statement Andrew Morton
@ 2020-12-15 3:08 ` Andrew Morton
2020-12-15 3:09 ` [patch 099/200] docs/vm: remove unused 3 items explanation for /proc/vmstat Andrew Morton
` (102 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:08 UTC (permalink / raw)
To: akpm, david, linux-mm, longman, mm-commits, torvalds, urezki,
willy
From: Waiman Long <longman@redhat.com>
Subject: mm/vmalloc: Fix unlock order in s_stop()
When multiple locks are acquired, they should be released in reverse
order. For s_start() and s_stop() in mm/vmalloc.c, that is not the
case.
s_start: mutex_lock(&vmap_purge_lock); spin_lock(&vmap_area_lock);
s_stop : mutex_unlock(&vmap_purge_lock); spin_unlock(&vmap_area_lock);
This unlock sequence, though allowed, is not optimal. If a waiter is
present, mutex_unlock() will need to go through the slowpath of waking
up the waiter with preemption disabled. Fix that by releasing the
spinlock first before the mutex.
Link: https://lkml.kernel.org/r/20201213180843.16938-1-longman@redhat.com
Fixes: e36176be1c39 ("mm/vmalloc: rework vmap_area_lock")
Signed-off-by: Waiman Long <longman@redhat.com>
Reviewed-by: Uladzislau Rezki (Sony) <urezki@gmail.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Matthew Wilcox <willy@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmalloc.c | 4 ++--
1 file changed, 2 insertions(+), 2 deletions(-)
--- a/mm/vmalloc.c~mm-vmalloc-fix-unlock-order-in-s_stop
+++ a/mm/vmalloc.c
@@ -3465,11 +3465,11 @@ static void *s_next(struct seq_file *m,
}
static void s_stop(struct seq_file *m, void *p)
- __releases(&vmap_purge_lock)
__releases(&vmap_area_lock)
+ __releases(&vmap_purge_lock)
{
- mutex_unlock(&vmap_purge_lock);
spin_unlock(&vmap_area_lock);
+ mutex_unlock(&vmap_purge_lock);
}
static void show_numa_info(struct seq_file *m, struct vm_struct *v)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 099/200] docs/vm: remove unused 3 items explanation for /proc/vmstat
2020-12-15 3:02 incoming Andrew Morton
` (97 preceding siblings ...)
2020-12-15 3:08 ` [patch 098/200] mm/vmalloc: Fix unlock order in s_stop() Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:09 ` [patch 100/200] mm/vmalloc.c: fix kasan shadow poisoning size Andrew Morton
` (101 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: akpm, alex.shi, corbet, kirill.shutemov, linux-mm, mm-commits,
rientjes, torvalds, yang.shi, ziy
From: Alex Shi <alex.shi@linux.alibaba.com>
Subject: docs/vm: remove unused 3 items explanation for /proc/vmstat
Commit 5647bc293ab1 ("mm: compaction: Move migration fail/success
stats to migrate.c"), removed 3 items in /proc/vmstat. but the docs
still has their explanation. let's remove them.
"compact_blocks_moved",
"compact_pages_moved",
"compact_pagemigrate_failed",
Link: https://lkml.kernel.org/r/1605520282-51993-1-git-send-email-alex.shi@linux.alibaba.com
Signed-off-by: Alex Shi <alex.shi@linux.alibaba.com>
Reviewed-by: Zi Yan <ziy@nvidia.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Yang Shi <yang.shi@linux.alibaba.com>
Cc: "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>
Cc: David Rientjes <rientjes@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/admin-guide/mm/transhuge.rst | 15 ---------------
1 file changed, 15 deletions(-)
--- a/Documentation/admin-guide/mm/transhuge.rst~docs-vm-remove-unused-3-items-explanation-for-proc-vmstat
+++ a/Documentation/admin-guide/mm/transhuge.rst
@@ -401,21 +401,6 @@ compact_fail
is incremented if the system tries to compact memory
but failed.
-compact_pages_moved
- is incremented each time a page is moved. If
- this value is increasing rapidly, it implies that the system
- is copying a lot of data to satisfy the huge page allocation.
- It is possible that the cost of copying exceeds any savings
- from reduced TLB misses.
-
-compact_pagemigrate_failed
- is incremented when the underlying mechanism
- for moving a page failed.
-
-compact_blocks_moved
- is incremented each time memory compaction examines
- a huge page aligned range of pages.
-
It is possible to establish how long the stalls were using the function
tracer to record how long was spent in __alloc_pages_nodemask and
using the mm_page_alloc tracepoint to identify which allocations were
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 100/200] mm/vmalloc.c: fix kasan shadow poisoning size
2020-12-15 3:02 incoming Andrew Morton
` (98 preceding siblings ...)
2020-12-15 3:09 ` [patch 099/200] docs/vm: remove unused 3 items explanation for /proc/vmstat Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:09 ` [patch 101/200] workqueue: kasan: record workqueue stack Andrew Morton
` (100 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: akpm, andreyknvl, aryabinin, dvyukov, elver, glider, linux-mm,
mm-commits, torvalds, vincenzo.frascino
From: Vincenzo Frascino <vincenzo.frascino@arm.com>
Subject: mm/vmalloc.c: fix kasan shadow poisoning size
The size of vm area can be affected by the presence or not of the guard
page. In particular when VM_NO_GUARD is present, the actual accessible
size has to be considered like the real size minus the guard page.
Currently kasan does not keep into account this information during the
poison operation and in particular tries to poison the guard page as well.
This approach, even if incorrect, does not cause an issue because the tags
for the guard page are written in the shadow memory. With the future
introduction of the Tag-Based KASAN, being the guard page inaccessible by
nature, the write tag operation on this page triggers a fault.
Fix kasan shadow poisoning size invoking get_vm_area_size() instead of
accessing directly the field in the data structure to detect the correct
value.
Link: https://lkml.kernel.org/r/20201027160213.32904-1-vincenzo.frascino@arm.com
Fixes: d98c9e83b5e7c ("kasan: fix crashes on access to memory mapped by vm_map_ram()")
Signed-off-by: Vincenzo Frascino <vincenzo.frascino@arm.com>
Cc: Andrey Konovalov <andreyknvl@google.com>
Cc: Dmitry Vyukov <dvyukov@google.com>
Cc: Andrey Ryabinin <aryabinin@virtuozzo.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Marco Elver <elver@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmalloc.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/vmalloc.c~mm-vmalloc-fix-kasan-shadow-poisoning-size
+++ a/mm/vmalloc.c
@@ -2272,7 +2272,7 @@ static void __vunmap(const void *addr, i
debug_check_no_locks_freed(area->addr, get_vm_area_size(area));
debug_check_no_obj_freed(area->addr, get_vm_area_size(area));
- kasan_poison_vmalloc(area->addr, area->size);
+ kasan_poison_vmalloc(area->addr, get_vm_area_size(area));
vm_remove_mappings(area, deallocate_pages);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 101/200] workqueue: kasan: record workqueue stack
2020-12-15 3:02 incoming Andrew Morton
` (99 preceding siblings ...)
2020-12-15 3:09 ` [patch 100/200] mm/vmalloc.c: fix kasan shadow poisoning size Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:09 ` [patch 102/200] kasan: print " Andrew Morton
` (99 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: akpm, andreyknvl, aryabinin, corbet, dvyukov, elver, glider,
jiangshanlai, linux-mm, matthias.bgg, mm-commits, tj, torvalds,
walter-zh.wu
From: Walter Wu <walter-zh.wu@mediatek.com>
Subject: workqueue: kasan: record workqueue stack
Patch series "kasan: add workqueue stack for generic KASAN", v5.
Syzbot reports many UAF issues for workqueue, see [1].
In some of these access/allocation happened in process_one_work(),
we see the free stack is useless in KASAN report, it doesn't help
programmers to solve UAF for workqueue issue.
This patchset improves KASAN reports by making them to have workqueue
queueing stack. It is useful for programmers to solve use-after-free
or double-free memory issue.
Generic KASAN also records the last two workqueue stacks and prints
them in KASAN report. It is only suitable for generic KASAN.
[1]https://groups.google.com/g/syzkaller-bugs/search?q=%22use-after-free%22+process_one_work
[2]https://bugzilla.kernel.org/show_bug.cgi?id=198437
This patch (of 4):
When analyzing use-after-free or double-free issue, recording the
enqueuing work stacks is helpful to preserve usage history which
potentially gives a hint about the affected code.
For workqueue it has turned out to be useful to record the enqueuing work
call stacks. Because user can see KASAN report to determine whether it is
root cause. They don't need to enable debugobjects, but they have a
chance to find out the root cause.
Link: https://lkml.kernel.org/r/20201203022148.29754-1-walter-zh.wu@mediatek.com
Link: https://lkml.kernel.org/r/20201203022442.30006-1-walter-zh.wu@mediatek.com
Signed-off-by: Walter Wu <walter-zh.wu@mediatek.com>
Suggested-by: Marco Elver <elver@google.com>
Acked-by: Marco Elver <elver@google.com>
Acked-by: Tejun Heo <tj@kernel.org>
Reviewed-by: Dmitry Vyukov <dvyukov@google.com>
Reviewed-by: Andrey Konovalov <andreyknvl@google.com>
Cc: Andrey Ryabinin <aryabinin@virtuozzo.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Lai Jiangshan <jiangshanlai@gmail.com>
Cc: Marco Elver <elver@google.com>
Cc: Matthias Brugger <matthias.bgg@gmail.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
kernel/workqueue.c | 3 +++
1 file changed, 3 insertions(+)
--- a/kernel/workqueue.c~workqueue-kasan-record-workqueue-stack
+++ a/kernel/workqueue.c
@@ -1327,6 +1327,9 @@ static void insert_work(struct pool_work
{
struct worker_pool *pool = pwq->pool;
+ /* record the work call stack in order to print it in KASAN reports */
+ kasan_record_aux_stack(work);
+
/* we own @work, set data and link */
set_work_pwq(work, pwq, extra_flags);
list_add_tail(&work->entry, head);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 102/200] kasan: print workqueue stack
2020-12-15 3:02 incoming Andrew Morton
` (100 preceding siblings ...)
2020-12-15 3:09 ` [patch 101/200] workqueue: kasan: record workqueue stack Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:09 ` [patch 103/200] lib/test_kasan.c: add workqueue test case Andrew Morton
` (98 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: akpm, andreyknvl, aryabinin, corbet, dvyukov, elver, glider,
jiangshanlai, linux-mm, matthias.bgg, mm-commits, tj, torvalds,
walter-zh.wu
From: Walter Wu <walter-zh.wu@mediatek.com>
Subject: kasan: print workqueue stack
The aux_stack[2] is reused to record the call_rcu() call stack and
enqueuing work call stacks. So that we need to change the auxiliary stack
title for common title, print them in KASAN report.
Link: https://lkml.kernel.org/r/20201203022715.30635-1-walter-zh.wu@mediatek.com
Signed-off-by: Walter Wu <walter-zh.wu@mediatek.com>
Suggested-by: Marco Elver <elver@google.com>
Acked-by: Marco Elver <elver@google.com>
Reviewed-by: Dmitry Vyukov <dvyukov@google.com>
Reviewed-by: Andrey Konovalov <andreyknvl@google.com>
Cc: Andrey Ryabinin <aryabinin@virtuozzo.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Lai Jiangshan <jiangshanlai@gmail.com>
Cc: Matthias Brugger <matthias.bgg@gmail.com>
Cc: Tejun Heo <tj@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/kasan/generic.c | 3 ---
mm/kasan/report.c | 4 ++--
2 files changed, 2 insertions(+), 5 deletions(-)
--- a/mm/kasan/generic.c~kasan-print-workqueue-stack
+++ a/mm/kasan/generic.c
@@ -339,9 +339,6 @@ void kasan_record_aux_stack(void *addr)
object = nearest_obj(cache, page, addr);
alloc_info = get_alloc_info(cache, object);
- /*
- * record the last two call_rcu() call stacks.
- */
alloc_info->aux_stack[1] = alloc_info->aux_stack[0];
alloc_info->aux_stack[0] = kasan_save_stack(GFP_NOWAIT);
}
--- a/mm/kasan/report.c~kasan-print-workqueue-stack
+++ a/mm/kasan/report.c
@@ -185,12 +185,12 @@ static void describe_object(struct kmem_
#ifdef CONFIG_KASAN_GENERIC
if (alloc_info->aux_stack[0]) {
- pr_err("Last call_rcu():\n");
+ pr_err("Last potentially related work creation:\n");
print_stack(alloc_info->aux_stack[0]);
pr_err("\n");
}
if (alloc_info->aux_stack[1]) {
- pr_err("Second to last call_rcu():\n");
+ pr_err("Second to last potentially related work creation:\n");
print_stack(alloc_info->aux_stack[1]);
pr_err("\n");
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 103/200] lib/test_kasan.c: add workqueue test case
2020-12-15 3:02 incoming Andrew Morton
` (101 preceding siblings ...)
2020-12-15 3:09 ` [patch 102/200] kasan: print " Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:09 ` [patch 104/200] kasan: update documentation for generic kasan Andrew Morton
` (97 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: akpm, andreyknvl, aryabinin, corbet, dvyukov, elver, glider,
jiangshanlai, linux-mm, matthias.bgg, mm-commits, tj, torvalds,
walter-zh.wu
From: Walter Wu <walter-zh.wu@mediatek.com>
Subject: lib/test_kasan.c: add workqueue test case
Adds a test to verify workqueue stack recording and print it in
KASAN report.
The KASAN report was as follows(cleaned up slightly):
BUG: KASAN: use-after-free in kasan_workqueue_uaf
Freed by task 54:
kasan_save_stack+0x24/0x50
kasan_set_track+0x24/0x38
kasan_set_free_info+0x20/0x40
__kasan_slab_free+0x10c/0x170
kasan_slab_free+0x10/0x18
kfree+0x98/0x270
kasan_workqueue_work+0xc/0x18
Last potentially related work creation:
kasan_save_stack+0x24/0x50
kasan_record_wq_stack+0xa8/0xb8
insert_work+0x48/0x288
__queue_work+0x3e8/0xc40
queue_work_on+0xf4/0x118
kasan_workqueue_uaf+0xfc/0x190
Link: https://lkml.kernel.org/r/20201203022748.30681-1-walter-zh.wu@mediatek.com
Signed-off-by: Walter Wu <walter-zh.wu@mediatek.com>
Acked-by: Marco Elver <elver@google.com>
Reviewed-by: Dmitry Vyukov <dvyukov@google.com>
Reviewed-by: Andrey Konovalov <andreyknvl@google.com>
Cc: Andrey Ryabinin <aryabinin@virtuozzo.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Matthias Brugger <matthias.bgg@gmail.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Lai Jiangshan <jiangshanlai@gmail.com>
Cc: Tejun Heo <tj@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
lib/test_kasan_module.c | 29 +++++++++++++++++++++++++++++
1 file changed, 29 insertions(+)
--- a/lib/test_kasan_module.c~lib-test_kasanc-add-workqueue-test-case
+++ a/lib/test_kasan_module.c
@@ -91,6 +91,34 @@ static noinline void __init kasan_rcu_ua
call_rcu(&global_rcu_ptr->rcu, kasan_rcu_reclaim);
}
+static noinline void __init kasan_workqueue_work(struct work_struct *work)
+{
+ kfree(work);
+}
+
+static noinline void __init kasan_workqueue_uaf(void)
+{
+ struct workqueue_struct *workqueue;
+ struct work_struct *work;
+
+ workqueue = create_workqueue("kasan_wq_test");
+ if (!workqueue) {
+ pr_err("Allocation failed\n");
+ return;
+ }
+ work = kmalloc(sizeof(struct work_struct), GFP_KERNEL);
+ if (!work) {
+ pr_err("Allocation failed\n");
+ return;
+ }
+
+ INIT_WORK(work, kasan_workqueue_work);
+ queue_work(workqueue, work);
+ destroy_workqueue(workqueue);
+
+ pr_info("use-after-free on workqueue\n");
+ ((volatile struct work_struct *)work)->data;
+}
static int __init test_kasan_module_init(void)
{
@@ -102,6 +130,7 @@ static int __init test_kasan_module_init
copy_user_test();
kasan_rcu_uaf();
+ kasan_workqueue_uaf();
kasan_restore_multi_shot(multishot);
return -EAGAIN;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 104/200] kasan: update documentation for generic kasan
2020-12-15 3:02 incoming Andrew Morton
` (102 preceding siblings ...)
2020-12-15 3:09 ` [patch 103/200] lib/test_kasan.c: add workqueue test case Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:09 ` [patch 105/200] lkdtm: disable KASAN for rodata.o Andrew Morton
` (96 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: akpm, andreyknvl, aryabinin, corbet, dvyukov, elver, glider,
jiangshanlai, linux-mm, matthias.bgg, mm-commits, tj, torvalds,
walter-zh.wu
From: Walter Wu <walter-zh.wu@mediatek.com>
Subject: kasan: update documentation for generic kasan
Generic KASAN also supports to record the last two workqueue stacks and
print them in KASAN report. So that need to update documentation.
Link: https://lkml.kernel.org/r/20201203023037.30792-1-walter-zh.wu@mediatek.com
Signed-off-by: Walter Wu <walter-zh.wu@mediatek.com>
Suggested-by: Marco Elver <elver@google.com>
Acked-by: Marco Elver <elver@google.com>
Reviewed-by: Dmitry Vyukov <dvyukov@google.com>
Reviewed-by: Andrey Konovalov <andreyknvl@google.com>
Cc: Andrey Ryabinin <aryabinin@virtuozzo.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Lai Jiangshan <jiangshanlai@gmail.com>
Cc: Matthias Brugger <matthias.bgg@gmail.com>
Cc: Tejun Heo <tj@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/dev-tools/kasan.rst | 5 +++--
1 file changed, 3 insertions(+), 2 deletions(-)
--- a/Documentation/dev-tools/kasan.rst~kasan-update-documentation-for-generic-kasan
+++ a/Documentation/dev-tools/kasan.rst
@@ -190,8 +190,9 @@ function calls GCC directly inserts the
This option significantly enlarges kernel but it gives x1.1-x2 performance
boost over outline instrumented kernel.
-Generic KASAN prints up to 2 call_rcu() call stacks in reports, the last one
-and the second to last.
+Generic KASAN also reports the last 2 call stacks to creation of work that
+potentially has access to an object. Call stacks for the following are shown:
+call_rcu() and workqueue queuing.
Software tag-based KASAN
~~~~~~~~~~~~~~~~~~~~~~~~
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 105/200] lkdtm: disable KASAN for rodata.o
2020-12-15 3:02 incoming Andrew Morton
` (103 preceding siblings ...)
2020-12-15 3:09 ` [patch 104/200] kasan: update documentation for generic kasan Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:09 ` [patch 106/200] alpha: switch from DISCONTIGMEM to SPARSEMEM Andrew Morton
` (95 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: akpm, andreyknvl, arnd, dvyukov, elver, gregkh, keescook,
linux-mm, mm-commits, torvalds
From: Marco Elver <elver@google.com>
Subject: lkdtm: disable KASAN for rodata.o
Building lkdtm with KASAN and Clang 11 or later results in the following
error when attempting to load the module:
kernel tried to execute NX-protected page - exploit attempt? (uid: 0)
BUG: unable to handle page fault for address: ffffffffc019cd70
#PF: supervisor instruction fetch in kernel mode
#PF: error_code(0x0011) - permissions violation
...
RIP: 0010:asan.module_ctor+0x0/0xffffffffffffa290 [lkdtm]
...
Call Trace:
do_init_module+0x17c/0x570
load_module+0xadee/0xd0b0
__x64_sys_finit_module+0x16c/0x1a0
do_syscall_64+0x34/0x50
entry_SYSCALL_64_after_hwframe+0x44/0xa9
The reason is that rodata.o generates a dummy function that lives in
.rodata to validate that .rodata can't be executed; however, Clang 11 adds
KASAN globals support by generating module constructors to initialize
globals redzones. When Clang 11 adds a module constructor to rodata.o, it
is also added to .rodata: any attempt to call it on initialization results
in the above error.
Therefore, disable KASAN instrumentation for rodata.o.
Link: https://lkml.kernel.org/r/20201214191413.3164796-1-elver@google.com
Signed-off-by: Marco Elver <elver@google.com>
Cc: Kees Cook <keescook@chromium.org>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org>
Cc: Andrey Konovalov <andreyknvl@google.com>
Cc: Dmitry Vyukov <dvyukov@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/misc/lkdtm/Makefile | 1 +
1 file changed, 1 insertion(+)
--- a/drivers/misc/lkdtm/Makefile~lkdtm-disable-kasan-for-rodatao
+++ a/drivers/misc/lkdtm/Makefile
@@ -11,6 +11,7 @@ lkdtm-$(CONFIG_LKDTM) += usercopy.o
lkdtm-$(CONFIG_LKDTM) += stackleak.o
lkdtm-$(CONFIG_LKDTM) += cfi.o
+KASAN_SANITIZE_rodata.o := n
KASAN_SANITIZE_stackleak.o := n
KCOV_INSTRUMENT_rodata.o := n
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 106/200] alpha: switch from DISCONTIGMEM to SPARSEMEM
2020-12-15 3:02 incoming Andrew Morton
` (104 preceding siblings ...)
2020-12-15 3:09 ` [patch 105/200] lkdtm: disable KASAN for rodata.o Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:09 ` [patch 107/200] ia64: remove custom __early_pfn_to_nid() Andrew Morton
` (94 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: adobriyan, akpm, catalin.marinas, corbet, geert, gerg, glaubitz,
linux-mm, linux, mattst88, mm-commits, mroos, rppt, schmitzmic,
tony.luck, torvalds, vgupta, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: alpha: switch from DISCONTIGMEM to SPARSEMEM
Patch series "arch, mm: deprecate DISCONTIGMEM", v2.
It's been a while since DISCONTIGMEM is generally considered deprecated,
but it is still used by four architectures. This set replaces
DISCONTIGMEM with a different way to handle holes in the memory map and
marks DISCONTIGMEM configuration as BROKEN in Kconfigs of these
architectures with the intention to completely remove it in several
releases.
While for 64-bit alpha and ia64 the switch to SPARSEMEM is quite obvious
and was a matter of moving some bits around, for smaller 32-bit arc and
m68k SPARSEMEM is not necessarily the best thing to do.
On 32-bit machines SPARSEMEM would require large sections to make section
index fit in the page flags, but larger sections mean that more memory is
wasted for unused memory map.
Besides, pfn_to_page() and page_to_pfn() become less efficient, at least
on arc.
So I've decided to generalize arm's approach for freeing of unused parts
of the memory map with FLATMEM and enable it for both arc and m68k. The
details are in the description of patches 10 (arc) and 13 (m68k).
This patch (of 13):
Enable SPARSEMEM support on alpha and deprecate DISCONTIGMEM.
The required changes are mostly around moving duplicated definitions of
page access and address conversion macros to a common place and making sure
they are available for all memory models.
The DISCONTINGMEM support is marked as BROKEN an will be removed in a
couple of releases.
Link: https://lkml.kernel.org/r/20201101170454.9567-1-rppt@kernel.org
Link: https://lkml.kernel.org/r/20201101170454.9567-2-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Geert Uytterhoeven <geert@linux-m68k.org>
Cc: Greg Ungerer <gerg@linux-m68k.org>
Cc: John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Matt Turner <mattst88@gmail.com>
Cc: Meelis Roos <mroos@linux.ee>
Cc: Michael Schmitz <schmitzmic@gmail.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/alpha/Kconfig | 8 ++++++++
arch/alpha/include/asm/mmzone.h | 14 ++------------
arch/alpha/include/asm/page.h | 7 ++++---
arch/alpha/include/asm/pgtable.h | 12 +++++-------
arch/alpha/include/asm/sparsemem.h | 18 ++++++++++++++++++
arch/alpha/kernel/setup.c | 1 +
6 files changed, 38 insertions(+), 22 deletions(-)
--- a/arch/alpha/include/asm/mmzone.h~alpha-switch-from-discontigmem-to-sparsemem
+++ a/arch/alpha/include/asm/mmzone.h
@@ -6,6 +6,8 @@
#ifndef _ASM_MMZONE_H_
#define _ASM_MMZONE_H_
+#ifdef CONFIG_DISCONTIGMEM
+
#include <asm/smp.h>
/*
@@ -45,8 +47,6 @@ PLAT_NODE_DATA_LOCALNR(unsigned long p,
}
#endif
-#ifdef CONFIG_DISCONTIGMEM
-
/*
* Following are macros that each numa implementation must define.
*/
@@ -68,11 +68,6 @@ PLAT_NODE_DATA_LOCALNR(unsigned long p,
/* XXX: FIXME -- nyc */
#define kern_addr_valid(kaddr) (0)
-#define virt_to_page(kaddr) pfn_to_page(__pa(kaddr) >> PAGE_SHIFT)
-
-#define pmd_page(pmd) (pfn_to_page(pmd_val(pmd) >> 32))
-#define pte_pfn(pte) (pte_val(pte) >> 32)
-
#define mk_pte(page, pgprot) \
({ \
pte_t pte; \
@@ -95,16 +90,11 @@ PLAT_NODE_DATA_LOCALNR(unsigned long p,
__xx; \
})
-#define page_to_pa(page) \
- (page_to_pfn(page) << PAGE_SHIFT)
-
#define pfn_to_nid(pfn) pa_to_nid(((u64)(pfn) << PAGE_SHIFT))
#define pfn_valid(pfn) \
(((pfn) - node_start_pfn(pfn_to_nid(pfn))) < \
node_spanned_pages(pfn_to_nid(pfn))) \
-#define virt_addr_valid(kaddr) pfn_valid((__pa(kaddr) >> PAGE_SHIFT))
-
#endif /* CONFIG_DISCONTIGMEM */
#endif /* _ASM_MMZONE_H_ */
--- a/arch/alpha/include/asm/page.h~alpha-switch-from-discontigmem-to-sparsemem
+++ a/arch/alpha/include/asm/page.h
@@ -83,12 +83,13 @@ typedef struct page *pgtable_t;
#define __pa(x) ((unsigned long) (x) - PAGE_OFFSET)
#define __va(x) ((void *)((unsigned long) (x) + PAGE_OFFSET))
-#ifndef CONFIG_DISCONTIGMEM
+
#define virt_to_page(kaddr) pfn_to_page(__pa(kaddr) >> PAGE_SHIFT)
+#define virt_addr_valid(kaddr) pfn_valid((__pa(kaddr) >> PAGE_SHIFT))
+#ifdef CONFIG_FLATMEM
#define pfn_valid(pfn) ((pfn) < max_mapnr)
-#define virt_addr_valid(kaddr) pfn_valid(__pa(kaddr) >> PAGE_SHIFT)
-#endif /* CONFIG_DISCONTIGMEM */
+#endif /* CONFIG_FLATMEM */
#include <asm-generic/memory_model.h>
#include <asm-generic/getorder.h>
--- a/arch/alpha/include/asm/pgtable.h~alpha-switch-from-discontigmem-to-sparsemem
+++ a/arch/alpha/include/asm/pgtable.h
@@ -203,10 +203,10 @@ extern unsigned long __zero_page(void);
* Conversion functions: convert a page and protection to a page entry,
* and a page entry and page directory to the page they refer to.
*/
-#ifndef CONFIG_DISCONTIGMEM
-#define page_to_pa(page) (((page) - mem_map) << PAGE_SHIFT)
-
+#define page_to_pa(page) (page_to_pfn(page) << PAGE_SHIFT)
#define pte_pfn(pte) (pte_val(pte) >> 32)
+
+#ifndef CONFIG_DISCONTIGMEM
#define pte_page(pte) pfn_to_page(pte_pfn(pte))
#define mk_pte(page, pgprot) \
({ \
@@ -236,10 +236,8 @@ pmd_page_vaddr(pmd_t pmd)
return ((pmd_val(pmd) & _PFN_MASK) >> (32-PAGE_SHIFT)) + PAGE_OFFSET;
}
-#ifndef CONFIG_DISCONTIGMEM
-#define pmd_page(pmd) (mem_map + ((pmd_val(pmd) & _PFN_MASK) >> 32))
-#define pud_page(pud) (mem_map + ((pud_val(pud) & _PFN_MASK) >> 32))
-#endif
+#define pmd_page(pmd) (pfn_to_page(pmd_val(pmd) >> 32))
+#define pud_page(pud) (pfn_to_page(pud_val(pud) >> 32))
extern inline unsigned long pud_page_vaddr(pud_t pgd)
{ return PAGE_OFFSET + ((pud_val(pgd) & _PFN_MASK) >> (32-PAGE_SHIFT)); }
--- /dev/null
+++ a/arch/alpha/include/asm/sparsemem.h
@@ -0,0 +1,18 @@
+/* SPDX-License-Identifier: GPL-2.0 */
+#ifndef _ASM_ALPHA_SPARSEMEM_H
+#define _ASM_ALPHA_SPARSEMEM_H
+
+#ifdef CONFIG_SPARSEMEM
+
+#define SECTION_SIZE_BITS 27
+
+/*
+ * According to "Alpha Architecture Reference Manual" physical
+ * addresses are at most 48 bits.
+ * https://download.majix.org/dec/alpha_arch_ref.pdf
+ */
+#define MAX_PHYSMEM_BITS 48
+
+#endif /* CONFIG_SPARSEMEM */
+
+#endif /* _ASM_ALPHA_SPARSEMEM_H */
--- a/arch/alpha/Kconfig~alpha-switch-from-discontigmem-to-sparsemem
+++ a/arch/alpha/Kconfig
@@ -40,6 +40,7 @@ config ALPHA
select CPU_NO_EFFICIENT_FFS if !ALPHA_EV67
select MMU_GATHER_NO_RANGE
select SET_FS
+ select SPARSEMEM_EXTREME if SPARSEMEM
help
The Alpha is a 64-bit general-purpose processor designed and
marketed by the Digital Equipment Corporation of blessed memory,
@@ -551,12 +552,19 @@ config NR_CPUS
config ARCH_DISCONTIGMEM_ENABLE
bool "Discontiguous Memory Support"
+ depends on BROKEN
help
Say Y to support efficient handling of discontiguous physical memory,
for architectures which are either NUMA (Non-Uniform Memory Access)
or have huge holes in the physical address space for other reasons.
See <file:Documentation/vm/numa.rst> for more.
+config ARCH_SPARSEMEM_ENABLE
+ bool "Sparse Memory Support"
+ help
+ Say Y to support efficient handling of discontiguous physical memory,
+ for systems that have huge holes in the physical address space.
+
config NUMA
bool "NUMA Support (EXPERIMENTAL)"
depends on DISCONTIGMEM && BROKEN
--- a/arch/alpha/kernel/setup.c~alpha-switch-from-discontigmem-to-sparsemem
+++ a/arch/alpha/kernel/setup.c
@@ -648,6 +648,7 @@ setup_arch(char **cmdline_p)
/* Find our memory. */
setup_memory(kernel_end);
memblock_set_bottom_up(true);
+ sparse_init();
/* First guess at cpu cache sizes. Do this before init_arch. */
determine_cpu_caches(cpu->type);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 107/200] ia64: remove custom __early_pfn_to_nid()
2020-12-15 3:02 incoming Andrew Morton
` (105 preceding siblings ...)
2020-12-15 3:09 ` [patch 106/200] alpha: switch from DISCONTIGMEM to SPARSEMEM Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:09 ` [patch 108/200] ia64: remove 'ifdef CONFIG_ZONE_DMA32' statements Andrew Morton
` (93 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: adobriyan, akpm, catalin.marinas, corbet, geert, gerg, glaubitz,
linux-mm, linux, mattst88, mm-commits, mroos, rppt, schmitzmic,
tony.luck, torvalds, vgupta, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: ia64: remove custom __early_pfn_to_nid()
The ia64 implementation of __early_pfn_to_nid() essentially relies on the
same data as the generic implementation.
The correspondence between memory ranges and nodes is set in memblock
during early memory initialization in register_active_ranges() function.
The initialization of sparsemem that requires early_pfn_to_nid() happens
later and it can use the memblock information like the other architectures.
Link: https://lkml.kernel.org/r/20201101170454.9567-3-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Geert Uytterhoeven <geert@linux-m68k.org>
Cc: Greg Ungerer <gerg@linux-m68k.org>
Cc: John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Matt Turner <mattst88@gmail.com>
Cc: Meelis Roos <mroos@linux.ee>
Cc: Michael Schmitz <schmitzmic@gmail.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/ia64/Kconfig | 3 ---
arch/ia64/mm/numa.c | 30 ------------------------------
include/linux/mm.h | 3 ---
include/linux/mmzone.h | 11 -----------
mm/page_alloc.c | 16 ++++++++++++----
5 files changed, 12 insertions(+), 51 deletions(-)
--- a/arch/ia64/Kconfig~ia64-remove-custom-__early_pfn_to_nid
+++ a/arch/ia64/Kconfig
@@ -342,9 +342,6 @@ config HOLES_IN_ZONE
bool
default y if VIRTUAL_MEM_MAP
-config HAVE_ARCH_EARLY_PFN_TO_NID
- def_bool NUMA && SPARSEMEM
-
config HAVE_ARCH_NODEDATA_EXTENSION
def_bool y
depends on NUMA
--- a/arch/ia64/mm/numa.c~ia64-remove-custom-__early_pfn_to_nid
+++ a/arch/ia64/mm/numa.c
@@ -58,36 +58,6 @@ paddr_to_nid(unsigned long paddr)
EXPORT_SYMBOL(paddr_to_nid);
#if defined(CONFIG_SPARSEMEM) && defined(CONFIG_NUMA)
-/*
- * Because of holes evaluate on section limits.
- * If the section of memory exists, then return the node where the section
- * resides. Otherwise return node 0 as the default. This is used by
- * SPARSEMEM to allocate the SPARSEMEM sectionmap on the NUMA node where
- * the section resides.
- */
-int __meminit __early_pfn_to_nid(unsigned long pfn,
- struct mminit_pfnnid_cache *state)
-{
- int i, section = pfn >> PFN_SECTION_SHIFT, ssec, esec;
-
- if (section >= state->last_start && section < state->last_end)
- return state->last_nid;
-
- for (i = 0; i < num_node_memblks; i++) {
- ssec = node_memblk[i].start_paddr >> PA_SECTION_SHIFT;
- esec = (node_memblk[i].start_paddr + node_memblk[i].size +
- ((1L << PA_SECTION_SHIFT) - 1)) >> PA_SECTION_SHIFT;
- if (section >= ssec && section < esec) {
- state->last_start = ssec;
- state->last_end = esec;
- state->last_nid = node_memblk[i].nid;
- return node_memblk[i].nid;
- }
- }
-
- return -1;
-}
-
void numa_clear_node(int cpu)
{
unmap_cpu_from_node(cpu, NUMA_NO_NODE);
--- a/include/linux/mm.h~ia64-remove-custom-__early_pfn_to_nid
+++ a/include/linux/mm.h
@@ -2434,9 +2434,6 @@ static inline int early_pfn_to_nid(unsig
#else
/* please see mm/page_alloc.c */
extern int __meminit early_pfn_to_nid(unsigned long pfn);
-/* there is a per-arch backend function. */
-extern int __meminit __early_pfn_to_nid(unsigned long pfn,
- struct mminit_pfnnid_cache *state);
#endif
extern void set_dma_reserve(unsigned long new_dma_reserve);
--- a/include/linux/mmzone.h~ia64-remove-custom-__early_pfn_to_nid
+++ a/include/linux/mmzone.h
@@ -1429,17 +1429,6 @@ void sparse_init(void);
#endif /* CONFIG_SPARSEMEM */
/*
- * During memory init memblocks map pfns to nids. The search is expensive and
- * this caches recent lookups. The implementation of __early_pfn_to_nid
- * may treat start/end as pfns or sections.
- */
-struct mminit_pfnnid_cache {
- unsigned long last_start;
- unsigned long last_end;
- int last_nid;
-};
-
-/*
* If it is possible to have holes within a MAX_ORDER_NR_PAGES, then we
* need to check pfn validity within that MAX_ORDER_NR_PAGES block.
* pfn_valid_within() should be used in this case; we optimise this away
--- a/mm/page_alloc.c~ia64-remove-custom-__early_pfn_to_nid
+++ a/mm/page_alloc.c
@@ -1559,14 +1559,23 @@ void __free_pages_core(struct page *page
#ifdef CONFIG_NEED_MULTIPLE_NODES
-static struct mminit_pfnnid_cache early_pfnnid_cache __meminitdata;
+/*
+ * During memory init memblocks map pfns to nids. The search is expensive and
+ * this caches recent lookups. The implementation of __early_pfn_to_nid
+ * treats start/end as pfns.
+ */
+struct mminit_pfnnid_cache {
+ unsigned long last_start;
+ unsigned long last_end;
+ int last_nid;
+};
-#ifndef CONFIG_HAVE_ARCH_EARLY_PFN_TO_NID
+static struct mminit_pfnnid_cache early_pfnnid_cache __meminitdata;
/*
* Required by SPARSEMEM. Given a PFN, return what node the PFN is on.
*/
-int __meminit __early_pfn_to_nid(unsigned long pfn,
+static int __meminit __early_pfn_to_nid(unsigned long pfn,
struct mminit_pfnnid_cache *state)
{
unsigned long start_pfn, end_pfn;
@@ -1584,7 +1593,6 @@ int __meminit __early_pfn_to_nid(unsigne
return nid;
}
-#endif /* CONFIG_HAVE_ARCH_EARLY_PFN_TO_NID */
int __meminit early_pfn_to_nid(unsigned long pfn)
{
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 108/200] ia64: remove 'ifdef CONFIG_ZONE_DMA32' statements
2020-12-15 3:02 incoming Andrew Morton
` (106 preceding siblings ...)
2020-12-15 3:09 ` [patch 107/200] ia64: remove custom __early_pfn_to_nid() Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:09 ` [patch 109/200] ia64: discontig: paging_init(): remove local max_pfn calculation Andrew Morton
` (92 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: adobriyan, akpm, catalin.marinas, corbet, geert, gerg, glaubitz,
linux-mm, linux, mattst88, mm-commits, mroos, rppt, schmitzmic,
tony.luck, torvalds, vgupta, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: ia64: remove 'ifdef CONFIG_ZONE_DMA32' statements
After the removal of SN2 platform (commit cf07cb1ff4ea ("ia64: remove
support for the SGI SN2 platform") IA-64 always has ZONE_DMA32 and there is
no point to guard code with this configuration option.
Remove ifdefery associated with CONFIG_ZONE_DMA32
Link: https://lkml.kernel.org/r/20201101170454.9567-4-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Geert Uytterhoeven <geert@linux-m68k.org>
Cc: Greg Ungerer <gerg@linux-m68k.org>
Cc: John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Matt Turner <mattst88@gmail.com>
Cc: Meelis Roos <mroos@linux.ee>
Cc: Michael Schmitz <schmitzmic@gmail.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/ia64/mm/contig.c | 2 --
arch/ia64/mm/discontig.c | 2 --
2 files changed, 4 deletions(-)
--- a/arch/ia64/mm/contig.c~ia64-remove-ifdef-config_zone_dma32-statements
+++ a/arch/ia64/mm/contig.c
@@ -177,10 +177,8 @@ paging_init (void)
unsigned long max_zone_pfns[MAX_NR_ZONES];
memset(max_zone_pfns, 0, sizeof(max_zone_pfns));
-#ifdef CONFIG_ZONE_DMA32
max_dma = virt_to_phys((void *) MAX_DMA_ADDRESS) >> PAGE_SHIFT;
max_zone_pfns[ZONE_DMA32] = max_dma;
-#endif
max_zone_pfns[ZONE_NORMAL] = max_low_pfn;
#ifdef CONFIG_VIRTUAL_MEM_MAP
--- a/arch/ia64/mm/discontig.c~ia64-remove-ifdef-config_zone_dma32-statements
+++ a/arch/ia64/mm/discontig.c
@@ -621,9 +621,7 @@ void __init paging_init(void)
}
memset(max_zone_pfns, 0, sizeof(max_zone_pfns));
-#ifdef CONFIG_ZONE_DMA32
max_zone_pfns[ZONE_DMA32] = max_dma;
-#endif
max_zone_pfns[ZONE_NORMAL] = max_pfn;
free_area_init(max_zone_pfns);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 109/200] ia64: discontig: paging_init(): remove local max_pfn calculation
2020-12-15 3:02 incoming Andrew Morton
` (107 preceding siblings ...)
2020-12-15 3:09 ` [patch 108/200] ia64: remove 'ifdef CONFIG_ZONE_DMA32' statements Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:09 ` [patch 110/200] ia64: split virtual map initialization out of paging_init() Andrew Morton
` (91 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: adobriyan, akpm, catalin.marinas, corbet, geert, gerg, glaubitz,
linux-mm, linux, mattst88, mm-commits, mroos, rppt, schmitzmic,
tony.luck, torvalds, vgupta, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: ia64: discontig: paging_init(): remove local max_pfn calculation
The maximal PFN in the system is calculated during find_memory() time and
it is stored at max_low_pfn then.
Use this value in paging_init() and remove the redundant detection of
max_pfn in that function.
Link: https://lkml.kernel.org/r/20201101170454.9567-5-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Geert Uytterhoeven <geert@linux-m68k.org>
Cc: Greg Ungerer <gerg@linux-m68k.org>
Cc: John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Matt Turner <mattst88@gmail.com>
Cc: Meelis Roos <mroos@linux.ee>
Cc: Michael Schmitz <schmitzmic@gmail.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/ia64/mm/discontig.c | 5 +----
1 file changed, 1 insertion(+), 4 deletions(-)
--- a/arch/ia64/mm/discontig.c~ia64-discontig-paging_init-remove-local-max_pfn-calculation
+++ a/arch/ia64/mm/discontig.c
@@ -594,7 +594,6 @@ void __init paging_init(void)
{
unsigned long max_dma;
unsigned long pfn_offset = 0;
- unsigned long max_pfn = 0;
int node;
unsigned long max_zone_pfns[MAX_NR_ZONES];
@@ -616,13 +615,11 @@ void __init paging_init(void)
#ifdef CONFIG_VIRTUAL_MEM_MAP
NODE_DATA(node)->node_mem_map = vmem_map + pfn_offset;
#endif
- if (mem_data[node].max_pfn > max_pfn)
- max_pfn = mem_data[node].max_pfn;
}
memset(max_zone_pfns, 0, sizeof(max_zone_pfns));
max_zone_pfns[ZONE_DMA32] = max_dma;
- max_zone_pfns[ZONE_NORMAL] = max_pfn;
+ max_zone_pfns[ZONE_NORMAL] = max_low_pfn;
free_area_init(max_zone_pfns);
zero_page_memmap_ptr = virt_to_page(ia64_imva(empty_zero_page));
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 110/200] ia64: split virtual map initialization out of paging_init()
2020-12-15 3:02 incoming Andrew Morton
` (108 preceding siblings ...)
2020-12-15 3:09 ` [patch 109/200] ia64: discontig: paging_init(): remove local max_pfn calculation Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:09 ` [patch 111/200] ia64: forbid using VIRTUAL_MEM_MAP with FLATMEM Andrew Morton
` (90 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: adobriyan, akpm, catalin.marinas, corbet, geert, gerg, glaubitz,
linux-mm, linux, mattst88, mm-commits, mroos, rppt, schmitzmic,
tony.luck, torvalds, vgupta, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: ia64: split virtual map initialization out of paging_init()
For both FLATMEM and DISCONTIGMEM/SPARSEMEM the virtual map initialization
is spread over paging_init() for no good reason.
Split out the bits related to virtual map initialization to a helper
functions, one for FLATMEM and another for !FLATMEM configurations.
Link: https://lkml.kernel.org/r/20201101170454.9567-6-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Geert Uytterhoeven <geert@linux-m68k.org>
Cc: Greg Ungerer <gerg@linux-m68k.org>
Cc: John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Matt Turner <mattst88@gmail.com>
Cc: Meelis Roos <mroos@linux.ee>
Cc: Michael Schmitz <schmitzmic@gmail.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/ia64/mm/contig.c | 34 ++++++++++++++++++++--------------
arch/ia64/mm/discontig.c | 37 ++++++++++++++++++++-----------------
2 files changed, 40 insertions(+), 31 deletions(-)
--- a/arch/ia64/mm/contig.c~ia64-split-virtual-map-initialization-out-of-paging_init
+++ a/arch/ia64/mm/contig.c
@@ -166,21 +166,8 @@ find_memory (void)
alloc_per_cpu_data();
}
-/*
- * Set up the page tables.
- */
-
-void __init
-paging_init (void)
+static void __init virtual_map_init(void)
{
- unsigned long max_dma;
- unsigned long max_zone_pfns[MAX_NR_ZONES];
-
- memset(max_zone_pfns, 0, sizeof(max_zone_pfns));
- max_dma = virt_to_phys((void *) MAX_DMA_ADDRESS) >> PAGE_SHIFT;
- max_zone_pfns[ZONE_DMA32] = max_dma;
- max_zone_pfns[ZONE_NORMAL] = max_low_pfn;
-
#ifdef CONFIG_VIRTUAL_MEM_MAP
efi_memmap_walk(find_largest_hole, (u64 *)&max_gap);
if (max_gap < LARGE_GAP) {
@@ -206,6 +193,25 @@ paging_init (void)
printk("Virtual mem_map starts at 0x%p\n", mem_map);
}
#endif /* !CONFIG_VIRTUAL_MEM_MAP */
+}
+
+/*
+ * Set up the page tables.
+ */
+
+void __init
+paging_init (void)
+{
+ unsigned long max_dma;
+ unsigned long max_zone_pfns[MAX_NR_ZONES];
+
+ memset(max_zone_pfns, 0, sizeof(max_zone_pfns));
+ max_dma = virt_to_phys((void *) MAX_DMA_ADDRESS) >> PAGE_SHIFT;
+ max_zone_pfns[ZONE_DMA32] = max_dma;
+ max_zone_pfns[ZONE_NORMAL] = max_low_pfn;
+
+ virtual_map_init();
+
free_area_init(max_zone_pfns);
zero_page_memmap_ptr = virt_to_page(ia64_imva(empty_zero_page));
}
--- a/arch/ia64/mm/discontig.c~ia64-split-virtual-map-initialization-out-of-paging_init
+++ a/arch/ia64/mm/discontig.c
@@ -584,6 +584,25 @@ void call_pernode_memory(unsigned long s
}
}
+static void __init virtual_map_init(void)
+{
+#ifdef CONFIG_VIRTUAL_MEM_MAP
+ int node;
+
+ VMALLOC_END -= PAGE_ALIGN(ALIGN(max_low_pfn, MAX_ORDER_NR_PAGES) *
+ sizeof(struct page));
+ vmem_map = (struct page *) VMALLOC_END;
+ efi_memmap_walk(create_mem_map_page_table, NULL);
+ printk("Virtual mem_map starts at 0x%p\n", vmem_map);
+
+ for_each_online_node(node) {
+ unsigned long pfn_offset = mem_data[node].min_pfn;
+
+ NODE_DATA(node)->node_mem_map = vmem_map + pfn_offset;
+ }
+#endif
+}
+
/**
* paging_init - setup page tables
*
@@ -593,29 +612,13 @@ void call_pernode_memory(unsigned long s
void __init paging_init(void)
{
unsigned long max_dma;
- unsigned long pfn_offset = 0;
- int node;
unsigned long max_zone_pfns[MAX_NR_ZONES];
max_dma = virt_to_phys((void *) MAX_DMA_ADDRESS) >> PAGE_SHIFT;
sparse_init();
-#ifdef CONFIG_VIRTUAL_MEM_MAP
- VMALLOC_END -= PAGE_ALIGN(ALIGN(max_low_pfn, MAX_ORDER_NR_PAGES) *
- sizeof(struct page));
- vmem_map = (struct page *) VMALLOC_END;
- efi_memmap_walk(create_mem_map_page_table, NULL);
- printk("Virtual mem_map starts at 0x%p\n", vmem_map);
-#endif
-
- for_each_online_node(node) {
- pfn_offset = mem_data[node].min_pfn;
-
-#ifdef CONFIG_VIRTUAL_MEM_MAP
- NODE_DATA(node)->node_mem_map = vmem_map + pfn_offset;
-#endif
- }
+ virtual_map_init();
memset(max_zone_pfns, 0, sizeof(max_zone_pfns));
max_zone_pfns[ZONE_DMA32] = max_dma;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 111/200] ia64: forbid using VIRTUAL_MEM_MAP with FLATMEM
2020-12-15 3:02 incoming Andrew Morton
` (109 preceding siblings ...)
2020-12-15 3:09 ` [patch 110/200] ia64: split virtual map initialization out of paging_init() Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:09 ` [patch 112/200] ia64: make SPARSEMEM default and disable DISCONTIGMEM Andrew Morton
` (89 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: adobriyan, akpm, catalin.marinas, corbet, geert, gerg, glaubitz,
linux-mm, linux, mattst88, mm-commits, mroos, rppt, schmitzmic,
tony.luck, torvalds, vgupta, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: ia64: forbid using VIRTUAL_MEM_MAP with FLATMEM
Virtual memory map was intended to avoid wasting memory on the memory map
on systems with large holes in the physical memory layout. Long ago it been
superseded first by DISCONTIGMEM and then by SPARSEMEM. Moreover,
SPARSEMEM_VMEMMAP provide the same functionality in much more portable way.
As the first step to removing the VIRTUAL_MEM_MAP forbid it's usage with
FLATMEM and panic on systems with large holes in the physical memory
layout that try to run FLATMEM kernels.
Link: https://lkml.kernel.org/r/20201101170454.9567-7-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Geert Uytterhoeven <geert@linux-m68k.org>
Cc: Greg Ungerer <gerg@linux-m68k.org>
Cc: John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Matt Turner <mattst88@gmail.com>
Cc: Meelis Roos <mroos@linux.ee>
Cc: Michael Schmitz <schmitzmic@gmail.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/ia64/Kconfig | 2 -
arch/ia64/include/asm/meminit.h | 2 -
arch/ia64/mm/contig.c | 52 +++++++++++++-----------------
arch/ia64/mm/init.c | 14 --------
4 files changed, 24 insertions(+), 46 deletions(-)
--- a/arch/ia64/include/asm/meminit.h~ia64-forbid-using-virtual_mem_map-with-flatmem
+++ a/arch/ia64/include/asm/meminit.h
@@ -59,10 +59,8 @@ extern int reserve_elfcorehdr(u64 *start
extern int register_active_ranges(u64 start, u64 len, int nid);
#ifdef CONFIG_VIRTUAL_MEM_MAP
-# define LARGE_GAP 0x40000000 /* Use virtual mem map if hole is > than this */
extern unsigned long VMALLOC_END;
extern struct page *vmem_map;
- extern int find_largest_hole(u64 start, u64 end, void *arg);
extern int create_mem_map_page_table(u64 start, u64 end, void *arg);
extern int vmemmap_find_next_valid_pfn(int, int);
#else
--- a/arch/ia64/Kconfig~ia64-forbid-using-virtual_mem_map-with-flatmem
+++ a/arch/ia64/Kconfig
@@ -329,7 +329,7 @@ config NODES_SHIFT
# VIRTUAL_MEM_MAP has been retained for historical reasons.
config VIRTUAL_MEM_MAP
bool "Virtual mem map"
- depends on !SPARSEMEM
+ depends on !SPARSEMEM && !FLATMEM
default y
help
Say Y to compile the kernel with support for a virtual mem map.
--- a/arch/ia64/mm/contig.c~ia64-forbid-using-virtual_mem_map-with-flatmem
+++ a/arch/ia64/mm/contig.c
@@ -19,15 +19,12 @@
#include <linux/mm.h>
#include <linux/nmi.h>
#include <linux/swap.h>
+#include <linux/sizes.h>
#include <asm/meminit.h>
#include <asm/sections.h>
#include <asm/mca.h>
-#ifdef CONFIG_VIRTUAL_MEM_MAP
-static unsigned long max_gap;
-#endif
-
/* physical address where the bootmem map is located */
unsigned long bootmap_start;
@@ -166,33 +163,30 @@ find_memory (void)
alloc_per_cpu_data();
}
-static void __init virtual_map_init(void)
+static int __init find_largest_hole(u64 start, u64 end, void *arg)
{
-#ifdef CONFIG_VIRTUAL_MEM_MAP
- efi_memmap_walk(find_largest_hole, (u64 *)&max_gap);
- if (max_gap < LARGE_GAP) {
- vmem_map = (struct page *) 0;
- } else {
- unsigned long map_size;
-
- /* allocate virtual_mem_map */
-
- map_size = PAGE_ALIGN(ALIGN(max_low_pfn, MAX_ORDER_NR_PAGES) *
- sizeof(struct page));
- VMALLOC_END -= map_size;
- vmem_map = (struct page *) VMALLOC_END;
- efi_memmap_walk(create_mem_map_page_table, NULL);
+ u64 *max_gap = arg;
- /*
- * alloc_node_mem_map makes an adjustment for mem_map
- * which isn't compatible with vmem_map.
- */
- NODE_DATA(0)->node_mem_map = vmem_map +
- find_min_pfn_with_active_regions();
+ static u64 last_end = PAGE_OFFSET;
- printk("Virtual mem_map starts at 0x%p\n", mem_map);
- }
-#endif /* !CONFIG_VIRTUAL_MEM_MAP */
+ /* NOTE: this algorithm assumes efi memmap table is ordered */
+
+ if (*max_gap < (start - last_end))
+ *max_gap = start - last_end;
+ last_end = end;
+ return 0;
+}
+
+static void __init verify_gap_absence(void)
+{
+ unsigned long max_gap;
+
+ /* Forbid FLATMEM if hole is > than 1G */
+ efi_memmap_walk(find_largest_hole, (u64 *)&max_gap);
+ if (max_gap >= SZ_1G)
+ panic("Cannot use FLATMEM with %ldMB hole\n"
+ "Please switch over to SPARSEMEM\n",
+ (max_gap >> 20));
}
/*
@@ -210,7 +204,7 @@ paging_init (void)
max_zone_pfns[ZONE_DMA32] = max_dma;
max_zone_pfns[ZONE_NORMAL] = max_low_pfn;
- virtual_map_init();
+ verify_gap_absence();
free_area_init(max_zone_pfns);
zero_page_memmap_ptr = virt_to_page(ia64_imva(empty_zero_page));
--- a/arch/ia64/mm/init.c~ia64-forbid-using-virtual_mem_map-with-flatmem
+++ a/arch/ia64/mm/init.c
@@ -574,20 +574,6 @@ ia64_pfn_valid (unsigned long pfn)
}
EXPORT_SYMBOL(ia64_pfn_valid);
-int __init find_largest_hole(u64 start, u64 end, void *arg)
-{
- u64 *max_gap = arg;
-
- static u64 last_end = PAGE_OFFSET;
-
- /* NOTE: this algorithm assumes efi memmap table is ordered */
-
- if (*max_gap < (start - last_end))
- *max_gap = start - last_end;
- last_end = end;
- return 0;
-}
-
#endif /* CONFIG_VIRTUAL_MEM_MAP */
int __init register_active_ranges(u64 start, u64 len, int nid)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 112/200] ia64: make SPARSEMEM default and disable DISCONTIGMEM
2020-12-15 3:02 incoming Andrew Morton
` (110 preceding siblings ...)
2020-12-15 3:09 ` [patch 111/200] ia64: forbid using VIRTUAL_MEM_MAP with FLATMEM Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:09 ` [patch 113/200] arm: remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL Andrew Morton
` (88 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: adobriyan, akpm, catalin.marinas, corbet, geert, gerg, glaubitz,
linux-mm, linux, mattst88, mm-commits, mroos, rppt, schmitzmic,
tony.luck, torvalds, vgupta, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: ia64: make SPARSEMEM default and disable DISCONTIGMEM
SPARSEMEM memory model suitable for systems with large holes in their
phyiscal memory layout. With SPARSEMEM_VMEMMAP enabled it provides
pfn_to_page() and page_to_pfn() as fast as FLATMEM.
Make it the default memory model for IA-64 and disable DISCONTIGMEM which
is considered obsolete for quite some time.
Link: https://lkml.kernel.org/r/20201101170454.9567-8-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Geert Uytterhoeven <geert@linux-m68k.org>
Cc: Greg Ungerer <gerg@linux-m68k.org>
Cc: John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Matt Turner <mattst88@gmail.com>
Cc: Meelis Roos <mroos@linux.ee>
Cc: Michael Schmitz <schmitzmic@gmail.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/ia64/Kconfig | 6 +++---
1 file changed, 3 insertions(+), 3 deletions(-)
--- a/arch/ia64/Kconfig~ia64-make-sparsemem-default-and-disable-discontigmem
+++ a/arch/ia64/Kconfig
@@ -288,6 +288,7 @@ config ARCH_SELECT_MEMORY_MODEL
config ARCH_DISCONTIGMEM_ENABLE
def_bool y
+ depends on BROKEN
help
Say Y to support efficient handling of discontiguous physical memory,
for architectures which are either NUMA (Non-Uniform Memory Access)
@@ -299,12 +300,11 @@ config ARCH_FLATMEM_ENABLE
config ARCH_SPARSEMEM_ENABLE
def_bool y
- depends on ARCH_DISCONTIGMEM_ENABLE
select SPARSEMEM_VMEMMAP_ENABLE
-config ARCH_DISCONTIGMEM_DEFAULT
+config ARCH_SPARSEMEM_DEFAULT
def_bool y
- depends on ARCH_DISCONTIGMEM_ENABLE
+ depends on ARCH_SPARSEMEM_ENABLE
config NUMA
bool "NUMA support"
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 113/200] arm: remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL
2020-12-15 3:02 incoming Andrew Morton
` (111 preceding siblings ...)
2020-12-15 3:09 ` [patch 112/200] ia64: make SPARSEMEM default and disable DISCONTIGMEM Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:09 ` [patch 114/200] arm, arm64: move free_unused_memmap() to generic mm Andrew Morton
` (87 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: adobriyan, akpm, catalin.marinas, corbet, geert, gerg, glaubitz,
linux-mm, linux, mattst88, mm-commits, mroos, rppt, schmitzmic,
tony.luck, torvalds, vgupta, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: arm: remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL
ARM is the only architecture that defines CONFIG_ARCH_HAS_HOLES_MEMORYMODEL
which in turn enables memmap_valid_within() function that is intended to
verify existence of struct page associated with a pfn when there are holes
in the memory map.
However, the ARCH_HAS_HOLES_MEMORYMODEL also enables HAVE_ARCH_PFN_VALID
and arch-specific pfn_valid() implementation that also deals with the holes
in the memory map.
The only two users of memmap_valid_within() call this function after
a call to pfn_valid() so the memmap_valid_within() check becomes redundant.
Remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL and memmap_valid_within() and rely
entirely on ARM's implementation of pfn_valid() that is now enabled
unconditionally.
Link: https://lkml.kernel.org/r/20201101170454.9567-9-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Geert Uytterhoeven <geert@linux-m68k.org>
Cc: Greg Ungerer <gerg@linux-m68k.org>
Cc: John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Matt Turner <mattst88@gmail.com>
Cc: Meelis Roos <mroos@linux.ee>
Cc: Michael Schmitz <schmitzmic@gmail.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/vm/memory-model.rst | 3 --
arch/arm/Kconfig | 8 +------
arch/arm/mach-bcm/Kconfig | 1
arch/arm/mach-davinci/Kconfig | 1
arch/arm/mach-exynos/Kconfig | 1
arch/arm/mach-highbank/Kconfig | 1
arch/arm/mach-omap2/Kconfig | 1
arch/arm/mach-s5pv210/Kconfig | 1
arch/arm/mach-tango/Kconfig | 1
fs/proc/kcore.c | 2 -
include/linux/mmzone.h | 31 ----------------------------
mm/mmzone.c | 14 ------------
mm/vmstat.c | 4 ---
13 files changed, 3 insertions(+), 66 deletions(-)
--- a/arch/arm/Kconfig~arm-remove-config_arch_has_holes_memorymodel
+++ a/arch/arm/Kconfig
@@ -25,7 +25,7 @@ config ARM
select ARCH_HAS_TICK_BROADCAST if GENERIC_CLOCKEVENTS_BROADCAST
select ARCH_HAVE_CUSTOM_GPIO_H
select ARCH_HAS_GCOV_PROFILE_ALL
- select ARCH_KEEP_MEMBLOCK if HAVE_ARCH_PFN_VALID || KEXEC
+ select ARCH_KEEP_MEMBLOCK
select ARCH_MIGHT_HAVE_PC_PARPORT
select ARCH_NO_SG_CHAIN if !ARM_HAS_SG_CHAIN
select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
@@ -520,7 +520,6 @@ config ARCH_S3C24XX
config ARCH_OMAP1
bool "TI OMAP1"
depends on MMU
- select ARCH_HAS_HOLES_MEMORYMODEL
select ARCH_OMAP
select CLKDEV_LOOKUP
select CLKSRC_MMIO
@@ -1480,9 +1479,6 @@ config OABI_COMPAT
UNPREDICTABLE (in fact it can be predicted that it won't work
at all). If in doubt say N.
-config ARCH_HAS_HOLES_MEMORYMODEL
- bool
-
config ARCH_SELECT_MEMORY_MODEL
bool
@@ -1494,7 +1490,7 @@ config ARCH_SPARSEMEM_ENABLE
select SPARSEMEM_STATIC if SPARSEMEM
config HAVE_ARCH_PFN_VALID
- def_bool ARCH_HAS_HOLES_MEMORYMODEL || !SPARSEMEM
+ def_bool y
config HIGHMEM
bool "High Memory Support"
--- a/arch/arm/mach-bcm/Kconfig~arm-remove-config_arch_has_holes_memorymodel
+++ a/arch/arm/mach-bcm/Kconfig
@@ -211,7 +211,6 @@ config ARCH_BRCMSTB
select BCM7038_L1_IRQ
select BRCMSTB_L2_IRQ
select BCM7120_L2_IRQ
- select ARCH_HAS_HOLES_MEMORYMODEL
select ZONE_DMA if ARM_LPAE
select SOC_BRCMSTB
select SOC_BUS
--- a/arch/arm/mach-davinci/Kconfig~arm-remove-config_arch_has_holes_memorymodel
+++ a/arch/arm/mach-davinci/Kconfig
@@ -5,7 +5,6 @@ menuconfig ARCH_DAVINCI
depends on ARCH_MULTI_V5
select DAVINCI_TIMER
select ZONE_DMA
- select ARCH_HAS_HOLES_MEMORYMODEL
select PM_GENERIC_DOMAINS if PM
select PM_GENERIC_DOMAINS_OF if PM && OF
select REGMAP_MMIO
--- a/arch/arm/mach-exynos/Kconfig~arm-remove-config_arch_has_holes_memorymodel
+++ a/arch/arm/mach-exynos/Kconfig
@@ -8,7 +8,6 @@
menuconfig ARCH_EXYNOS
bool "Samsung Exynos"
depends on ARCH_MULTI_V7
- select ARCH_HAS_HOLES_MEMORYMODEL
select ARCH_SUPPORTS_BIG_ENDIAN
select ARM_AMBA
select ARM_GIC
--- a/arch/arm/mach-highbank/Kconfig~arm-remove-config_arch_has_holes_memorymodel
+++ a/arch/arm/mach-highbank/Kconfig
@@ -2,7 +2,6 @@
config ARCH_HIGHBANK
bool "Calxeda ECX-1000/2000 (Highbank/Midway)"
depends on ARCH_MULTI_V7
- select ARCH_HAS_HOLES_MEMORYMODEL
select ARCH_SUPPORTS_BIG_ENDIAN
select ARM_AMBA
select ARM_ERRATA_764369 if SMP
--- a/arch/arm/mach-omap2/Kconfig~arm-remove-config_arch_has_holes_memorymodel
+++ a/arch/arm/mach-omap2/Kconfig
@@ -93,7 +93,6 @@ config SOC_DRA7XX
config ARCH_OMAP2PLUS
bool
select ARCH_HAS_BANDGAP
- select ARCH_HAS_HOLES_MEMORYMODEL
select ARCH_HAS_RESET_CONTROLLER
select ARCH_OMAP
select CLKSRC_MMIO
--- a/arch/arm/mach-s5pv210/Kconfig~arm-remove-config_arch_has_holes_memorymodel
+++ a/arch/arm/mach-s5pv210/Kconfig
@@ -8,7 +8,6 @@
config ARCH_S5PV210
bool "Samsung S5PV210/S5PC110"
depends on ARCH_MULTI_V7
- select ARCH_HAS_HOLES_MEMORYMODEL
select ARM_VIC
select CLKSRC_SAMSUNG_PWM
select COMMON_CLK_SAMSUNG
--- a/arch/arm/mach-tango/Kconfig~arm-remove-config_arch_has_holes_memorymodel
+++ a/arch/arm/mach-tango/Kconfig
@@ -3,7 +3,6 @@ config ARCH_TANGO
bool "Sigma Designs Tango4 (SMP87xx)"
depends on ARCH_MULTI_V7
# Cortex-A9 MPCore r3p0, PL310 r3p2
- select ARCH_HAS_HOLES_MEMORYMODEL
select ARM_ERRATA_754322
select ARM_ERRATA_764369 if SMP
select ARM_ERRATA_775420
--- a/Documentation/vm/memory-model.rst~arm-remove-config_arch_has_holes_memorymodel
+++ a/Documentation/vm/memory-model.rst
@@ -51,8 +51,7 @@ call :c:func:`free_area_init` function.
usable until the call to :c:func:`memblock_free_all` that hands all the
memory to the page allocator.
-If an architecture enables `CONFIG_ARCH_HAS_HOLES_MEMORYMODEL` option,
-it may free parts of the `mem_map` array that do not cover the
+An architecture may free parts of the `mem_map` array that do not cover the
actual physical pages. In such case, the architecture specific
:c:func:`pfn_valid` implementation should take the holes in the
`mem_map` into account.
--- a/fs/proc/kcore.c~arm-remove-config_arch_has_holes_memorymodel
+++ a/fs/proc/kcore.c
@@ -193,8 +193,6 @@ kclist_add_private(unsigned long pfn, un
return 1;
p = pfn_to_page(pfn);
- if (!memmap_valid_within(pfn, p, page_zone(p)))
- return 1;
ent = kmalloc(sizeof(*ent), GFP_KERNEL);
if (!ent)
--- a/include/linux/mmzone.h~arm-remove-config_arch_has_holes_memorymodel
+++ a/include/linux/mmzone.h
@@ -1440,37 +1440,6 @@ void sparse_init(void);
#define pfn_valid_within(pfn) (1)
#endif
-#ifdef CONFIG_ARCH_HAS_HOLES_MEMORYMODEL
-/*
- * pfn_valid() is meant to be able to tell if a given PFN has valid memmap
- * associated with it or not. This means that a struct page exists for this
- * pfn. The caller cannot assume the page is fully initialized in general.
- * Hotplugable pages might not have been onlined yet. pfn_to_online_page()
- * will ensure the struct page is fully online and initialized. Special pages
- * (e.g. ZONE_DEVICE) are never onlined and should be treated accordingly.
- *
- * In FLATMEM, it is expected that holes always have valid memmap as long as
- * there is valid PFNs either side of the hole. In SPARSEMEM, it is assumed
- * that a valid section has a memmap for the entire section.
- *
- * However, an ARM, and maybe other embedded architectures in the future
- * free memmap backing holes to save memory on the assumption the memmap is
- * never used. The page_zone linkages are then broken even though pfn_valid()
- * returns true. A walker of the full memmap must then do this additional
- * check to ensure the memmap they are looking at is sane by making sure
- * the zone and PFN linkages are still valid. This is expensive, but walkers
- * of the full memmap are extremely rare.
- */
-bool memmap_valid_within(unsigned long pfn,
- struct page *page, struct zone *zone);
-#else
-static inline bool memmap_valid_within(unsigned long pfn,
- struct page *page, struct zone *zone)
-{
- return true;
-}
-#endif /* CONFIG_ARCH_HAS_HOLES_MEMORYMODEL */
-
#endif /* !__GENERATING_BOUNDS.H */
#endif /* !__ASSEMBLY__ */
#endif /* _LINUX_MMZONE_H */
--- a/mm/mmzone.c~arm-remove-config_arch_has_holes_memorymodel
+++ a/mm/mmzone.c
@@ -72,20 +72,6 @@ struct zoneref *__next_zones_zonelist(st
return z;
}
-#ifdef CONFIG_ARCH_HAS_HOLES_MEMORYMODEL
-bool memmap_valid_within(unsigned long pfn,
- struct page *page, struct zone *zone)
-{
- if (page_to_pfn(page) != pfn)
- return false;
-
- if (page_zone(page) != zone)
- return false;
-
- return true;
-}
-#endif /* CONFIG_ARCH_HAS_HOLES_MEMORYMODEL */
-
void lruvec_init(struct lruvec *lruvec)
{
enum lru_list lru;
--- a/mm/vmstat.c~arm-remove-config_arch_has_holes_memorymodel
+++ a/mm/vmstat.c
@@ -1503,10 +1503,6 @@ static void pagetypeinfo_showblockcount_
if (!page)
continue;
- /* Watch for unexpected holes punched in the memmap */
- if (!memmap_valid_within(pfn, page, zone))
- continue;
-
if (page_zone(page) != zone)
continue;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 114/200] arm, arm64: move free_unused_memmap() to generic mm
2020-12-15 3:02 incoming Andrew Morton
` (112 preceding siblings ...)
2020-12-15 3:09 ` [patch 113/200] arm: remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL Andrew Morton
@ 2020-12-15 3:09 ` Andrew Morton
2020-12-15 3:10 ` [patch 115/200] arc: use FLATMEM with freeing of unused memory map instead of DISCONTIGMEM Andrew Morton
` (86 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:09 UTC (permalink / raw)
To: adobriyan, akpm, catalin.marinas, corbet, geert, gerg, glaubitz,
linux-mm, linux, mattst88, mm-commits, mroos, rppt, schmitzmic,
tony.luck, torvalds, vgupta, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: arm, arm64: move free_unused_memmap() to generic mm
ARM and ARM64 free unused parts of the memory map just before the
initialization of the page allocator. To allow holes in the memory map both
architectures overload pfn_valid() and define HAVE_ARCH_PFN_VALID.
Allowing holes in the memory map for FLATMEM may be useful for small
machines, such as ARC and m68k and will enable those architectures to cease
using DISCONTIGMEM and still support more than one memory bank.
Move the functions that free unused memory map to generic mm and enable
them in case HAVE_ARCH_PFN_VALID=y.
Link: https://lkml.kernel.org/r/20201101170454.9567-10-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com> [arm64]
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Geert Uytterhoeven <geert@linux-m68k.org>
Cc: Greg Ungerer <gerg@linux-m68k.org>
Cc: John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Matt Turner <mattst88@gmail.com>
Cc: Meelis Roos <mroos@linux.ee>
Cc: Michael Schmitz <schmitzmic@gmail.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/Kconfig | 3 +
arch/arm/Kconfig | 4 --
arch/arm/mm/init.c | 78 ---------------------------------------
arch/arm64/Kconfig | 4 --
arch/arm64/mm/init.c | 68 ----------------------------------
mm/memblock.c | 80 +++++++++++++++++++++++++++++++++++++++++
6 files changed, 85 insertions(+), 152 deletions(-)
--- a/arch/arm64/Kconfig~arm-arm64-move-free_unused_memmap-to-generic-mm
+++ a/arch/arm64/Kconfig
@@ -140,6 +140,7 @@ config ARM64
select HAVE_ARCH_KGDB
select HAVE_ARCH_MMAP_RND_BITS
select HAVE_ARCH_MMAP_RND_COMPAT_BITS if COMPAT
+ select HAVE_ARCH_PFN_VALID
select HAVE_ARCH_PREL32_RELOCATIONS
select HAVE_ARCH_SECCOMP_FILTER
select HAVE_ARCH_STACKLEAK
@@ -1043,9 +1044,6 @@ config ARCH_SELECT_MEMORY_MODEL
config ARCH_FLATMEM_ENABLE
def_bool !NUMA
-config HAVE_ARCH_PFN_VALID
- def_bool y
-
config HW_PERF_EVENTS
def_bool y
depends on ARM_PMU
--- a/arch/arm64/mm/init.c~arm-arm64-move-free_unused_memmap-to-generic-mm
+++ a/arch/arm64/mm/init.c
@@ -430,71 +430,6 @@ void __init bootmem_init(void)
memblock_dump_all();
}
-#ifndef CONFIG_SPARSEMEM_VMEMMAP
-static inline void free_memmap(unsigned long start_pfn, unsigned long end_pfn)
-{
- struct page *start_pg, *end_pg;
- unsigned long pg, pgend;
-
- /*
- * Convert start_pfn/end_pfn to a struct page pointer.
- */
- start_pg = pfn_to_page(start_pfn - 1) + 1;
- end_pg = pfn_to_page(end_pfn - 1) + 1;
-
- /*
- * Convert to physical addresses, and round start upwards and end
- * downwards.
- */
- pg = (unsigned long)PAGE_ALIGN(__pa(start_pg));
- pgend = (unsigned long)__pa(end_pg) & PAGE_MASK;
-
- /*
- * If there are free pages between these, free the section of the
- * memmap array.
- */
- if (pg < pgend)
- memblock_free(pg, pgend - pg);
-}
-
-/*
- * The mem_map array can get very big. Free the unused area of the memory map.
- */
-static void __init free_unused_memmap(void)
-{
- unsigned long start, end, prev_end = 0;
- int i;
-
- for_each_mem_pfn_range(i, MAX_NUMNODES, &start, &end, NULL) {
-#ifdef CONFIG_SPARSEMEM
- /*
- * Take care not to free memmap entries that don't exist due
- * to SPARSEMEM sections which aren't present.
- */
- start = min(start, ALIGN(prev_end, PAGES_PER_SECTION));
-#endif
- /*
- * If we had a previous bank, and there is a space between the
- * current bank and the previous, free it.
- */
- if (prev_end && prev_end < start)
- free_memmap(prev_end, start);
-
- /*
- * Align up here since the VM subsystem insists that the
- * memmap entries are valid from the bank end aligned to
- * MAX_ORDER_NR_PAGES.
- */
- prev_end = ALIGN(end, MAX_ORDER_NR_PAGES);
- }
-
-#ifdef CONFIG_SPARSEMEM
- if (!IS_ALIGNED(prev_end, PAGES_PER_SECTION))
- free_memmap(prev_end, ALIGN(prev_end, PAGES_PER_SECTION));
-#endif
-}
-#endif /* !CONFIG_SPARSEMEM_VMEMMAP */
-
/*
* mem_init() marks the free areas in the mem_map and tells us how much memory
* is free. This is done after various parts of the system have claimed their
@@ -510,9 +445,6 @@ void __init mem_init(void)
set_max_mapnr(max_pfn - PHYS_PFN_OFFSET);
-#ifndef CONFIG_SPARSEMEM_VMEMMAP
- free_unused_memmap();
-#endif
/* this will put all unused low memory onto the freelists */
memblock_free_all();
--- a/arch/arm/Kconfig~arm-arm64-move-free_unused_memmap-to-generic-mm
+++ a/arch/arm/Kconfig
@@ -69,6 +69,7 @@ config ARM
select HAVE_ARCH_JUMP_LABEL if !XIP_KERNEL && !CPU_ENDIAN_BE32 && MMU
select HAVE_ARCH_KGDB if !CPU_ENDIAN_BE32 && MMU
select HAVE_ARCH_MMAP_RND_BITS if MMU
+ select HAVE_ARCH_PFN_VALID
select HAVE_ARCH_SECCOMP
select HAVE_ARCH_SECCOMP_FILTER if AEABI && !OABI_COMPAT
select HAVE_ARCH_THREAD_STRUCT_WHITELIST
@@ -1489,9 +1490,6 @@ config ARCH_SPARSEMEM_ENABLE
bool
select SPARSEMEM_STATIC if SPARSEMEM
-config HAVE_ARCH_PFN_VALID
- def_bool y
-
config HIGHMEM
bool "High Memory Support"
depends on MMU
--- a/arch/arm/mm/init.c~arm-arm64-move-free_unused_memmap-to-generic-mm
+++ a/arch/arm/mm/init.c
@@ -267,83 +267,6 @@ static inline void poison_init_mem(void
*p++ = 0xe7fddef0;
}
-static inline void __init
-free_memmap(unsigned long start_pfn, unsigned long end_pfn)
-{
- struct page *start_pg, *end_pg;
- phys_addr_t pg, pgend;
-
- /*
- * Convert start_pfn/end_pfn to a struct page pointer.
- */
- start_pg = pfn_to_page(start_pfn - 1) + 1;
- end_pg = pfn_to_page(end_pfn - 1) + 1;
-
- /*
- * Convert to physical addresses, and
- * round start upwards and end downwards.
- */
- pg = PAGE_ALIGN(__pa(start_pg));
- pgend = __pa(end_pg) & PAGE_MASK;
-
- /*
- * If there are free pages between these,
- * free the section of the memmap array.
- */
- if (pg < pgend)
- memblock_free_early(pg, pgend - pg);
-}
-
-/*
- * The mem_map array can get very big. Free the unused area of the memory map.
- */
-static void __init free_unused_memmap(void)
-{
- unsigned long start, end, prev_end = 0;
- int i;
-
- /*
- * This relies on each bank being in address order.
- * The banks are sorted previously in bootmem_init().
- */
- for_each_mem_pfn_range(i, MAX_NUMNODES, &start, &end, NULL) {
-#ifdef CONFIG_SPARSEMEM
- /*
- * Take care not to free memmap entries that don't exist
- * due to SPARSEMEM sections which aren't present.
- */
- start = min(start,
- ALIGN(prev_end, PAGES_PER_SECTION));
-#else
- /*
- * Align down here since the VM subsystem insists that the
- * memmap entries are valid from the bank start aligned to
- * MAX_ORDER_NR_PAGES.
- */
- start = round_down(start, MAX_ORDER_NR_PAGES);
-#endif
- /*
- * If we had a previous bank, and there is a space
- * between the current bank and the previous, free it.
- */
- if (prev_end && prev_end < start)
- free_memmap(prev_end, start);
-
- /*
- * Align up here since the VM subsystem insists that the
- * memmap entries are valid from the bank end aligned to
- * MAX_ORDER_NR_PAGES.
- */
- prev_end = ALIGN(end, MAX_ORDER_NR_PAGES);
- }
-
-#ifdef CONFIG_SPARSEMEM
- if (!IS_ALIGNED(prev_end, PAGES_PER_SECTION))
- free_memmap(prev_end,
- ALIGN(prev_end, PAGES_PER_SECTION));
-#endif
-}
-
static void __init free_highpages(void)
{
#ifdef CONFIG_HIGHMEM
@@ -385,7 +308,6 @@ void __init mem_init(void)
set_max_mapnr(pfn_to_page(max_pfn) - mem_map);
/* this will put all unused low memory onto the freelists */
- free_unused_memmap();
memblock_free_all();
#ifdef CONFIG_SA1111
--- a/arch/Kconfig~arm-arm64-move-free_unused_memmap-to-generic-mm
+++ a/arch/Kconfig
@@ -1044,6 +1044,9 @@ config ARCH_WANT_LD_ORPHAN_WARN
by the linker, since the locations of such sections can change between linker
versions.
+config HAVE_ARCH_PFN_VALID
+ bool
+
source "kernel/gcov/Kconfig"
source "scripts/gcc-plugins/Kconfig"
--- a/mm/memblock.c~arm-arm64-move-free_unused_memmap-to-generic-mm
+++ a/mm/memblock.c
@@ -1926,6 +1926,85 @@ static int __init early_memblock(char *p
}
early_param("memblock", early_memblock);
+static void __init free_memmap(unsigned long start_pfn, unsigned long end_pfn)
+{
+ struct page *start_pg, *end_pg;
+ phys_addr_t pg, pgend;
+
+ /*
+ * Convert start_pfn/end_pfn to a struct page pointer.
+ */
+ start_pg = pfn_to_page(start_pfn - 1) + 1;
+ end_pg = pfn_to_page(end_pfn - 1) + 1;
+
+ /*
+ * Convert to physical addresses, and round start upwards and end
+ * downwards.
+ */
+ pg = PAGE_ALIGN(__pa(start_pg));
+ pgend = __pa(end_pg) & PAGE_MASK;
+
+ /*
+ * If there are free pages between these, free the section of the
+ * memmap array.
+ */
+ if (pg < pgend)
+ memblock_free(pg, pgend - pg);
+}
+
+/*
+ * The mem_map array can get very big. Free the unused area of the memory map.
+ */
+static void __init free_unused_memmap(void)
+{
+ unsigned long start, end, prev_end = 0;
+ int i;
+
+ if (!IS_ENABLED(CONFIG_HAVE_ARCH_PFN_VALID) ||
+ IS_ENABLED(CONFIG_SPARSEMEM_VMEMMAP))
+ return;
+
+ /*
+ * This relies on each bank being in address order.
+ * The banks are sorted previously in bootmem_init().
+ */
+ for_each_mem_pfn_range(i, MAX_NUMNODES, &start, &end, NULL) {
+#ifdef CONFIG_SPARSEMEM
+ /*
+ * Take care not to free memmap entries that don't exist
+ * due to SPARSEMEM sections which aren't present.
+ */
+ start = min(start, ALIGN(prev_end, PAGES_PER_SECTION));
+#else
+ /*
+ * Align down here since the VM subsystem insists that the
+ * memmap entries are valid from the bank start aligned to
+ * MAX_ORDER_NR_PAGES.
+ */
+ start = round_down(start, MAX_ORDER_NR_PAGES);
+#endif
+
+ /*
+ * If we had a previous bank, and there is a space
+ * between the current bank and the previous, free it.
+ */
+ if (prev_end && prev_end < start)
+ free_memmap(prev_end, start);
+
+ /*
+ * Align up here since the VM subsystem insists that the
+ * memmap entries are valid from the bank end aligned to
+ * MAX_ORDER_NR_PAGES.
+ */
+ prev_end = ALIGN(end, MAX_ORDER_NR_PAGES);
+ }
+
+#ifdef CONFIG_SPARSEMEM
+ if (!IS_ALIGNED(prev_end, PAGES_PER_SECTION))
+ free_memmap(prev_end, ALIGN(prev_end, PAGES_PER_SECTION));
+#endif
+}
+
static void __init __free_pages_memory(unsigned long start, unsigned long end)
{
int order;
@@ -2012,6 +2091,7 @@ unsigned long __init memblock_free_all(v
{
unsigned long pages;
+ free_unused_memmap();
reset_all_zones_managed_pages();
pages = free_low_memory_core_early();
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 115/200] arc: use FLATMEM with freeing of unused memory map instead of DISCONTIGMEM
2020-12-15 3:02 incoming Andrew Morton
` (113 preceding siblings ...)
2020-12-15 3:09 ` [patch 114/200] arm, arm64: move free_unused_memmap() to generic mm Andrew Morton
@ 2020-12-15 3:10 ` Andrew Morton
2020-12-15 3:10 ` [patch 116/200] m68k/mm: make node data and node setup depend on CONFIG_DISCONTIGMEM Andrew Morton
` (85 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:10 UTC (permalink / raw)
To: adobriyan, akpm, catalin.marinas, corbet, geert, gerg, glaubitz,
linux-mm, linux, mattst88, mm-commits, mroos, rppt, schmitzmic,
tony.luck, torvalds, vgupta, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: arc: use FLATMEM with freeing of unused memory map instead of DISCONTIGMEM
Currently ARC uses DISCONTIGMEM to cope with sparse physical memory address
space on systems with 2 memory banks. While DISCONTIGMEM avoids wasting
memory on unpopulated memory map, it adds both memory and CPU overhead
relatively to FLATMEM. Moreover, DISCONTINGMEM is generally considered
deprecated.
The obvious replacement for DISCONTIGMEM would be SPARSEMEM, but it is also
less efficient than FLATMEM in pfn_to_page() and page_to_pfn() conversions.
Besides it requires tuning of SECTION_SIZE which is not trivial for
possible ARC memory configuration.
Since the memory map for both banks is always allocated from the "lowmem"
bank, it is possible to use FLATMEM for two-bank configuration and simply
free the unused hole in the memory map. All is required for that is to
provide ARC-specific pfn_valid() that will take into account actual
physical memory configuration and define HAVE_ARCH_PFN_VALID.
The resulting kernel image configured with defconfig + HIGHMEM=y is
smaller:
$ size a/vmlinux b/vmlinux
text data bss dec hex filename
4673503 1245456 279756 6198715 5e95bb a/vmlinux
4658706 1246864 279756 6185326 5e616e b/vmlinux
$ ./scripts/bloat-o-meter a/vmlinux b/vmlinux
add/remove: 28/30 grow/shrink: 42/399 up/down: 10986/-29025 (-18039)
...
Total: Before=4709315, After = 4691276, chg -0.38%
Booting nSIM with haps_ns.dts results in the following memory usage
reports:
a:
Memory: 1559104K/1572864K available (3531K kernel code, 595K rwdata, 752K rodata, 136K init, 275K bss, 13760K reserved, 0K cma-reserved, 1048576K highmem)
b:
Memory: 1559112K/1572864K available (3519K kernel code, 594K rwdata, 752K rodata, 136K init, 280K bss, 13752K reserved, 0K cma-reserved, 1048576K highmem)
Link: https://lkml.kernel.org/r/20201101170454.9567-11-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Geert Uytterhoeven <geert@linux-m68k.org>
Cc: Greg Ungerer <gerg@linux-m68k.org>
Cc: John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Matt Turner <mattst88@gmail.com>
Cc: Meelis Roos <mroos@linux.ee>
Cc: Michael Schmitz <schmitzmic@gmail.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/arc/Kconfig | 3 ++-
arch/arc/include/asm/page.h | 20 +++++++++++++++++---
arch/arc/mm/init.c | 29 ++++++++++++++++++++++-------
3 files changed, 41 insertions(+), 11 deletions(-)
--- a/arch/arc/include/asm/page.h~arc-use-flatmem-with-freeing-of-unused-memory-map-instead-of-discontigmem
+++ a/arch/arc/include/asm/page.h
@@ -82,11 +82,25 @@ typedef pte_t * pgtable_t;
*/
#define virt_to_pfn(kaddr) (__pa(kaddr) >> PAGE_SHIFT)
-#define ARCH_PFN_OFFSET virt_to_pfn(CONFIG_LINUX_RAM_BASE)
+/*
+ * When HIGHMEM is enabled we have holes in the memory map so we need
+ * pfn_valid() that takes into account the actual extents of the physical
+ * memory
+ */
+#ifdef CONFIG_HIGHMEM
+
+extern unsigned long arch_pfn_offset;
+#define ARCH_PFN_OFFSET arch_pfn_offset
-#ifdef CONFIG_FLATMEM
+extern int pfn_valid(unsigned long pfn);
+#define pfn_valid pfn_valid
+
+#else /* CONFIG_HIGHMEM */
+
+#define ARCH_PFN_OFFSET virt_to_pfn(CONFIG_LINUX_RAM_BASE)
#define pfn_valid(pfn) (((pfn) - ARCH_PFN_OFFSET) < max_mapnr)
-#endif
+
+#endif /* CONFIG_HIGHMEM */
/*
* __pa, __va, virt_to_page (ALERT: deprecated, don't use them)
--- a/arch/arc/Kconfig~arc-use-flatmem-with-freeing-of-unused-memory-map-instead-of-discontigmem
+++ a/arch/arc/Kconfig
@@ -67,6 +67,7 @@ config GENERIC_CSUM
config ARCH_DISCONTIGMEM_ENABLE
def_bool n
+ depends on BROKEN
config ARCH_FLATMEM_ENABLE
def_bool y
@@ -506,7 +507,7 @@ config LINUX_RAM_BASE
config HIGHMEM
bool "High Memory Support"
- select ARCH_DISCONTIGMEM_ENABLE
+ select HAVE_ARCH_PFN_VALID
help
With ARC 2G:2G address split, only upper 2G is directly addressable by
kernel. Enable this to potentially allow access to rest of 2G and PAE
--- a/arch/arc/mm/init.c~arc-use-flatmem-with-freeing-of-unused-memory-map-instead-of-discontigmem
+++ a/arch/arc/mm/init.c
@@ -28,6 +28,8 @@ static unsigned long low_mem_sz;
static unsigned long min_high_pfn, max_high_pfn;
static phys_addr_t high_mem_start;
static phys_addr_t high_mem_sz;
+unsigned long arch_pfn_offset;
+EXPORT_SYMBOL(arch_pfn_offset);
#endif
#ifdef CONFIG_DISCONTIGMEM
@@ -98,16 +100,11 @@ void __init setup_arch_memory(void)
init_mm.brk = (unsigned long)_end;
/* first page of system - kernel .vector starts here */
- min_low_pfn = ARCH_PFN_OFFSET;
+ min_low_pfn = virt_to_pfn(CONFIG_LINUX_RAM_BASE);
/* Last usable page of low mem */
max_low_pfn = max_pfn = PFN_DOWN(low_mem_start + low_mem_sz);
-#ifdef CONFIG_FLATMEM
- /* pfn_valid() uses this */
- max_mapnr = max_low_pfn - min_low_pfn;
-#endif
-
/*------------- bootmem allocator setup -----------------------*/
/*
@@ -153,7 +150,9 @@ void __init setup_arch_memory(void)
* DISCONTIGMEM in turns requires multiple nodes. node 0 above is
* populated with normal memory zone while node 1 only has highmem
*/
+#ifdef CONFIG_DISCONTIGMEM
node_set_online(1);
+#endif
min_high_pfn = PFN_DOWN(high_mem_start);
max_high_pfn = PFN_DOWN(high_mem_start + high_mem_sz);
@@ -161,8 +160,15 @@ void __init setup_arch_memory(void)
max_zone_pfn[ZONE_HIGHMEM] = min_low_pfn;
high_memory = (void *)(min_high_pfn << PAGE_SHIFT);
+
+ arch_pfn_offset = min(min_low_pfn, min_high_pfn);
kmap_init();
-#endif
+
+#else /* CONFIG_HIGHMEM */
+ /* pfn_valid() uses this when FLATMEM=y and HIGHMEM=n */
+ max_mapnr = max_low_pfn - min_low_pfn;
+
+#endif /* CONFIG_HIGHMEM */
free_area_init(max_zone_pfn);
}
@@ -190,3 +196,12 @@ void __init mem_init(void)
highmem_init();
mem_init_print_info(NULL);
}
+
+#ifdef CONFIG_HIGHMEM
+int pfn_valid(unsigned long pfn)
+{
+ return (pfn >= min_high_pfn && pfn <= max_high_pfn) ||
+ (pfn >= min_low_pfn && pfn <= max_low_pfn);
+}
+EXPORT_SYMBOL(pfn_valid);
+#endif
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 116/200] m68k/mm: make node data and node setup depend on CONFIG_DISCONTIGMEM
2020-12-15 3:02 incoming Andrew Morton
` (114 preceding siblings ...)
2020-12-15 3:10 ` [patch 115/200] arc: use FLATMEM with freeing of unused memory map instead of DISCONTIGMEM Andrew Morton
@ 2020-12-15 3:10 ` Andrew Morton
2020-12-15 3:10 ` [patch 117/200] m68k/mm: enable use of generic memory_model.h for !DISCONTIGMEM Andrew Morton
` (84 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:10 UTC (permalink / raw)
To: adobriyan, akpm, catalin.marinas, corbet, geert, gerg, glaubitz,
linux-mm, linux, mattst88, mm-commits, mroos, rppt, schmitzmic,
tony.luck, torvalds, vgupta, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: m68k/mm: make node data and node setup depend on CONFIG_DISCONTIGMEM
The pg_data_t node structures and their initialization currently depends on
!CONFIG_SINGLE_MEMORY_CHUNK. Since they are required only for DISCONTIGMEM
make this dependency explicit and replace usage of
CONFIG_SINGLE_MEMORY_CHUNK with CONFIG_DISCONTIGMEM where appropriate.
The CONFIG_SINGLE_MEMORY_CHUNK was implicitly disabled on the ColdFire MMU
variant, although it always presumed a single memory bank. As there is no
actual need for DISCONTIGMEM in this case, make sure that ColdFire MMU
systems set CONFIG_SINGLE_MEMORY_CHUNK to 'y'.
Link: https://lkml.kernel.org/r/20201101170454.9567-12-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Geert Uytterhoeven <geert@linux-m68k.org>
Cc: Greg Ungerer <gerg@linux-m68k.org>
Cc: John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Matt Turner <mattst88@gmail.com>
Cc: Meelis Roos <mroos@linux.ee>
Cc: Michael Schmitz <schmitzmic@gmail.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/m68k/Kconfig.cpu | 4 ++--
arch/m68k/include/asm/page_mm.h | 2 +-
arch/m68k/include/asm/virtconvert.h | 2 +-
arch/m68k/mm/init.c | 4 ++--
4 files changed, 6 insertions(+), 6 deletions(-)
--- a/arch/m68k/include/asm/page_mm.h~m68k-mm-make-node-data-and-node-setup-depend-on-config_discontigmem
+++ a/arch/m68k/include/asm/page_mm.h
@@ -126,7 +126,7 @@ static inline void *__va(unsigned long x
extern int m68k_virt_to_node_shift;
-#ifdef CONFIG_SINGLE_MEMORY_CHUNK
+#ifndef CONFIG_DISCONTIGMEM
#define __virt_to_node(addr) (&pg_data_map[0])
#else
extern struct pglist_data *pg_data_table[];
--- a/arch/m68k/include/asm/virtconvert.h~m68k-mm-make-node-data-and-node-setup-depend-on-config_discontigmem
+++ a/arch/m68k/include/asm/virtconvert.h
@@ -29,7 +29,7 @@ static inline void *phys_to_virt(unsigne
}
/* Permanent address of a page. */
-#if defined(CONFIG_MMU) && defined(CONFIG_SINGLE_MEMORY_CHUNK)
+#if defined(CONFIG_MMU) && !defined(CONFIG_DISCONTIGMEM)
#define page_to_phys(page) \
__pa(PAGE_OFFSET + (((page) - pg_data_map[0].node_mem_map) << PAGE_SHIFT))
#else
--- a/arch/m68k/Kconfig.cpu~m68k-mm-make-node-data-and-node-setup-depend-on-config_discontigmem
+++ a/arch/m68k/Kconfig.cpu
@@ -373,7 +373,7 @@ config RMW_INSNS
config SINGLE_MEMORY_CHUNK
bool "Use one physical chunk of memory only" if ADVANCED && !SUN3
depends on MMU
- default y if SUN3
+ default y if SUN3 || MMU_COLDFIRE
select NEED_MULTIPLE_NODES
help
Ignore all but the first contiguous chunk of physical memory for VM
@@ -406,7 +406,7 @@ config M68K_L2_CACHE
config NODES_SHIFT
int
default "3"
- depends on !SINGLE_MEMORY_CHUNK
+ depends on DISCONTIGMEM
config CPU_HAS_NO_BITFIELDS
bool
--- a/arch/m68k/mm/init.c~m68k-mm-make-node-data-and-node-setup-depend-on-config_discontigmem
+++ a/arch/m68k/mm/init.c
@@ -47,14 +47,14 @@ EXPORT_SYMBOL(pg_data_map);
int m68k_virt_to_node_shift;
-#ifndef CONFIG_SINGLE_MEMORY_CHUNK
+#ifdef CONFIG_DISCONTIGMEM
pg_data_t *pg_data_table[65];
EXPORT_SYMBOL(pg_data_table);
#endif
void __init m68k_setup_node(int node)
{
-#ifndef CONFIG_SINGLE_MEMORY_CHUNK
+#ifdef CONFIG_DISCONTIGMEM
struct m68k_mem_info *info = m68k_memory + node;
int i, end;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 117/200] m68k/mm: enable use of generic memory_model.h for !DISCONTIGMEM
2020-12-15 3:02 incoming Andrew Morton
` (115 preceding siblings ...)
2020-12-15 3:10 ` [patch 116/200] m68k/mm: make node data and node setup depend on CONFIG_DISCONTIGMEM Andrew Morton
@ 2020-12-15 3:10 ` Andrew Morton
2020-12-15 3:10 ` [patch 118/200] m68k: deprecate DISCONTIGMEM Andrew Morton
` (83 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:10 UTC (permalink / raw)
To: adobriyan, akpm, catalin.marinas, corbet, geert, gerg, glaubitz,
linux-mm, linux, mattst88, mm-commits, mroos, rppt, schmitzmic,
tony.luck, torvalds, vgupta, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: m68k/mm: enable use of generic memory_model.h for !DISCONTIGMEM
The pg_data_map and pg_data_table arrays as well as page_to_pfn() and
pfn_to_page() are required only for DISCONTIGMEM. Other memory models can
use the generic definitions in asm-generic/memory_model.h.
Link: https://lkml.kernel.org/r/20201101170454.9567-13-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Geert Uytterhoeven <geert@linux-m68k.org>
Cc: Greg Ungerer <gerg@linux-m68k.org>
Cc: John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Matt Turner <mattst88@gmail.com>
Cc: Meelis Roos <mroos@linux.ee>
Cc: Michael Schmitz <schmitzmic@gmail.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/m68k/Kconfig.cpu | 1 -
arch/m68k/include/asm/page.h | 2 ++
arch/m68k/include/asm/page_mm.h | 5 +++++
arch/m68k/include/asm/virtconvert.h | 5 -----
arch/m68k/mm/init.c | 6 +++---
5 files changed, 10 insertions(+), 9 deletions(-)
--- a/arch/m68k/include/asm/page.h~m68k-mm-enable-use-of-generic-memory_modelh-for-discontigmem
+++ a/arch/m68k/include/asm/page.h
@@ -62,8 +62,10 @@ extern unsigned long _ramend;
#include <asm/page_no.h>
#endif
+#ifdef CONFIG_DISCONTIGMEM
#define __phys_to_pfn(paddr) ((unsigned long)((paddr) >> PAGE_SHIFT))
#define __pfn_to_phys(pfn) PFN_PHYS(pfn)
+#endif
#include <asm-generic/getorder.h>
--- a/arch/m68k/include/asm/page_mm.h~m68k-mm-enable-use-of-generic-memory_modelh-for-discontigmem
+++ a/arch/m68k/include/asm/page_mm.h
@@ -153,6 +153,7 @@ static inline __attribute_const__ int __
pfn_to_virt(page_to_pfn(page)); \
})
+#ifdef CONFIG_DISCONTIGMEM
#define pfn_to_page(pfn) ({ \
unsigned long __pfn = (pfn); \
struct pglist_data *pgdat; \
@@ -165,6 +166,10 @@ static inline __attribute_const__ int __
pgdat = &pg_data_map[page_to_nid(__p)]; \
((__p) - pgdat->node_mem_map) + pgdat->node_start_pfn; \
})
+#else
+#define ARCH_PFN_OFFSET (m68k_memory[0].addr)
+#include <asm-generic/memory_model.h>
+#endif
#define virt_addr_valid(kaddr) ((void *)(kaddr) >= (void *)PAGE_OFFSET && (void *)(kaddr) < high_memory)
#define pfn_valid(pfn) virt_addr_valid(pfn_to_virt(pfn))
--- a/arch/m68k/include/asm/virtconvert.h~m68k-mm-enable-use-of-generic-memory_modelh-for-discontigmem
+++ a/arch/m68k/include/asm/virtconvert.h
@@ -29,12 +29,7 @@ static inline void *phys_to_virt(unsigne
}
/* Permanent address of a page. */
-#if defined(CONFIG_MMU) && !defined(CONFIG_DISCONTIGMEM)
-#define page_to_phys(page) \
- __pa(PAGE_OFFSET + (((page) - pg_data_map[0].node_mem_map) << PAGE_SHIFT))
-#else
#define page_to_phys(page) (page_to_pfn(page) << PAGE_SHIFT)
-#endif
/*
* IO bus memory addresses are 1:1 with the physical address,
--- a/arch/m68k/Kconfig.cpu~m68k-mm-enable-use-of-generic-memory_modelh-for-discontigmem
+++ a/arch/m68k/Kconfig.cpu
@@ -374,7 +374,6 @@ config SINGLE_MEMORY_CHUNK
bool "Use one physical chunk of memory only" if ADVANCED && !SUN3
depends on MMU
default y if SUN3 || MMU_COLDFIRE
- select NEED_MULTIPLE_NODES
help
Ignore all but the first contiguous chunk of physical memory for VM
purposes. This will save a few bytes kernel size and may speed up
--- a/arch/m68k/mm/init.c~m68k-mm-enable-use-of-generic-memory_modelh-for-discontigmem
+++ a/arch/m68k/mm/init.c
@@ -42,12 +42,12 @@ EXPORT_SYMBOL(empty_zero_page);
#ifdef CONFIG_MMU
-pg_data_t pg_data_map[MAX_NUMNODES];
-EXPORT_SYMBOL(pg_data_map);
-
int m68k_virt_to_node_shift;
#ifdef CONFIG_DISCONTIGMEM
+pg_data_t pg_data_map[MAX_NUMNODES];
+EXPORT_SYMBOL(pg_data_map);
+
pg_data_t *pg_data_table[65];
EXPORT_SYMBOL(pg_data_table);
#endif
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 118/200] m68k: deprecate DISCONTIGMEM
2020-12-15 3:02 incoming Andrew Morton
` (116 preceding siblings ...)
2020-12-15 3:10 ` [patch 117/200] m68k/mm: enable use of generic memory_model.h for !DISCONTIGMEM Andrew Morton
@ 2020-12-15 3:10 ` Andrew Morton
2020-12-15 3:10 ` [patch 119/200] mm: introduce debug_pagealloc_{map,unmap}_pages() helpers Andrew Morton
` (82 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:10 UTC (permalink / raw)
To: adobriyan, akpm, catalin.marinas, corbet, geert, gerg, glaubitz,
linux-mm, linux, mattst88, mm-commits, mroos, rppt, schmitzmic,
tony.luck, torvalds, vgupta, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: m68k: deprecate DISCONTIGMEM
DISCONTIGMEM was intended to provide more efficient support for systems
with holes in their physical address space that FLATMEM did.
Yet, it's overhead in terms of the memory consumption seems to overweight
the savings on the unused memory map.
For a ARAnyM system with 16 MBytes of FastRAM configured, the memory usage
reported after page allocator initialization is
Memory: 23828K/30720K available (3206K kernel code, 535K rwdata, 936K rodata, 768K init, 193K bss, 6892K reserved, 0K cma-reserved)
and with DISCONTIGMEM disabled and with relatively large hole in the memory
map it is:
Memory: 23864K/30720K available (3197K kernel code, 516K rwdata, 936K rodata, 764K init, 179K bss, 6856K reserved, 0K cma-reserved)
Moreover, since m68k already has custom pfn_valid() it is possible to
define HAVE_ARCH_PFN_VALID to enable freeing of unused memory map. The
minimal size of a hole that can be freed should not be less than
MAX_ORDER_NR_PAGES so to achieve more substantial memory savings let m68k
also define custom FORCE_MAX_ZONEORDER.
With FORCE_MAX_ZONEORDER set to 9 memory usage becomes:
Memory: 23880K/30720K available (3197K kernel code, 516K rwdata, 936K rodata, 764K init, 179K bss, 6840K reserved, 0K cma-reserved)
Link: https://lkml.kernel.org/r/20201101170454.9567-14-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Alexey Dobriyan <adobriyan@gmail.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Geert Uytterhoeven <geert@linux-m68k.org>
Cc: Greg Ungerer <gerg@linux-m68k.org>
Cc: John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Matt Turner <mattst88@gmail.com>
Cc: Meelis Roos <mroos@linux.ee>
Cc: Michael Schmitz <schmitzmic@gmail.com>
Cc: Russell King <linux@armlinux.org.uk>
Cc: Tony Luck <tony.luck@intel.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/m68k/Kconfig.cpu | 26 +++++++++++++++++++++++++-
1 file changed, 25 insertions(+), 1 deletion(-)
--- a/arch/m68k/Kconfig.cpu~m68k-deprecate-discontigmem
+++ a/arch/m68k/Kconfig.cpu
@@ -20,6 +20,7 @@ choice
config M68KCLASSIC
bool "Classic M68K CPU family support"
+ select HAVE_ARCH_PFN_VALID
config COLDFIRE
bool "Coldfire CPU family support"
@@ -377,11 +378,34 @@ config SINGLE_MEMORY_CHUNK
help
Ignore all but the first contiguous chunk of physical memory for VM
purposes. This will save a few bytes kernel size and may speed up
- some operations. Say N if not sure.
+ some operations.
+ When this option os set to N, you may want to lower "Maximum zone
+ order" to save memory that could be wasted for unused memory map.
+ Say N if not sure.
config ARCH_DISCONTIGMEM_ENABLE
+ depends on BROKEN
def_bool MMU && !SINGLE_MEMORY_CHUNK
+config FORCE_MAX_ZONEORDER
+ int "Maximum zone order" if ADVANCED
+ depends on !SINGLE_MEMORY_CHUNK
+ default "11"
+ help
+ The kernel memory allocator divides physically contiguous memory
+ blocks into "zones", where each zone is a power of two number of
+ pages. This option selects the largest power of two that the kernel
+ keeps in the memory allocator. If you need to allocate very large
+ blocks of physically contiguous memory, then you may need to
+ increase this value.
+
+ For systems that have holes in their physical address space this
+ value also defines the minimal size of the hole that allows
+ freeing unused memory map.
+
+ This config option is actually maximum order plus one. For example,
+ a value of 11 means that the largest free memory block is 2^10 pages.
+
config 060_WRITETHROUGH
bool "Use write-through caching for 68060 supervisor accesses"
depends on ADVANCED && M68060
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 119/200] mm: introduce debug_pagealloc_{map,unmap}_pages() helpers
2020-12-15 3:02 incoming Andrew Morton
` (117 preceding siblings ...)
2020-12-15 3:10 ` [patch 118/200] m68k: deprecate DISCONTIGMEM Andrew Morton
@ 2020-12-15 3:10 ` Andrew Morton
2020-12-15 3:10 ` [patch 120/200] PM: hibernate: make direct map manipulations more explicit Andrew Morton
` (81 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:10 UTC (permalink / raw)
To: akpm, aou, benh, borntraeger, bp, catalin.marinas, cl,
dave.hansen, davem, david, gor, hca, hpa, iamjoonsoo.kim,
kirill.shutemov, len.brown, linux-mm, luto, mingo, mm-commits,
mpe, palmer, paul.walmsley, paulus, pavel, penberg, peterz,
rafael.j.wysocki, rick.p.edgecombe, rientjes, rjw, rppt, tglx,
torvalds, vbabka, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: mm: introduce debug_pagealloc_{map,unmap}_pages() helpers
Patch series "arch, mm: improve robustness of direct map manipulation", v7.
During recent discussion about KVM protected memory, David raised a
concern about usage of __kernel_map_pages() outside of DEBUG_PAGEALLOC
scope [1].
Indeed, for architectures that define CONFIG_ARCH_HAS_SET_DIRECT_MAP it is
possible that __kernel_map_pages() would fail, but since this function is
void, the failure will go unnoticed.
Moreover, there's lack of consistency of __kernel_map_pages() semantics
across architectures as some guard this function with #ifdef
DEBUG_PAGEALLOC, some refuse to update the direct map if page allocation
debugging is disabled at run time and some allow modifying the direct map
regardless of DEBUG_PAGEALLOC settings.
This set straightens this out by restoring dependency of
__kernel_map_pages() on DEBUG_PAGEALLOC and updating the call sites
accordingly.
Since currently the only user of __kernel_map_pages() outside
DEBUG_PAGEALLOC is hibernation, it is updated to make direct map accesses
there more explicit.
[1] https://lore.kernel.org/lkml/2759b4bf-e1e3-d006-7d86-78a40348269d@redhat.com
This patch (of 4):
When CONFIG_DEBUG_PAGEALLOC is enabled, it unmaps pages from the kernel
direct mapping after free_pages(). The pages than need to be mapped back
before they could be used. Theese mapping operations use
__kernel_map_pages() guarded with with debug_pagealloc_enabled().
The only place that calls __kernel_map_pages() without checking whether
DEBUG_PAGEALLOC is enabled is the hibernation code that presumes
availability of this function when ARCH_HAS_SET_DIRECT_MAP is set. Still,
on arm64, __kernel_map_pages() will bail out when DEBUG_PAGEALLOC is not
enabled but set_direct_map_invalid_noflush() may render some pages not
present in the direct map and hibernation code won't be able to save such
pages.
To make page allocation debugging and hibernation interaction more robust,
the dependency on DEBUG_PAGEALLOC or ARCH_HAS_SET_DIRECT_MAP has to be
made more explicit.
Start with combining the guard condition and the call to
__kernel_map_pages() into debug_pagealloc_map_pages() and
debug_pagealloc_unmap_pages() functions to emphasize that
__kernel_map_pages() should not be called without DEBUG_PAGEALLOC and use
these new functions to map/unmap pages when page allocation debugging is
enabled.
Link: https://lkml.kernel.org/r/20201109192128.960-1-rppt@kernel.org
Link: https://lkml.kernel.org/r/20201109192128.960-2-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Andy Lutomirski <luto@kernel.org>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: "David S. Miller" <davem@davemloft.net>
Cc: Dave Hansen <dave.hansen@linux.intel.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "Edgecombe, Rick P" <rick.p.edgecombe@intel.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Len Brown <len.brown@intel.com>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: Palmer Dabbelt <palmer@dabbelt.com>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Pavel Machek <pavel@ucw.cz>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: "Rafael J. Wysocki" <rjw@rjwysocki.net>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Will Deacon <will@kernel.org>
Cc: Rafael J. Wysocki <rafael.j.wysocki@intel.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/mm.h | 15 +++++++++++++++
mm/memory_hotplug.c | 3 +--
mm/page_alloc.c | 6 ++----
mm/slab.c | 2 +-
4 files changed, 19 insertions(+), 7 deletions(-)
--- a/include/linux/mm.h~mm-introduce-debug_pagealloc_mapunmap_pages-helpers
+++ a/include/linux/mm.h
@@ -2943,12 +2943,27 @@ kernel_map_pages(struct page *page, int
{
__kernel_map_pages(page, numpages, enable);
}
+
+static inline void debug_pagealloc_map_pages(struct page *page, int numpages)
+{
+ if (debug_pagealloc_enabled_static())
+ __kernel_map_pages(page, numpages, 1);
+}
+
+static inline void debug_pagealloc_unmap_pages(struct page *page, int numpages)
+{
+ if (debug_pagealloc_enabled_static())
+ __kernel_map_pages(page, numpages, 0);
+}
+
#ifdef CONFIG_HIBERNATION
extern bool kernel_page_present(struct page *page);
#endif /* CONFIG_HIBERNATION */
#else /* CONFIG_DEBUG_PAGEALLOC || CONFIG_ARCH_HAS_SET_DIRECT_MAP */
static inline void
kernel_map_pages(struct page *page, int numpages, int enable) {}
+static inline void debug_pagealloc_map_pages(struct page *page, int numpages) {}
+static inline void debug_pagealloc_unmap_pages(struct page *page, int numpages) {}
#ifdef CONFIG_HIBERNATION
static inline bool kernel_page_present(struct page *page) { return true; }
#endif /* CONFIG_HIBERNATION */
--- a/mm/memory_hotplug.c~mm-introduce-debug_pagealloc_mapunmap_pages-helpers
+++ a/mm/memory_hotplug.c
@@ -596,8 +596,7 @@ void generic_online_page(struct page *pa
* so we should map it first. This is better than introducing a special
* case in page freeing fast path.
*/
- if (debug_pagealloc_enabled_static())
- kernel_map_pages(page, 1 << order, 1);
+ debug_pagealloc_map_pages(page, 1 << order);
__free_pages_core(page, order);
totalram_pages_add(1UL << order);
#ifdef CONFIG_HIGHMEM
--- a/mm/page_alloc.c~mm-introduce-debug_pagealloc_mapunmap_pages-helpers
+++ a/mm/page_alloc.c
@@ -1273,8 +1273,7 @@ static __always_inline bool free_pages_p
*/
arch_free_page(page, order);
- if (debug_pagealloc_enabled_static())
- kernel_map_pages(page, 1 << order, 0);
+ debug_pagealloc_unmap_pages(page, 1 << order);
kasan_free_nondeferred_pages(page, order);
@@ -2279,8 +2278,7 @@ inline void post_alloc_hook(struct page
set_page_refcounted(page);
arch_alloc_page(page, order);
- if (debug_pagealloc_enabled_static())
- kernel_map_pages(page, 1 << order, 1);
+ debug_pagealloc_map_pages(page, 1 << order);
kasan_alloc_pages(page, order);
kernel_poison_pages(page, 1 << order, 1);
set_page_owner(page, order, gfp_flags);
--- a/mm/slab.c~mm-introduce-debug_pagealloc_mapunmap_pages-helpers
+++ a/mm/slab.c
@@ -1435,7 +1435,7 @@ static void slab_kernel_map(struct kmem_
if (!is_debug_pagealloc_cache(cachep))
return;
- kernel_map_pages(virt_to_page(objp), cachep->size / PAGE_SIZE, map);
+ __kernel_map_pages(virt_to_page(objp), cachep->size / PAGE_SIZE, map);
}
#else
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 120/200] PM: hibernate: make direct map manipulations more explicit
2020-12-15 3:02 incoming Andrew Morton
` (118 preceding siblings ...)
2020-12-15 3:10 ` [patch 119/200] mm: introduce debug_pagealloc_{map,unmap}_pages() helpers Andrew Morton
@ 2020-12-15 3:10 ` Andrew Morton
2020-12-15 3:10 ` [patch 121/200] arch, mm: restore dependency of __kernel_map_pages() on DEBUG_PAGEALLOC Andrew Morton
` (80 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:10 UTC (permalink / raw)
To: akpm, aou, benh, borntraeger, bp, catalin.marinas, cl,
dave.hansen, davem, david, gor, hca, hpa, iamjoonsoo.kim,
kirill.shutemov, len.brown, linux-mm, luto, mingo, mm-commits,
mpe, palmer, paul.walmsley, paulus, pavel, penberg, peterz,
rafael.j.wysocki, rick.p.edgecombe, rientjes, rjw, rppt, tglx,
torvalds, vbabka, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: PM: hibernate: make direct map manipulations more explicit
When DEBUG_PAGEALLOC or ARCH_HAS_SET_DIRECT_MAP is enabled a page may be
not present in the direct map and has to be explicitly mapped before it
could be copied.
Introduce hibernate_map_page() and hibernation_unmap_page() that will
explicitly use set_direct_map_{default,invalid}_noflush() for
ARCH_HAS_SET_DIRECT_MAP case and debug_pagealloc_{map,unmap}_pages() for
DEBUG_PAGEALLOC case.
The remapping of the pages in safe_copy_page() presumes that it only
changes protection bits in an existing PTE and so it is safe to ignore
return value of set_direct_map_{default,invalid}_noflush().
Still, add a pr_warn() so that future changes in set_memory APIs will not
silently break hibernation.
Link: https://lkml.kernel.org/r/20201109192128.960-3-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Acked-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Andy Lutomirski <luto@kernel.org>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Dave Hansen <dave.hansen@linux.intel.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "David S. Miller" <davem@davemloft.net>
Cc: "Edgecombe, Rick P" <rick.p.edgecombe@intel.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Len Brown <len.brown@intel.com>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: Palmer Dabbelt <palmer@dabbelt.com>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Pavel Machek <pavel@ucw.cz>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: "Rafael J. Wysocki" <rjw@rjwysocki.net>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/mm.h | 12 ------------
kernel/power/snapshot.c | 38 ++++++++++++++++++++++++++++++++++++--
2 files changed, 36 insertions(+), 14 deletions(-)
--- a/include/linux/mm.h~pm-hibernate-make-direct-map-manipulations-more-explicit
+++ a/include/linux/mm.h
@@ -2934,16 +2934,6 @@ static inline bool debug_pagealloc_enabl
#if defined(CONFIG_DEBUG_PAGEALLOC) || defined(CONFIG_ARCH_HAS_SET_DIRECT_MAP)
extern void __kernel_map_pages(struct page *page, int numpages, int enable);
-/*
- * When called in DEBUG_PAGEALLOC context, the call should most likely be
- * guarded by debug_pagealloc_enabled() or debug_pagealloc_enabled_static()
- */
-static inline void
-kernel_map_pages(struct page *page, int numpages, int enable)
-{
- __kernel_map_pages(page, numpages, enable);
-}
-
static inline void debug_pagealloc_map_pages(struct page *page, int numpages)
{
if (debug_pagealloc_enabled_static())
@@ -2960,8 +2950,6 @@ static inline void debug_pagealloc_unmap
extern bool kernel_page_present(struct page *page);
#endif /* CONFIG_HIBERNATION */
#else /* CONFIG_DEBUG_PAGEALLOC || CONFIG_ARCH_HAS_SET_DIRECT_MAP */
-static inline void
-kernel_map_pages(struct page *page, int numpages, int enable) {}
static inline void debug_pagealloc_map_pages(struct page *page, int numpages) {}
static inline void debug_pagealloc_unmap_pages(struct page *page, int numpages) {}
#ifdef CONFIG_HIBERNATION
--- a/kernel/power/snapshot.c~pm-hibernate-make-direct-map-manipulations-more-explicit
+++ a/kernel/power/snapshot.c
@@ -76,6 +76,40 @@ static inline void hibernate_restore_pro
static inline void hibernate_restore_unprotect_page(void *page_address) {}
#endif /* CONFIG_STRICT_KERNEL_RWX && CONFIG_ARCH_HAS_SET_MEMORY */
+
+/*
+ * The calls to set_direct_map_*() should not fail because remapping a page
+ * here means that we only update protection bits in an existing PTE.
+ * It is still worth to have a warning here if something changes and this
+ * will no longer be the case.
+ */
+static inline void hibernate_map_page(struct page *page)
+{
+ if (IS_ENABLED(CONFIG_ARCH_HAS_SET_DIRECT_MAP)) {
+ int ret = set_direct_map_default_noflush(page);
+
+ if (ret)
+ pr_warn_once("Failed to remap page\n");
+ } else {
+ debug_pagealloc_map_pages(page, 1);
+ }
+}
+
+static inline void hibernate_unmap_page(struct page *page)
+{
+ if (IS_ENABLED(CONFIG_ARCH_HAS_SET_DIRECT_MAP)) {
+ unsigned long addr = (unsigned long)page_address(page);
+ int ret = set_direct_map_invalid_noflush(page);
+
+ if (ret)
+ pr_warn_once("Failed to remap page\n");
+
+ flush_tlb_kernel_range(addr, addr + PAGE_SIZE);
+ } else {
+ debug_pagealloc_unmap_pages(page, 1);
+ }
+}
+
static int swsusp_page_is_free(struct page *);
static void swsusp_set_page_forbidden(struct page *);
static void swsusp_unset_page_forbidden(struct page *);
@@ -1355,9 +1389,9 @@ static void safe_copy_page(void *dst, st
if (kernel_page_present(s_page)) {
do_copy_page(dst, page_address(s_page));
} else {
- kernel_map_pages(s_page, 1, 1);
+ hibernate_map_page(s_page);
do_copy_page(dst, page_address(s_page));
- kernel_map_pages(s_page, 1, 0);
+ hibernate_unmap_page(s_page);
}
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 121/200] arch, mm: restore dependency of __kernel_map_pages() on DEBUG_PAGEALLOC
2020-12-15 3:02 incoming Andrew Morton
` (119 preceding siblings ...)
2020-12-15 3:10 ` [patch 120/200] PM: hibernate: make direct map manipulations more explicit Andrew Morton
@ 2020-12-15 3:10 ` Andrew Morton
2020-12-15 3:10 ` [patch 122/200] arch, mm: make kernel_page_present() always available Andrew Morton
` (79 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:10 UTC (permalink / raw)
To: akpm, aou, benh, borntraeger, bp, catalin.marinas, cl,
dave.hansen, davem, david, gor, hca, hpa, iamjoonsoo.kim,
kirill.shutemov, len.brown, linux-mm, luto, mingo, mm-commits,
mpe, palmer, paul.walmsley, paulus, pavel, penberg, peterz,
rafael.j.wysocki, rick.p.edgecombe, rientjes, rjw, rppt, tglx,
torvalds, vbabka, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: arch, mm: restore dependency of __kernel_map_pages() on DEBUG_PAGEALLOC
The design of DEBUG_PAGEALLOC presumes that __kernel_map_pages() must
never fail. With this assumption is wouldn't be safe to allow general
usage of this function.
Moreover, some architectures that implement __kernel_map_pages() have this
function guarded by #ifdef DEBUG_PAGEALLOC and some refuse to map/unmap
pages when page allocation debugging is disabled at runtime.
As all the users of __kernel_map_pages() were converted to use
debug_pagealloc_map_pages() it is safe to make it available only when
DEBUG_PAGEALLOC is set.
Link: https://lkml.kernel.org/r/20201109192128.960-4-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Acked-by: David Hildenbrand <david@redhat.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Andy Lutomirski <luto@kernel.org>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Dave Hansen <dave.hansen@linux.intel.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "David S. Miller" <davem@davemloft.net>
Cc: "Edgecombe, Rick P" <rick.p.edgecombe@intel.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Len Brown <len.brown@intel.com>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: Palmer Dabbelt <palmer@dabbelt.com>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Pavel Machek <pavel@ucw.cz>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Rafael J. Wysocki <rafael.j.wysocki@intel.com>
Cc: "Rafael J. Wysocki" <rjw@rjwysocki.net>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/Kconfig | 3 +++
arch/arm64/Kconfig | 4 +---
arch/arm64/mm/pageattr.c | 8 ++++++--
arch/powerpc/Kconfig | 5 +----
arch/riscv/Kconfig | 4 +---
arch/riscv/include/asm/pgtable.h | 2 --
arch/riscv/mm/pageattr.c | 2 ++
arch/s390/Kconfig | 4 +---
arch/sparc/Kconfig | 4 +---
arch/x86/Kconfig | 4 +---
arch/x86/mm/pat/set_memory.c | 2 ++
include/linux/mm.h | 10 +++++++---
12 files changed, 26 insertions(+), 26 deletions(-)
--- a/arch/arm64/Kconfig~arch-mm-restore-dependency-of-__kernel_map_pages-on-debug_pagealloc
+++ a/arch/arm64/Kconfig
@@ -71,6 +71,7 @@ config ARM64
select ARCH_USE_QUEUED_RWLOCKS
select ARCH_USE_QUEUED_SPINLOCKS
select ARCH_USE_SYM_ANNOTATIONS
+ select ARCH_SUPPORTS_DEBUG_PAGEALLOC
select ARCH_SUPPORTS_MEMORY_FAILURE
select ARCH_SUPPORTS_SHADOW_CALL_STACK if CC_HAVE_SHADOW_CALL_STACK
select ARCH_SUPPORTS_ATOMIC_RMW
@@ -1028,9 +1029,6 @@ config HOLES_IN_ZONE
source "kernel/Kconfig.hz"
-config ARCH_SUPPORTS_DEBUG_PAGEALLOC
- def_bool y
-
config ARCH_SPARSEMEM_ENABLE
def_bool y
select SPARSEMEM_VMEMMAP_ENABLE
--- a/arch/arm64/mm/pageattr.c~arch-mm-restore-dependency-of-__kernel_map_pages-on-debug_pagealloc
+++ a/arch/arm64/mm/pageattr.c
@@ -155,7 +155,7 @@ int set_direct_map_invalid_noflush(struc
.clear_mask = __pgprot(PTE_VALID),
};
- if (!rodata_full)
+ if (!debug_pagealloc_enabled() && !rodata_full)
return 0;
return apply_to_page_range(&init_mm,
@@ -170,7 +170,7 @@ int set_direct_map_default_noflush(struc
.clear_mask = __pgprot(PTE_RDONLY),
};
- if (!rodata_full)
+ if (!debug_pagealloc_enabled() && !rodata_full)
return 0;
return apply_to_page_range(&init_mm,
@@ -178,6 +178,7 @@ int set_direct_map_default_noflush(struc
PAGE_SIZE, change_page_range, &data);
}
+#ifdef CONFIG_DEBUG_PAGEALLOC
void __kernel_map_pages(struct page *page, int numpages, int enable)
{
if (!debug_pagealloc_enabled() && !rodata_full)
@@ -186,6 +187,7 @@ void __kernel_map_pages(struct page *pag
set_memory_valid((unsigned long)page_address(page), numpages, enable);
}
+#ifdef CONFIG_HIBERNATION
/*
* This function is used to determine if a linear map page has been marked as
* not-valid. Walk the page table and check the PTE_VALID bit. This is based
@@ -232,3 +234,5 @@ bool kernel_page_present(struct page *pa
ptep = pte_offset_kernel(pmdp, addr);
return pte_valid(READ_ONCE(*ptep));
}
+#endif /* CONFIG_HIBERNATION */
+#endif /* CONFIG_DEBUG_PAGEALLOC */
--- a/arch/Kconfig~arch-mm-restore-dependency-of-__kernel_map_pages-on-debug_pagealloc
+++ a/arch/Kconfig
@@ -1047,6 +1047,9 @@ config ARCH_WANT_LD_ORPHAN_WARN
config HAVE_ARCH_PFN_VALID
bool
+config ARCH_SUPPORTS_DEBUG_PAGEALLOC
+ bool
+
source "kernel/gcov/Kconfig"
source "scripts/gcc-plugins/Kconfig"
--- a/arch/powerpc/Kconfig~arch-mm-restore-dependency-of-__kernel_map_pages-on-debug_pagealloc
+++ a/arch/powerpc/Kconfig
@@ -146,6 +146,7 @@ config PPC
select ARCH_MIGHT_HAVE_PC_SERIO
select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
select ARCH_SUPPORTS_ATOMIC_RMW
+ select ARCH_SUPPORTS_DEBUG_PAGEALLOC if PPC32 || PPC_BOOK3S_64
select ARCH_USE_BUILTIN_BSWAP
select ARCH_USE_CMPXCHG_LOCKREF if PPC64
select ARCH_USE_QUEUED_RWLOCKS if PPC_QUEUED_SPINLOCKS
@@ -356,10 +357,6 @@ config PPC_OF_PLATFORM_PCI
depends on PCI
depends on PPC64 # not supported on 32 bits yet
-config ARCH_SUPPORTS_DEBUG_PAGEALLOC
- depends on PPC32 || PPC_BOOK3S_64
- def_bool y
-
config ARCH_SUPPORTS_UPROBES
def_bool y
--- a/arch/riscv/include/asm/pgtable.h~arch-mm-restore-dependency-of-__kernel_map_pages-on-debug_pagealloc
+++ a/arch/riscv/include/asm/pgtable.h
@@ -461,8 +461,6 @@ static inline int ptep_clear_flush_young
#define VMALLOC_START 0
#define VMALLOC_END TASK_SIZE
-static inline void __kernel_map_pages(struct page *page, int numpages, int enable) {}
-
#endif /* !CONFIG_MMU */
#define kern_addr_valid(addr) (1) /* FIXME */
--- a/arch/riscv/Kconfig~arch-mm-restore-dependency-of-__kernel_map_pages-on-debug_pagealloc
+++ a/arch/riscv/Kconfig
@@ -14,6 +14,7 @@ config RISCV
def_bool y
select ARCH_CLOCKSOURCE_INIT
select ARCH_SUPPORTS_ATOMIC_RMW
+ select ARCH_SUPPORTS_DEBUG_PAGEALLOC if MMU
select ARCH_HAS_BINFMT_FLAT
select ARCH_HAS_DEBUG_VM_PGTABLE
select ARCH_HAS_DEBUG_VIRTUAL if MMU
@@ -153,9 +154,6 @@ config ARCH_SELECT_MEMORY_MODEL
config ARCH_WANT_GENERAL_HUGETLB
def_bool y
-config ARCH_SUPPORTS_DEBUG_PAGEALLOC
- def_bool y
-
config SYS_SUPPORTS_HUGETLBFS
depends on MMU
def_bool y
--- a/arch/riscv/mm/pageattr.c~arch-mm-restore-dependency-of-__kernel_map_pages-on-debug_pagealloc
+++ a/arch/riscv/mm/pageattr.c
@@ -184,6 +184,7 @@ int set_direct_map_default_noflush(struc
return ret;
}
+#ifdef CONFIG_DEBUG_PAGEALLOC
void __kernel_map_pages(struct page *page, int numpages, int enable)
{
if (!debug_pagealloc_enabled())
@@ -196,3 +197,4 @@ void __kernel_map_pages(struct page *pag
__set_memory((unsigned long)page_address(page), numpages,
__pgprot(0), __pgprot(_PAGE_PRESENT));
}
+#endif
--- a/arch/s390/Kconfig~arch-mm-restore-dependency-of-__kernel_map_pages-on-debug_pagealloc
+++ a/arch/s390/Kconfig
@@ -35,9 +35,6 @@ config GENERIC_LOCKBREAK
config PGSTE
def_bool y if KVM
-config ARCH_SUPPORTS_DEBUG_PAGEALLOC
- def_bool y
-
config AUDIT_ARCH
def_bool y
@@ -106,6 +103,7 @@ config S390
select ARCH_INLINE_WRITE_UNLOCK_IRQRESTORE
select ARCH_STACKWALK
select ARCH_SUPPORTS_ATOMIC_RMW
+ select ARCH_SUPPORTS_DEBUG_PAGEALLOC
select ARCH_SUPPORTS_NUMA_BALANCING
select ARCH_USE_BUILTIN_BSWAP
select ARCH_USE_CMPXCHG_LOCKREF
--- a/arch/sparc/Kconfig~arch-mm-restore-dependency-of-__kernel_map_pages-on-debug_pagealloc
+++ a/arch/sparc/Kconfig
@@ -88,6 +88,7 @@ config SPARC64
select HAVE_C_RECORDMCOUNT
select HAVE_ARCH_AUDITSYSCALL
select ARCH_SUPPORTS_ATOMIC_RMW
+ select ARCH_SUPPORTS_DEBUG_PAGEALLOC
select HAVE_NMI
select HAVE_REGS_AND_STACK_ACCESS_API
select ARCH_USE_QUEUED_RWLOCKS
@@ -148,9 +149,6 @@ config GENERIC_ISA_DMA
bool
default y if SPARC32
-config ARCH_SUPPORTS_DEBUG_PAGEALLOC
- def_bool y if SPARC64
-
config PGTABLE_LEVELS
default 4 if 64BIT
default 3
--- a/arch/x86/Kconfig~arch-mm-restore-dependency-of-__kernel_map_pages-on-debug_pagealloc
+++ a/arch/x86/Kconfig
@@ -91,6 +91,7 @@ config X86
select ARCH_STACKWALK
select ARCH_SUPPORTS_ACPI
select ARCH_SUPPORTS_ATOMIC_RMW
+ select ARCH_SUPPORTS_DEBUG_PAGEALLOC
select ARCH_SUPPORTS_NUMA_BALANCING if X86_64
select ARCH_USE_BUILTIN_BSWAP
select ARCH_USE_QUEUED_RWLOCKS
@@ -331,9 +332,6 @@ config ZONE_DMA32
config AUDIT_ARCH
def_bool y if X86_64
-config ARCH_SUPPORTS_DEBUG_PAGEALLOC
- def_bool y
-
config KASAN_SHADOW_OFFSET
hex
depends on KASAN
--- a/arch/x86/mm/pat/set_memory.c~arch-mm-restore-dependency-of-__kernel_map_pages-on-debug_pagealloc
+++ a/arch/x86/mm/pat/set_memory.c
@@ -2194,6 +2194,7 @@ int set_direct_map_default_noflush(struc
return __set_pages_p(page, 1);
}
+#ifdef CONFIG_DEBUG_PAGEALLOC
void __kernel_map_pages(struct page *page, int numpages, int enable)
{
if (PageHighMem(page))
@@ -2239,6 +2240,7 @@ bool kernel_page_present(struct page *pa
return (pte_val(*pte) & _PAGE_PRESENT);
}
#endif /* CONFIG_HIBERNATION */
+#endif /* CONFIG_DEBUG_PAGEALLOC */
int __init kernel_map_pages_in_pgd(pgd_t *pgd, u64 pfn, unsigned long address,
unsigned numpages, unsigned long page_flags)
--- a/include/linux/mm.h~arch-mm-restore-dependency-of-__kernel_map_pages-on-debug_pagealloc
+++ a/include/linux/mm.h
@@ -2931,7 +2931,11 @@ static inline bool debug_pagealloc_enabl
return static_branch_unlikely(&_debug_pagealloc_enabled);
}
-#if defined(CONFIG_DEBUG_PAGEALLOC) || defined(CONFIG_ARCH_HAS_SET_DIRECT_MAP)
+#ifdef CONFIG_DEBUG_PAGEALLOC
+/*
+ * To support DEBUG_PAGEALLOC architecture must ensure that
+ * __kernel_map_pages() never fails
+ */
extern void __kernel_map_pages(struct page *page, int numpages, int enable);
static inline void debug_pagealloc_map_pages(struct page *page, int numpages)
@@ -2949,13 +2953,13 @@ static inline void debug_pagealloc_unmap
#ifdef CONFIG_HIBERNATION
extern bool kernel_page_present(struct page *page);
#endif /* CONFIG_HIBERNATION */
-#else /* CONFIG_DEBUG_PAGEALLOC || CONFIG_ARCH_HAS_SET_DIRECT_MAP */
+#else /* CONFIG_DEBUG_PAGEALLOC */
static inline void debug_pagealloc_map_pages(struct page *page, int numpages) {}
static inline void debug_pagealloc_unmap_pages(struct page *page, int numpages) {}
#ifdef CONFIG_HIBERNATION
static inline bool kernel_page_present(struct page *page) { return true; }
#endif /* CONFIG_HIBERNATION */
-#endif /* CONFIG_DEBUG_PAGEALLOC || CONFIG_ARCH_HAS_SET_DIRECT_MAP */
+#endif /* CONFIG_DEBUG_PAGEALLOC */
#ifdef __HAVE_ARCH_GATE_AREA
extern struct vm_area_struct *get_gate_vma(struct mm_struct *mm);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 122/200] arch, mm: make kernel_page_present() always available
2020-12-15 3:02 incoming Andrew Morton
` (120 preceding siblings ...)
2020-12-15 3:10 ` [patch 121/200] arch, mm: restore dependency of __kernel_map_pages() on DEBUG_PAGEALLOC Andrew Morton
@ 2020-12-15 3:10 ` Andrew Morton
2020-12-15 3:10 ` [patch 123/200] mm, page_alloc: clean up pageset high and batch update Andrew Morton
` (78 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:10 UTC (permalink / raw)
To: akpm, aou, benh, borntraeger, bp, catalin.marinas, cl,
dave.hansen, davem, david, gor, hca, hpa, iamjoonsoo.kim,
kirill.shutemov, len.brown, linux-mm, luto, mingo, mm-commits,
mpe, palmer, paul.walmsley, paulus, pavel, penberg, peterz,
rafael.j.wysocki, rick.p.edgecombe, rientjes, rjw, rppt, tglx,
torvalds, vbabka, will
From: Mike Rapoport <rppt@linux.ibm.com>
Subject: arch, mm: make kernel_page_present() always available
For architectures that enable ARCH_HAS_SET_MEMORY having the ability to
verify that a page is mapped in the kernel direct map can be useful
regardless of hibernation.
Add RISC-V implementation of kernel_page_present(), update its forward
declarations and stubs to be a part of set_memory API and remove ugly
ifdefery in inlcude/linux/mm.h around current declarations of
kernel_page_present().
Link: https://lkml.kernel.org/r/20201109192128.960-5-rppt@kernel.org
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Andy Lutomirski <luto@kernel.org>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Dave Hansen <dave.hansen@linux.intel.com>
Cc: David Hildenbrand <david@redhat.com>
Cc: David Rientjes <rientjes@google.com>
Cc: "David S. Miller" <davem@davemloft.net>
Cc: "Edgecombe, Rick P" <rick.p.edgecombe@intel.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Len Brown <len.brown@intel.com>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Cc: Palmer Dabbelt <palmer@dabbelt.com>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Pavel Machek <pavel@ucw.cz>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: Peter Zijlstra <peterz@infradead.org>
Cc: Rafael J. Wysocki <rafael.j.wysocki@intel.com>
Cc: "Rafael J. Wysocki" <rjw@rjwysocki.net>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Will Deacon <will@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/arm64/include/asm/cacheflush.h | 1
arch/arm64/mm/pageattr.c | 4 ---
arch/riscv/include/asm/set_memory.h | 1
arch/riscv/mm/pageattr.c | 29 ++++++++++++++++++++++++++
arch/x86/include/asm/set_memory.h | 1
arch/x86/mm/pat/set_memory.c | 4 ---
include/linux/mm.h | 7 ------
include/linux/set_memory.h | 5 ++++
8 files changed, 39 insertions(+), 13 deletions(-)
--- a/arch/arm64/include/asm/cacheflush.h~arch-mm-make-kernel_page_present-always-available
+++ a/arch/arm64/include/asm/cacheflush.h
@@ -140,6 +140,7 @@ int set_memory_valid(unsigned long addr,
int set_direct_map_invalid_noflush(struct page *page);
int set_direct_map_default_noflush(struct page *page);
+bool kernel_page_present(struct page *page);
#include <asm-generic/cacheflush.h>
--- a/arch/arm64/mm/pageattr.c~arch-mm-make-kernel_page_present-always-available
+++ a/arch/arm64/mm/pageattr.c
@@ -186,8 +186,8 @@ void __kernel_map_pages(struct page *pag
set_memory_valid((unsigned long)page_address(page), numpages, enable);
}
+#endif /* CONFIG_DEBUG_PAGEALLOC */
-#ifdef CONFIG_HIBERNATION
/*
* This function is used to determine if a linear map page has been marked as
* not-valid. Walk the page table and check the PTE_VALID bit. This is based
@@ -234,5 +234,3 @@ bool kernel_page_present(struct page *pa
ptep = pte_offset_kernel(pmdp, addr);
return pte_valid(READ_ONCE(*ptep));
}
-#endif /* CONFIG_HIBERNATION */
-#endif /* CONFIG_DEBUG_PAGEALLOC */
--- a/arch/riscv/include/asm/set_memory.h~arch-mm-make-kernel_page_present-always-available
+++ a/arch/riscv/include/asm/set_memory.h
@@ -24,6 +24,7 @@ static inline int set_memory_nx(unsigned
int set_direct_map_invalid_noflush(struct page *page);
int set_direct_map_default_noflush(struct page *page);
+bool kernel_page_present(struct page *page);
#endif /* __ASSEMBLY__ */
--- a/arch/riscv/mm/pageattr.c~arch-mm-make-kernel_page_present-always-available
+++ a/arch/riscv/mm/pageattr.c
@@ -198,3 +198,32 @@ void __kernel_map_pages(struct page *pag
__pgprot(0), __pgprot(_PAGE_PRESENT));
}
#endif
+
+bool kernel_page_present(struct page *page)
+{
+ unsigned long addr = (unsigned long)page_address(page);
+ pgd_t *pgd;
+ pud_t *pud;
+ p4d_t *p4d;
+ pmd_t *pmd;
+ pte_t *pte;
+
+ pgd = pgd_offset_k(addr);
+ if (!pgd_present(*pgd))
+ return false;
+
+ p4d = p4d_offset(pgd, addr);
+ if (!p4d_present(*p4d))
+ return false;
+
+ pud = pud_offset(p4d, addr);
+ if (!pud_present(*pud))
+ return false;
+
+ pmd = pmd_offset(pud, addr);
+ if (!pmd_present(*pmd))
+ return false;
+
+ pte = pte_offset_kernel(pmd, addr);
+ return pte_present(*pte);
+}
--- a/arch/x86/include/asm/set_memory.h~arch-mm-make-kernel_page_present-always-available
+++ a/arch/x86/include/asm/set_memory.h
@@ -82,6 +82,7 @@ int set_pages_rw(struct page *page, int
int set_direct_map_invalid_noflush(struct page *page);
int set_direct_map_default_noflush(struct page *page);
+bool kernel_page_present(struct page *page);
extern int kernel_set_to_readonly;
--- a/arch/x86/mm/pat/set_memory.c~arch-mm-make-kernel_page_present-always-available
+++ a/arch/x86/mm/pat/set_memory.c
@@ -2226,8 +2226,8 @@ void __kernel_map_pages(struct page *pag
arch_flush_lazy_mmu_mode();
}
+#endif /* CONFIG_DEBUG_PAGEALLOC */
-#ifdef CONFIG_HIBERNATION
bool kernel_page_present(struct page *page)
{
unsigned int level;
@@ -2239,8 +2239,6 @@ bool kernel_page_present(struct page *pa
pte = lookup_address((unsigned long)page_address(page), &level);
return (pte_val(*pte) & _PAGE_PRESENT);
}
-#endif /* CONFIG_HIBERNATION */
-#endif /* CONFIG_DEBUG_PAGEALLOC */
int __init kernel_map_pages_in_pgd(pgd_t *pgd, u64 pfn, unsigned long address,
unsigned numpages, unsigned long page_flags)
--- a/include/linux/mm.h~arch-mm-make-kernel_page_present-always-available
+++ a/include/linux/mm.h
@@ -2949,16 +2949,9 @@ static inline void debug_pagealloc_unmap
if (debug_pagealloc_enabled_static())
__kernel_map_pages(page, numpages, 0);
}
-
-#ifdef CONFIG_HIBERNATION
-extern bool kernel_page_present(struct page *page);
-#endif /* CONFIG_HIBERNATION */
#else /* CONFIG_DEBUG_PAGEALLOC */
static inline void debug_pagealloc_map_pages(struct page *page, int numpages) {}
static inline void debug_pagealloc_unmap_pages(struct page *page, int numpages) {}
-#ifdef CONFIG_HIBERNATION
-static inline bool kernel_page_present(struct page *page) { return true; }
-#endif /* CONFIG_HIBERNATION */
#endif /* CONFIG_DEBUG_PAGEALLOC */
#ifdef __HAVE_ARCH_GATE_AREA
--- a/include/linux/set_memory.h~arch-mm-make-kernel_page_present-always-available
+++ a/include/linux/set_memory.h
@@ -23,6 +23,11 @@ static inline int set_direct_map_default
{
return 0;
}
+
+static inline bool kernel_page_present(struct page *page)
+{
+ return true;
+}
#endif
#ifndef set_mce_nospec
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 123/200] mm, page_alloc: clean up pageset high and batch update
2020-12-15 3:02 incoming Andrew Morton
` (121 preceding siblings ...)
2020-12-15 3:10 ` [patch 122/200] arch, mm: make kernel_page_present() always available Andrew Morton
@ 2020-12-15 3:10 ` Andrew Morton
2020-12-15 3:10 ` [patch 124/200] mm, page_alloc: calculate pageset high and batch once per zone Andrew Morton
` (77 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:10 UTC (permalink / raw)
To: akpm, david, linux-mm, mhocko, mm-commits, osalvador,
pankaj.gupta, torvalds, vbabka
From: Vlastimil Babka <vbabka@suse.cz>
Subject: mm, page_alloc: clean up pageset high and batch update
Patch series "disable pcplists during memory offline", v3.
As per the discussions [1] [2] this is an attempt to implement David's
suggestion that page isolation should disable pcplists to avoid races with
page freeing in progress. This is done without extra checks in fast
paths, as explained in Patch 9. The repeated draining done by [2] is then
no longer needed. Previous version (RFC) is at [3].
The RFC tried to hide pcplists disabling/enabling into page isolation, but
it wasn't completely possible, as memory offline does not unisolation.
Michal suggested an explicit API in [4] so that's the current
implementation and it seems indeed nicer.
Once we accept that page isolation users need to do explicit actions
around it depending on the needed guarantees, we can also IMHO accept that
the current pcplist draining can be also done by the callers, which is
more effective. After all, there are only two users of page isolation.
So patch 6 does effectively the same thing as Pavel proposed in [5], and
patch 7 implement stronger guarantees only for memory offline. If CMA
decides to opt-in to the stronger guarantee, it can be added later.
Patches 1-5 are preparatory cleanups for pcplist disabling.
Patchset was briefly tested in QEMU so that memory online/offline works,
but I haven't done a stress test that would prove the race fixed by [2] is
eliminated.
Note that patch 7 could be avoided if we instead adjusted page freeing in
shown in [6], but I believe the current implementation of disabling
pcplists is not too much complex, so I would prefer this instead of adding
new checks and longer irq-disabled section into page freeing hotpaths.
[1] https://lore.kernel.org/linux-mm/20200901124615.137200-1-pasha.tatashin@soleen.com/
[2] https://lore.kernel.org/linux-mm/20200903140032.380431-1-pasha.tatashin@soleen.com/
[3] https://lore.kernel.org/linux-mm/20200907163628.26495-1-vbabka@suse.cz/
[4] https://lore.kernel.org/linux-mm/20200909113647.GG7348@dhcp22.suse.cz/
[5] https://lore.kernel.org/linux-mm/20200904151448.100489-3-pasha.tatashin@soleen.com/
[6] https://lore.kernel.org/linux-mm/3d3b53db-aeaa-ff24-260b-36427fac9b1c@suse.cz/
[7] https://lore.kernel.org/linux-mm/20200922143712.12048-1-vbabka@suse.cz/
[8] https://lore.kernel.org/linux-mm/20201008114201.18824-1-vbabka@suse.cz/
This patch (of 7):
The updates to pcplists' high and batch values are handled by multiple
functions that make the calculations hard to follow. Consolidate
everything to pageset_set_high_and_batch() and remove pageset_set_batch()
and pageset_set_high() wrappers.
The only special case using one of the removed wrappers was:
build_all_zonelists_init()
setup_pageset()
pageset_set_batch()
which was hardcoding batch as 0, so we can just open-code a call to
pageset_update() with constant parameters instead.
No functional change.
Link: https://lkml.kernel.org/r/20201111092812.11329-1-vbabka@suse.cz
Link: https://lkml.kernel.org/r/20201111092812.11329-2-vbabka@suse.cz
Signed-off-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Acked-by: Pankaj Gupta <pankaj.gupta@cloud.ionos.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_alloc.c | 49 ++++++++++++++++++----------------------------
1 file changed, 20 insertions(+), 29 deletions(-)
--- a/mm/page_alloc.c~mm-page_alloc-clean-up-pageset-high-and-batch-update
+++ a/mm/page_alloc.c
@@ -5919,7 +5919,7 @@ static void build_zonelists(pg_data_t *p
* not check if the processor is online before following the pageset pointer.
* Other parts of the kernel may not check if the zone is available.
*/
-static void setup_pageset(struct per_cpu_pageset *p, unsigned long batch);
+static void setup_pageset(struct per_cpu_pageset *p);
static DEFINE_PER_CPU(struct per_cpu_pageset, boot_pageset);
static DEFINE_PER_CPU(struct per_cpu_nodestat, boot_nodestats);
@@ -5987,7 +5987,7 @@ build_all_zonelists_init(void)
* (a chicken-egg dilemma).
*/
for_each_possible_cpu(cpu)
- setup_pageset(&per_cpu(boot_pageset, cpu), 0);
+ setup_pageset(&per_cpu(boot_pageset, cpu));
mminit_verify_zonelist();
cpuset_init_current_mems_allowed();
@@ -6296,12 +6296,6 @@ static void pageset_update(struct per_cp
pcp->batch = batch;
}
-/* a companion to pageset_set_high() */
-static void pageset_set_batch(struct per_cpu_pageset *p, unsigned long batch)
-{
- pageset_update(&p->pcp, 6 * batch, max(1UL, 1 * batch));
-}
-
static void pageset_init(struct per_cpu_pageset *p)
{
struct per_cpu_pages *pcp;
@@ -6314,35 +6308,32 @@ static void pageset_init(struct per_cpu_
INIT_LIST_HEAD(&pcp->lists[migratetype]);
}
-static void setup_pageset(struct per_cpu_pageset *p, unsigned long batch)
+static void setup_pageset(struct per_cpu_pageset *p)
{
pageset_init(p);
- pageset_set_batch(p, batch);
+ pageset_update(&p->pcp, 0, 1);
}
/*
- * pageset_set_high() sets the high water mark for hot per_cpu_pagelist
- * to the value high for the pageset p.
+ * Calculate and set new high and batch values for given per-cpu pageset of a
+ * zone, based on the zone's size and the percpu_pagelist_fraction sysctl.
*/
-static void pageset_set_high(struct per_cpu_pageset *p,
- unsigned long high)
-{
- unsigned long batch = max(1UL, high / 4);
- if ((high / 4) > (PAGE_SHIFT * 8))
- batch = PAGE_SHIFT * 8;
-
- pageset_update(&p->pcp, high, batch);
-}
-
static void pageset_set_high_and_batch(struct zone *zone,
- struct per_cpu_pageset *pcp)
+ struct per_cpu_pageset *p)
{
- if (percpu_pagelist_fraction)
- pageset_set_high(pcp,
- (zone_managed_pages(zone) /
- percpu_pagelist_fraction));
- else
- pageset_set_batch(pcp, zone_batchsize(zone));
+ unsigned long new_high, new_batch;
+
+ if (percpu_pagelist_fraction) {
+ new_high = zone_managed_pages(zone) / percpu_pagelist_fraction;
+ new_batch = max(1UL, new_high / 4);
+ if ((new_high / 4) > (PAGE_SHIFT * 8))
+ new_batch = PAGE_SHIFT * 8;
+ } else {
+ new_batch = zone_batchsize(zone);
+ new_high = 6 * new_batch;
+ new_batch = max(1UL, 1 * new_batch);
+ }
+ pageset_update(&p->pcp, new_high, new_batch);
}
static void __meminit zone_pageset_init(struct zone *zone, int cpu)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 124/200] mm, page_alloc: calculate pageset high and batch once per zone
2020-12-15 3:02 incoming Andrew Morton
` (122 preceding siblings ...)
2020-12-15 3:10 ` [patch 123/200] mm, page_alloc: clean up pageset high and batch update Andrew Morton
@ 2020-12-15 3:10 ` Andrew Morton
2020-12-15 3:10 ` [patch 125/200] mm, page_alloc: remove setup_pageset() Andrew Morton
` (76 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:10 UTC (permalink / raw)
To: akpm, david, linux-mm, mhocko, mm-commits, osalvador,
pankaj.gupta, torvalds, vbabka
From: Vlastimil Babka <vbabka@suse.cz>
Subject: mm, page_alloc: calculate pageset high and batch once per zone
We currently call pageset_set_high_and_batch() for each possible cpu,
which repeats the same calculations of high and batch values.
Instead call the function just once per zone, and make it apply the
calculated values to all per-cpu pagesets of the zone.
This also allows removing the zone_pageset_init() and __zone_pcp_update()
wrappers.
No functional change.
Link: https://lkml.kernel.org/r/20201111092812.11329-3-vbabka@suse.cz
Signed-off-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Acked-by: Pankaj Gupta <pankaj.gupta@cloud.ionos.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_alloc.c | 42 ++++++++++++++++++------------------------
1 file changed, 18 insertions(+), 24 deletions(-)
--- a/mm/page_alloc.c~mm-page_alloc-calculate-pageset-high-and-batch-once-per-zone
+++ a/mm/page_alloc.c
@@ -6315,13 +6315,14 @@ static void setup_pageset(struct per_cpu
}
/*
- * Calculate and set new high and batch values for given per-cpu pageset of a
+ * Calculate and set new high and batch values for all per-cpu pagesets of a
* zone, based on the zone's size and the percpu_pagelist_fraction sysctl.
*/
-static void pageset_set_high_and_batch(struct zone *zone,
- struct per_cpu_pageset *p)
+static void zone_set_pageset_high_and_batch(struct zone *zone)
{
unsigned long new_high, new_batch;
+ struct per_cpu_pageset *p;
+ int cpu;
if (percpu_pagelist_fraction) {
new_high = zone_managed_pages(zone) / percpu_pagelist_fraction;
@@ -6333,23 +6334,25 @@ static void pageset_set_high_and_batch(s
new_high = 6 * new_batch;
new_batch = max(1UL, 1 * new_batch);
}
- pageset_update(&p->pcp, new_high, new_batch);
-}
-
-static void __meminit zone_pageset_init(struct zone *zone, int cpu)
-{
- struct per_cpu_pageset *pcp = per_cpu_ptr(zone->pageset, cpu);
- pageset_init(pcp);
- pageset_set_high_and_batch(zone, pcp);
+ for_each_possible_cpu(cpu) {
+ p = per_cpu_ptr(zone->pageset, cpu);
+ pageset_update(&p->pcp, new_high, new_batch);
+ }
}
void __meminit setup_zone_pageset(struct zone *zone)
{
+ struct per_cpu_pageset *p;
int cpu;
+
zone->pageset = alloc_percpu(struct per_cpu_pageset);
- for_each_possible_cpu(cpu)
- zone_pageset_init(zone, cpu);
+ for_each_possible_cpu(cpu) {
+ p = per_cpu_ptr(zone->pageset, cpu);
+ pageset_init(p);
+ }
+
+ zone_set_pageset_high_and_batch(zone);
}
/*
@@ -8083,15 +8086,6 @@ int lowmem_reserve_ratio_sysctl_handler(
return 0;
}
-static void __zone_pcp_update(struct zone *zone)
-{
- unsigned int cpu;
-
- for_each_possible_cpu(cpu)
- pageset_set_high_and_batch(zone,
- per_cpu_ptr(zone->pageset, cpu));
-}
-
/*
* percpu_pagelist_fraction - changes the pcp->high for each zone on each
* cpu. It is the fraction of total pages in each zone that a hot per cpu
@@ -8124,7 +8118,7 @@ int percpu_pagelist_fraction_sysctl_hand
goto out;
for_each_populated_zone(zone)
- __zone_pcp_update(zone);
+ zone_set_pageset_high_and_batch(zone);
out:
mutex_unlock(&pcp_batch_high_lock);
return ret;
@@ -8731,7 +8725,7 @@ EXPORT_SYMBOL(free_contig_range);
void __meminit zone_pcp_update(struct zone *zone)
{
mutex_lock(&pcp_batch_high_lock);
- __zone_pcp_update(zone);
+ zone_set_pageset_high_and_batch(zone);
mutex_unlock(&pcp_batch_high_lock);
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 125/200] mm, page_alloc: remove setup_pageset()
2020-12-15 3:02 incoming Andrew Morton
` (123 preceding siblings ...)
2020-12-15 3:10 ` [patch 124/200] mm, page_alloc: calculate pageset high and batch once per zone Andrew Morton
@ 2020-12-15 3:10 ` Andrew Morton
2020-12-15 3:10 ` [patch 126/200] mm, page_alloc: simplify pageset_update() Andrew Morton
` (75 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:10 UTC (permalink / raw)
To: akpm, david, linux-mm, mhocko, mm-commits, osalvador,
pankaj.gupta, torvalds, vbabka
From: Vlastimil Babka <vbabka@suse.cz>
Subject: mm, page_alloc: remove setup_pageset()
We initialize boot-time pagesets with setup_pageset(), which sets high and
batch values that effectively disable pcplists.
We can remove this wrapper if we just set these values for all pagesets in
pageset_init(). Non-boot pagesets then subsequently update them to the
proper values.
No functional change.
Link: https://lkml.kernel.org/r/20201111092812.11329-4-vbabka@suse.cz
Signed-off-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: David Hildenbrand <david@redhat.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Michal Hocko <mhocko@suse.com>
Acked-by: Pankaj Gupta <pankaj.gupta@cloud.ionos.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_alloc.c | 17 ++++++++++-------
1 file changed, 10 insertions(+), 7 deletions(-)
--- a/mm/page_alloc.c~mm-page_alloc-remove-setup_pageset
+++ a/mm/page_alloc.c
@@ -5919,7 +5919,7 @@ static void build_zonelists(pg_data_t *p
* not check if the processor is online before following the pageset pointer.
* Other parts of the kernel may not check if the zone is available.
*/
-static void setup_pageset(struct per_cpu_pageset *p);
+static void pageset_init(struct per_cpu_pageset *p);
static DEFINE_PER_CPU(struct per_cpu_pageset, boot_pageset);
static DEFINE_PER_CPU(struct per_cpu_nodestat, boot_nodestats);
@@ -5987,7 +5987,7 @@ build_all_zonelists_init(void)
* (a chicken-egg dilemma).
*/
for_each_possible_cpu(cpu)
- setup_pageset(&per_cpu(boot_pageset, cpu));
+ pageset_init(&per_cpu(boot_pageset, cpu));
mminit_verify_zonelist();
cpuset_init_current_mems_allowed();
@@ -6306,12 +6306,15 @@ static void pageset_init(struct per_cpu_
pcp = &p->pcp;
for (migratetype = 0; migratetype < MIGRATE_PCPTYPES; migratetype++)
INIT_LIST_HEAD(&pcp->lists[migratetype]);
-}
-static void setup_pageset(struct per_cpu_pageset *p)
-{
- pageset_init(p);
- pageset_update(&p->pcp, 0, 1);
+ /*
+ * Set batch and high values safe for a boot pageset. A true percpu
+ * pageset's initialization will update them subsequently. Here we don't
+ * need to be as careful as pageset_update() as nobody can access the
+ * pageset yet.
+ */
+ pcp->high = 0;
+ pcp->batch = 1;
}
/*
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 126/200] mm, page_alloc: simplify pageset_update()
2020-12-15 3:02 incoming Andrew Morton
` (124 preceding siblings ...)
2020-12-15 3:10 ` [patch 125/200] mm, page_alloc: remove setup_pageset() Andrew Morton
@ 2020-12-15 3:10 ` Andrew Morton
2020-12-15 3:10 ` [patch 127/200] mm, page_alloc: cache pageset high and batch in struct zone Andrew Morton
` (74 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:10 UTC (permalink / raw)
To: akpm, david, linux-mm, mhocko, mm-commits, osalvador, torvalds,
vbabka
From: Vlastimil Babka <vbabka@suse.cz>
Subject: mm, page_alloc: simplify pageset_update()
pageset_update() attempts to update pcplist's high and batch values in a
way that readers don't observe batch > high. It uses smp_wmb() to order
the updates in a way to achieve this. However, without proper pairing
read barriers in readers this guarantee doesn't hold, and there are no
such barriers in e.g. free_unref_page_commit().
Commit 88e8ac11d2ea ("mm, page_alloc: fix core hung in
free_pcppages_bulk()") already showed this is problematic, and solved this
by ultimately only trusing pcp->count of the current cpu with interrupts
disabled.
The update dance with unpaired write barriers thus makes no sense.
Replace them with plain WRITE_ONCE to prevent store tearing, and document
that the values can change asynchronously and should not be trusted for
correctness.
All current readers appear to be OK after 88e8ac11d2ea. Convert them to
READ_ONCE to prevent unnecessary read tearing, but mainly to alert anybody
making future changes to the code that special care is needed.
Link: https://lkml.kernel.org/r/20201111092812.11329-5-vbabka@suse.cz
Signed-off-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Acked-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_alloc.c | 42 +++++++++++++++++++-----------------------
1 file changed, 19 insertions(+), 23 deletions(-)
--- a/mm/page_alloc.c~mm-page_alloc-simplify-pageset_update
+++ a/mm/page_alloc.c
@@ -1344,7 +1344,7 @@ static void free_pcppages_bulk(struct zo
{
int migratetype = 0;
int batch_free = 0;
- int prefetch_nr = 0;
+ int prefetch_nr = READ_ONCE(pcp->batch);
bool isolated_pageblocks;
struct page *page, *tmp;
LIST_HEAD(head);
@@ -1395,8 +1395,10 @@ static void free_pcppages_bulk(struct zo
* avoid excessive prefetching due to large count, only
* prefetch buddy for the first pcp->batch nr of pages.
*/
- if (prefetch_nr++ < pcp->batch)
+ if (prefetch_nr) {
prefetch_buddy(page);
+ prefetch_nr--;
+ }
} while (--count && --batch_free && !list_empty(list));
}
@@ -3197,10 +3199,8 @@ static void free_unref_page_commit(struc
pcp = &this_cpu_ptr(zone->pageset)->pcp;
list_add(&page->lru, &pcp->lists[migratetype]);
pcp->count++;
- if (pcp->count >= pcp->high) {
- unsigned long batch = READ_ONCE(pcp->batch);
- free_pcppages_bulk(zone, batch, pcp);
- }
+ if (pcp->count >= READ_ONCE(pcp->high))
+ free_pcppages_bulk(zone, READ_ONCE(pcp->batch), pcp);
}
/*
@@ -3385,7 +3385,7 @@ static struct page *__rmqueue_pcplist(st
do {
if (list_empty(list)) {
pcp->count += rmqueue_bulk(zone, 0,
- pcp->batch, list,
+ READ_ONCE(pcp->batch), list,
migratetype, alloc_flags);
if (unlikely(list_empty(list)))
return NULL;
@@ -6270,13 +6270,16 @@ static int zone_batchsize(struct zone *z
}
/*
- * pcp->high and pcp->batch values are related and dependent on one another:
- * ->batch must never be higher then ->high.
- * The following function updates them in a safe manner without read side
- * locking.
- *
- * Any new users of pcp->batch and pcp->high should ensure they can cope with
- * those fields changing asynchronously (acording to the above rule).
+ * pcp->high and pcp->batch values are related and generally batch is lower
+ * than high. They are also related to pcp->count such that count is lower
+ * than high, and as soon as it reaches high, the pcplist is flushed.
+ *
+ * However, guaranteeing these relations at all times would require e.g. write
+ * barriers here but also careful usage of read barriers at the read side, and
+ * thus be prone to error and bad for performance. Thus the update only prevents
+ * store tearing. Any new users of pcp->batch and pcp->high should ensure they
+ * can cope with those fields changing asynchronously, and fully trust only the
+ * pcp->count field on the local CPU with interrupts disabled.
*
* mutex_is_locked(&pcp_batch_high_lock) required when calling this function
* outside of boot time (or some other assurance that no concurrent updaters
@@ -6285,15 +6288,8 @@ static int zone_batchsize(struct zone *z
static void pageset_update(struct per_cpu_pages *pcp, unsigned long high,
unsigned long batch)
{
- /* start with a fail safe value for batch */
- pcp->batch = 1;
- smp_wmb();
-
- /* Update high, then batch, in order */
- pcp->high = high;
- smp_wmb();
-
- pcp->batch = batch;
+ WRITE_ONCE(pcp->batch, batch);
+ WRITE_ONCE(pcp->high, high);
}
static void pageset_init(struct per_cpu_pageset *p)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 127/200] mm, page_alloc: cache pageset high and batch in struct zone
2020-12-15 3:02 incoming Andrew Morton
` (125 preceding siblings ...)
2020-12-15 3:10 ` [patch 126/200] mm, page_alloc: simplify pageset_update() Andrew Morton
@ 2020-12-15 3:10 ` Andrew Morton
2020-12-15 3:10 ` [patch 128/200] mm, page_alloc: move draining pcplists to page isolation users Andrew Morton
` (73 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:10 UTC (permalink / raw)
To: akpm, david, linux-mm, mhocko, mm-commits, osalvador, torvalds,
vbabka
From: Vlastimil Babka <vbabka@suse.cz>
Subject: mm, page_alloc: cache pageset high and batch in struct zone
All per-cpu pagesets for a zone use the same high and batch values, that
are duplicated there just for performance (locality) reasons. This patch
adds the same variables also to struct zone as a shared copy.
This will be useful later for making possible to disable pcplists
temporarily by setting high value to 0, while remembering the values for
restoring them later. But we can also immediately benefit from not
updating pagesets of all possible cpus in case the newly recalculated
values (after sysctl change or memory online/offline) are actually
unchanged from the previous ones.
Link: https://lkml.kernel.org/r/20201111092812.11329-6-vbabka@suse.cz
Signed-off-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/mmzone.h | 6 ++++++
mm/page_alloc.c | 16 ++++++++++++++--
2 files changed, 20 insertions(+), 2 deletions(-)
--- a/include/linux/mmzone.h~mm-page_alloc-cache-pageset-high-and-batch-in-struct-zone
+++ a/include/linux/mmzone.h
@@ -470,6 +470,12 @@ struct zone {
#endif
struct pglist_data *zone_pgdat;
struct per_cpu_pageset __percpu *pageset;
+ /*
+ * the high and batch values are copied to individual pagesets for
+ * faster access
+ */
+ int pageset_high;
+ int pageset_batch;
#ifndef CONFIG_SPARSEMEM
/*
--- a/mm/page_alloc.c~mm-page_alloc-cache-pageset-high-and-batch-in-struct-zone
+++ a/mm/page_alloc.c
@@ -5920,6 +5920,9 @@ static void build_zonelists(pg_data_t *p
* Other parts of the kernel may not check if the zone is available.
*/
static void pageset_init(struct per_cpu_pageset *p);
+/* These effectively disable the pcplists in the boot pageset completely */
+#define BOOT_PAGESET_HIGH 0
+#define BOOT_PAGESET_BATCH 1
static DEFINE_PER_CPU(struct per_cpu_pageset, boot_pageset);
static DEFINE_PER_CPU(struct per_cpu_nodestat, boot_nodestats);
@@ -6309,8 +6312,8 @@ static void pageset_init(struct per_cpu_
* need to be as careful as pageset_update() as nobody can access the
* pageset yet.
*/
- pcp->high = 0;
- pcp->batch = 1;
+ pcp->high = BOOT_PAGESET_HIGH;
+ pcp->batch = BOOT_PAGESET_BATCH;
}
/*
@@ -6334,6 +6337,13 @@ static void zone_set_pageset_high_and_ba
new_batch = max(1UL, 1 * new_batch);
}
+ if (zone->pageset_high == new_high &&
+ zone->pageset_batch == new_batch)
+ return;
+
+ zone->pageset_high = new_high;
+ zone->pageset_batch = new_batch;
+
for_each_possible_cpu(cpu) {
p = per_cpu_ptr(zone->pageset, cpu);
pageset_update(&p->pcp, new_high, new_batch);
@@ -6394,6 +6404,8 @@ static __meminit void zone_pcp_init(stru
* offset of a (static) per cpu variable into the per cpu area.
*/
zone->pageset = &boot_pageset;
+ zone->pageset_high = BOOT_PAGESET_HIGH;
+ zone->pageset_batch = BOOT_PAGESET_BATCH;
if (populated_zone(zone))
printk(KERN_DEBUG " %s zone: %lu pages, LIFO batch:%u\n",
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 128/200] mm, page_alloc: move draining pcplists to page isolation users
2020-12-15 3:02 incoming Andrew Morton
` (126 preceding siblings ...)
2020-12-15 3:10 ` [patch 127/200] mm, page_alloc: cache pageset high and batch in struct zone Andrew Morton
@ 2020-12-15 3:10 ` Andrew Morton
2020-12-15 3:10 ` [patch 129/200] mm, page_alloc: disable pcplists during memory offline Andrew Morton
` (72 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:10 UTC (permalink / raw)
To: akpm, david, linux-mm, mhocko, mm-commits, osalvador,
pasha.tatashin, torvalds, vbabka
From: Vlastimil Babka <vbabka@suse.cz>
Subject: mm, page_alloc: move draining pcplists to page isolation users
Currently, pcplists are drained during set_migratetype_isolate() which
means once per pageblock processed start_isolate_page_range(). This is
somewhat wasteful. Moreover, the callers might need different guarantees,
and the draining is currently prone to races and does not guarantee that
no page from isolated pageblock will end up on the pcplist after the
drain.
Better guarantees are added by later patches and require explicit actions
by page isolation users that need them. Thus it makes sense to move the
current imperfect draining to the callers also as a preparation step.
Link: https://lkml.kernel.org/r/20201111092812.11329-7-vbabka@suse.cz
Suggested-by: David Hildenbrand <david@redhat.com>
Suggested-by: Pavel Tatashin <pasha.tatashin@soleen.com>
Signed-off-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: David Hildenbrand <david@redhat.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memory_hotplug.c | 11 ++++++-----
mm/page_alloc.c | 2 ++
mm/page_isolation.c | 10 +++++-----
3 files changed, 13 insertions(+), 10 deletions(-)
--- a/mm/memory_hotplug.c~mm-page_alloc-move-draining-pcplists-to-page-isolation-users
+++ a/mm/memory_hotplug.c
@@ -1500,6 +1500,8 @@ int __ref offline_pages(unsigned long st
goto failed_removal;
}
+ drain_all_pages(zone);
+
arg.start_pfn = start_pfn;
arg.nr_pages = nr_pages;
node_states_check_changes_offline(nr_pages, zone, &arg);
@@ -1550,11 +1552,10 @@ int __ref offline_pages(unsigned long st
}
/*
- * per-cpu pages are drained in start_isolate_page_range, but if
- * there are still pages that are not free, make sure that we
- * drain again, because when we isolated range we might
- * have raced with another thread that was adding pages to pcp
- * list.
+ * per-cpu pages are drained after start_isolate_page_range, but
+ * if there are still pages that are not free, make sure that we
+ * drain again, because when we isolated range we might have
+ * raced with another thread that was adding pages to pcp list.
*
* Forward progress should be still guaranteed because
* pages on the pcp list can only belong to MOVABLE_ZONE
--- a/mm/page_alloc.c~mm-page_alloc-move-draining-pcplists-to-page-isolation-users
+++ a/mm/page_alloc.c
@@ -8528,6 +8528,8 @@ int alloc_contig_range(unsigned long sta
if (ret)
return ret;
+ drain_all_pages(cc.zone);
+
/*
* In case of -EBUSY, we'd like to know which page causes problem.
* So, just fall through. test_pages_isolated() has a tracepoint
--- a/mm/page_isolation.c~mm-page_alloc-move-draining-pcplists-to-page-isolation-users
+++ a/mm/page_isolation.c
@@ -49,7 +49,6 @@ static int set_migratetype_isolate(struc
__mod_zone_freepage_state(zone, -nr_pages, mt);
spin_unlock_irqrestore(&zone->lock, flags);
- drain_all_pages(zone);
return 0;
}
@@ -172,11 +171,12 @@ __first_valid_page(unsigned long pfn, un
*
* Please note that there is no strong synchronization with the page allocator
* either. Pages might be freed while their page blocks are marked ISOLATED.
- * In some cases pages might still end up on pcp lists and that would allow
+ * A call to drain_all_pages() after isolation can flush most of them. However
+ * in some cases pages might still end up on pcp lists and that would allow
* for their allocation even when they are in fact isolated already. Depending
- * on how strong of a guarantee the caller needs drain_all_pages might be needed
- * (e.g. __offline_pages will need to call it after check for isolated range for
- * a next retry).
+ * on how strong of a guarantee the caller needs, further drain_all_pages()
+ * might be needed (e.g. __offline_pages will need to call it after check for
+ * isolated range for a next retry).
*
* Return: 0 on success and -EBUSY if any part of range cannot be isolated.
*/
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 129/200] mm, page_alloc: disable pcplists during memory offline
2020-12-15 3:02 incoming Andrew Morton
` (127 preceding siblings ...)
2020-12-15 3:10 ` [patch 128/200] mm, page_alloc: move draining pcplists to page isolation users Andrew Morton
@ 2020-12-15 3:10 ` Andrew Morton
2020-12-15 3:11 ` [patch 130/200] include/linux/page-flags.h: remove unused __[Set|Clear]PagePrivate Andrew Morton
` (71 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:10 UTC (permalink / raw)
To: akpm, david, linux-mm, mhocko, mm-commits, osalvador, torvalds,
vbabka
From: Vlastimil Babka <vbabka@suse.cz>
Subject: mm, page_alloc: disable pcplists during memory offline
Memory offlining relies on page isolation to guarantee a forward progress
because pages cannot be reused while they are isolated. But the page
isolation itself doesn't prevent from races while freed pages are stored
on pcp lists and thus can be reused. This can be worked around by
repeated draining of pcplists, as done by commit 968318261221
("mm/memory_hotplug: drain per-cpu pages again during memory offline").
David and Michal would prefer that this race was closed in a way that
callers of page isolation who need stronger guarantees don't need to
repeatedly drain. David suggested disabling pcplists usage completely
during page isolation, instead of repeatedly draining them.
To achieve this without adding special cases in alloc/free fastpath, we
can use the same approach as boot pagesets - when pcp->high is 0, any
pcplist addition will be immediately flushed.
The race can thus be closed by setting pcp->high to 0 and draining
pcplists once, before calling start_isolate_page_range(). The draining
will serialize after processes that already disabled interrupts and read
the old value of pcp->high in free_unref_page_commit(), and processes that
have not yet disabled interrupts, will observe pcp->high == 0 when they
are rescheduled, and skip pcplists. This guarantees no stray pages on
pcplists in zones where isolation happens.
This patch thus adds zone_pcp_disable() and zone_pcp_enable() functions
that page isolation users can call before start_isolate_page_range() and
after unisolating (or offlining) the isolated pages.
Also, drain_all_pages() is optimized to only execute on cpus where
pcplists are not empty. The check can however race with a free to pcplist
that has not yet increased the pcp->count from 0 to 1. Thus make the
drain optionally skip the racy check and drain on all cpus, and use this
option in zone_pcp_disable().
As we have to avoid external updates to high and batch while pcplists are
disabled, we take pcp_batch_high_lock in zone_pcp_disable() and release it
in zone_pcp_enable(). This also synchronizes multiple users of
zone_pcp_disable()/enable().
Currently the only user of this functionality is offline_pages().
[vbabka@suse.cz: add comment, per David]
Link: https://lkml.kernel.org/r/527480ef-ed72-e1c1-52a0-1c5b0113df45@suse.cz
Link: https://lkml.kernel.org/r/20201111092812.11329-8-vbabka@suse.cz
Signed-off-by: Vlastimil Babka <vbabka@suse.cz>
Suggested-by: David Hildenbrand <david@redhat.com>
Suggested-by: Michal Hocko <mhocko@suse.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/internal.h | 2 +
mm/memory_hotplug.c | 28 ++++++----------
mm/page_alloc.c | 73 +++++++++++++++++++++++++++++++++++-------
mm/page_isolation.c | 6 +--
4 files changed, 78 insertions(+), 31 deletions(-)
--- a/mm/internal.h~mm-page_alloc-disable-pcplists-during-memory-offline
+++ a/mm/internal.h
@@ -204,6 +204,8 @@ extern void free_unref_page_list(struct
extern void zone_pcp_update(struct zone *zone);
extern void zone_pcp_reset(struct zone *zone);
+extern void zone_pcp_disable(struct zone *zone);
+extern void zone_pcp_enable(struct zone *zone);
#if defined CONFIG_COMPACTION || defined CONFIG_CMA
--- a/mm/memory_hotplug.c~mm-page_alloc-disable-pcplists-during-memory-offline
+++ a/mm/memory_hotplug.c
@@ -1491,17 +1491,21 @@ int __ref offline_pages(unsigned long st
}
node = zone_to_nid(zone);
+ /*
+ * Disable pcplists so that page isolation cannot race with freeing
+ * in a way that pages from isolated pageblock are left on pcplists.
+ */
+ zone_pcp_disable(zone);
+
/* set above range as isolated */
ret = start_isolate_page_range(start_pfn, end_pfn,
MIGRATE_MOVABLE,
MEMORY_OFFLINE | REPORT_FAILURE);
if (ret) {
reason = "failure to isolate range";
- goto failed_removal;
+ goto failed_removal_pcplists_disabled;
}
- drain_all_pages(zone);
-
arg.start_pfn = start_pfn;
arg.nr_pages = nr_pages;
node_states_check_changes_offline(nr_pages, zone, &arg);
@@ -1551,20 +1555,8 @@ int __ref offline_pages(unsigned long st
goto failed_removal_isolated;
}
- /*
- * per-cpu pages are drained after start_isolate_page_range, but
- * if there are still pages that are not free, make sure that we
- * drain again, because when we isolated range we might have
- * raced with another thread that was adding pages to pcp list.
- *
- * Forward progress should be still guaranteed because
- * pages on the pcp list can only belong to MOVABLE_ZONE
- * because has_unmovable_pages explicitly checks for
- * PageBuddy on freed pages on other zones.
- */
ret = test_pages_isolated(start_pfn, end_pfn, MEMORY_OFFLINE);
- if (ret)
- drain_all_pages(zone);
+
} while (ret);
/* Mark all sections offline and remove free pages from the buddy. */
@@ -1580,6 +1572,8 @@ int __ref offline_pages(unsigned long st
zone->nr_isolate_pageblock -= nr_pages / pageblock_nr_pages;
spin_unlock_irqrestore(&zone->lock, flags);
+ zone_pcp_enable(zone);
+
/* removal success */
adjust_managed_page_count(pfn_to_page(start_pfn), -nr_pages);
zone->present_pages -= nr_pages;
@@ -1612,6 +1606,8 @@ int __ref offline_pages(unsigned long st
failed_removal_isolated:
undo_isolate_page_range(start_pfn, end_pfn, MIGRATE_MOVABLE);
memory_notify(MEM_CANCEL_OFFLINE, &arg);
+failed_removal_pcplists_disabled:
+ zone_pcp_enable(zone);
failed_removal:
pr_debug("memory offlining [mem %#010llx-%#010llx] failed due to %s\n",
(unsigned long long) start_pfn << PAGE_SHIFT,
--- a/mm/page_alloc.c~mm-page_alloc-disable-pcplists-during-memory-offline
+++ a/mm/page_alloc.c
@@ -3026,13 +3026,16 @@ static void drain_local_pages_wq(struct
}
/*
- * Spill all the per-cpu pages from all CPUs back into the buddy allocator.
- *
- * When zone parameter is non-NULL, spill just the single zone's pages.
+ * The implementation of drain_all_pages(), exposing an extra parameter to
+ * drain on all cpus.
*
- * Note that this can be extremely slow as the draining happens in a workqueue.
+ * drain_all_pages() is optimized to only execute on cpus where pcplists are
+ * not empty. The check for non-emptiness can however race with a free to
+ * pcplist that has not yet increased the pcp->count from 0 to 1. Callers
+ * that need the guarantee that every CPU has drained can disable the
+ * optimizing racy check.
*/
-void drain_all_pages(struct zone *zone)
+void __drain_all_pages(struct zone *zone, bool force_all_cpus)
{
int cpu;
@@ -3071,7 +3074,13 @@ void drain_all_pages(struct zone *zone)
struct zone *z;
bool has_pcps = false;
- if (zone) {
+ if (force_all_cpus) {
+ /*
+ * The pcp.count check is racy, some callers need a
+ * guarantee that no cpu is missed.
+ */
+ has_pcps = true;
+ } else if (zone) {
pcp = per_cpu_ptr(zone->pageset, cpu);
if (pcp->pcp.count)
has_pcps = true;
@@ -3104,6 +3113,18 @@ void drain_all_pages(struct zone *zone)
mutex_unlock(&pcpu_drain_mutex);
}
+/*
+ * Spill all the per-cpu pages from all CPUs back into the buddy allocator.
+ *
+ * When zone parameter is non-NULL, spill just the single zone's pages.
+ *
+ * Note that this can be extremely slow as the draining happens in a workqueue.
+ */
+void drain_all_pages(struct zone *zone)
+{
+ __drain_all_pages(zone, false);
+}
+
#ifdef CONFIG_HIBERNATION
/*
@@ -6316,6 +6337,18 @@ static void pageset_init(struct per_cpu_
pcp->batch = BOOT_PAGESET_BATCH;
}
+void __zone_set_pageset_high_and_batch(struct zone *zone, unsigned long high,
+ unsigned long batch)
+{
+ struct per_cpu_pageset *p;
+ int cpu;
+
+ for_each_possible_cpu(cpu) {
+ p = per_cpu_ptr(zone->pageset, cpu);
+ pageset_update(&p->pcp, high, batch);
+ }
+}
+
/*
* Calculate and set new high and batch values for all per-cpu pagesets of a
* zone, based on the zone's size and the percpu_pagelist_fraction sysctl.
@@ -6323,8 +6356,6 @@ static void pageset_init(struct per_cpu_
static void zone_set_pageset_high_and_batch(struct zone *zone)
{
unsigned long new_high, new_batch;
- struct per_cpu_pageset *p;
- int cpu;
if (percpu_pagelist_fraction) {
new_high = zone_managed_pages(zone) / percpu_pagelist_fraction;
@@ -6344,10 +6375,7 @@ static void zone_set_pageset_high_and_ba
zone->pageset_high = new_high;
zone->pageset_batch = new_batch;
- for_each_possible_cpu(cpu) {
- p = per_cpu_ptr(zone->pageset, cpu);
- pageset_update(&p->pcp, new_high, new_batch);
- }
+ __zone_set_pageset_high_and_batch(zone, new_high, new_batch);
}
void __meminit setup_zone_pageset(struct zone *zone)
@@ -8742,6 +8770,27 @@ void __meminit zone_pcp_update(struct zo
mutex_unlock(&pcp_batch_high_lock);
}
+/*
+ * Effectively disable pcplists for the zone by setting the high limit to 0
+ * and draining all cpus. A concurrent page freeing on another CPU that's about
+ * to put the page on pcplist will either finish before the drain and the page
+ * will be drained, or observe the new high limit and skip the pcplist.
+ *
+ * Must be paired with a call to zone_pcp_enable().
+ */
+void zone_pcp_disable(struct zone *zone)
+{
+ mutex_lock(&pcp_batch_high_lock);
+ __zone_set_pageset_high_and_batch(zone, 0, 1);
+ __drain_all_pages(zone, true);
+}
+
+void zone_pcp_enable(struct zone *zone)
+{
+ __zone_set_pageset_high_and_batch(zone, zone->pageset_high, zone->pageset_batch);
+ mutex_unlock(&pcp_batch_high_lock);
+}
+
void zone_pcp_reset(struct zone *zone)
{
unsigned long flags;
--- a/mm/page_isolation.c~mm-page_alloc-disable-pcplists-during-memory-offline
+++ a/mm/page_isolation.c
@@ -174,9 +174,9 @@ __first_valid_page(unsigned long pfn, un
* A call to drain_all_pages() after isolation can flush most of them. However
* in some cases pages might still end up on pcp lists and that would allow
* for their allocation even when they are in fact isolated already. Depending
- * on how strong of a guarantee the caller needs, further drain_all_pages()
- * might be needed (e.g. __offline_pages will need to call it after check for
- * isolated range for a next retry).
+ * on how strong of a guarantee the caller needs, zone_pcp_disable/enable()
+ * might be used to flush and disable pcplist before isolation and enable after
+ * unisolation.
*
* Return: 0 on success and -EBUSY if any part of range cannot be isolated.
*/
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 130/200] include/linux/page-flags.h: remove unused __[Set|Clear]PagePrivate
2020-12-15 3:02 incoming Andrew Morton
` (128 preceding siblings ...)
2020-12-15 3:10 ` [patch 129/200] mm, page_alloc: disable pcplists during memory offline Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 131/200] mm/page-flags: fix comment Andrew Morton
` (70 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, david, linmiaohe, linux-mm, mm-commits, torvalds, willy
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: include/linux/page-flags.h: remove unused __[Set|Clear]PagePrivate
They are not used anymore.
Link: https://lkml.kernel.org/r/20201009135914.64826-1-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Reviewed-by: David Hildenbrand <david@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/page-flags.h | 3 +--
1 file changed, 1 insertion(+), 2 deletions(-)
--- a/include/linux/page-flags.h~page-flags-remove-unused-__pageprivate
+++ a/include/linux/page-flags.h
@@ -363,8 +363,7 @@ PAGEFLAG(SwapBacked, swapbacked, PF_NO_T
* for its own purposes.
* - PG_private and PG_private_2 cause releasepage() and co to be invoked
*/
-PAGEFLAG(Private, private, PF_ANY) __SETPAGEFLAG(Private, private, PF_ANY)
- __CLEARPAGEFLAG(Private, private, PF_ANY)
+PAGEFLAG(Private, private, PF_ANY)
PAGEFLAG(Private2, private_2, PF_ANY) TESTSCFLAG(Private2, private_2, PF_ANY)
PAGEFLAG(OwnerPriv1, owner_priv_1, PF_ANY)
TESTCLEARFLAG(OwnerPriv1, owner_priv_1, PF_ANY)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 131/200] mm/page-flags: fix comment
2020-12-15 3:02 incoming Andrew Morton
` (129 preceding siblings ...)
2020-12-15 3:11 ` [patch 130/200] include/linux/page-flags.h: remove unused __[Set|Clear]PagePrivate Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 132/200] mm/page_alloc: add __free_pages() documentation Andrew Morton
` (69 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, linux-mm, mm-commits, torvalds, william.kucharski, willy
From: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Subject: mm/page-flags: fix comment
We haven't had 'dontuse' flags since 2002. Replace this obsolete warning
with a hopefully more useful one.
Link: https://lkml.kernel.org/r/20201027025823.3704-1-willy@infradead.org
Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Reviewed-by: William Kucharski <william.kucharski@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/page-flags.h | 3 +--
1 file changed, 1 insertion(+), 2 deletions(-)
--- a/include/linux/page-flags.h~mm-page-flags-fix-comment
+++ a/include/linux/page-flags.h
@@ -86,8 +86,7 @@
*/
/*
- * Don't use the *_dontuse flags. Use the macros. Otherwise you'll break
- * locked- and dirty-page accounting.
+ * Don't use the pageflags directly. Use the PageFoo macros.
*
* The page flags field is split into two parts, the main flags area
* which extends from the low bits upwards, and the fields area which
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 132/200] mm/page_alloc: add __free_pages() documentation
2020-12-15 3:02 incoming Andrew Morton
` (130 preceding siblings ...)
2020-12-15 3:11 ` [patch 131/200] mm/page-flags: fix comment Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 133/200] mm/page_alloc: mark some symbols with static keyword Andrew Morton
` (68 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, linux-mm, mm-commits, rppt, torvalds, vbabka,
william.kucharski, willy
From: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Subject: mm/page_alloc: add __free_pages() documentation
Provide some guidance towards when this might not be the right interface
to use.
Link: https://lkml.kernel.org/r/20201027025523.3235-1-willy@infradead.org
Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Reviewed-by: William Kucharski <william.kucharski@oracle.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: Mike Rapoport <rppt@linux.ibm.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_alloc.c | 20 ++++++++++++++++++++
1 file changed, 20 insertions(+)
--- a/mm/page_alloc.c~mm-page_alloc-add-__free_pages-documentation
+++ a/mm/page_alloc.c
@@ -5043,6 +5043,26 @@ static inline void free_the_page(struct
__free_pages_ok(page, order, FPI_NONE);
}
+/**
+ * __free_pages - Free pages allocated with alloc_pages().
+ * @page: The page pointer returned from alloc_pages().
+ * @order: The order of the allocation.
+ *
+ * This function can free multi-page allocations that are not compound
+ * pages. It does not check that the @order passed in matches that of
+ * the allocation, so it is easy to leak memory. Freeing more memory
+ * than was allocated will probably emit a warning.
+ *
+ * If the last reference to this page is speculative, it will be released
+ * by put_page() which only frees the first page of a non-compound
+ * allocation. To prevent the remaining pages from being leaked, we free
+ * the subsequent pages here. If you want to use the page's reference
+ * count to decide when to free the allocation, you should allocate a
+ * compound page, and use put_page() instead of __free_pages().
+ *
+ * Context: May be called in interrupt context or while holding a normal
+ * spinlock, but not in NMI context or while holding a raw spinlock.
+ */
void __free_pages(struct page *page, unsigned int order)
{
if (put_page_testzero(page))
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 133/200] mm/page_alloc: mark some symbols with static keyword
2020-12-15 3:02 incoming Andrew Morton
` (131 preceding siblings ...)
2020-12-15 3:11 ` [patch 132/200] mm/page_alloc: add __free_pages() documentation Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 134/200] mm/page_alloc: clear all pages in post_alloc_hook() with init_on_alloc=1 Andrew Morton
` (67 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, linux-mm, mm-commits, torvalds, vbabka, zou_wei
From: Zou Wei <zou_wei@huawei.com>
Subject: mm/page_alloc: mark some symbols with static keyword
Fix the following sparse warnings:
mm/page_alloc.c:3040:6: warning: symbol '__drain_all_pages' was not declared. Should it be static?
mm/page_alloc.c:6349:6: warning: symbol '__zone_set_pageset_high_and_batch' was not declared. Should it be static?
Link: https://lkml.kernel.org/r/1605517365-65858-1-git-send-email-zou_wei@huawei.com
Signed-off-by: Zou Wei <zou_wei@huawei.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_alloc.c | 4 ++--
1 file changed, 2 insertions(+), 2 deletions(-)
--- a/mm/page_alloc.c~mm-page_alloc-mark-some-symbols-with-static-keyword
+++ a/mm/page_alloc.c
@@ -3035,7 +3035,7 @@ static void drain_local_pages_wq(struct
* that need the guarantee that every CPU has drained can disable the
* optimizing racy check.
*/
-void __drain_all_pages(struct zone *zone, bool force_all_cpus)
+static void __drain_all_pages(struct zone *zone, bool force_all_cpus)
{
int cpu;
@@ -6357,7 +6357,7 @@ static void pageset_init(struct per_cpu_
pcp->batch = BOOT_PAGESET_BATCH;
}
-void __zone_set_pageset_high_and_batch(struct zone *zone, unsigned long high,
+static void __zone_set_pageset_high_and_batch(struct zone *zone, unsigned long high,
unsigned long batch)
{
struct per_cpu_pageset *p;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 134/200] mm/page_alloc: clear all pages in post_alloc_hook() with init_on_alloc=1
2020-12-15 3:02 incoming Andrew Morton
` (132 preceding siblings ...)
2020-12-15 3:11 ` [patch 133/200] mm/page_alloc: mark some symbols with static keyword Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 135/200] init/main: fix broken buffer_init when DEFERRED_STRUCT_PAGE_INIT set Andrew Morton
` (66 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, david, glider, keescook, linux-mm, mhocko, mike.kravetz,
mm-commits, mpe, osalvador, rppt, torvalds, vbabka
From: David Hildenbrand <david@redhat.com>
Subject: mm/page_alloc: clear all pages in post_alloc_hook() with init_on_alloc=1
commit 6471384af2a6 ("mm: security: introduce init_on_alloc=1 and
init_on_free=1 boot options") resulted with init_on_alloc=1 in all pages
leaving the buddy via alloc_pages() and friends to be
initialized/cleared/zeroed on allocation.
However, the same logic is currently not applied to alloc_contig_pages():
allocated pages leaving the buddy aren't cleared with init_on_alloc=1 and
init_on_free=0. Let's also properly clear pages on that allocation path.
To achieve that, let's move clearing into post_alloc_hook(). This will
not only affect alloc_contig_pages() allocations but also any pages used
as migration target in compaction code via compaction_alloc().
While this sounds sub-optimal, it's the very same handling as when
allocating migration targets via alloc_migration_target() - pages will get
properly cleared with init_on_free=1. In case we ever want to optimize
migration in that regard, we should tackle all such migration users - if
we believe migration code can be fully trusted.
With this change, we will see double clearing of pages in some cases. One
example are gigantic pages (either allocated via CMA, or allocated
dynamically via alloc_contig_pages()) - which is the right thing to do
(and to be optimized outside of the buddy in the callers) as discussed in:
https://lkml.kernel.org/r/20201019182853.7467-1-gpiccoli@canonical.com
This change implies that with init_on_alloc=1
- All CMA allocations will be cleared
- Gigantic pages allocated via alloc_contig_pages() will be cleared
- virtio-mem memory to be unplugged will be cleared. While this is
suboptimal, it's similar to memory balloon drivers handling, where
all pages to be inflated will get cleared as well.
- Pages isolated for compaction will be cleared
Link: https://lkml.kernel.org/r/20201120180452.19071-1-david@redhat.com
Signed-off-by: David Hildenbrand <david@redhat.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Michal Hocko <mhocko@suse.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Mike Rapoport <rppt@linux.ibm.com>
Cc: Oscar Salvador <osalvador@suse.de>
Cc: Kees Cook <keescook@chromium.org>
Cc: Michael Ellerman <mpe@ellerman.id.au>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_alloc.c | 6 +++---
1 file changed, 3 insertions(+), 3 deletions(-)
--- a/mm/page_alloc.c~mm-page_alloc-clear-all-pages-in-post_alloc_hook-with-init_on_alloc=1
+++ a/mm/page_alloc.c
@@ -2284,6 +2284,9 @@ inline void post_alloc_hook(struct page
kasan_alloc_pages(page, order);
kernel_poison_pages(page, 1 << order, 1);
set_page_owner(page, order, gfp_flags);
+
+ if (!free_pages_prezeroed() && want_init_on_alloc(gfp_flags))
+ kernel_init_free_pages(page, 1 << order);
}
static void prep_new_page(struct page *page, unsigned int order, gfp_t gfp_flags,
@@ -2291,9 +2294,6 @@ static void prep_new_page(struct page *p
{
post_alloc_hook(page, order, gfp_flags);
- if (!free_pages_prezeroed() && want_init_on_alloc(gfp_flags))
- kernel_init_free_pages(page, 1 << order);
-
if (order && (gfp_flags & __GFP_COMP))
prep_compound_page(page, order);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 135/200] init/main: fix broken buffer_init when DEFERRED_STRUCT_PAGE_INIT set
2020-12-15 3:02 incoming Andrew Morton
` (133 preceding siblings ...)
2020-12-15 3:11 ` [patch 134/200] mm/page_alloc: clear all pages in post_alloc_hook() with init_on_alloc=1 Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 136/200] mm: page_alloc: refactor setup_per_zone_lowmem_reserve() Andrew Morton
` (65 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, linf, linux-mm, mgorman, mm-commits, torvalds, vbabka
From: Lin Feng <linf@wangsu.com>
Subject: init/main: fix broken buffer_init when DEFERRED_STRUCT_PAGE_INIT set
In the booting phase if CONFIG_DEFERRED_STRUCT_PAGE_INIT is set,
we have following callchain:
start_kernel
...
mm_init
mem_init
memblock_free_all
reset_all_zones_managed_pages
free_low_memory_core_early
...
buffer_init
nr_free_buffer_pages
zone->managed_pages
...
rest_init
kernel_init
kernel_init_freeable
page_alloc_init_late
kthread_run(deferred_init_memmap, NODE_DATA(nid), "pgdatinit%d", nid);
wait_for_completion(&pgdat_init_all_done_comp);
...
files_maxfiles_init
It's clear that buffer_init depends on zone->managed_pages, but it's reset
in reset_all_zones_managed_pages after that pages are readded into
zone->managed_pages, but when buffer_init runs this process is half done
and most of them will finally be added till deferred_init_memmap done. In
large memory couting of nr_free_buffer_pages drifts too much, also
drifting from kernels to kernels on same hardware.
Fix is simple, it delays buffer_init run till deferred_init_memmap all
done.
But as corrected by this patch, max_buffer_heads becomes very large, the
value is roughly as many as 4 times of totalram_pages, formula:
max_buffer_heads = nrpages * (10%) * (PAGE_SIZE / sizeof(struct
buffer_head));
Say in a 64GB memory box we have 16777216 pages, then max_buffer_heads
turns out to be roughly 67,108,864. In common cases, should a buffer_head
be mapped to one page/block(4KB)? So max_buffer_heads never exceeds
totalram_pages. IMO it's likely to make buffer_heads_over_limit bool
value alwasy false, then make codes 'if (buffer_heads_over_limit)' test in
vmscan unnecessary.
So this patch will change the original behavior related to
buffer_heads_over_limit in vmscan since we used a half done value of
zone->managed_pages before, or should we use a smaller factor(<10%) in
previous formula.
akpm: I think this is OK - the max_buffer_heads code is only needed on
highmem machines, to prevent ZONE_NORMAL from being consumed by large
amounts of buffer_heads attached to highmem pagecache. This problem will
not occur on 64-bit machines, so this feature's non-functionality on such
machines is a feature, not a bug.
Link: https://lkml.kernel.org/r/20201123110500.103523-1-linf@wangsu.com
Signed-off-by: Lin Feng <linf@wangsu.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Cc: Mel Gorman <mgorman@techsingularity.net>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
init/main.c | 2 --
mm/page_alloc.c | 3 +++
2 files changed, 3 insertions(+), 2 deletions(-)
--- a/init/main.c~init-main-fix-broken-buffer_init-when-deferred_struct_page_init-set
+++ a/init/main.c
@@ -58,7 +58,6 @@
#include <linux/rmap.h>
#include <linux/mempolicy.h>
#include <linux/key.h>
-#include <linux/buffer_head.h>
#include <linux/page_ext.h>
#include <linux/debug_locks.h>
#include <linux/debugobjects.h>
@@ -1036,7 +1035,6 @@ asmlinkage __visible void __init __no_sa
fork_init();
proc_caches_init();
uts_ns_init();
- buffer_init();
key_init();
security_init();
dbg_late_init();
--- a/mm/page_alloc.c~init-main-fix-broken-buffer_init-when-deferred_struct_page_init-set
+++ a/mm/page_alloc.c
@@ -71,6 +71,7 @@
#include <linux/psi.h>
#include <linux/padata.h>
#include <linux/khugepaged.h>
+#include <linux/buffer_head.h>
#include <asm/sections.h>
#include <asm/tlbflush.h>
@@ -2113,6 +2114,8 @@ void __init page_alloc_init_late(void)
files_maxfiles_init();
#endif
+ buffer_init();
+
/* Discard memblock private memory */
memblock_discard();
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 136/200] mm: page_alloc: refactor setup_per_zone_lowmem_reserve()
2020-12-15 3:02 incoming Andrew Morton
` (134 preceding siblings ...)
2020-12-15 3:11 ` [patch 135/200] init/main: fix broken buffer_init when DEFERRED_STRUCT_PAGE_INIT set Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 137/200] mm/page_alloc: speed up the iteration of max_order Andrew Morton
` (64 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, bhe, guro, linux-mm, lstoakes, mhocko, mm-commits, npiggin,
torvalds, vbabka
From: Lorenzo Stoakes <lstoakes@gmail.com>
Subject: mm: page_alloc: refactor setup_per_zone_lowmem_reserve()
setup_per_zone_lowmem_reserve() iterates through each zone setting
zone->lowmem_reserve[j] = 0 (where j is the zone's index) then iterates
backwards through all preceding zones, setting
lower_zone->lowmem_reserve[j] = sum(managed pages of higher zones) /
lowmem_reserve_ratio[idx] for each (where idx is the lower zone's index).
If the lower zone has no managed pages or its ratio is 0 then all of its
lowmem_reserve[] entries are effectively zeroed.
As these arrays are only assigned here and all lowmem_reserve[] entries
for index < this zone's index are implicitly assumed to be 0 (as these are
specifically output in show_free_areas() and zoneinfo_show_print() for
example) there is no need to additionally zero index == this zone's index
too. This patch avoids zeroing unnecessarily.
Rather than iterating through zones and setting lowmem_reserve[j] for each
lower zone this patch reverse the process and populates each zone's
lowmem_reserve[] values in ascending order.
This clarifies what is going on especially in the case of zero managed
pages or ratio which is now explicitly shown to clear these values.
Link: https://lkml.kernel.org/r/20201129162758.115907-1-lstoakes@gmail.com
Signed-off-by: Lorenzo Stoakes <lstoakes@gmail.com>
Cc: Baoquan He <bhe@redhat.com>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Nicholas Piggin <npiggin@gmail.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Roman Gushchin <guro@fb.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_alloc.c | 33 +++++++++++++--------------------
1 file changed, 13 insertions(+), 20 deletions(-)
--- a/mm/page_alloc.c~mm-page_alloc-refactor-setup_per_zone_lowmem_reserve
+++ a/mm/page_alloc.c
@@ -7862,31 +7862,24 @@ static void calculate_totalreserve_pages
static void setup_per_zone_lowmem_reserve(void)
{
struct pglist_data *pgdat;
- enum zone_type j, idx;
+ enum zone_type i, j;
for_each_online_pgdat(pgdat) {
- for (j = 0; j < MAX_NR_ZONES; j++) {
- struct zone *zone = pgdat->node_zones + j;
- unsigned long managed_pages = zone_managed_pages(zone);
+ for (i = 0; i < MAX_NR_ZONES - 1; i++) {
+ struct zone *zone = &pgdat->node_zones[i];
+ int ratio = sysctl_lowmem_reserve_ratio[i];
+ bool clear = !ratio || !zone_managed_pages(zone);
+ unsigned long managed_pages = 0;
- zone->lowmem_reserve[j] = 0;
-
- idx = j;
- while (idx) {
- struct zone *lower_zone;
-
- idx--;
- lower_zone = pgdat->node_zones + idx;
-
- if (!sysctl_lowmem_reserve_ratio[idx] ||
- !zone_managed_pages(lower_zone)) {
- lower_zone->lowmem_reserve[j] = 0;
- continue;
+ for (j = i + 1; j < MAX_NR_ZONES; j++) {
+ if (clear) {
+ zone->lowmem_reserve[j] = 0;
} else {
- lower_zone->lowmem_reserve[j] =
- managed_pages / sysctl_lowmem_reserve_ratio[idx];
+ struct zone *upper_zone = &pgdat->node_zones[j];
+
+ managed_pages += zone_managed_pages(upper_zone);
+ zone->lowmem_reserve[j] = managed_pages / ratio;
}
- managed_pages += zone_managed_pages(lower_zone);
}
}
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 137/200] mm/page_alloc: speed up the iteration of max_order
2020-12-15 3:02 incoming Andrew Morton
` (135 preceding siblings ...)
2020-12-15 3:11 ` [patch 136/200] mm: page_alloc: refactor setup_per_zone_lowmem_reserve() Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 138/200] mm,hwpoison: drain pcplists before bailing out for non-buddy zero-refcount page Andrew Morton
` (63 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, david, linux-mm, mm-commits, osalvador, songmuchun,
torvalds, vbabka
From: Muchun Song <songmuchun@bytedance.com>
Subject: mm/page_alloc: speed up the iteration of max_order
When we free a page whose order is very close to MAX_ORDER and greater
than pageblock_order, it wastes some CPU cycles to increase max_order to
MAX_ORDER one by one and check the pageblock migratetype of that page
repeatedly especially when MAX_ORDER is much larger than pageblock_order.
We also should not be checking migratetype of buddy when "order ==
MAX_ORDER - 1" as the buddy pfn may be invalid, so adjust the condition.
With the new check, we don't need the max_order check anymore, so we
replace it.
Also adjust max_order initialization so that it's lower by one than
previously, which makes the code hopefully more clear.
Link: https://lkml.kernel.org/r/20201204155109.55451-1-songmuchun@bytedance.com
Fixes: d9dddbf55667 ("mm/page_alloc: prevent merging between isolated and other pageblocks")
Signed-off-by: Muchun Song <songmuchun@bytedance.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: David Hildenbrand <david@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_alloc.c | 8 ++++----
1 file changed, 4 insertions(+), 4 deletions(-)
--- a/mm/page_alloc.c~mm-page_alloc-speeding-up-the-iteration-of-max_order
+++ a/mm/page_alloc.c
@@ -996,7 +996,7 @@ static inline void __free_one_page(struc
struct page *buddy;
bool to_tail;
- max_order = min_t(unsigned int, MAX_ORDER, pageblock_order + 1);
+ max_order = min_t(unsigned int, MAX_ORDER - 1, pageblock_order);
VM_BUG_ON(!zone_is_initialized(zone));
VM_BUG_ON_PAGE(page->flags & PAGE_FLAGS_CHECK_AT_PREP, page);
@@ -1009,7 +1009,7 @@ static inline void __free_one_page(struc
VM_BUG_ON_PAGE(bad_range(zone, page), page);
continue_merging:
- while (order < max_order - 1) {
+ while (order < max_order) {
if (compaction_capture(capc, page, order, migratetype)) {
__mod_zone_freepage_state(zone, -(1 << order),
migratetype);
@@ -1035,7 +1035,7 @@ continue_merging:
pfn = combined_pfn;
order++;
}
- if (max_order < MAX_ORDER) {
+ if (order < MAX_ORDER - 1) {
/* If we are here, it means order is >= pageblock_order.
* We want to prevent merge between freepages on isolate
* pageblock and normal pageblock. Without this, pageblock
@@ -1056,7 +1056,7 @@ continue_merging:
is_migrate_isolate(buddy_mt)))
goto done_merging;
}
- max_order++;
+ max_order = order + 1;
goto continue_merging;
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 138/200] mm,hwpoison: drain pcplists before bailing out for non-buddy zero-refcount page
2020-12-15 3:02 incoming Andrew Morton
` (136 preceding siblings ...)
2020-12-15 3:11 ` [patch 137/200] mm/page_alloc: speed up the iteration of max_order Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 139/200] mm,hwpoison: take free pages off the buddy freelists Andrew Morton
` (62 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, linux-mm, mm-commits, naoya.horiguchi, osalvador, torvalds
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,hwpoison: drain pcplists before bailing out for non-buddy zero-refcount page
Patch series "HWpoison: further fixes and cleanups", v5.
This patchset includes some more fixes and a cleanup.
Patch#2 and patch#3 are both fixes for taking a HWpoison page off a buddy
freelist, since having them there has proved to be bad (see [1] and
pathch#2's commit log). Patch#3 does the same for hugetlb pages.
[1] https://lkml.org/lkml/2020/9/22/565
This patch (of 4):
A page with 0-refcount and !PageBuddy could perfectly be a pcppage.
Currently, we bail out with an error if we encounter such a page, meaning
that we do not handle pcppages neither from hard-offline nor from
soft-offline path.
Fix this by draining pcplists whenever we find this kind of page and retry
the check again. It might be that pcplists have been spilled into the
buddy allocator and so we can handle it.
Link: https://lkml.kernel.org/r/20201013144447.6706-1-osalvador@suse.de
Link: https://lkml.kernel.org/r/20201013144447.6706-2-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Naoya Horiguchi <naoya.horiguchi@nec.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memory-failure.c | 24 ++++++++++++++++++++++--
1 file changed, 22 insertions(+), 2 deletions(-)
--- a/mm/memory-failure.c~mmhwpoison-drain-pcplists-before-bailing-out-for-non-buddy-zero-refcount-page
+++ a/mm/memory-failure.c
@@ -946,13 +946,13 @@ static int page_action(struct page_state
}
/**
- * get_hwpoison_page() - Get refcount for memory error handling:
+ * __get_hwpoison_page() - Get refcount for memory error handling:
* @page: raw error page (hit by memory error)
*
* Return: return 0 if failed to grab the refcount, otherwise true (some
* non-zero value.)
*/
-static int get_hwpoison_page(struct page *page)
+static int __get_hwpoison_page(struct page *page)
{
struct page *head = compound_head(page);
@@ -982,6 +982,26 @@ static int get_hwpoison_page(struct page
return 0;
}
+static int get_hwpoison_page(struct page *p)
+{
+ int ret;
+ bool drained = false;
+
+retry:
+ ret = __get_hwpoison_page(p);
+ if (!ret && !is_free_buddy_page(p) && !page_count(p) && !drained) {
+ /*
+ * The page might be in a pcplist, so try to drain those
+ * and see if we are lucky.
+ */
+ drain_all_pages(page_zone(p));
+ drained = true;
+ goto retry;
+ }
+
+ return ret;
+}
+
/*
* Do all that is necessary to remove user space mappings. Unmap
* the pages and send SIGBUS to the processes if the data was dirty.
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 139/200] mm,hwpoison: take free pages off the buddy freelists
2020-12-15 3:02 incoming Andrew Morton
` (137 preceding siblings ...)
2020-12-15 3:11 ` [patch 138/200] mm,hwpoison: drain pcplists before bailing out for non-buddy zero-refcount page Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 140/200] mm,hwpoison: drop unneeded pcplist draining Andrew Morton
` (61 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, linux-mm, mm-commits, naoya.horiguchi, osalvador, torvalds
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,hwpoison: take free pages off the buddy freelists
The crux of the matter is that historically we left poisoned pages in the
buddy system because we have some checks in place when allocating a page
that are gatekeeper for poisoned pages. Unfortunately, we do have other
users (e.g: compaction [1]) that scan buddy freelists and try to get a
page from there without checking whether the page is HWPoison.
As I stated already, I think it is fundamentally wrong to keep HWPoison
pages within the buddy systems, checks in place or not.
Let us fix this the same way we did for soft_offline [2], taking the page
off the buddy freelist so it is completely unreachable.
Note that this is fairly simple to trigger, as we only need to poison free
buddy pages (madvise MADV_HWPOISON) and then run some sort of memory
stress system.
Just for a matter of reference, I put a dump_page() in compaction_alloc()
to trigger for HWPoison patches:
kernel: page:0000000012b2982b refcount:1 mapcount:0 mapping:0000000000000000 index:0x1 pfn:0x1d5db
kernel: flags: 0xfffffc0800000(hwpoison)
kernel: raw: 000fffffc0800000 ffffea00007573c8 ffffc90000857de0 0000000000000000
kernel: raw: 0000000000000001 0000000000000000 00000001ffffffff 0000000000000000
kernel: page dumped because: compaction_alloc
kernel: CPU: 4 PID: 123 Comm: kcompactd0 Tainted: G E 5.9.0-rc2-mm1-1-default+ #5
kernel: Hardware name: QEMU Standard PC (i440FX + PIIX, 1996), BIOS rel-1.10.2-0-g5f4c7b1-prebuilt.qemu-project.org 04/01/2014
kernel: Call Trace:
kernel: dump_stack+0x6d/0x8b
kernel: compaction_alloc+0xb2/0xc0
kernel: migrate_pages+0x2a6/0x12a0
kernel: ? isolate_freepages+0xc80/0xc80
kernel: ? __ClearPageMovable+0xb0/0xb0
kernel: compact_zone+0x5eb/0x11c0
kernel: ? finish_task_switch+0x74/0x300
kernel: ? lock_timer_base+0xa8/0x170
kernel: proactive_compact_node+0x89/0xf0
kernel: ? kcompactd+0x2d0/0x3a0
kernel: kcompactd+0x2d0/0x3a0
kernel: ? finish_wait+0x80/0x80
kernel: ? kcompactd_do_work+0x350/0x350
kernel: kthread+0x118/0x130
kernel: ? kthread_associate_blkcg+0xa0/0xa0
kernel: ret_from_fork+0x22/0x30
After that, if e.g: a process faults in the page, it will get killed
unexpectedly.
Fix it by containing the page immediatelly.
Besides that, two more changes can be noticed:
* MF_DELAYED no longer suits as we are fixing the issue by containing
the page immediately, so it does no longer rely on the allocation-time
checks to stop HWPoison to be handed over.
gain unless it is unpoisoned, so we fixed the situation.
Because of that, let us use MF_RECOVERED from now on.
* The second block that handles PageBuddy pages is no longer needed:
We call shake_page and then check whether the page is Buddy
because shake_page calls drain_all_pages, which sends pcp-pages back to
the buddy freelists, so we could have a chance to handle free pages.
Currently, get_hwpoison_page already calls drain_all_pages, and we call
get_hwpoison_page right before coming here, so we should be on the safe
side.
[1] https://lore.kernel.org/linux-mm/20190826104144.GA7849@linux/T/#u
[2] https://patchwork.kernel.org/cover/11792607/
[osalvador@suse.de: take the poisoned subpage off the buddy frelists]
Link: https://lkml.kernel.org/r/20201013144447.6706-4-osalvador@suse.de
Link: https://lkml.kernel.org/r/20201013144447.6706-3-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Naoya Horiguchi <naoya.horiguchi@nec.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memory-failure.c | 46 +++++++++++++++++++++++++++---------------
1 file changed, 30 insertions(+), 16 deletions(-)
--- a/mm/memory-failure.c~mmhwpoison-take-free-pages-off-the-buddy-freelists
+++ a/mm/memory-failure.c
@@ -809,7 +809,7 @@ static int me_swapcache_clean(struct pag
*/
static int me_huge_page(struct page *p, unsigned long pfn)
{
- int res = 0;
+ int res;
struct page *hpage = compound_head(p);
struct address_space *mapping;
@@ -820,6 +820,7 @@ static int me_huge_page(struct page *p,
if (mapping) {
res = truncate_error_page(hpage, pfn, mapping);
} else {
+ res = MF_FAILED;
unlock_page(hpage);
/*
* migration entry prevents later access on error anonymous
@@ -828,8 +829,10 @@ static int me_huge_page(struct page *p,
*/
if (PageAnon(hpage))
put_page(hpage);
- dissolve_free_huge_page(p);
- res = MF_RECOVERED;
+ if (!dissolve_free_huge_page(p) && take_page_off_buddy(p)) {
+ page_ref_inc(p);
+ res = MF_RECOVERED;
+ }
lock_page(hpage);
}
@@ -1196,9 +1199,13 @@ static int memory_failure_hugetlb(unsign
}
}
unlock_page(head);
- dissolve_free_huge_page(p);
- action_result(pfn, MF_MSG_FREE_HUGE, MF_DELAYED);
- return 0;
+ res = MF_FAILED;
+ if (!dissolve_free_huge_page(p) && take_page_off_buddy(p)) {
+ page_ref_inc(p);
+ res = MF_RECOVERED;
+ }
+ action_result(pfn, MF_MSG_FREE_HUGE, res);
+ return res == MF_RECOVERED ? 0 : -EBUSY;
}
lock_page(head);
@@ -1339,6 +1346,7 @@ int memory_failure(unsigned long pfn, in
struct dev_pagemap *pgmap;
int res;
unsigned long page_flags;
+ bool retry = true;
if (!sysctl_memory_failure_recovery)
panic("Memory failure on page %lx", pfn);
@@ -1356,6 +1364,7 @@ int memory_failure(unsigned long pfn, in
return -ENXIO;
}
+try_again:
if (PageHuge(p))
return memory_failure_hugetlb(pfn, flags);
if (TestSetPageHWPoison(p)) {
@@ -1380,8 +1389,21 @@ int memory_failure(unsigned long pfn, in
*/
if (!(flags & MF_COUNT_INCREASED) && !get_hwpoison_page(p)) {
if (is_free_buddy_page(p)) {
- action_result(pfn, MF_MSG_BUDDY, MF_DELAYED);
- return 0;
+ if (take_page_off_buddy(p)) {
+ page_ref_inc(p);
+ res = MF_RECOVERED;
+ } else {
+ /* We lost the race, try again */
+ if (retry) {
+ ClearPageHWPoison(p);
+ num_poisoned_pages_dec();
+ retry = false;
+ goto try_again;
+ }
+ res = MF_FAILED;
+ }
+ action_result(pfn, MF_MSG_BUDDY, res);
+ return res == MF_RECOVERED ? 0 : -EBUSY;
} else {
action_result(pfn, MF_MSG_KERNEL_HIGH_ORDER, MF_IGNORED);
return -EBUSY;
@@ -1405,14 +1427,6 @@ int memory_failure(unsigned long pfn, in
* walked by the page reclaim code, however that's not a big loss.
*/
shake_page(p, 0);
- /* shake_page could have turned it free. */
- if (!PageLRU(p) && is_free_buddy_page(p)) {
- if (flags & MF_COUNT_INCREASED)
- action_result(pfn, MF_MSG_BUDDY, MF_DELAYED);
- else
- action_result(pfn, MF_MSG_BUDDY_2ND, MF_DELAYED);
- return 0;
- }
lock_page(p);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 140/200] mm,hwpoison: drop unneeded pcplist draining
2020-12-15 3:02 incoming Andrew Morton
` (138 preceding siblings ...)
2020-12-15 3:11 ` [patch 139/200] mm,hwpoison: take free pages off the buddy freelists Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 141/200] mm,hwpoison: refactor get_any_page Andrew Morton
` (60 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, linux-mm, mm-commits, naoya.horiguchi, osalvador, torvalds
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,hwpoison: drop unneeded pcplist draining
memory_failure and soft_offline_path paths now drain pcplists by calling
get_hwpoison_page.
memory_failure flags the page as HWPoison before, so that page cannot
longer go into a pcplist, and soft_offline_page only flags a page as
HWPoison if 1) we took the page off a buddy freelist 2) the page was
in-use and we migrated it 3) was a clean pagecache.
Because of that, a page cannot longer be poisoned and be in a pcplist.
Link: https://lkml.kernel.org/r/20201013144447.6706-5-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Naoya Horiguchi <naoya.horiguchi@nec.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/madvise.c | 5 -----
1 file changed, 5 deletions(-)
--- a/mm/madvise.c~mmhwpoison-drop-unneeded-pcplist-draining
+++ a/mm/madvise.c
@@ -877,7 +877,6 @@ static long madvise_remove(struct vm_are
static int madvise_inject_error(int behavior,
unsigned long start, unsigned long end)
{
- struct zone *zone;
unsigned long size;
if (!capable(CAP_SYS_ADMIN))
@@ -922,10 +921,6 @@ static int madvise_inject_error(int beha
return ret;
}
- /* Ensure that all poisoned pages are removed from per-cpu lists */
- for_each_populated_zone(zone)
- drain_all_pages(zone);
-
return 0;
}
#endif
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 141/200] mm,hwpoison: refactor get_any_page
2020-12-15 3:02 incoming Andrew Morton
` (139 preceding siblings ...)
2020-12-15 3:11 ` [patch 140/200] mm,hwpoison: drop unneeded pcplist draining Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 142/200] mm,hwpoison: disable pcplists before grabbing a refcount Andrew Morton
` (59 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, linux-mm, mm-commits, naoya.horiguchi, osalvador, qcai,
torvalds, Vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,hwpoison: refactor get_any_page
Patch series "HWPoison: Refactor get page interface", v2.
This patch (of 3):
When we want to grab a refcount via get_any_page, we call __get_any_page
that calls get_hwpoison_page to get the actual refcount.
get_any_page() is only there because we have a sort of retry mechanism in
case the page we met is unknown to us or if we raced with an allocation.
Also __get_any_page() prints some messages about the page type in case the
page was a free page or the page type was unknown, but if anything, we
only need to print a message in case the pagetype was unknown, as that is
reporting an error down the chain.
Let us merge get_any_page() and __get_any_page(), and let the message be
printed in soft_offline_page. While we are it, we can also remove the
'pfn' parameter as it is no longer used.
Link: https://lkml.kernel.org/r/20201204102558.31607-1-osalvador@suse.de
Link: https://lkml.kernel.org/r/20201204102558.31607-2-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Naoya Horiguchi <naoya.horiguchi@nec.com>
Acked-by: Vlastimil Babka <Vbabka@suse.cz>
Cc: Qian Cai <qcai@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memory-failure.c | 99 +++++++++++++++++-------------------------
1 file changed, 42 insertions(+), 57 deletions(-)
--- a/mm/memory-failure.c~mmhwpoison-refactor-get_any_page
+++ a/mm/memory-failure.c
@@ -1707,70 +1707,51 @@ EXPORT_SYMBOL(unpoison_memory);
/*
* Safely get reference count of an arbitrary page.
- * Returns 0 for a free page, -EIO for a zero refcount page
- * that is not free, and 1 for any other page type.
- * For 1 the page is returned with increased page count, otherwise not.
+ * Returns 0 for a free page, 1 for an in-use page, -EIO for a page-type we
+ * cannot handle and -EBUSY if we raced with an allocation.
+ * We only incremented refcount in case the page was already in-use and it is
+ * a known type we can handle.
*/
-static int __get_any_page(struct page *p, unsigned long pfn, int flags)
+static int get_any_page(struct page *p, int flags)
{
- int ret;
+ int ret = 0, pass = 0;
+ bool count_increased = false;
if (flags & MF_COUNT_INCREASED)
- return 1;
+ count_increased = true;
- /*
- * When the target page is a free hugepage, just remove it
- * from free hugepage list.
- */
- if (!get_hwpoison_page(p)) {
- if (PageHuge(p)) {
- pr_info("%s: %#lx free huge page\n", __func__, pfn);
- ret = 0;
- } else if (is_free_buddy_page(p)) {
- pr_info("%s: %#lx free buddy page\n", __func__, pfn);
- ret = 0;
- } else if (page_count(p)) {
- /* raced with allocation */
+try_again:
+ if (!count_increased && !get_hwpoison_page(p)) {
+ if (page_count(p)) {
+ /* We raced with an allocation, retry. */
+ if (pass++ < 3)
+ goto try_again;
ret = -EBUSY;
- } else {
- pr_info("%s: %#lx: unknown zero refcount page type %lx\n",
- __func__, pfn, p->flags);
+ } else if (!PageHuge(p) && !is_free_buddy_page(p)) {
+ /* We raced with put_page, retry. */
+ if (pass++ < 3)
+ goto try_again;
ret = -EIO;
}
} else {
- /* Not a free page */
- ret = 1;
- }
- return ret;
-}
-
-static int get_any_page(struct page *page, unsigned long pfn, int flags)
-{
- int ret = __get_any_page(page, pfn, flags);
-
- if (ret == -EBUSY)
- ret = __get_any_page(page, pfn, flags);
-
- if (ret == 1 && !PageHuge(page) &&
- !PageLRU(page) && !__PageMovable(page)) {
- /*
- * Try to free it.
- */
- put_page(page);
- shake_page(page, 1);
-
- /*
- * Did it turn free?
- */
- ret = __get_any_page(page, pfn, 0);
- if (ret == 1 && !PageLRU(page)) {
- /* Drop page reference which is from __get_any_page() */
- put_page(page);
- pr_info("soft_offline: %#lx: unknown non LRU page type %lx (%pGp)\n",
- pfn, page->flags, &page->flags);
- return -EIO;
+ if (PageHuge(p) || PageLRU(p) || __PageMovable(p)) {
+ ret = 1;
+ } else {
+ /*
+ * A page we cannot handle. Check whether we can turn
+ * it into something we can handle.
+ */
+ if (pass++ < 3) {
+ put_page(p);
+ shake_page(p, 1);
+ count_increased = false;
+ goto try_again;
+ }
+ put_page(p);
+ ret = -EIO;
}
}
+
return ret;
}
@@ -1939,7 +1920,7 @@ int soft_offline_page(unsigned long pfn,
return -EIO;
if (PageHWPoison(page)) {
- pr_info("soft offline: %#lx page already poisoned\n", pfn);
+ pr_info("%s: %#lx page already poisoned\n", __func__, pfn);
if (flags & MF_COUNT_INCREASED)
put_page(page);
return 0;
@@ -1947,16 +1928,20 @@ int soft_offline_page(unsigned long pfn,
retry:
get_online_mems();
- ret = get_any_page(page, pfn, flags);
+ ret = get_any_page(page, flags);
put_online_mems();
- if (ret > 0)
+ if (ret > 0) {
ret = soft_offline_in_use_page(page);
- else if (ret == 0)
+ } else if (ret == 0) {
if (soft_offline_free_page(page) && try_again) {
try_again = false;
goto retry;
}
+ } else if (ret == -EIO) {
+ pr_info("%s: %#lx: unknown page type: %lx (%pGP)\n",
+ __func__, pfn, page->flags, &page->flags);
+ }
return ret;
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 142/200] mm,hwpoison: disable pcplists before grabbing a refcount
2020-12-15 3:02 incoming Andrew Morton
` (140 preceding siblings ...)
2020-12-15 3:11 ` [patch 141/200] mm,hwpoison: refactor get_any_page Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 143/200] mm,hwpoison: remove drain_all_pages from shake_page Andrew Morton
` (58 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, linux-mm, mm-commits, naoya.horiguchi, osalvador, qcai,
torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,hwpoison: disable pcplists before grabbing a refcount
Currently, we have a sort of retry mechanism to make sure pages in
pcp-lists are spilled to the buddy system, so we can handle those.
We can save us this extra checks with the new disable-pcplist mechanism
that is available with [1].
zone_pcplist_disable makes sure to 1) disable pcplists, so any page that
is freed up from that point onwards will end up in the buddy system and 2)
drain pcplists, so those pages that already in pcplists are spilled to
buddy.
With that, we can make a common entry point for grabbing a refcount from
both soft_offline and memory_failure paths that is guarded by
zone_pcplist_disable/zone_pcplist_enable.
[1] https://patchwork.kernel.org/project/linux-mm/cover/20201111092812.11329-1-vbabka@suse.cz/
Link: https://lkml.kernel.org/r/20201204102558.31607-3-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Naoya Horiguchi <naoya.horiguchi@nec.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Cc: Qian Cai <qcai@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memory-failure.c | 132 ++++++++++++++++++++----------------------
1 file changed, 65 insertions(+), 67 deletions(-)
--- a/mm/memory-failure.c~mmhwpoison-disable-pcplists-before-grabbing-a-refcount
+++ a/mm/memory-failure.c
@@ -985,26 +985,73 @@ static int __get_hwpoison_page(struct pa
return 0;
}
-static int get_hwpoison_page(struct page *p)
+/*
+ * Safely get reference count of an arbitrary page.
+ *
+ * Returns 0 for a free page, 1 for an in-use page,
+ * -EIO for a page-type we cannot handle and -EBUSY if we raced with an
+ * allocation.
+ * We only incremented refcount in case the page was already in-use and it
+ * is a known type we can handle.
+ */
+static int get_any_page(struct page *p, unsigned long flags)
{
- int ret;
- bool drained = false;
+ int ret = 0, pass = 0;
+ bool count_increased = false;
-retry:
- ret = __get_hwpoison_page(p);
- if (!ret && !is_free_buddy_page(p) && !page_count(p) && !drained) {
- /*
- * The page might be in a pcplist, so try to drain those
- * and see if we are lucky.
- */
- drain_all_pages(page_zone(p));
- drained = true;
- goto retry;
+ if (flags & MF_COUNT_INCREASED)
+ count_increased = true;
+
+try_again:
+ if (!count_increased && !__get_hwpoison_page(p)) {
+ if (page_count(p)) {
+ /* We raced with an allocation, retry. */
+ if (pass++ < 3)
+ goto try_again;
+ ret = -EBUSY;
+ } else if (!PageHuge(p) && !is_free_buddy_page(p)) {
+ /* We raced with put_page, retry. */
+ if (pass++ < 3)
+ goto try_again;
+ ret = -EIO;
+ }
+ } else {
+ if (PageHuge(p) || PageLRU(p) || __PageMovable(p)) {
+ ret = 1;
+ } else {
+ /*
+ * A page we cannot handle. Check whether we can turn
+ * it into something we can handle.
+ */
+ if (pass++ < 3) {
+ put_page(p);
+ shake_page(p, 1);
+ count_increased = false;
+ goto try_again;
+ }
+ put_page(p);
+ ret = -EIO;
+ }
}
return ret;
}
+static int get_hwpoison_page(struct page *p, unsigned long flags,
+ enum mf_flags ctxt)
+{
+ int ret;
+
+ zone_pcp_disable(page_zone(p));
+ if (ctxt == MF_SOFT_OFFLINE)
+ ret = get_any_page(p, flags);
+ else
+ ret = __get_hwpoison_page(p);
+ zone_pcp_enable(page_zone(p));
+
+ return ret;
+}
+
/*
* Do all that is necessary to remove user space mappings. Unmap
* the pages and send SIGBUS to the processes if the data was dirty.
@@ -1185,7 +1232,7 @@ static int memory_failure_hugetlb(unsign
num_poisoned_pages_inc();
- if (!(flags & MF_COUNT_INCREASED) && !get_hwpoison_page(p)) {
+ if (!(flags & MF_COUNT_INCREASED) && !get_hwpoison_page(p, flags, 0)) {
/*
* Check "filter hit" and "race with other subpage."
*/
@@ -1387,7 +1434,7 @@ try_again:
* In fact it's dangerous to directly bump up page count from 0,
* that may make page_ref_freeze()/page_ref_unfreeze() mismatch.
*/
- if (!(flags & MF_COUNT_INCREASED) && !get_hwpoison_page(p)) {
+ if (!(flags & MF_COUNT_INCREASED) && !get_hwpoison_page(p, flags, 0)) {
if (is_free_buddy_page(p)) {
if (take_page_off_buddy(p)) {
page_ref_inc(p);
@@ -1630,6 +1677,7 @@ int unpoison_memory(unsigned long pfn)
struct page *page;
struct page *p;
int freeit = 0;
+ unsigned long flags = 0;
static DEFINE_RATELIMIT_STATE(unpoison_rs, DEFAULT_RATELIMIT_INTERVAL,
DEFAULT_RATELIMIT_BURST);
@@ -1674,7 +1722,7 @@ int unpoison_memory(unsigned long pfn)
return 0;
}
- if (!get_hwpoison_page(p)) {
+ if (!get_hwpoison_page(p, flags, 0)) {
if (TestClearPageHWPoison(p))
num_poisoned_pages_dec();
unpoison_pr_info("Unpoison: Software-unpoisoned free page %#lx\n",
@@ -1705,56 +1753,6 @@ int unpoison_memory(unsigned long pfn)
}
EXPORT_SYMBOL(unpoison_memory);
-/*
- * Safely get reference count of an arbitrary page.
- * Returns 0 for a free page, 1 for an in-use page, -EIO for a page-type we
- * cannot handle and -EBUSY if we raced with an allocation.
- * We only incremented refcount in case the page was already in-use and it is
- * a known type we can handle.
- */
-static int get_any_page(struct page *p, int flags)
-{
- int ret = 0, pass = 0;
- bool count_increased = false;
-
- if (flags & MF_COUNT_INCREASED)
- count_increased = true;
-
-try_again:
- if (!count_increased && !get_hwpoison_page(p)) {
- if (page_count(p)) {
- /* We raced with an allocation, retry. */
- if (pass++ < 3)
- goto try_again;
- ret = -EBUSY;
- } else if (!PageHuge(p) && !is_free_buddy_page(p)) {
- /* We raced with put_page, retry. */
- if (pass++ < 3)
- goto try_again;
- ret = -EIO;
- }
- } else {
- if (PageHuge(p) || PageLRU(p) || __PageMovable(p)) {
- ret = 1;
- } else {
- /*
- * A page we cannot handle. Check whether we can turn
- * it into something we can handle.
- */
- if (pass++ < 3) {
- put_page(p);
- shake_page(p, 1);
- count_increased = false;
- goto try_again;
- }
- put_page(p);
- ret = -EIO;
- }
- }
-
- return ret;
-}
-
static bool isolate_page(struct page *page, struct list_head *pagelist)
{
bool isolated = false;
@@ -1928,7 +1926,7 @@ int soft_offline_page(unsigned long pfn,
retry:
get_online_mems();
- ret = get_any_page(page, flags);
+ ret = get_hwpoison_page(page, flags, MF_SOFT_OFFLINE);
put_online_mems();
if (ret > 0) {
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 143/200] mm,hwpoison: remove drain_all_pages from shake_page
2020-12-15 3:02 incoming Andrew Morton
` (141 preceding siblings ...)
2020-12-15 3:11 ` [patch 142/200] mm,hwpoison: disable pcplists before grabbing a refcount Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 144/200] mm,memory_failure: always pin the page in madvise_inject_error Andrew Morton
` (57 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, linux-mm, mm-commits, naoya.horiguchi, osalvador, qcai,
torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,hwpoison: remove drain_all_pages from shake_page
get_hwpoison_page already drains pcplists, previously disabling them when
trying to grab a refcount. We do not need shake_page to take care of it
anymore.
Link: https://lkml.kernel.org/r/20201204102558.31607-4-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Naoya Horiguchi <naoya.horiguchi@nec.com>
Cc: Qian Cai <qcai@redhat.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memory-failure.c | 7 ++-----
1 file changed, 2 insertions(+), 5 deletions(-)
--- a/mm/memory-failure.c~mmhwpoison-remove-drain_all_pages-from-shake_page
+++ a/mm/memory-failure.c
@@ -263,8 +263,8 @@ static int kill_proc(struct to_kill *tk,
}
/*
- * When a unknown page type is encountered drain as many buffers as possible
- * in the hope to turn the page into a LRU or free page, which we can handle.
+ * Unknown page type encountered. Try to check whether it can turn PageLRU by
+ * lru_add_drain_all, or a free page by reclaiming slabs when possible.
*/
void shake_page(struct page *p, int access)
{
@@ -273,9 +273,6 @@ void shake_page(struct page *p, int acce
if (!PageSlab(p)) {
lru_add_drain_all();
- if (PageLRU(p))
- return;
- drain_all_pages(page_zone(p));
if (PageLRU(p) || is_free_buddy_page(p))
return;
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 144/200] mm,memory_failure: always pin the page in madvise_inject_error
2020-12-15 3:02 incoming Andrew Morton
` (142 preceding siblings ...)
2020-12-15 3:11 ` [patch 143/200] mm,hwpoison: remove drain_all_pages from shake_page Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 145/200] mm,hwpoison: return -EBUSY when migration fails Andrew Morton
` (56 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, dan.j.williams, linux-mm, mm-commits, naoya.horiguchi,
osalvador, torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,memory_failure: always pin the page in madvise_inject_error
madvise_inject_error() uses get_user_pages_fast to translate the address
we specified to a page. After [1], we drop the extra reference count for
memory_failure() path. That commit says that memory_failure wanted to
keep the pin in order to take the page out of circulation.
The truth is that we need to keep the page pinned, otherwise the page
might be re-used after the put_page() and we can end up messing with
someone else's memory.
E.g:
CPU0
process X CPU1
madvise_inject_error
get_user_pages
put_page
page gets reclaimed
process Y allocates the page
memory_failure
// We mess with process Y memory
madvise() is meant to operate on a self address space, so messing with
pages that do not belong to us seems the wrong thing to do.
To avoid that, let us keep the page pinned for memory_failure as well.
Pages for DAX mappings will release this extra refcount in
memory_failure_dev_pagemap.
[1] ("23e7b5c2e271: mm, madvise_inject_error:
Let memory_failure() optionally take a page reference")
Link: https://lkml.kernel.org/r/20201207094818.8518-1-osalvador@suse.de
Fixes: 23e7b5c2e271 ("mm, madvise_inject_error: Let memory_failure() optionally take a page reference")
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Suggested-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Naoya Horiguchi <naoya.horiguchi@nec.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Dan Williams <dan.j.williams@intel.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/madvise.c | 9 +--------
mm/memory-failure.c | 6 ++++++
2 files changed, 7 insertions(+), 8 deletions(-)
--- a/mm/madvise.c~mmmemory_failure-always-pin-the-page-in-madvise_inject_error
+++ a/mm/madvise.c
@@ -907,14 +907,7 @@ static int madvise_inject_error(int beha
} else {
pr_info("Injecting memory failure for pfn %#lx at process virtual address %#lx\n",
pfn, start);
- /*
- * Drop the page reference taken by get_user_pages_fast(). In
- * the absence of MF_COUNT_INCREASED the memory_failure()
- * routine is responsible for pinning the page to prevent it
- * from being released back to the page allocator.
- */
- put_page(page);
- ret = memory_failure(pfn, 0);
+ ret = memory_failure(pfn, MF_COUNT_INCREASED);
}
if (ret)
--- a/mm/memory-failure.c~mmmemory_failure-always-pin-the-page-in-madvise_inject_error
+++ a/mm/memory-failure.c
@@ -1302,6 +1302,12 @@ static int memory_failure_dev_pagemap(un
loff_t start;
dax_entry_t cookie;
+ if (flags & MF_COUNT_INCREASED)
+ /*
+ * Drop the extra refcount in case we come from madvise().
+ */
+ put_page(page);
+
/*
* Prevent the inode from being freed while we are interrogating
* the address_space, typically this would be handled by
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 145/200] mm,hwpoison: return -EBUSY when migration fails
2020-12-15 3:02 incoming Andrew Morton
` (143 preceding siblings ...)
2020-12-15 3:11 ` [patch 144/200] mm,memory_failure: always pin the page in madvise_inject_error Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 146/200] mm/hugetlb.c: just use put_page_testzero() instead of page_count() Andrew Morton
` (55 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, david, linux-mm, mm-commits, naoya.horiguchi, osalvador,
torvalds, vbabka
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,hwpoison: return -EBUSY when migration fails
Currently, we return -EIO when we fail to migrate the page.
Migrations' failures are rather transient as they can happen due to
several reasons, e.g: high page refcount bump, mapping->migrate_page
failing etc. All meaning that at that time the page could not be
migrated, but that has nothing to do with an EIO error.
Let us return -EBUSY instead, as we do in case we failed to isolate the
page.
While are it, let us remove the "ret" print as its value does not change.
Link: https://lkml.kernel.org/r/20201209092818.30417-1-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Acked-by: Naoya Horiguchi <naoya.horiguchi@nec.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Cc: David Hildenbrand <david@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/memory-failure.c | 6 +++---
1 file changed, 3 insertions(+), 3 deletions(-)
--- a/mm/memory-failure.c~mmhwpoison-return-ebusy-when-migration-fails
+++ a/mm/memory-failure.c
@@ -1855,11 +1855,11 @@ static int __soft_offline_page(struct pa
pr_info("soft offline: %#lx: %s migration failed %d, type %lx (%pGp)\n",
pfn, msg_page[huge], ret, page->flags, &page->flags);
if (ret > 0)
- ret = -EIO;
+ ret = -EBUSY;
}
} else {
- pr_info("soft offline: %#lx: %s isolation failed: %d, page count %d, type %lx (%pGp)\n",
- pfn, msg_page[huge], ret, page_count(page), page->flags, &page->flags);
+ pr_info("soft offline: %#lx: %s isolation failed, page count %d, type %lx (%pGp)\n",
+ pfn, msg_page[huge], page_count(page), page->flags, &page->flags);
ret = -EBUSY;
}
return ret;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 146/200] mm/hugetlb.c: just use put_page_testzero() instead of page_count()
2020-12-15 3:02 incoming Andrew Morton
` (144 preceding siblings ...)
2020-12-15 3:11 ` [patch 145/200] mm,hwpoison: return -EBUSY when migration fails Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:11 ` [patch 147/200] include/linux/huge_mm.h: remove extern keyword Andrew Morton
` (54 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, linux-mm, mike.kravetz, mm-commits, sh_def, torvalds
From: Hui Su <sh_def@163.com>
Subject: mm/hugetlb.c: just use put_page_testzero() instead of page_count()
We test the page reference count is zero or not here, it can be a bug here
if page refercence count is not zero. So we can just use
put_page_testzero() instead of page_count().
Link: https://lkml.kernel.org/r/20201007170949.GA6416@rlk
Signed-off-by: Hui Su <sh_def@163.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 3 +--
1 file changed, 1 insertion(+), 2 deletions(-)
--- a/mm/hugetlb.c~mm-hugetlbc-just-use-put_page_testzero-instead-of-page_count
+++ a/mm/hugetlb.c
@@ -2014,8 +2014,7 @@ retry:
* This page is now managed by the hugetlb allocator and has
* no users -- drop the buddy allocator's reference.
*/
- put_page_testzero(page);
- VM_BUG_ON_PAGE(page_count(page), page);
+ VM_BUG_ON_PAGE(!put_page_testzero(page), page);
enqueue_huge_page(h, page);
}
free:
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 147/200] include/linux/huge_mm.h: remove extern keyword
2020-12-15 3:02 incoming Andrew Morton
` (145 preceding siblings ...)
2020-12-15 3:11 ` [patch 146/200] mm/hugetlb.c: just use put_page_testzero() instead of page_count() Andrew Morton
@ 2020-12-15 3:11 ` Andrew Morton
2020-12-15 3:12 ` [patch 148/200] khugepaged: add parameter explanations for kernel-doc markup Andrew Morton
` (53 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:11 UTC (permalink / raw)
To: akpm, hch, linux-mm, mm-commits, rcampbell, torvalds
From: Ralph Campbell <rcampbell@nvidia.com>
Subject: include/linux/huge_mm.h: remove extern keyword
The external function definitions don't need the "extern" keyword. Remove
them so future changes don't copy the function definition style.
Link: https://lkml.kernel.org/r/20201106235135.32109-1-rcampbell@nvidia.com
Signed-off-by: Ralph Campbell <rcampbell@nvidia.com>
Reviewed-by: Christoph Hellwig <hch@lst.de>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/huge_mm.h | 93 ++++++++++++++++----------------------
1 file changed, 41 insertions(+), 52 deletions(-)
--- a/include/linux/huge_mm.h~include-linux-huge_mmh-remove-extern-keyword
+++ a/include/linux/huge_mm.h
@@ -7,43 +7,37 @@
#include <linux/fs.h> /* only for vma_is_dax() */
-extern vm_fault_t do_huge_pmd_anonymous_page(struct vm_fault *vmf);
-extern int copy_huge_pmd(struct mm_struct *dst_mm, struct mm_struct *src_mm,
- pmd_t *dst_pmd, pmd_t *src_pmd, unsigned long addr,
- struct vm_area_struct *vma);
-extern void huge_pmd_set_accessed(struct vm_fault *vmf, pmd_t orig_pmd);
-extern int copy_huge_pud(struct mm_struct *dst_mm, struct mm_struct *src_mm,
- pud_t *dst_pud, pud_t *src_pud, unsigned long addr,
- struct vm_area_struct *vma);
+vm_fault_t do_huge_pmd_anonymous_page(struct vm_fault *vmf);
+int copy_huge_pmd(struct mm_struct *dst_mm, struct mm_struct *src_mm,
+ pmd_t *dst_pmd, pmd_t *src_pmd, unsigned long addr,
+ struct vm_area_struct *vma);
+void huge_pmd_set_accessed(struct vm_fault *vmf, pmd_t orig_pmd);
+int copy_huge_pud(struct mm_struct *dst_mm, struct mm_struct *src_mm,
+ pud_t *dst_pud, pud_t *src_pud, unsigned long addr,
+ struct vm_area_struct *vma);
#ifdef CONFIG_HAVE_ARCH_TRANSPARENT_HUGEPAGE_PUD
-extern void huge_pud_set_accessed(struct vm_fault *vmf, pud_t orig_pud);
+void huge_pud_set_accessed(struct vm_fault *vmf, pud_t orig_pud);
#else
static inline void huge_pud_set_accessed(struct vm_fault *vmf, pud_t orig_pud)
{
}
#endif
-extern vm_fault_t do_huge_pmd_wp_page(struct vm_fault *vmf, pmd_t orig_pmd);
-extern struct page *follow_trans_huge_pmd(struct vm_area_struct *vma,
- unsigned long addr,
- pmd_t *pmd,
- unsigned int flags);
-extern bool madvise_free_huge_pmd(struct mmu_gather *tlb,
- struct vm_area_struct *vma,
- pmd_t *pmd, unsigned long addr, unsigned long next);
-extern int zap_huge_pmd(struct mmu_gather *tlb,
- struct vm_area_struct *vma,
- pmd_t *pmd, unsigned long addr);
-extern int zap_huge_pud(struct mmu_gather *tlb,
- struct vm_area_struct *vma,
- pud_t *pud, unsigned long addr);
-extern bool move_huge_pmd(struct vm_area_struct *vma, unsigned long old_addr,
- unsigned long new_addr,
- pmd_t *old_pmd, pmd_t *new_pmd);
-extern int change_huge_pmd(struct vm_area_struct *vma, pmd_t *pmd,
- unsigned long addr, pgprot_t newprot,
- unsigned long cp_flags);
+vm_fault_t do_huge_pmd_wp_page(struct vm_fault *vmf, pmd_t orig_pmd);
+struct page *follow_trans_huge_pmd(struct vm_area_struct *vma,
+ unsigned long addr, pmd_t *pmd,
+ unsigned int flags);
+bool madvise_free_huge_pmd(struct mmu_gather *tlb, struct vm_area_struct *vma,
+ pmd_t *pmd, unsigned long addr, unsigned long next);
+int zap_huge_pmd(struct mmu_gather *tlb, struct vm_area_struct *vma, pmd_t *pmd,
+ unsigned long addr);
+int zap_huge_pud(struct mmu_gather *tlb, struct vm_area_struct *vma, pud_t *pud,
+ unsigned long addr);
+bool move_huge_pmd(struct vm_area_struct *vma, unsigned long old_addr,
+ unsigned long new_addr, pmd_t *old_pmd, pmd_t *new_pmd);
+int change_huge_pmd(struct vm_area_struct *vma, pmd_t *pmd, unsigned long addr,
+ pgprot_t newprot, unsigned long cp_flags);
vm_fault_t vmf_insert_pfn_pmd_prot(struct vm_fault *vmf, pfn_t pfn,
pgprot_t pgprot, bool write);
@@ -100,13 +94,13 @@ enum transparent_hugepage_flag {
struct kobject;
struct kobj_attribute;
-extern ssize_t single_hugepage_flag_store(struct kobject *kobj,
- struct kobj_attribute *attr,
- const char *buf, size_t count,
- enum transparent_hugepage_flag flag);
-extern ssize_t single_hugepage_flag_show(struct kobject *kobj,
- struct kobj_attribute *attr, char *buf,
- enum transparent_hugepage_flag flag);
+ssize_t single_hugepage_flag_store(struct kobject *kobj,
+ struct kobj_attribute *attr,
+ const char *buf, size_t count,
+ enum transparent_hugepage_flag flag);
+ssize_t single_hugepage_flag_show(struct kobject *kobj,
+ struct kobj_attribute *attr, char *buf,
+ enum transparent_hugepage_flag flag);
extern struct kobj_attribute shmem_enabled_attr;
#define HPAGE_PMD_ORDER (HPAGE_PMD_SHIFT-PAGE_SHIFT)
@@ -179,12 +173,11 @@ static inline bool transhuge_vma_suitabl
(transparent_hugepage_flags & \
(1<<TRANSPARENT_HUGEPAGE_USE_ZERO_PAGE_FLAG))
-extern unsigned long thp_get_unmapped_area(struct file *filp,
- unsigned long addr, unsigned long len, unsigned long pgoff,
- unsigned long flags);
+unsigned long thp_get_unmapped_area(struct file *filp, unsigned long addr,
+ unsigned long len, unsigned long pgoff, unsigned long flags);
-extern void prep_transhuge_page(struct page *page);
-extern void free_transhuge_page(struct page *page);
+void prep_transhuge_page(struct page *page);
+void free_transhuge_page(struct page *page);
bool is_transparent_hugepage(struct page *page);
bool can_split_huge_page(struct page *page, int *pextra_pins);
@@ -222,16 +215,12 @@ void __split_huge_pud(struct vm_area_str
__split_huge_pud(__vma, __pud, __address); \
} while (0)
-extern int hugepage_madvise(struct vm_area_struct *vma,
- unsigned long *vm_flags, int advice);
-extern void vma_adjust_trans_huge(struct vm_area_struct *vma,
- unsigned long start,
- unsigned long end,
- long adjust_next);
-extern spinlock_t *__pmd_trans_huge_lock(pmd_t *pmd,
- struct vm_area_struct *vma);
-extern spinlock_t *__pud_trans_huge_lock(pud_t *pud,
- struct vm_area_struct *vma);
+int hugepage_madvise(struct vm_area_struct *vma, unsigned long *vm_flags,
+ int advice);
+void vma_adjust_trans_huge(struct vm_area_struct *vma, unsigned long start,
+ unsigned long end, long adjust_next);
+spinlock_t *__pmd_trans_huge_lock(pmd_t *pmd, struct vm_area_struct *vma);
+spinlock_t *__pud_trans_huge_lock(pud_t *pud, struct vm_area_struct *vma);
static inline int is_swap_pmd(pmd_t pmd)
{
@@ -294,7 +283,7 @@ struct page *follow_devmap_pmd(struct vm
struct page *follow_devmap_pud(struct vm_area_struct *vma, unsigned long addr,
pud_t *pud, int flags, struct dev_pagemap **pgmap);
-extern vm_fault_t do_huge_pmd_numa_page(struct vm_fault *vmf, pmd_t orig_pmd);
+vm_fault_t do_huge_pmd_numa_page(struct vm_fault *vmf, pmd_t orig_pmd);
extern struct page *huge_zero_page;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 148/200] khugepaged: add parameter explanations for kernel-doc markup
2020-12-15 3:02 incoming Andrew Morton
` (146 preceding siblings ...)
2020-12-15 3:11 ` [patch 147/200] include/linux/huge_mm.h: remove extern keyword Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 149/200] mm: hugetlb: fix type of delta parameter and related local variables in gather_surplus_pages() Andrew Morton
` (52 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, alex.shi, corbet, linux-mm, mm-commits, rdunlap, torvalds
From: Alex Shi <alex.shi@linux.alibaba.com>
Subject: khugepaged: add parameter explanations for kernel-doc markup
Add missed parameter explanation for some kernel-doc warnings:
mm/khugepaged.c:102: warning: Function parameter or member
'nr_pte_mapped_thp' not described in 'mm_slot'
mm/khugepaged.c:102: warning: Function parameter or member
'pte_mapped_thp' not described in 'mm_slot'
mm/khugepaged.c:1424: warning: Function parameter or member 'mm' not
described in 'collapse_pte_mapped_thp'
mm/khugepaged.c:1424: warning: Function parameter or member 'addr' not
described in 'collapse_pte_mapped_thp'
mm/khugepaged.c:1626: warning: Function parameter or member 'mm' not
described in 'collapse_file'
mm/khugepaged.c:1626: warning: Function parameter or member 'file' not
described in 'collapse_file'
mm/khugepaged.c:1626: warning: Function parameter or member 'start' not
described in 'collapse_file'
mm/khugepaged.c:1626: warning: Function parameter or member 'hpage' not
described in 'collapse_file'
mm/khugepaged.c:1626: warning: Function parameter or member 'node' not
described in 'collapse_file'
Link: https://lkml.kernel.org/r/1605597325-25284-1-git-send-email-alex.shi@linux.alibaba.com
Signed-off-by: Alex Shi <alex.shi@linux.alibaba.com>
Cc: Randy Dunlap <rdunlap@infradead.org>
Cc: Jonathan Corbet <corbet@lwn.net>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/khugepaged.c | 14 +++++++++++++-
1 file changed, 13 insertions(+), 1 deletion(-)
--- a/mm/khugepaged.c~khugepaged-add-couples-parameter-explanation-for-kernel-doc-markup
+++ a/mm/khugepaged.c
@@ -90,6 +90,8 @@ static struct kmem_cache *mm_slot_cache
* @hash: hash collision list
* @mm_node: khugepaged scan list headed in khugepaged_scan.mm_head
* @mm: the mm that this information is valid for
+ * @nr_pte_mapped_thp: number of pte mapped THP
+ * @pte_mapped_thp: address array corresponding pte mapped THP
*/
struct mm_slot {
struct hlist_node hash;
@@ -1414,7 +1416,11 @@ static int khugepaged_add_pte_mapped_thp
}
/**
- * Try to collapse a pte-mapped THP for mm at address haddr.
+ * collapse_pte_mapped_thp - Try to collapse a pte-mapped THP for mm at
+ * address haddr.
+ *
+ * @mm: process address space where collapse happens
+ * @addr: THP collapse address
*
* This function checks whether all the PTEs in the PMD are pointing to the
* right THP. If so, retract the page table so the THP can refault in with
@@ -1605,6 +1611,12 @@ static void retract_page_tables(struct a
/**
* collapse_file - collapse filemap/tmpfs/shmem pages into huge one.
*
+ * @mm: process address space where collapse happens
+ * @file: file that collapse on
+ * @start: collapse start address
+ * @hpage: new allocated huge page for collapse
+ * @node: appointed node the new huge page allocate from
+ *
* Basic scheme is simple, details are more complex:
* - allocate and lock a new huge page;
* - scan page cache replacing old pages with the new one
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 149/200] mm: hugetlb: fix type of delta parameter and related local variables in gather_surplus_pages()
2020-12-15 3:02 incoming Andrew Morton
` (147 preceding siblings ...)
2020-12-15 3:12 ` [patch 148/200] khugepaged: add parameter explanations for kernel-doc markup Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 150/200] mm,hugetlb: remove unneeded initialization Andrew Morton
` (51 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, linux-mm, liu.xiang, liuxiang_1999, ma.chenggong,
mike.kravetz, mm-commits, pan.jiagen, torvalds
From: Liu Xiang <liu.xiang@zlingsmart.com>
Subject: mm: hugetlb: fix type of delta parameter and related local variables in gather_surplus_pages()
On 64-bit machine, delta variable in hugetlb_acct_memory() may be larger
than 0xffffffff, but gather_surplus_pages() can only use the low 32-bit
value now. So we need to fix type of delta parameter and related local
variables in gather_surplus_pages().
Link: https://lkml.kernel.org/r/1605793733-3573-1-git-send-email-liu.xiang@zlingsmart.com
Reported-by: Ma Chenggong <ma.chenggong@zlingsmart.com>
Signed-off-by: Liu Xiang <liu.xiang@zlingsmart.com>
Signed-off-by: Pan Jiagen <pan.jiagen@zlingsmart.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Liu Xiang <liuxiang_1999@126.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 7 ++++---
1 file changed, 4 insertions(+), 3 deletions(-)
--- a/mm/hugetlb.c~mm-hugetlb-fix-type-of-delta-parameter-and-related-local-variables-in-gather_surplus_pages
+++ a/mm/hugetlb.c
@@ -1944,13 +1944,14 @@ struct page *alloc_huge_page_vma(struct
* Increase the hugetlb pool such that it can accommodate a reservation
* of size 'delta'.
*/
-static int gather_surplus_pages(struct hstate *h, int delta)
+static int gather_surplus_pages(struct hstate *h, long delta)
__must_hold(&hugetlb_lock)
{
struct list_head surplus_list;
struct page *page, *tmp;
- int ret, i;
- int needed, allocated;
+ int ret;
+ long i;
+ long needed, allocated;
bool alloc_ok = true;
needed = (h->resv_huge_pages + delta) - h->free_huge_pages;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 150/200] mm,hugetlb: remove unneeded initialization
2020-12-15 3:02 incoming Andrew Morton
` (148 preceding siblings ...)
2020-12-15 3:12 ` [patch 149/200] mm: hugetlb: fix type of delta parameter and related local variables in gather_surplus_pages() Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 151/200] hugetlb: fix an error code in hugetlb_reserve_pages() Andrew Morton
` (50 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, david, linux-mm, mike.kravetz, mm-commits, osalvador,
torvalds
From: Oscar Salvador <osalvador@suse.de>
Subject: mm,hugetlb: remove unneeded initialization
hugetlb_add_hstate initializes nr_huge_pages and free_huge_pages to 0, but
since hstates[] is a global variable, all its fields are defined to 0
already.
Link: https://lkml.kernel.org/r/20201119112141.6452-1-osalvador@suse.de
Signed-off-by: Oscar Salvador <osalvador@suse.de>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 2 --
1 file changed, 2 deletions(-)
--- a/mm/hugetlb.c~mmhugetlb-remove-unneded-initialization
+++ a/mm/hugetlb.c
@@ -3198,8 +3198,6 @@ void __init hugetlb_add_hstate(unsigned
h = &hstates[hugetlb_max_hstate++];
h->order = order;
h->mask = ~((1ULL << (order + PAGE_SHIFT)) - 1);
- h->nr_huge_pages = 0;
- h->free_huge_pages = 0;
for (i = 0; i < MAX_NUMNODES; ++i)
INIT_LIST_HEAD(&h->hugepage_freelists[i]);
INIT_LIST_HEAD(&h->hugepage_activelist);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 151/200] hugetlb: fix an error code in hugetlb_reserve_pages()
2020-12-15 3:02 incoming Andrew Morton
` (149 preceding siblings ...)
2020-12-15 3:12 ` [patch 150/200] mm,hugetlb: remove unneeded initialization Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 152/200] mm: don't wake kswapd prematurely when watermark boosting is disabled Andrew Morton
` (49 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, almasrymina, dan.carpenter, david, linux-mm, mike.kravetz,
mm-commits, rientjes, torvalds
From: Dan Carpenter <dan.carpenter@oracle.com>
Subject: hugetlb: fix an error code in hugetlb_reserve_pages()
Preserve the error code from region_add() instead of returning success.
Link: https://lkml.kernel.org/r/X9NGZWnZl5/Mt99R@mwanda
Fixes: 0db9d74ed884 ("hugetlb: disable region_add file_region coalescing")
Signed-off-by: Dan Carpenter <dan.carpenter@oracle.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: David Rientjes <rientjes@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/hugetlb.c | 1 +
1 file changed, 1 insertion(+)
--- a/mm/hugetlb.c~hugetlb-fix-an-error-code-in-hugetlb_reserve_pages
+++ a/mm/hugetlb.c
@@ -5113,6 +5113,7 @@ int hugetlb_reserve_pages(struct inode *
if (unlikely(add < 0)) {
hugetlb_acct_memory(h, -gbl_reserve);
+ ret = add;
goto out_put_pages;
} else if (unlikely(chg > add)) {
/*
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 152/200] mm: don't wake kswapd prematurely when watermark boosting is disabled
2020-12-15 3:02 incoming Andrew Morton
` (150 preceding siblings ...)
2020-12-15 3:12 ` [patch 151/200] hugetlb: fix an error code in hugetlb_reserve_pages() Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 153/200] mm/vmscan: drop unneeded assignment in kswapd() Andrew Morton
` (48 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, hannes, linux-mm, mgorman, mm-commits, torvalds
From: Johannes Weiner <hannes@cmpxchg.org>
Subject: mm: don't wake kswapd prematurely when watermark boosting is disabled
On 2-node NUMA hosts we see bursts of kswapd reclaim and subsequent
pressure spikes and stalls from cache refaults while there is plenty of
free memory in the system.
Usually, kswapd is woken up when all eligible nodes in an allocation are
full. But the code related to watermark boosting can wake kswapd on one
full node while the other one is mostly empty. This may be justified to
fight fragmentation, but is currently unconditionally done whether
watermark boosting is occurring or not.
In our case, many of our workloads' throughput scales with available
memory, and pure utilization is a more tangible concern than trends around
longer-term fragmentation. As a result we generally disable watermark
boosting.
Wake kswapd only woken when watermark boosting is requested.
Link: https://lkml.kernel.org/r/20201020175833.397286-1-hannes@cmpxchg.org
Fixes: 1c30844d2dfe ("mm: reclaim small amounts of memory when an external fragmentation event occurs")
Signed-off-by: Johannes Weiner <hannes@cmpxchg.org>
Acked-by: Mel Gorman <mgorman@suse.de>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_alloc.c | 13 +++++++------
1 file changed, 7 insertions(+), 6 deletions(-)
--- a/mm/page_alloc.c~mm-dont-wake-kswapd-prematurely-when-watermark-boosting-is-disabled
+++ a/mm/page_alloc.c
@@ -2482,12 +2482,12 @@ static bool can_steal_fallback(unsigned
return false;
}
-static inline void boost_watermark(struct zone *zone)
+static inline bool boost_watermark(struct zone *zone)
{
unsigned long max_boost;
if (!watermark_boost_factor)
- return;
+ return false;
/*
* Don't bother in zones that are unlikely to produce results.
* On small machines, including kdump capture kernels running
@@ -2495,7 +2495,7 @@ static inline void boost_watermark(struc
* memory situation immediately.
*/
if ((pageblock_nr_pages * 4) > zone_managed_pages(zone))
- return;
+ return false;
max_boost = mult_frac(zone->_watermark[WMARK_HIGH],
watermark_boost_factor, 10000);
@@ -2509,12 +2509,14 @@ static inline void boost_watermark(struc
* boosted watermark resulting in a hang.
*/
if (!max_boost)
- return;
+ return false;
max_boost = max(pageblock_nr_pages, max_boost);
zone->watermark_boost = min(zone->watermark_boost + pageblock_nr_pages,
max_boost);
+
+ return true;
}
/*
@@ -2552,8 +2554,7 @@ static void steal_suitable_fallback(stru
* likelihood of future fallbacks. Wake kswapd now as the node
* may be balanced overall and kswapd will not wake naturally.
*/
- boost_watermark(zone);
- if (alloc_flags & ALLOC_KSWAPD)
+ if (boost_watermark(zone) && (alloc_flags & ALLOC_KSWAPD))
set_bit(ZONE_BOOSTED_WATERMARK, &zone->flags);
/* We are not allowed to try stealing from the whole block */
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 153/200] mm/vmscan: drop unneeded assignment in kswapd()
2020-12-15 3:02 incoming Andrew Morton
` (151 preceding siblings ...)
2020-12-15 3:12 ` [patch 152/200] mm: don't wake kswapd prematurely when watermark boosting is disabled Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 154/200] mm/vmscan.c: remove the filename in the top of file comment Andrew Morton
` (47 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, linux-mm, lukas.bulwahn, mgorman, mhocko, mm-commits,
natechancellor, ndesaulniers, torvalds, vbabka
From: Lukas Bulwahn <lukas.bulwahn@gmail.com>
Subject: mm/vmscan: drop unneeded assignment in kswapd()
The refactoring to kswapd() in commit e716f2eb24de ("mm, vmscan: prevent
kswapd sleeping prematurely due to mismatched classzone_idx") turned an
assignment to reclaim_order into a dead store, as in all further paths,
reclaim_order will be assigned again before it is used.
make clang-analyzer on x86_64 tinyconfig caught my attention with:
mm/vmscan.c: warning: Although the value stored to 'reclaim_order' is
used in the enclosing expression, the value is never actually read from
'reclaim_order' [clang-analyzer-deadcode.DeadStores]
Compilers will detect this unneeded assignment and optimize this anyway.
So, the resulting binary is identical before and after this change.
Simplify the code and remove unneeded assignment to make clang-analyzer
happy.
No functional change. No change in binary code.
Link: https://lkml.kernel.org/r/20201004125827.17679-1-lukas.bulwahn@gmail.com
Signed-off-by: Lukas Bulwahn <lukas.bulwahn@gmail.com>
Acked-by: Mel Gorman <mgorman@techsingularity.net>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Nathan Chancellor <natechancellor@gmail.com>
Cc: Nick Desaulniers <ndesaulniers@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmscan.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/vmscan.c~mm-vmscan-drop-unneeded-assignment-in-kswapd
+++ a/mm/vmscan.c
@@ -3895,7 +3895,7 @@ kswapd_try_sleep:
highest_zoneidx);
/* Read the new order and highest_zoneidx */
- alloc_order = reclaim_order = READ_ONCE(pgdat->kswapd_order);
+ alloc_order = READ_ONCE(pgdat->kswapd_order);
highest_zoneidx = kswapd_highest_zoneidx(pgdat,
highest_zoneidx);
WRITE_ONCE(pgdat->kswapd_order, 0);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 154/200] mm/vmscan.c: remove the filename in the top of file comment
2020-12-15 3:02 incoming Andrew Morton
` (152 preceding siblings ...)
2020-12-15 3:12 ` [patch 153/200] mm/vmscan: drop unneeded assignment in kswapd() Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 155/200] mm/page_isolation: do not isolate the max order page Andrew Morton
` (46 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, hymmsx.yu, linux-mm, mm-commits, torvalds
From: "logic.yu" <hymmsx.yu@gmail.com>
Subject: mm/vmscan.c: remove the filename in the top of file comment
No point in having the filename inside the file.
Link: https://lkml.kernel.org/r/20201115141541.3878-1-hymmsx.yu@gmail.com
Signed-off-by: logic.yu <hymmsx.yu@gmail.com>
Reviewed-by: Andrew Morton <akpm@linux-foundation.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/vmscan.c | 2 --
1 file changed, 2 deletions(-)
--- a/mm/vmscan.c~mm-remove-the-filename-in-the-top-of-file-comment-in-vmscanc
+++ a/mm/vmscan.c
@@ -1,7 +1,5 @@
// SPDX-License-Identifier: GPL-2.0
/*
- * linux/mm/vmscan.c
- *
* Copyright (C) 1991, 1992, 1993, 1994 Linus Torvalds
*
* Swap reorganised 29.12.95, Stephen Tweedie.
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 155/200] mm/page_isolation: do not isolate the max order page
2020-12-15 3:02 incoming Andrew Morton
` (153 preceding siblings ...)
2020-12-15 3:12 ` [patch 154/200] mm/vmscan.c: remove the filename in the top of file comment Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 156/200] z3fold: simplify freeing slots Andrew Morton
` (45 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, david, iamjoonsoo.kim, linux-mm, mm-commits, osalvador,
songmuchun, torvalds, vbabka, willy
From: Muchun Song <songmuchun@bytedance.com>
Subject: mm/page_isolation: do not isolate the max order page
A max order page has no buddy page and never merges to another order. So
isolating and then freeing it is pointless.
Link: https://lkml.kernel.org/r/20201202122114.75316-1-songmuchun@bytedance.com
Fixes: 3c605096d315 ("mm/page_alloc: restrict max order of merging on isolated pageblock")
Signed-off-by: Muchun Song <songmuchun@bytedance.com>
Reviewed-by: Andrew Morton <akpm@linux-foundation.org>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: David Hildenbrand <david@redhat.com>
Reviewed-by: Oscar Salvador <osalvador@suse.de>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/page_isolation.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/page_isolation.c~mm-page_isolation-do-not-isolate-the-max-order-page
+++ a/mm/page_isolation.c
@@ -88,7 +88,7 @@ static void unset_migratetype_isolate(st
*/
if (PageBuddy(page)) {
order = buddy_order(page);
- if (order >= pageblock_order) {
+ if (order >= pageblock_order && order < MAX_ORDER - 1) {
pfn = page_to_pfn(page);
buddy_pfn = __find_buddy_pfn(pfn, order);
buddy = page + (buddy_pfn - pfn);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 156/200] z3fold: simplify freeing slots
2020-12-15 3:02 incoming Andrew Morton
` (154 preceding siblings ...)
2020-12-15 3:12 ` [patch 155/200] mm/page_isolation: do not isolate the max order page Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 157/200] z3fold: stricter locking and more careful reclaim Andrew Morton
` (44 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, bigeasy, efault, linux-mm, mm-commits, stable, torvalds,
vitaly.wool
From: Vitaly Wool <vitaly.wool@konsulko.com>
Subject: z3fold: simplify freeing slots
Patch series "z3fold: stability / rt fixes".
Address z3fold stability issues under stress load, primarily in the
reclaim and free aspects. Besides, it fixes the locking problems that
were only seen in real-time kernel configuration.
This patch (of 3):
There used to be two places in the code where slots could be freed, namely
when freeing the last allocated handle from the slots and when releasing
the z3fold header these slots aree linked to. The logic to decide on
whether to free certain slots was complicated and error prone in both
functions and it led to failures in RT case.
To fix that, make free_handle() the single point of freeing slots.
Link: https://lkml.kernel.org/r/20201209145151.18994-1-vitaly.wool@konsulko.com
Link: https://lkml.kernel.org/r/20201209145151.18994-2-vitaly.wool@konsulko.com
Signed-off-by: Vitaly Wool <vitaly.wool@konsulko.com>
Tested-by: Mike Galbraith <efault@gmx.de>
Cc: Sebastian Andrzej Siewior <bigeasy@linutronix.de>
Cc: <stable@vger.kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/z3fold.c | 55 +++++++++++---------------------------------------
1 file changed, 13 insertions(+), 42 deletions(-)
--- a/mm/z3fold.c~z3fold-simplify-freeing-slots
+++ a/mm/z3fold.c
@@ -90,7 +90,7 @@ struct z3fold_buddy_slots {
* be enough slots to hold all possible variants
*/
unsigned long slot[BUDDY_MASK + 1];
- unsigned long pool; /* back link + flags */
+ unsigned long pool; /* back link */
rwlock_t lock;
};
#define HANDLE_FLAG_MASK (0x03)
@@ -182,13 +182,6 @@ enum z3fold_page_flags {
};
/*
- * handle flags, go under HANDLE_FLAG_MASK
- */
-enum z3fold_handle_flags {
- HANDLES_ORPHANED = 0,
-};
-
-/*
* Forward declarations
*/
static struct z3fold_header *__z3fold_alloc(struct z3fold_pool *, size_t, bool);
@@ -303,10 +296,9 @@ static inline void put_z3fold_header(str
z3fold_page_unlock(zhdr);
}
-static inline void free_handle(unsigned long handle)
+static inline void free_handle(unsigned long handle, struct z3fold_header *zhdr)
{
struct z3fold_buddy_slots *slots;
- struct z3fold_header *zhdr;
int i;
bool is_free;
@@ -316,22 +308,13 @@ static inline void free_handle(unsigned
if (WARN_ON(*(unsigned long *)handle == 0))
return;
- zhdr = handle_to_z3fold_header(handle);
slots = handle_to_slots(handle);
write_lock(&slots->lock);
*(unsigned long *)handle = 0;
- if (zhdr->slots == slots) {
- write_unlock(&slots->lock);
- return; /* simple case, nothing else to do */
- }
+ if (zhdr->slots != slots)
+ zhdr->foreign_handles--;
- /* we are freeing a foreign handle if we are here */
- zhdr->foreign_handles--;
is_free = true;
- if (!test_bit(HANDLES_ORPHANED, &slots->pool)) {
- write_unlock(&slots->lock);
- return;
- }
for (i = 0; i <= BUDDY_MASK; i++) {
if (slots->slot[i]) {
is_free = false;
@@ -343,6 +326,8 @@ static inline void free_handle(unsigned
if (is_free) {
struct z3fold_pool *pool = slots_to_pool(slots);
+ if (zhdr->slots == slots)
+ zhdr->slots = NULL;
kmem_cache_free(pool->c_handle, slots);
}
}
@@ -525,8 +510,6 @@ static void __release_z3fold_page(struct
{
struct page *page = virt_to_page(zhdr);
struct z3fold_pool *pool = zhdr_to_pool(zhdr);
- bool is_free = true;
- int i;
WARN_ON(!list_empty(&zhdr->buddy));
set_bit(PAGE_STALE, &page->private);
@@ -536,21 +519,6 @@ static void __release_z3fold_page(struct
list_del_init(&page->lru);
spin_unlock(&pool->lock);
- /* If there are no foreign handles, free the handles array */
- read_lock(&zhdr->slots->lock);
- for (i = 0; i <= BUDDY_MASK; i++) {
- if (zhdr->slots->slot[i]) {
- is_free = false;
- break;
- }
- }
- if (!is_free)
- set_bit(HANDLES_ORPHANED, &zhdr->slots->pool);
- read_unlock(&zhdr->slots->lock);
-
- if (is_free)
- kmem_cache_free(pool->c_handle, zhdr->slots);
-
if (locked)
z3fold_page_unlock(zhdr);
@@ -973,6 +941,9 @@ lookup:
}
}
+ if (zhdr && !zhdr->slots)
+ zhdr->slots = alloc_slots(pool,
+ can_sleep ? GFP_NOIO : GFP_ATOMIC);
return zhdr;
}
@@ -1270,7 +1241,7 @@ static void z3fold_free(struct z3fold_po
}
if (!page_claimed)
- free_handle(handle);
+ free_handle(handle, zhdr);
if (kref_put(&zhdr->refcount, release_z3fold_page_locked_list)) {
atomic64_dec(&pool->pages_nr);
return;
@@ -1429,19 +1400,19 @@ static int z3fold_reclaim_page(struct z3
ret = pool->ops->evict(pool, middle_handle);
if (ret)
goto next;
- free_handle(middle_handle);
+ free_handle(middle_handle, zhdr);
}
if (first_handle) {
ret = pool->ops->evict(pool, first_handle);
if (ret)
goto next;
- free_handle(first_handle);
+ free_handle(first_handle, zhdr);
}
if (last_handle) {
ret = pool->ops->evict(pool, last_handle);
if (ret)
goto next;
- free_handle(last_handle);
+ free_handle(last_handle, zhdr);
}
next:
if (test_bit(PAGE_HEADLESS, &page->private)) {
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 157/200] z3fold: stricter locking and more careful reclaim
2020-12-15 3:02 incoming Andrew Morton
` (155 preceding siblings ...)
2020-12-15 3:12 ` [patch 156/200] z3fold: simplify freeing slots Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 158/200] z3fold: remove preempt disabled sections for RT Andrew Morton
` (43 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, bigeasy, efault, linux-mm, mm-commits, stable, torvalds,
vitaly.wool
From: Vitaly Wool <vitaly.wool@konsulko.com>
Subject: z3fold: stricter locking and more careful reclaim
Use temporary slots in reclaim function to avoid possible race when
freeing those.
While at it, make sure we check CLAIMED flag under page lock in the
reclaim function to make sure we are not racing with z3fold_alloc().
Link: https://lkml.kernel.org/r/20201209145151.18994-4-vitaly.wool@konsulko.com
Signed-off-by: Vitaly Wool <vitaly.wool@konsulko.com>
Cc: <stable@vger.kernel.org>
Cc: Mike Galbraith <efault@gmx.de>
Cc: Sebastian Andrzej Siewior <bigeasy@linutronix.de>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/z3fold.c | 143 +++++++++++++++++++++++++++++---------------------
1 file changed, 85 insertions(+), 58 deletions(-)
--- a/mm/z3fold.c~z3fold-stricter-locking-and-more-careful-reclaim
+++ a/mm/z3fold.c
@@ -182,6 +182,13 @@ enum z3fold_page_flags {
};
/*
+ * handle flags, go under HANDLE_FLAG_MASK
+ */
+enum z3fold_handle_flags {
+ HANDLES_NOFREE = 0,
+};
+
+/*
* Forward declarations
*/
static struct z3fold_header *__z3fold_alloc(struct z3fold_pool *, size_t, bool);
@@ -311,6 +318,12 @@ static inline void free_handle(unsigned
slots = handle_to_slots(handle);
write_lock(&slots->lock);
*(unsigned long *)handle = 0;
+
+ if (test_bit(HANDLES_NOFREE, &slots->pool)) {
+ write_unlock(&slots->lock);
+ return; /* simple case, nothing else to do */
+ }
+
if (zhdr->slots != slots)
zhdr->foreign_handles--;
@@ -621,6 +634,28 @@ static inline void add_to_unbuddied(stru
}
}
+static inline enum buddy get_free_buddy(struct z3fold_header *zhdr, int chunks)
+{
+ enum buddy bud = HEADLESS;
+
+ if (zhdr->middle_chunks) {
+ if (!zhdr->first_chunks &&
+ chunks <= zhdr->start_middle - ZHDR_CHUNKS)
+ bud = FIRST;
+ else if (!zhdr->last_chunks)
+ bud = LAST;
+ } else {
+ if (!zhdr->first_chunks)
+ bud = FIRST;
+ else if (!zhdr->last_chunks)
+ bud = LAST;
+ else
+ bud = MIDDLE;
+ }
+
+ return bud;
+}
+
static inline void *mchunk_memmove(struct z3fold_header *zhdr,
unsigned short dst_chunk)
{
@@ -682,18 +717,7 @@ static struct z3fold_header *compact_sin
if (WARN_ON(new_zhdr == zhdr))
goto out_fail;
- if (new_zhdr->first_chunks == 0) {
- if (new_zhdr->middle_chunks != 0 &&
- chunks >= new_zhdr->start_middle) {
- new_bud = LAST;
- } else {
- new_bud = FIRST;
- }
- } else if (new_zhdr->last_chunks == 0) {
- new_bud = LAST;
- } else if (new_zhdr->middle_chunks == 0) {
- new_bud = MIDDLE;
- }
+ new_bud = get_free_buddy(new_zhdr, chunks);
q = new_zhdr;
switch (new_bud) {
case FIRST:
@@ -815,9 +839,8 @@ static void do_compact_page(struct z3fol
return;
}
- if (unlikely(PageIsolated(page) ||
- test_bit(PAGE_CLAIMED, &page->private) ||
- test_bit(PAGE_STALE, &page->private))) {
+ if (test_bit(PAGE_STALE, &page->private) ||
+ test_and_set_bit(PAGE_CLAIMED, &page->private)) {
z3fold_page_unlock(zhdr);
return;
}
@@ -826,13 +849,16 @@ static void do_compact_page(struct z3fol
zhdr->mapped_count == 0 && compact_single_buddy(zhdr)) {
if (kref_put(&zhdr->refcount, release_z3fold_page_locked))
atomic64_dec(&pool->pages_nr);
- else
+ else {
+ clear_bit(PAGE_CLAIMED, &page->private);
z3fold_page_unlock(zhdr);
+ }
return;
}
z3fold_compact_page(zhdr);
add_to_unbuddied(pool, zhdr);
+ clear_bit(PAGE_CLAIMED, &page->private);
z3fold_page_unlock(zhdr);
}
@@ -1080,17 +1106,8 @@ static int z3fold_alloc(struct z3fold_po
retry:
zhdr = __z3fold_alloc(pool, size, can_sleep);
if (zhdr) {
- if (zhdr->first_chunks == 0) {
- if (zhdr->middle_chunks != 0 &&
- chunks >= zhdr->start_middle)
- bud = LAST;
- else
- bud = FIRST;
- } else if (zhdr->last_chunks == 0)
- bud = LAST;
- else if (zhdr->middle_chunks == 0)
- bud = MIDDLE;
- else {
+ bud = get_free_buddy(zhdr, chunks);
+ if (bud == HEADLESS) {
if (kref_put(&zhdr->refcount,
release_z3fold_page_locked))
atomic64_dec(&pool->pages_nr);
@@ -1236,7 +1253,6 @@ static void z3fold_free(struct z3fold_po
pr_err("%s: unknown bud %d\n", __func__, bud);
WARN_ON(1);
put_z3fold_header(zhdr);
- clear_bit(PAGE_CLAIMED, &page->private);
return;
}
@@ -1251,8 +1267,7 @@ static void z3fold_free(struct z3fold_po
z3fold_page_unlock(zhdr);
return;
}
- if (unlikely(PageIsolated(page)) ||
- test_and_set_bit(NEEDS_COMPACTING, &page->private)) {
+ if (test_and_set_bit(NEEDS_COMPACTING, &page->private)) {
put_z3fold_header(zhdr);
clear_bit(PAGE_CLAIMED, &page->private);
return;
@@ -1316,6 +1331,10 @@ static int z3fold_reclaim_page(struct z3
struct page *page = NULL;
struct list_head *pos;
unsigned long first_handle = 0, middle_handle = 0, last_handle = 0;
+ struct z3fold_buddy_slots slots __attribute__((aligned(SLOTS_ALIGN)));
+
+ rwlock_init(&slots.lock);
+ slots.pool = (unsigned long)pool | (1 << HANDLES_NOFREE);
spin_lock(&pool->lock);
if (!pool->ops || !pool->ops->evict || retries == 0) {
@@ -1330,35 +1349,36 @@ static int z3fold_reclaim_page(struct z3
list_for_each_prev(pos, &pool->lru) {
page = list_entry(pos, struct page, lru);
- /* this bit could have been set by free, in which case
- * we pass over to the next page in the pool.
- */
- if (test_and_set_bit(PAGE_CLAIMED, &page->private)) {
- page = NULL;
- continue;
- }
-
- if (unlikely(PageIsolated(page))) {
- clear_bit(PAGE_CLAIMED, &page->private);
- page = NULL;
- continue;
- }
zhdr = page_address(page);
if (test_bit(PAGE_HEADLESS, &page->private))
break;
+ if (kref_get_unless_zero(&zhdr->refcount) == 0) {
+ zhdr = NULL;
+ break;
+ }
if (!z3fold_page_trylock(zhdr)) {
- clear_bit(PAGE_CLAIMED, &page->private);
+ if (kref_put(&zhdr->refcount,
+ release_z3fold_page))
+ atomic64_dec(&pool->pages_nr);
zhdr = NULL;
continue; /* can't evict at this point */
}
- if (zhdr->foreign_handles) {
- clear_bit(PAGE_CLAIMED, &page->private);
- z3fold_page_unlock(zhdr);
+
+ /* test_and_set_bit is of course atomic, but we still
+ * need to do it under page lock, otherwise checking
+ * that bit in __z3fold_alloc wouldn't make sense
+ */
+ if (zhdr->foreign_handles ||
+ test_and_set_bit(PAGE_CLAIMED, &page->private)) {
+ if (kref_put(&zhdr->refcount,
+ release_z3fold_page))
+ atomic64_dec(&pool->pages_nr);
+ else
+ z3fold_page_unlock(zhdr);
zhdr = NULL;
continue; /* can't evict such page */
}
- kref_get(&zhdr->refcount);
list_del_init(&zhdr->buddy);
zhdr->cpu = -1;
break;
@@ -1380,12 +1400,16 @@ static int z3fold_reclaim_page(struct z3
first_handle = 0;
last_handle = 0;
middle_handle = 0;
+ memset(slots.slot, 0, sizeof(slots.slot));
if (zhdr->first_chunks)
- first_handle = encode_handle(zhdr, FIRST);
+ first_handle = __encode_handle(zhdr, &slots,
+ FIRST);
if (zhdr->middle_chunks)
- middle_handle = encode_handle(zhdr, MIDDLE);
+ middle_handle = __encode_handle(zhdr, &slots,
+ MIDDLE);
if (zhdr->last_chunks)
- last_handle = encode_handle(zhdr, LAST);
+ last_handle = __encode_handle(zhdr, &slots,
+ LAST);
/*
* it's safe to unlock here because we hold a
* reference to this page
@@ -1400,19 +1424,16 @@ static int z3fold_reclaim_page(struct z3
ret = pool->ops->evict(pool, middle_handle);
if (ret)
goto next;
- free_handle(middle_handle, zhdr);
}
if (first_handle) {
ret = pool->ops->evict(pool, first_handle);
if (ret)
goto next;
- free_handle(first_handle, zhdr);
}
if (last_handle) {
ret = pool->ops->evict(pool, last_handle);
if (ret)
goto next;
- free_handle(last_handle, zhdr);
}
next:
if (test_bit(PAGE_HEADLESS, &page->private)) {
@@ -1426,9 +1447,11 @@ next:
spin_unlock(&pool->lock);
clear_bit(PAGE_CLAIMED, &page->private);
} else {
+ struct z3fold_buddy_slots *slots = zhdr->slots;
z3fold_page_lock(zhdr);
if (kref_put(&zhdr->refcount,
release_z3fold_page_locked)) {
+ kmem_cache_free(pool->c_handle, slots);
atomic64_dec(&pool->pages_nr);
return 0;
}
@@ -1544,8 +1567,7 @@ static bool z3fold_page_isolate(struct p
VM_BUG_ON_PAGE(!PageMovable(page), page);
VM_BUG_ON_PAGE(PageIsolated(page), page);
- if (test_bit(PAGE_HEADLESS, &page->private) ||
- test_bit(PAGE_CLAIMED, &page->private))
+ if (test_bit(PAGE_HEADLESS, &page->private))
return false;
zhdr = page_address(page);
@@ -1557,6 +1579,8 @@ static bool z3fold_page_isolate(struct p
if (zhdr->mapped_count != 0 || zhdr->foreign_handles != 0)
goto out;
+ if (test_and_set_bit(PAGE_CLAIMED, &page->private))
+ goto out;
pool = zhdr_to_pool(zhdr);
spin_lock(&pool->lock);
if (!list_empty(&zhdr->buddy))
@@ -1583,16 +1607,17 @@ static int z3fold_page_migrate(struct ad
VM_BUG_ON_PAGE(!PageMovable(page), page);
VM_BUG_ON_PAGE(!PageIsolated(page), page);
+ VM_BUG_ON_PAGE(!test_bit(PAGE_CLAIMED, &page->private), page);
VM_BUG_ON_PAGE(!PageLocked(newpage), newpage);
zhdr = page_address(page);
pool = zhdr_to_pool(zhdr);
- if (!z3fold_page_trylock(zhdr)) {
+ if (!z3fold_page_trylock(zhdr))
return -EAGAIN;
- }
if (zhdr->mapped_count != 0 || zhdr->foreign_handles != 0) {
z3fold_page_unlock(zhdr);
+ clear_bit(PAGE_CLAIMED, &page->private);
return -EBUSY;
}
if (work_pending(&zhdr->work)) {
@@ -1634,6 +1659,7 @@ static int z3fold_page_migrate(struct ad
queue_work_on(new_zhdr->cpu, pool->compact_wq, &new_zhdr->work);
page_mapcount_reset(page);
+ clear_bit(PAGE_CLAIMED, &page->private);
put_page(page);
return 0;
}
@@ -1657,6 +1683,7 @@ static void z3fold_page_putback(struct p
spin_lock(&pool->lock);
list_add(&page->lru, &pool->lru);
spin_unlock(&pool->lock);
+ clear_bit(PAGE_CLAIMED, &page->private);
z3fold_page_unlock(zhdr);
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 158/200] z3fold: remove preempt disabled sections for RT
2020-12-15 3:02 incoming Andrew Morton
` (156 preceding siblings ...)
2020-12-15 3:12 ` [patch 157/200] z3fold: stricter locking and more careful reclaim Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 159/200] mm/compaction: rename 'start_pfn' to 'iteration_start_pfn' in compact_zone() Andrew Morton
` (42 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, bigeasy, linux-mm, mm-commits, torvalds, vitaly.wool
From: Vitaly Wool <vitaly.wool@konsulko.com>
Subject: z3fold: remove preempt disabled sections for RT
Replace get_cpu_ptr() with migrate_disable()+this_cpu_ptr() so RT can take
spinlocks that become sleeping locks.
Signed-off-by Mike Galbraith <efault@gmx.de>
Link: https://lkml.kernel.org/r/20201209145151.18994-3-vitaly.wool@konsulko.com
Signed-off-by: Vitaly Wool <vitaly.wool@konsulko.com>
Cc: Sebastian Andrzej Siewior <bigeasy@linutronix.de>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/z3fold.c | 17 ++++++++++-------
1 file changed, 10 insertions(+), 7 deletions(-)
--- a/mm/z3fold.c~z3fold-remove-preempt-disabled-sections-for-rt
+++ a/mm/z3fold.c
@@ -623,14 +623,16 @@ static inline void add_to_unbuddied(stru
{
if (zhdr->first_chunks == 0 || zhdr->last_chunks == 0 ||
zhdr->middle_chunks == 0) {
- struct list_head *unbuddied = get_cpu_ptr(pool->unbuddied);
-
+ struct list_head *unbuddied;
int freechunks = num_free_chunks(zhdr);
+
+ migrate_disable();
+ unbuddied = this_cpu_ptr(pool->unbuddied);
spin_lock(&pool->lock);
list_add(&zhdr->buddy, &unbuddied[freechunks]);
spin_unlock(&pool->lock);
zhdr->cpu = smp_processor_id();
- put_cpu_ptr(pool->unbuddied);
+ migrate_enable();
}
}
@@ -880,8 +882,9 @@ static inline struct z3fold_header *__z3
int chunks = size_to_chunks(size), i;
lookup:
+ migrate_disable();
/* First, try to find an unbuddied z3fold page. */
- unbuddied = get_cpu_ptr(pool->unbuddied);
+ unbuddied = this_cpu_ptr(pool->unbuddied);
for_each_unbuddied_list(i, chunks) {
struct list_head *l = &unbuddied[i];
@@ -899,7 +902,7 @@ lookup:
!z3fold_page_trylock(zhdr)) {
spin_unlock(&pool->lock);
zhdr = NULL;
- put_cpu_ptr(pool->unbuddied);
+ migrate_enable();
if (can_sleep)
cond_resched();
goto lookup;
@@ -913,7 +916,7 @@ lookup:
test_bit(PAGE_CLAIMED, &page->private)) {
z3fold_page_unlock(zhdr);
zhdr = NULL;
- put_cpu_ptr(pool->unbuddied);
+ migrate_enable();
if (can_sleep)
cond_resched();
goto lookup;
@@ -928,7 +931,7 @@ lookup:
kref_get(&zhdr->refcount);
break;
}
- put_cpu_ptr(pool->unbuddied);
+ migrate_enable();
if (!zhdr) {
int cpu;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 159/200] mm/compaction: rename 'start_pfn' to 'iteration_start_pfn' in compact_zone()
2020-12-15 3:02 incoming Andrew Morton
` (157 preceding siblings ...)
2020-12-15 3:12 ` [patch 158/200] z3fold: remove preempt disabled sections for RT Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 160/200] mm/compaction: move compaction_suitable's comment to right place Andrew Morton
` (41 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, david, linux-mm, mm-commits, pankaj.gupta.linux, torvalds,
vbabka, yanfei.xu
From: Yanfei Xu <yanfei.xu@windriver.com>
Subject: mm/compaction: rename 'start_pfn' to 'iteration_start_pfn' in compact_zone()
There are two 'start_pfn' declared in compact_zone() which have different
meanings. Rename the second one to 'iteration_start_pfn' to prevent
confusion.
Also, remove an useless semicolon.
Link: https://lkml.kernel.org/r/20201019115044.1571-1-yanfei.xu@windriver.com
Signed-off-by: Yanfei Xu <yanfei.xu@windriver.com>
Acked-by: David Hildenbrand <david@redhat.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Pankaj Gupta <pankaj.gupta.linux@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/compaction.c | 7 +++----
1 file changed, 3 insertions(+), 4 deletions(-)
--- a/mm/compaction.c~mm-compaction-rename-start_pfn-to-iteration_start_pfn-in-compact_zone
+++ a/mm/compaction.c
@@ -2275,7 +2275,7 @@ compact_zone(struct compact_control *cc,
while ((ret = compact_finished(cc)) == COMPACT_CONTINUE) {
int err;
- unsigned long start_pfn = cc->migrate_pfn;
+ unsigned long iteration_start_pfn = cc->migrate_pfn;
/*
* Avoid multiple rescans which can happen if a page cannot be
@@ -2287,7 +2287,7 @@ compact_zone(struct compact_control *cc,
*/
cc->rescan = false;
if (pageblock_start_pfn(last_migrated_pfn) ==
- pageblock_start_pfn(start_pfn)) {
+ pageblock_start_pfn(iteration_start_pfn)) {
cc->rescan = true;
}
@@ -2311,8 +2311,7 @@ compact_zone(struct compact_control *cc,
goto check_drain;
case ISOLATE_SUCCESS:
update_cached = false;
- last_migrated_pfn = start_pfn;
- ;
+ last_migrated_pfn = iteration_start_pfn;
}
err = migrate_pages(&cc->migratepages, compaction_alloc,
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 160/200] mm/compaction: move compaction_suitable's comment to right place
2020-12-15 3:02 incoming Andrew Morton
` (158 preceding siblings ...)
2020-12-15 3:12 ` [patch 159/200] mm/compaction: rename 'start_pfn' to 'iteration_start_pfn' in compact_zone() Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 161/200] mm/compaction: make defer_compaction and compaction_deferred static Andrew Morton
` (40 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, linux-mm, mm-commits, sh_def, torvalds
From: Hui Su <sh_def@163.com>
Subject: mm/compaction: move compaction_suitable's comment to right place
Since commit 837d026d560c ("mm/compaction: more trace to understand
when/why compaction start/finish"), the comment place is not suitable.
So move compaction_suitable's comment to right place.
Link: https://lkml.kernel.org/r/20201116144121.GA385717@rlk
Signed-off-by: Hui Su <sh_def@163.com>
Reviewed-by: Andrew Morton <akpm@linux-foundation.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/compaction.c | 14 +++++++-------
1 file changed, 7 insertions(+), 7 deletions(-)
--- a/mm/compaction.c~mm-compaction-move-compaction_suitables-comment-to-right-place
+++ a/mm/compaction.c
@@ -2070,13 +2070,6 @@ static enum compact_result compact_finis
return ret;
}
-/*
- * compaction_suitable: Is this suitable to run compaction on this zone now?
- * Returns
- * COMPACT_SKIPPED - If there are too few free pages for compaction
- * COMPACT_SUCCESS - If the allocation would succeed without compaction
- * COMPACT_CONTINUE - If compaction should run now
- */
static enum compact_result __compaction_suitable(struct zone *zone, int order,
unsigned int alloc_flags,
int highest_zoneidx,
@@ -2120,6 +2113,13 @@ static enum compact_result __compaction_
return COMPACT_CONTINUE;
}
+/*
+ * compaction_suitable: Is this suitable to run compaction on this zone now?
+ * Returns
+ * COMPACT_SKIPPED - If there are too few free pages for compaction
+ * COMPACT_SUCCESS - If the allocation would succeed without compaction
+ * COMPACT_CONTINUE - If compaction should run now
+ */
enum compact_result compaction_suitable(struct zone *zone, int order,
unsigned int alloc_flags,
int highest_zoneidx)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 161/200] mm/compaction: make defer_compaction and compaction_deferred static
2020-12-15 3:02 incoming Andrew Morton
` (159 preceding siblings ...)
2020-12-15 3:12 ` [patch 160/200] mm/compaction: move compaction_suitable's comment to right place Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 162/200] mm/oom_kill: change comment and rename is_dump_unreclaim_slabs() Andrew Morton
` (39 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, bhe, iamjoonsoo.kim, linux-mm, mateusznosek0, mm-commits,
nigupta, sh_def, torvalds, vbabka
From: Hui Su <sh_def@163.com>
Subject: mm/compaction: make defer_compaction and compaction_deferred static
defer_compaction() and compaction_deferred() and compaction_restarting()
in mm/compaction.c won't be used in other files, so make them static, and
remove the declaration in the header file.
Take the chance to fix a typo.
Link: https://lkml.kernel.org/r/20201123170801.GA9625@rlk
Signed-off-by: Hui Su <sh_def@163.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Cc: Nitin Gupta <nigupta@nvidia.com>
Cc: Baoquan He <bhe@redhat.com>
Cc: Mateusz Nosek <mateusznosek0@gmail.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/compaction.h | 12 ------------
mm/compaction.c | 8 ++++----
2 files changed, 4 insertions(+), 16 deletions(-)
--- a/include/linux/compaction.h~mm-compaction-make-defer_compaction-and-compaction_deferred-static
+++ a/include/linux/compaction.h
@@ -98,11 +98,8 @@ extern void reset_isolation_suitable(pg_
extern enum compact_result compaction_suitable(struct zone *zone, int order,
unsigned int alloc_flags, int highest_zoneidx);
-extern void defer_compaction(struct zone *zone, int order);
-extern bool compaction_deferred(struct zone *zone, int order);
extern void compaction_defer_reset(struct zone *zone, int order,
bool alloc_success);
-extern bool compaction_restarting(struct zone *zone, int order);
/* Compaction has made some progress and retrying makes sense */
static inline bool compaction_made_progress(enum compact_result result)
@@ -194,15 +191,6 @@ static inline enum compact_result compac
return COMPACT_SKIPPED;
}
-static inline void defer_compaction(struct zone *zone, int order)
-{
-}
-
-static inline bool compaction_deferred(struct zone *zone, int order)
-{
- return true;
-}
-
static inline bool compaction_made_progress(enum compact_result result)
{
return false;
--- a/mm/compaction.c~mm-compaction-make-defer_compaction-and-compaction_deferred-static
+++ a/mm/compaction.c
@@ -157,7 +157,7 @@ EXPORT_SYMBOL(__ClearPageMovable);
* allocation success. 1 << compact_defer_shift, compactions are skipped up
* to a limit of 1 << COMPACT_MAX_DEFER_SHIFT
*/
-void defer_compaction(struct zone *zone, int order)
+static void defer_compaction(struct zone *zone, int order)
{
zone->compact_considered = 0;
zone->compact_defer_shift++;
@@ -172,7 +172,7 @@ void defer_compaction(struct zone *zone,
}
/* Returns true if compaction should be skipped this time */
-bool compaction_deferred(struct zone *zone, int order)
+static bool compaction_deferred(struct zone *zone, int order)
{
unsigned long defer_limit = 1UL << zone->compact_defer_shift;
@@ -209,7 +209,7 @@ void compaction_defer_reset(struct zone
}
/* Returns true if restarting compaction after many failures */
-bool compaction_restarting(struct zone *zone, int order)
+static bool compaction_restarting(struct zone *zone, int order)
{
if (order < zone->compact_order_failed)
return false;
@@ -237,7 +237,7 @@ static void reset_cached_positions(struc
}
/*
- * Compound pages of >= pageblock_order should consistenly be skipped until
+ * Compound pages of >= pageblock_order should consistently be skipped until
* released. It is always pointless to compact pages of such order (if they are
* migratable), and the pageblocks they occupy cannot contain any free pages.
*/
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 162/200] mm/oom_kill: change comment and rename is_dump_unreclaim_slabs()
2020-12-15 3:02 incoming Andrew Morton
` (160 preceding siblings ...)
2020-12-15 3:12 ` [patch 161/200] mm/compaction: make defer_compaction and compaction_deferred static Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 163/200] mm/migrate.c: fix comment spelling Andrew Morton
` (38 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, linux-mm, mhocko, mm-commits, sh_def, torvalds
From: Hui Su <sh_def@163.com>
Subject: mm/oom_kill: change comment and rename is_dump_unreclaim_slabs()
Change the comment of is_dump_unreclaim_slabs(), it just check whether
nr_unreclaimable slabs amount is greater than user memory, and explain why
we dump unreclaim slabs.
Rename it to should_dump_unreclaim_slab() maybe better.
Link: https://lkml.kernel.org/r/20201030182704.GA53949@rlk
Signed-off-by: Hui Su <sh_def@163.com>
Acked-by: Michal Hocko <mhocko@suse.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/oom_kill.c | 14 ++++++++------
1 file changed, 8 insertions(+), 6 deletions(-)
--- a/mm/oom_kill.c~mm-oom_kill-change-comment-and-rename-is_dump_unreclaim_slabs
+++ a/mm/oom_kill.c
@@ -170,11 +170,13 @@ static bool oom_unkillable_task(struct t
return false;
}
-/*
- * Print out unreclaimble slabs info when unreclaimable slabs amount is greater
- * than all user memory (LRU pages)
- */
-static bool is_dump_unreclaim_slabs(void)
+/**
+ * Check whether unreclaimable slab amount is greater than
+ * all user memory(LRU pages).
+ * dump_unreclaimable_slab() could help in the case that
+ * oom due to too much unreclaimable slab used by kernel.
+*/
+static bool should_dump_unreclaim_slab(void)
{
unsigned long nr_lru;
@@ -463,7 +465,7 @@ static void dump_header(struct oom_contr
mem_cgroup_print_oom_meminfo(oc->memcg);
else {
show_mem(SHOW_MEM_FILTER_NODES, oc->nodemask);
- if (is_dump_unreclaim_slabs())
+ if (should_dump_unreclaim_slab())
dump_unreclaimable_slab();
}
if (sysctl_oom_dump_tasks)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 163/200] mm/migrate.c: fix comment spelling
2020-12-15 3:02 incoming Andrew Morton
` (161 preceding siblings ...)
2020-12-15 3:12 ` [patch 162/200] mm/oom_kill: change comment and rename is_dump_unreclaim_slabs() Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 164/200] mm/migrate.c: optimize migrate_vma_pages() mmu notifier Andrew Morton
` (37 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, linux-mm, lonuxli.64, mm-commits, torvalds
From: Long Li <lonuxli.64@gmail.com>
Subject: mm/migrate.c: fix comment spelling
The word in the comment is misspelled, it should be "include".
Link: https://lkml.kernel.org/r/20201024114144.GA20552@lilong
Signed-off-by: Long Li <lonuxli.64@gmail.com>
Reviewed-by: Andrew Morton <akpm@linux-foundation.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/migrate.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/migrate.c~mm-migrate-fix-comment-spelling
+++ a/mm/migrate.c
@@ -1696,7 +1696,7 @@ static int move_pages_and_store_status(s
* Positive err means the number of failed
* pages to migrate. Since we are going to
* abort and return the number of non-migrated
- * pages, so need to incude the rest of the
+ * pages, so need to include the rest of the
* nr_pages that have not been attempted as
* well.
*/
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 164/200] mm/migrate.c: optimize migrate_vma_pages() mmu notifier
2020-12-15 3:02 incoming Andrew Morton
` (162 preceding siblings ...)
2020-12-15 3:12 ` [patch 163/200] mm/migrate.c: fix comment spelling Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:12 ` [patch 165/200] mm: support THPs in zero_user_segments Andrew Morton
` (36 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, apopple, hch, jgg, jglisse, jhubbard, linux-mm, mm-commits,
rcampbell, torvalds
From: Ralph Campbell <rcampbell@nvidia.com>
Subject: mm/migrate.c: optimize migrate_vma_pages() mmu notifier
When migrating a zero page or pte_none() anonymous page to device private
memory, migrate_vma_setup() will initialize the src[] array with a NULL
PFN. This lets the device driver allocate device private memory and clear
it instead of DMAing a page of zeros over the device bus.
Since the source page didn't exist at the time, no struct page was locked
nor a migration PTE inserted into the CPU page tables. The actual PTE
insertion happens in migrate_vma_pages() when it tries to insert the
device private struct page PTE into the CPU page tables.
migrate_vma_pages() has to call the mmu notifiers again since another
device could fault on the same page before the page table locks are
acquired.
Allow device drivers to optimize the invalidation similar to
migrate_vma_setup() by calling mmu_notifier_range_init() which sets struct
mmu_notifier_range event type to MMU_NOTIFY_MIGRATE and the
migrate_pgmap_owner field.
Link: https://lkml.kernel.org/r/20201021191335.10916-1-rcampbell@nvidia.com
Signed-off-by: Ralph Campbell <rcampbell@nvidia.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: John Hubbard <jhubbard@nvidia.com>
Cc: Alistair Popple <apopple@nvidia.com>
Cc: Christoph Hellwig <hch@lst.de>
Cc: Jason Gunthorpe <jgg@nvidia.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/migrate.c | 9 ++++-----
1 file changed, 4 insertions(+), 5 deletions(-)
--- a/mm/migrate.c~mm-optimize-migrate_vma_pages-mmu-notifier
+++ a/mm/migrate.c
@@ -3001,11 +3001,10 @@ void migrate_vma_pages(struct migrate_vm
if (!notified) {
notified = true;
- mmu_notifier_range_init(&range,
- MMU_NOTIFY_CLEAR, 0,
- NULL,
- migrate->vma->vm_mm,
- addr, migrate->end);
+ mmu_notifier_range_init_migrate(&range, 0,
+ migrate->vma, migrate->vma->vm_mm,
+ addr, migrate->end,
+ migrate->pgmap_owner);
mmu_notifier_invalidate_range_start(&range);
}
migrate_vma_insert_page(migrate, addr, newpage,
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 165/200] mm: support THPs in zero_user_segments
2020-12-15 3:02 incoming Andrew Morton
` (163 preceding siblings ...)
2020-12-15 3:12 ` [patch 164/200] mm/migrate.c: optimize migrate_vma_pages() mmu notifier Andrew Morton
@ 2020-12-15 3:12 ` Andrew Morton
2020-12-15 3:13 ` [patch 166/200] mm: truncate_complete_page() does not exist any more Andrew Morton
` (35 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:12 UTC (permalink / raw)
To: akpm, jack, linux-mm, mgorman, mhocko, mm-commits, naresh.kamboju,
shy828301, songliubraving, torvalds, willy, ziy
From: "Matthew Wilcox (Oracle)" <willy@infradead.org>
Subject: mm: support THPs in zero_user_segments
We can only kmap() one subpage of a THP at a time, so loop over all
relevant subpages, skipping ones which don't need to be zeroed. This is
too large to inline when THPs are enabled and we actually need highmem, so
put it in highmem.c.
[willy@infradead.org: start1 was allowed to be less than start2]
Link: https://lkml.kernel.org/r/20201124041507.28996-1-willy@infradead.org
Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Cc: Yang Shi <shy828301@gmail.com>
Cc: Jan Kara <jack@suse.cz>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Zi Yan <ziy@nvidia.com>
Cc: Song Liu <songliubraving@fb.com>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Naresh Kamboju <naresh.kamboju@linaro.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/highmem.h | 19 ++++++++++---
mm/highmem.c | 52 ++++++++++++++++++++++++++++++++++++++
2 files changed, 67 insertions(+), 4 deletions(-)
--- a/include/linux/highmem.h~mm-support-thps-in-zero_user_segments
+++ a/include/linux/highmem.h
@@ -284,13 +284,22 @@ static inline void clear_highpage(struct
kunmap_atomic(kaddr);
}
+/*
+ * If we pass in a base or tail page, we can zero up to PAGE_SIZE.
+ * If we pass in a head page, we can zero up to the size of the compound page.
+ */
+#if defined(CONFIG_HIGHMEM) && defined(CONFIG_TRANSPARENT_HUGEPAGE)
+void zero_user_segments(struct page *page, unsigned start1, unsigned end1,
+ unsigned start2, unsigned end2);
+#else /* !HIGHMEM || !TRANSPARENT_HUGEPAGE */
static inline void zero_user_segments(struct page *page,
- unsigned start1, unsigned end1,
- unsigned start2, unsigned end2)
+ unsigned start1, unsigned end1,
+ unsigned start2, unsigned end2)
{
void *kaddr = kmap_atomic(page);
+ unsigned int i;
- BUG_ON(end1 > PAGE_SIZE || end2 > PAGE_SIZE);
+ BUG_ON(end1 > page_size(page) || end2 > page_size(page));
if (end1 > start1)
memset(kaddr + start1, 0, end1 - start1);
@@ -299,8 +308,10 @@ static inline void zero_user_segments(st
memset(kaddr + start2, 0, end2 - start2);
kunmap_atomic(kaddr);
- flush_dcache_page(page);
+ for (i = 0; i < compound_nr(page); i++)
+ flush_dcache_page(page + i);
}
+#endif /* !HIGHMEM || !TRANSPARENT_HUGEPAGE */
static inline void zero_user_segment(struct page *page,
unsigned start, unsigned end)
--- a/mm/highmem.c~mm-support-thps-in-zero_user_segments
+++ a/mm/highmem.c
@@ -369,6 +369,58 @@ void kunmap_high(struct page *page)
}
EXPORT_SYMBOL(kunmap_high);
+
+#ifdef CONFIG_TRANSPARENT_HUGEPAGE
+void zero_user_segments(struct page *page, unsigned start1, unsigned end1,
+ unsigned start2, unsigned end2)
+{
+ unsigned int i;
+
+ BUG_ON(end1 > page_size(page) || end2 > page_size(page));
+
+ for (i = 0; i < compound_nr(page); i++) {
+ void *kaddr = NULL;
+
+ if (start1 < PAGE_SIZE || start2 < PAGE_SIZE)
+ kaddr = kmap_atomic(page + i);
+
+ if (start1 >= PAGE_SIZE) {
+ start1 -= PAGE_SIZE;
+ end1 -= PAGE_SIZE;
+ } else {
+ unsigned this_end = min_t(unsigned, end1, PAGE_SIZE);
+
+ if (end1 > start1)
+ memset(kaddr + start1, 0, this_end - start1);
+ end1 -= this_end;
+ start1 = 0;
+ }
+
+ if (start2 >= PAGE_SIZE) {
+ start2 -= PAGE_SIZE;
+ end2 -= PAGE_SIZE;
+ } else {
+ unsigned this_end = min_t(unsigned, end2, PAGE_SIZE);
+
+ if (end2 > start2)
+ memset(kaddr + start2, 0, this_end - start2);
+ end2 -= this_end;
+ start2 = 0;
+ }
+
+ if (kaddr) {
+ kunmap_atomic(kaddr);
+ flush_dcache_page(page + i);
+ }
+
+ if (!end1 && !end2)
+ break;
+ }
+
+ BUG_ON((start1 | start2 | end1 | end2) != 0);
+}
+EXPORT_SYMBOL(zero_user_segments);
+#endif /* CONFIG_TRANSPARENT_HUGEPAGE */
#endif /* CONFIG_HIGHMEM */
#if defined(HASHED_PAGE_VIRTUAL)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 166/200] mm: truncate_complete_page() does not exist any more
2020-12-15 3:02 incoming Andrew Morton
` (164 preceding siblings ...)
2020-12-15 3:12 ` [patch 165/200] mm: support THPs in zero_user_segments Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:13 ` [patch 167/200] mm: migrate: simplify the logic for handling permanent failure Andrew Morton
` (34 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: akpm, jack, linux-mm, mgorman, mhocko, mm-commits, shy828301,
songliubraving, torvalds, willy, ziy
From: Yang Shi <shy828301@gmail.com>
Subject: mm: truncate_complete_page() does not exist any more
Patch series "mm: misc migrate cleanup and improvement", v3.
This patch (of 5):
The commit 9f4e41f4717832e ("mm: refactor truncate_complete_page()")
refactored truncate_complete_page(), and it is not existed anymore,
correct the comment in vmscan and migrate to avoid confusion.
Link: https://lkml.kernel.org/r/20201113205359.556831-1-shy828301@gmail.com
Link: https://lkml.kernel.org/r/20201113205359.556831-2-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Reviewed-by: Jan Kara <jack@suse.cz>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Zi Yan <ziy@nvidia.com>
Cc: Song Liu <songliubraving@fb.com>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Matthew Wilcox <willy@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/migrate.c | 2 +-
mm/vmscan.c | 2 +-
2 files changed, 2 insertions(+), 2 deletions(-)
--- a/mm/migrate.c~mm-truncate_complete_page-is-not-existed-anymore
+++ a/mm/migrate.c
@@ -1106,7 +1106,7 @@ static int __unmap_and_move(struct page
* and treated as swapcache but it has no rmap yet.
* Calling try_to_unmap() against a page->mapping==NULL page will
* trigger a BUG. So handle it here.
- * 2. An orphaned page (see truncate_complete_page) might have
+ * 2. An orphaned page (see truncate_cleanup_page) might have
* fs-private metadata. The page can be picked up due to memory
* offlining. Everywhere else except page reclaim, the page is
* invisible to the vm, so the page can not be migrated. So try to
--- a/mm/vmscan.c~mm-truncate_complete_page-is-not-existed-anymore
+++ a/mm/vmscan.c
@@ -1390,7 +1390,7 @@ static unsigned int shrink_page_list(str
*
* Rarely, pages can have buffers and no ->mapping. These are
* the pages which were not successfully invalidated in
- * truncate_complete_page(). We try to drop those buffers here
+ * truncate_cleanup_page(). We try to drop those buffers here
* and if that worked, and the page is no longer mapped into
* process address space (page_count == 1) it can be freed.
* Otherwise, leave the page on the LRU so it is swappable.
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 167/200] mm: migrate: simplify the logic for handling permanent failure
2020-12-15 3:02 incoming Andrew Morton
` (165 preceding siblings ...)
2020-12-15 3:13 ` [patch 166/200] mm: truncate_complete_page() does not exist any more Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:13 ` [patch 168/200] mm: migrate: skip shared exec THP for NUMA balancing Andrew Morton
` (33 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: akpm, jack, linux-mm, mgorman, mhocko, mm-commits, shy828301,
songliubraving, torvalds, willy, ziy
From: Yang Shi <shy828301@gmail.com>
Subject: mm: migrate: simplify the logic for handling permanent failure
When unmap_and_move{_huge_page}() returns !-EAGAIN and
!MIGRATEPAGE_SUCCESS, the page would be put back to LRU or proper list if
it is non-LRU movable page. But, the callers always call
putback_movable_pages() to put the failed pages back later on, so it seems
not very efficient to put every single page back immediately, and the code
looks convoluted.
Put the failed page on a separate list, then splice the list to migrate
list when all pages are tried. It is the caller's responsibility to call
putback_movable_pages() to handle failures. This also makes the code
simpler and more readable.
After the change the rules are:
* Success: non hugetlb page will be freed, hugetlb page will be put
back
* -EAGAIN: stay on the from list
* -ENOMEM: stay on the from list
* Other errno: put on ret_pages list then splice to from list
The from list would be empty iff all pages are migrated successfully, it
was not so before. This has no impact to current existing callsites.
Link: https://lkml.kernel.org/r/20201113205359.556831-3-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Reviewed-by: Zi Yan <ziy@nvidia.com>
Cc: Jan Kara <jack@suse.cz>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Song Liu <songliubraving@fb.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/migrate.c | 68 +++++++++++++++++++++++++++----------------------
1 file changed, 38 insertions(+), 30 deletions(-)
--- a/mm/migrate.c~mm-migrate-simplify-the-logic-for-handling-permanent-failure
+++ a/mm/migrate.c
@@ -1168,7 +1168,8 @@ static int unmap_and_move(new_page_t get
free_page_t put_new_page,
unsigned long private, struct page *page,
int force, enum migrate_mode mode,
- enum migrate_reason reason)
+ enum migrate_reason reason,
+ struct list_head *ret)
{
int rc = MIGRATEPAGE_SUCCESS;
struct page *newpage = NULL;
@@ -1205,7 +1206,14 @@ out:
* migrated will have kept its references and be restored.
*/
list_del(&page->lru);
+ }
+ /*
+ * If migration is successful, releases reference grabbed during
+ * isolation. Otherwise, restore the page to right list unless
+ * we want to retry.
+ */
+ if (rc == MIGRATEPAGE_SUCCESS) {
/*
* Compaction can migrate also non-LRU pages which are
* not accounted to NR_ISOLATED_*. They can be recognized
@@ -1214,35 +1222,16 @@ out:
if (likely(!__PageMovable(page)))
mod_node_page_state(page_pgdat(page), NR_ISOLATED_ANON +
page_is_file_lru(page), -thp_nr_pages(page));
- }
- /*
- * If migration is successful, releases reference grabbed during
- * isolation. Otherwise, restore the page to right list unless
- * we want to retry.
- */
- if (rc == MIGRATEPAGE_SUCCESS) {
if (reason != MR_MEMORY_FAILURE)
/*
* We release the page in page_handle_poison.
*/
put_page(page);
} else {
- if (rc != -EAGAIN) {
- if (likely(!__PageMovable(page))) {
- putback_lru_page(page);
- goto put_new;
- }
+ if (rc != -EAGAIN)
+ list_add_tail(&page->lru, ret);
- lock_page(page);
- if (PageMovable(page))
- putback_movable_page(page);
- else
- __ClearPageIsolated(page);
- unlock_page(page);
- put_page(page);
- }
-put_new:
if (put_new_page)
put_new_page(newpage, private);
else
@@ -1273,7 +1262,8 @@ put_new:
static int unmap_and_move_huge_page(new_page_t get_new_page,
free_page_t put_new_page, unsigned long private,
struct page *hpage, int force,
- enum migrate_mode mode, int reason)
+ enum migrate_mode mode, int reason,
+ struct list_head *ret)
{
int rc = -EAGAIN;
int page_was_mapped = 0;
@@ -1289,7 +1279,7 @@ static int unmap_and_move_huge_page(new_
* kicking migration.
*/
if (!hugepage_migration_supported(page_hstate(hpage))) {
- putback_active_hugepage(hpage);
+ list_move_tail(&hpage->lru, ret);
return -ENOSYS;
}
@@ -1374,8 +1364,10 @@ put_anon:
out_unlock:
unlock_page(hpage);
out:
- if (rc != -EAGAIN)
+ if (rc == MIGRATEPAGE_SUCCESS)
putback_active_hugepage(hpage);
+ else if (rc != -EAGAIN && rc != MIGRATEPAGE_SUCCESS)
+ list_move_tail(&hpage->lru, ret);
/*
* If migration was not successful and there's a freeing callback, use
@@ -1406,8 +1398,8 @@ out:
*
* The function returns after 10 attempts or if no pages are movable any more
* because the list has become empty or no retryable pages exist any more.
- * The caller should call putback_movable_pages() to return pages to the LRU
- * or free list only if ret != 0.
+ * It is caller's responsibility to call putback_movable_pages() to return pages
+ * to the LRU or free list only if ret != 0.
*
* Returns the number of pages that were not migrated, or an error code.
*/
@@ -1428,6 +1420,7 @@ int migrate_pages(struct list_head *from
struct page *page2;
int swapwrite = current->flags & PF_SWAPWRITE;
int rc, nr_subpages;
+ LIST_HEAD(ret_pages);
if (!swapwrite)
current->flags |= PF_SWAPWRITE;
@@ -1450,12 +1443,21 @@ retry:
if (PageHuge(page))
rc = unmap_and_move_huge_page(get_new_page,
put_new_page, private, page,
- pass > 2, mode, reason);
+ pass > 2, mode, reason,
+ &ret_pages);
else
rc = unmap_and_move(get_new_page, put_new_page,
private, page, pass > 2, mode,
- reason);
-
+ reason, &ret_pages);
+ /*
+ * The rules are:
+ * Success: non hugetlb page will be freed, hugetlb
+ * page will be put back
+ * -EAGAIN: stay on the from list
+ * -ENOMEM: stay on the from list
+ * Other errno: put on ret_pages list then splice to
+ * from list
+ */
switch(rc) {
case -ENOMEM:
/*
@@ -1521,6 +1523,12 @@ retry:
nr_thp_failed += thp_retry;
rc = nr_failed;
out:
+ /*
+ * Put the permanent failure page back to migration list, they
+ * will be put back to the right list by the caller.
+ */
+ list_splice(&ret_pages, from);
+
count_vm_events(PGMIGRATE_SUCCESS, nr_succeeded);
count_vm_events(PGMIGRATE_FAIL, nr_failed);
count_vm_events(THP_MIGRATION_SUCCESS, nr_thp_succeeded);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 168/200] mm: migrate: skip shared exec THP for NUMA balancing
2020-12-15 3:02 incoming Andrew Morton
` (166 preceding siblings ...)
2020-12-15 3:13 ` [patch 167/200] mm: migrate: simplify the logic for handling permanent failure Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:13 ` [patch 169/200] mm: migrate: clean up migrate_prep{_local} Andrew Morton
` (32 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: akpm, jack, linux-mm, mgorman, mhocko, mm-commits, shy828301,
songliubraving, torvalds, willy, ziy
From: Yang Shi <shy828301@gmail.com>
Subject: mm: migrate: skip shared exec THP for NUMA balancing
The NUMA balancing skip shared exec base page. Since
CONFIG_READ_ONLY_THP_FOR_FS was introduced, there are probably shared exec
THP, so skip such THPs for NUMA balancing as well.
And Willy's regular filesystem THP support patches could create shared
exec THP wven without that config.
In addition, the page_is_file_lru() is used to tell if the page is file
cache or not, but it filters out shmem page. It sounds like a typical
usecase by putting executables in shmem to achieve performance gain via
using shmem-THP, so it sounds worth skipping migration for such case too.
Link: https://lkml.kernel.org/r/20201113205359.556831-4-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Jan Kara <jack@suse.cz>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Song Liu <songliubraving@fb.com>
Cc: Zi Yan <ziy@nvidia.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/migrate.c | 18 ++++++++++++++++--
1 file changed, 16 insertions(+), 2 deletions(-)
--- a/mm/migrate.c~mm-migrate-skip-shared-exec-thp-for-numa-balancing
+++ a/mm/migrate.c
@@ -2071,6 +2071,17 @@ bool pmd_trans_migrating(pmd_t pmd)
return PageLocked(page);
}
+static inline bool is_shared_exec_page(struct vm_area_struct *vma,
+ struct page *page)
+{
+ if (page_mapcount(page) != 1 &&
+ (page_is_file_lru(page) || vma_is_shmem(vma)) &&
+ (vma->vm_flags & VM_EXEC))
+ return true;
+
+ return false;
+}
+
/*
* Attempt to migrate a misplaced page to the specified destination
* node. Caller is expected to have an elevated reference count on
@@ -2088,8 +2099,7 @@ int migrate_misplaced_page(struct page *
* Don't migrate file pages that are mapped in multiple processes
* with execute permissions as they are probably shared libraries.
*/
- if (page_mapcount(page) != 1 && page_is_file_lru(page) &&
- (vma->vm_flags & VM_EXEC))
+ if (is_shared_exec_page(vma, page))
goto out;
/*
@@ -2144,6 +2154,9 @@ int migrate_misplaced_transhuge_page(str
int page_lru = page_is_file_lru(page);
unsigned long start = address & HPAGE_PMD_MASK;
+ if (is_shared_exec_page(vma, page))
+ goto out;
+
new_page = alloc_pages_node(node,
(GFP_TRANSHUGE_LIGHT | __GFP_THISNODE),
HPAGE_PMD_ORDER);
@@ -2255,6 +2268,7 @@ out_fail:
out_unlock:
unlock_page(page);
+out:
put_page(page);
return 0;
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 169/200] mm: migrate: clean up migrate_prep{_local}
2020-12-15 3:02 incoming Andrew Morton
` (167 preceding siblings ...)
2020-12-15 3:13 ` [patch 168/200] mm: migrate: skip shared exec THP for NUMA balancing Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:13 ` [patch 170/200] mm: migrate: return -ENOSYS if THP migration is unsupported Andrew Morton
` (31 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: akpm, jack, linux-mm, mgorman, mhocko, mm-commits, shy828301,
songliubraving, torvalds, willy, ziy
From: Yang Shi <shy828301@gmail.com>
Subject: mm: migrate: clean up migrate_prep{_local}
The migrate_prep{_local} never fails, so it is pointless to have return
value and check the return value.
Link: https://lkml.kernel.org/r/20201113205359.556831-5-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Reviewed-by: Zi Yan <ziy@nvidia.com>
Cc: Jan Kara <jack@suse.cz>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Song Liu <songliubraving@fb.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/migrate.h | 4 ++--
mm/mempolicy.c | 8 ++------
mm/migrate.c | 8 ++------
3 files changed, 6 insertions(+), 14 deletions(-)
--- a/include/linux/migrate.h~mm-migrate-clean-up-migrate_prep_local
+++ a/include/linux/migrate.h
@@ -45,8 +45,8 @@ extern struct page *alloc_migration_targ
extern int isolate_movable_page(struct page *page, isolate_mode_t mode);
extern void putback_movable_page(struct page *page);
-extern int migrate_prep(void);
-extern int migrate_prep_local(void);
+extern void migrate_prep(void);
+extern void migrate_prep_local(void);
extern void migrate_page_states(struct page *newpage, struct page *page);
extern void migrate_page_copy(struct page *newpage, struct page *page);
extern int migrate_huge_page_move_mapping(struct address_space *mapping,
--- a/mm/mempolicy.c~mm-migrate-clean-up-migrate_prep_local
+++ a/mm/mempolicy.c
@@ -1114,9 +1114,7 @@ int do_migrate_pages(struct mm_struct *m
int err;
nodemask_t tmp;
- err = migrate_prep();
- if (err)
- return err;
+ migrate_prep();
mmap_read_lock(mm);
@@ -1315,9 +1313,7 @@ static long do_mbind(unsigned long start
if (flags & (MPOL_MF_MOVE | MPOL_MF_MOVE_ALL)) {
- err = migrate_prep();
- if (err)
- goto mpol_out;
+ migrate_prep();
}
{
NODEMASK_SCRATCH(scratch);
--- a/mm/migrate.c~mm-migrate-clean-up-migrate_prep_local
+++ a/mm/migrate.c
@@ -62,7 +62,7 @@
* to be migrated using isolate_lru_page(). If scheduling work on other CPUs is
* undesirable, use migrate_prep_local()
*/
-int migrate_prep(void)
+void migrate_prep(void)
{
/*
* Clear the LRU lists so pages can be isolated.
@@ -71,16 +71,12 @@ int migrate_prep(void)
* pages that may be busy.
*/
lru_add_drain_all();
-
- return 0;
}
/* Do the necessary work of migrate_prep but not if it involves other CPUs */
-int migrate_prep_local(void)
+void migrate_prep_local(void)
{
lru_add_drain();
-
- return 0;
}
int isolate_movable_page(struct page *page, isolate_mode_t mode)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 170/200] mm: migrate: return -ENOSYS if THP migration is unsupported
2020-12-15 3:02 incoming Andrew Morton
` (168 preceding siblings ...)
2020-12-15 3:13 ` [patch 169/200] mm: migrate: clean up migrate_prep{_local} Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:13 ` [patch 171/200] mm: migrate: remove unused parameter in migrate_vma_insert_page() Andrew Morton
` (30 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: akpm, jack, linux-mm, mgorman, mhocko, mm-commits, shy828301,
songliubraving, torvalds, willy, ziy
From: Yang Shi <shy828301@gmail.com>
Subject: mm: migrate: return -ENOSYS if THP migration is unsupported
In the current implementation unmap_and_move() would return -ENOMEM if THP
migration is unsupported, then the THP will be split. If split is failed
just exit without trying to migrate other pages. It doesn't make too much
sense since there may be enough free memory to migrate other pages and
there may be a lot base pages on the list.
Return -ENOSYS to make consistent with hugetlb. And if THP split is
failed just skip and try other pages on the list.
Just skip the whole list and exit when free memory is really low.
Link: https://lkml.kernel.org/r/20201113205359.556831-6-shy828301@gmail.com
Signed-off-by: Yang Shi <shy828301@gmail.com>
Cc: Jan Kara <jack@suse.cz>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mel Gorman <mgorman@suse.de>
Cc: Michal Hocko <mhocko@suse.com>
Cc: Song Liu <songliubraving@fb.com>
Cc: Zi Yan <ziy@nvidia.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/migrate.c | 62 ++++++++++++++++++++++++++++++++++++-------------
1 file changed, 46 insertions(+), 16 deletions(-)
--- a/mm/migrate.c~mm-migrate-return-enosys-if-thp-migration-is-unsupported
+++ a/mm/migrate.c
@@ -1171,7 +1171,7 @@ static int unmap_and_move(new_page_t get
struct page *newpage = NULL;
if (!thp_migration_supported() && PageTransHuge(page))
- return -ENOMEM;
+ return -ENOSYS;
if (page_count(page) == 1) {
/* page was freed from under us. So we are done. */
@@ -1378,6 +1378,20 @@ out:
return rc;
}
+static inline int try_split_thp(struct page *page, struct page **page2,
+ struct list_head *from)
+{
+ int rc = 0;
+
+ lock_page(page);
+ rc = split_huge_page_to_list(page, from);
+ unlock_page(page);
+ if (!rc)
+ list_safe_reset_next(page, *page2, lru);
+
+ return rc;
+}
+
/*
* migrate_pages - migrate the pages specified in a list, to the free pages
* supplied as the target for the page migration
@@ -1455,24 +1469,40 @@ retry:
* from list
*/
switch(rc) {
+ /*
+ * THP migration might be unsupported or the
+ * allocation could've failed so we should
+ * retry on the same page with the THP split
+ * to base pages.
+ *
+ * Head page is retried immediately and tail
+ * pages are added to the tail of the list so
+ * we encounter them after the rest of the list
+ * is processed.
+ */
+ case -ENOSYS:
+ /* THP migration is unsupported */
+ if (is_thp) {
+ if (!try_split_thp(page, &page2, from)) {
+ nr_thp_split++;
+ goto retry;
+ }
+
+ nr_thp_failed++;
+ nr_failed += nr_subpages;
+ break;
+ }
+
+ /* Hugetlb migration is unsupported */
+ nr_failed++;
+ break;
case -ENOMEM:
/*
- * THP migration might be unsupported or the
- * allocation could've failed so we should
- * retry on the same page with the THP split
- * to base pages.
- *
- * Head page is retried immediately and tail
- * pages are added to the tail of the list so
- * we encounter them after the rest of the list
- * is processed.
+ * When memory is low, don't bother to try to migrate
+ * other pages, just exit.
*/
if (is_thp) {
- lock_page(page);
- rc = split_huge_page_to_list(page, from);
- unlock_page(page);
- if (!rc) {
- list_safe_reset_next(page, page2, lru);
+ if (!try_split_thp(page, &page2, from)) {
nr_thp_split++;
goto retry;
}
@@ -1500,7 +1530,7 @@ retry:
break;
default:
/*
- * Permanent failure (-EBUSY, -ENOSYS, etc.):
+ * Permanent failure (-EBUSY, etc.):
* unlike -EAGAIN case, the failed page is
* removed from migration page list and not
* retried in the next outer loop.
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 171/200] mm: migrate: remove unused parameter in migrate_vma_insert_page()
2020-12-15 3:02 incoming Andrew Morton
` (169 preceding siblings ...)
2020-12-15 3:13 ` [patch 170/200] mm: migrate: return -ENOSYS if THP migration is unsupported Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:13 ` [patch 172/200] mm/cma.c: remove redundant cma_mutex lock Andrew Morton
` (29 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: akpm, david, linux-mm, mm-commits, starzhangzsd, torvalds
From: Stephen Zhang <starzhangzsd@gmail.com>
Subject: mm: migrate: remove unused parameter in migrate_vma_insert_page()
"dst" parameter to migrate_vma_insert_page() is not used anymore.
Link: https://lkml.kernel.org/r/CANubcdUwCAMuUyamG2dkWP=cqSR9MAS=tHLDc95kQkqU-rEnAg@mail.gmail.com
Signed-off-by: Stephen Zhang <starzhangzsd@gmail.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/migrate.c | 6 ++----
1 file changed, 2 insertions(+), 4 deletions(-)
--- a/mm/migrate.c~mm-migrate-remove-unused-parameter-in-migrate_vma_insert_page
+++ a/mm/migrate.c
@@ -2894,8 +2894,7 @@ EXPORT_SYMBOL(migrate_vma_setup);
static void migrate_vma_insert_page(struct migrate_vma *migrate,
unsigned long addr,
struct page *page,
- unsigned long *src,
- unsigned long *dst)
+ unsigned long *src)
{
struct vm_area_struct *vma = migrate->vma;
struct mm_struct *mm = vma->vm_mm;
@@ -3056,8 +3055,7 @@ void migrate_vma_pages(struct migrate_vm
mmu_notifier_invalidate_range_start(&range);
}
migrate_vma_insert_page(migrate, addr, newpage,
- &migrate->src[i],
- &migrate->dst[i]);
+ &migrate->src[i]);
continue;
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 172/200] mm/cma.c: remove redundant cma_mutex lock
2020-12-15 3:02 incoming Andrew Morton
` (170 preceding siblings ...)
2020-12-15 3:13 ` [patch 171/200] mm: migrate: remove unused parameter in migrate_vma_insert_page() Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:13 ` [patch 173/200] mm: cma: improve pr_debug log in cma_release() Andrew Morton
` (28 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: akpm, david, lecopzer.chen, linux-mm, matthias.bgg, mm-commits,
torvalds, vbabka, yj.chiang
From: Lecopzer Chen <lecopzer.chen@mediatek.com>
Subject: mm/cma.c: remove redundant cma_mutex lock
The cma_mutex which protects alloc_contig_range() was first appeared in
commit 7ee793a62fa8c ("cma: Remove potential deadlock situation"), at that
time, there is no guarantee the behavior of concurrency inside
alloc_contig_range().
After commit 2c7452a075d4db2dc ("mm/page_isolation.c: make
start_isolate_page_range() fail if already isolated")
> However, two subsystems (CMA and gigantic
> huge pages for example) could attempt operations on the same range. If
> this happens, one thread may 'undo' the work another thread is doing.
> This can result in pageblocks being incorrectly left marked as
> MIGRATE_ISOLATE and therefore not available for page allocation.
The concurrency inside alloc_contig_range() was clarified.
Now we can find that hugepage and virtio call alloc_contig_range() without
any lock, thus cma_mutex is "redundant" in cma_alloc() now.
Link: https://lkml.kernel.org/r/20201020102241.3729-1-lecopzer.chen@mediatek.com
Signed-off-by: Lecopzer Chen <lecopzer.chen@mediatek.com>
Acked-by: David Hildenbrand <david@redhat.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Cc: Matthias Brugger <matthias.bgg@gmail.com>
Cc: YJ Chiang <yj.chiang@mediatek.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/cma.c | 4 +---
1 file changed, 1 insertion(+), 3 deletions(-)
--- a/mm/cma.c~mm-cmac-remove-redundant-cma_mutex-lock
+++ a/mm/cma.c
@@ -38,7 +38,6 @@
struct cma cma_areas[MAX_CMA_AREAS];
unsigned cma_area_count;
-static DEFINE_MUTEX(cma_mutex);
phys_addr_t cma_get_base(const struct cma *cma)
{
@@ -454,10 +453,9 @@ struct page *cma_alloc(struct cma *cma,
mutex_unlock(&cma->lock);
pfn = cma->base_pfn + (bitmap_no << cma->order_per_bit);
- mutex_lock(&cma_mutex);
ret = alloc_contig_range(pfn, pfn + count, MIGRATE_CMA,
GFP_KERNEL | (no_warn ? __GFP_NOWARN : 0));
- mutex_unlock(&cma_mutex);
+
if (ret == 0) {
page = pfn_to_page(pfn);
break;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 173/200] mm: cma: improve pr_debug log in cma_release()
2020-12-15 3:02 incoming Andrew Morton
` (171 preceding siblings ...)
2020-12-15 3:13 ` [patch 172/200] mm/cma.c: remove redundant cma_mutex lock Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:13 ` [patch 174/200] mm, page_alloc: do not rely on the order of page_poison and init_on_alloc/free parameters Andrew Morton
` (27 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: akpm, charante, david, iamjoonsoo.kim, jrdr.linux, linux-mm,
mm-commits, torvalds, vbabka, vinmenon
From: Charan Teja Reddy <charante@codeaurora.org>
Subject: mm: cma: improve pr_debug log in cma_release()
It is required to print 'count' of pages, along with the pages, passed to
cma_release to debug the cases of mismatched count value passed between
cma_alloc() and cma_release() from a code path.
As an example, consider the below scenario:
1) CMA pool size is 4MB and
2) User doing the erroneous step of allocating 2 pages but freeing 1
page in a loop from this CMA pool. The step 2 causes cma_alloc() to
return NULL at one point of time because of -ENOMEM condition.
And the current pr_debug logs is not giving the info about these types of
allocation patterns because of count value not being printed in
cma_release().
We are printing the count value in the trace logs, just extend the same to
pr_debug logs too.
[akpm@linux-foundation.org: fix printk warning]
Link: https://lkml.kernel.org/r/1606318341-29521-1-git-send-email-charante@codeaurora.org
Signed-off-by: Charan Teja Reddy <charante@codeaurora.org>
Reviewed-by: Souptick Joarder <jrdr.linux@gmail.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Vlastimil Babka <vbabka@suse.cz>
Cc: Vinayak Menon <vinmenon@codeaurora.org>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/cma.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/cma.c~mm-cma-improve-pr_debug-log-in-cma_release
+++ a/mm/cma.c
@@ -510,7 +510,7 @@ bool cma_release(struct cma *cma, const
if (!cma || !pages)
return false;
- pr_debug("%s(page %p)\n", __func__, (void *)pages);
+ pr_debug("%s(page %p, count %u)\n", __func__, (void *)pages, count);
pfn = page_to_pfn(pages);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 174/200] mm, page_alloc: do not rely on the order of page_poison and init_on_alloc/free parameters
2020-12-15 3:02 incoming Andrew Morton
` (172 preceding siblings ...)
2020-12-15 3:13 ` [patch 173/200] mm: cma: improve pr_debug log in cma_release() Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:13 ` [patch 175/200] mm, page_poison: use static key more efficiently Andrew Morton
` (26 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: akpm, david, glider, keescook, labbott, linux-mm, mateusznosek0,
mhocko, mm-commits, rafael.j.wysocki, rppt, torvalds, vbabka
From: Vlastimil Babka <vbabka@suse.cz>
Subject: mm, page_alloc: do not rely on the order of page_poison and init_on_alloc/free parameters
Patch series "cleanup page poisoning", v3.
I have identified a number of issues and opportunities for cleanup with
CONFIG_PAGE_POISON and friends:
- interaction with init_on_alloc and init_on_free parameters depends on
the order of parameters (Patch 1)
- the boot time enabling uses static key, but inefficienty (Patch 2)
- sanity checking is incompatible with hibernation (Patch 3)
- CONFIG_PAGE_POISONING_NO_SANITY can be removed now that we have init_on_free
(Patch 4)
- CONFIG_PAGE_POISONING_ZERO can be most likely removed now that we have
init_on_free (Patch 5)
This patch (of 5):
Enabling page_poison=1 together with init_on_alloc=1 or init_on_free=1
produces a warning in dmesg that page_poison takes precedence. However,
as these warnings are printed in early_param handlers for
init_on_alloc/free, they are not printed if page_poison is enabled later
on the command line (handlers are called in the order of their
parameters), or when init_on_alloc/free is always enabled by the
respective config option - before the page_poison early param handler is
called, it is not considered to be enabled. This is inconsistent.
We can remove the dependency on order by making the init_on_* parameters
only set a boolean variable, and postponing the evaluation after all early
params have been processed. Introduce a new
init_mem_debugging_and_hardening() function for that, and move the related
debug_pagealloc processing there as well.
As a result init_mem_debugging_and_hardening() knows always accurately if
init_on_* and/or page_poison options were enabled. Thus we can also
optimize want_init_on_alloc() and want_init_on_free(). We don't need to
check page_poisoning_enabled() there, we can instead not enable the
init_on_* static keys at all, if page poisoning is enabled. This results
in a simpler and more effective code.
Link: https://lkml.kernel.org/r/20201113104033.22907-1-vbabka@suse.cz
Link: https://lkml.kernel.org/r/20201113104033.22907-2-vbabka@suse.cz
Signed-off-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: David Hildenbrand <david@redhat.com>
Reviewed-by: Mike Rapoport <rppt@linux.ibm.com>
Cc: Rafael J. Wysocki <rafael.j.wysocki@intel.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Kees Cook <keescook@chromium.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Mateusz Nosek <mateusznosek0@gmail.com>
Cc: Laura Abbott <labbott@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/mm.h | 20 +--------
init/main.c | 2
mm/page_alloc.c | 88 ++++++++++++++++++++-----------------------
3 files changed, 46 insertions(+), 64 deletions(-)
--- a/include/linux/mm.h~mm-page_alloc-do-not-rely-on-the-order-of-page_poison-and-init_on_alloc-free-parameters
+++ a/include/linux/mm.h
@@ -2872,6 +2872,7 @@ extern int apply_to_existing_page_range(
unsigned long address, unsigned long size,
pte_fn_t fn, void *data);
+extern void init_mem_debugging_and_hardening(void);
#ifdef CONFIG_PAGE_POISONING
extern bool page_poisoning_enabled(void);
extern void kernel_poison_pages(struct page *page, int numpages, int enable);
@@ -2881,35 +2882,20 @@ static inline void kernel_poison_pages(s
int enable) { }
#endif
-#ifdef CONFIG_INIT_ON_ALLOC_DEFAULT_ON
-DECLARE_STATIC_KEY_TRUE(init_on_alloc);
-#else
DECLARE_STATIC_KEY_FALSE(init_on_alloc);
-#endif
static inline bool want_init_on_alloc(gfp_t flags)
{
- if (static_branch_unlikely(&init_on_alloc) &&
- !page_poisoning_enabled())
+ if (static_branch_unlikely(&init_on_alloc))
return true;
return flags & __GFP_ZERO;
}
-#ifdef CONFIG_INIT_ON_FREE_DEFAULT_ON
-DECLARE_STATIC_KEY_TRUE(init_on_free);
-#else
DECLARE_STATIC_KEY_FALSE(init_on_free);
-#endif
static inline bool want_init_on_free(void)
{
- return static_branch_unlikely(&init_on_free) &&
- !page_poisoning_enabled();
+ return static_branch_unlikely(&init_on_free);
}
-#ifdef CONFIG_DEBUG_PAGEALLOC
-extern void init_debug_pagealloc(void);
-#else
-static inline void init_debug_pagealloc(void) {}
-#endif
extern bool _debug_pagealloc_enabled_early;
DECLARE_STATIC_KEY_FALSE(_debug_pagealloc_enabled);
--- a/init/main.c~mm-page_alloc-do-not-rely-on-the-order-of-page_poison-and-init_on_alloc-free-parameters
+++ a/init/main.c
@@ -824,7 +824,7 @@ static void __init mm_init(void)
* bigger than MAX_ORDER unless SPARSEMEM.
*/
page_ext_init_flatmem();
- init_debug_pagealloc();
+ init_mem_debugging_and_hardening();
report_meminit();
mem_init();
/* page_owner must be initialized after buddy is ready */
--- a/mm/page_alloc.c~mm-page_alloc-do-not-rely-on-the-order-of-page_poison-and-init_on_alloc-free-parameters
+++ a/mm/page_alloc.c
@@ -167,53 +167,26 @@ unsigned long totalcma_pages __read_most
int percpu_pagelist_fraction;
gfp_t gfp_allowed_mask __read_mostly = GFP_BOOT_MASK;
-#ifdef CONFIG_INIT_ON_ALLOC_DEFAULT_ON
-DEFINE_STATIC_KEY_TRUE(init_on_alloc);
-#else
DEFINE_STATIC_KEY_FALSE(init_on_alloc);
-#endif
EXPORT_SYMBOL(init_on_alloc);
-#ifdef CONFIG_INIT_ON_FREE_DEFAULT_ON
-DEFINE_STATIC_KEY_TRUE(init_on_free);
-#else
DEFINE_STATIC_KEY_FALSE(init_on_free);
-#endif
EXPORT_SYMBOL(init_on_free);
+static bool _init_on_alloc_enabled_early __read_mostly
+ = IS_ENABLED(CONFIG_INIT_ON_ALLOC_DEFAULT_ON);
static int __init early_init_on_alloc(char *buf)
{
- int ret;
- bool bool_result;
- ret = kstrtobool(buf, &bool_result);
- if (ret)
- return ret;
- if (bool_result && page_poisoning_enabled())
- pr_info("mem auto-init: CONFIG_PAGE_POISONING is on, will take precedence over init_on_alloc\n");
- if (bool_result)
- static_branch_enable(&init_on_alloc);
- else
- static_branch_disable(&init_on_alloc);
- return 0;
+ return kstrtobool(buf, &_init_on_alloc_enabled_early);
}
early_param("init_on_alloc", early_init_on_alloc);
+static bool _init_on_free_enabled_early __read_mostly
+ = IS_ENABLED(CONFIG_INIT_ON_FREE_DEFAULT_ON);
static int __init early_init_on_free(char *buf)
{
- int ret;
- bool bool_result;
-
- ret = kstrtobool(buf, &bool_result);
- if (ret)
- return ret;
- if (bool_result && page_poisoning_enabled())
- pr_info("mem auto-init: CONFIG_PAGE_POISONING is on, will take precedence over init_on_free\n");
- if (bool_result)
- static_branch_enable(&init_on_free);
- else
- static_branch_disable(&init_on_free);
- return 0;
+ return kstrtobool(buf, &_init_on_free_enabled_early);
}
early_param("init_on_free", early_init_on_free);
@@ -730,19 +703,6 @@ static int __init early_debug_pagealloc(
}
early_param("debug_pagealloc", early_debug_pagealloc);
-void init_debug_pagealloc(void)
-{
- if (!debug_pagealloc_enabled())
- return;
-
- static_branch_enable(&_debug_pagealloc_enabled);
-
- if (!debug_guardpage_minorder())
- return;
-
- static_branch_enable(&_debug_guardpage_enabled);
-}
-
static int __init debug_guardpage_minorder_setup(char *buf)
{
unsigned long res;
@@ -794,6 +754,42 @@ static inline void clear_page_guard(stru
unsigned int order, int migratetype) {}
#endif
+/*
+ * Enable static keys related to various memory debugging and hardening options.
+ * Some override others, and depend on early params that are evaluated in the
+ * order of appearance. So we need to first gather the full picture of what was
+ * enabled, and then make decisions.
+ */
+void init_mem_debugging_and_hardening(void)
+{
+ if (_init_on_alloc_enabled_early) {
+ if (page_poisoning_enabled())
+ pr_info("mem auto-init: CONFIG_PAGE_POISONING is on, "
+ "will take precedence over init_on_alloc\n");
+ else
+ static_branch_enable(&init_on_alloc);
+ }
+ if (_init_on_free_enabled_early) {
+ if (page_poisoning_enabled())
+ pr_info("mem auto-init: CONFIG_PAGE_POISONING is on, "
+ "will take precedence over init_on_free\n");
+ else
+ static_branch_enable(&init_on_free);
+ }
+
+#ifdef CONFIG_DEBUG_PAGEALLOC
+ if (!debug_pagealloc_enabled())
+ return;
+
+ static_branch_enable(&_debug_pagealloc_enabled);
+
+ if (!debug_guardpage_minorder())
+ return;
+
+ static_branch_enable(&_debug_guardpage_enabled);
+#endif
+}
+
static inline void set_buddy_order(struct page *page, unsigned int order)
{
set_page_private(page, order);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 175/200] mm, page_poison: use static key more efficiently
2020-12-15 3:02 incoming Andrew Morton
` (173 preceding siblings ...)
2020-12-15 3:13 ` [patch 174/200] mm, page_alloc: do not rely on the order of page_poison and init_on_alloc/free parameters Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:13 ` [patch 176/200] kernel/power: allow hibernation with page_poison sanity checking Andrew Morton
` (25 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: akpm, david, glider, keescook, labbott, linux-mm, mateusznosek0,
mhocko, mm-commits, rafael.j.wysocki, rppt, torvalds, vbabka
From: Vlastimil Babka <vbabka@suse.cz>
Subject: mm, page_poison: use static key more efficiently
Commit 11c9c7edae06 ("mm/page_poison.c: replace bool variable with static
key") changed page_poisoning_enabled() to a static key check. However,
the function is not inlined, so each check still involves a function call
with overhead not eliminated when page poisoning is disabled.
Analogically to how debug_pagealloc is handled, this patch converts
page_poisoning_enabled() back to boolean check, and introduces
page_poisoning_enabled_static() for fast paths. Both functions are
inlined.
The function kernel_poison_pages() is also called unconditionally and does
the static key check inside. Remove it from there and put it to callers.
Also split it to two functions kernel_poison_pages() and
kernel_unpoison_pages() instead of the confusing bool parameter.
Also optimize the check that enables page poisoning instead of
debug_pagealloc for architectures without proper debug_pagealloc support.
Move the check to init_mem_debugging_and_hardening() to enable a single
static key instead of having two static branches in
page_poisoning_enabled_static().
Link: https://lkml.kernel.org/r/20201113104033.22907-3-vbabka@suse.cz
Signed-off-by: Vlastimil Babka <vbabka@suse.cz>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Mike Rapoport <rppt@linux.ibm.com>
Cc: Rafael J. Wysocki <rafael.j.wysocki@intel.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Kees Cook <keescook@chromium.org>
Cc: Laura Abbott <labbott@kernel.org>
Cc: Mateusz Nosek <mateusznosek0@gmail.com>
Cc: Michal Hocko <mhocko@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/virtio/virtio_balloon.c | 2 -
include/linux/mm.h | 33 ++++++++++++++++--
mm/page_alloc.c | 18 ++++++++--
mm/page_poison.c | 53 +++---------------------------
4 files changed, 52 insertions(+), 54 deletions(-)
--- a/drivers/virtio/virtio_balloon.c~mm-page_poison-use-static-key-more-efficiently
+++ a/drivers/virtio/virtio_balloon.c
@@ -1116,7 +1116,7 @@ static int virtballoon_validate(struct v
*/
if (!want_init_on_free() &&
(IS_ENABLED(CONFIG_PAGE_POISONING_NO_SANITY) ||
- !page_poisoning_enabled()))
+ !page_poisoning_enabled_static()))
__virtio_clear_bit(vdev, VIRTIO_BALLOON_F_PAGE_POISON);
else if (!virtio_has_feature(vdev, VIRTIO_BALLOON_F_PAGE_POISON))
__virtio_clear_bit(vdev, VIRTIO_BALLOON_F_REPORTING);
--- a/include/linux/mm.h~mm-page_poison-use-static-key-more-efficiently
+++ a/include/linux/mm.h
@@ -2874,12 +2874,37 @@ extern int apply_to_existing_page_range(
extern void init_mem_debugging_and_hardening(void);
#ifdef CONFIG_PAGE_POISONING
-extern bool page_poisoning_enabled(void);
-extern void kernel_poison_pages(struct page *page, int numpages, int enable);
+extern void __kernel_poison_pages(struct page *page, int numpages);
+extern void __kernel_unpoison_pages(struct page *page, int numpages);
+extern bool _page_poisoning_enabled_early;
+DECLARE_STATIC_KEY_FALSE(_page_poisoning_enabled);
+static inline bool page_poisoning_enabled(void)
+{
+ return _page_poisoning_enabled_early;
+}
+/*
+ * For use in fast paths after init_mem_debugging() has run, or when a
+ * false negative result is not harmful when called too early.
+ */
+static inline bool page_poisoning_enabled_static(void)
+{
+ return static_branch_unlikely(&_page_poisoning_enabled);
+}
+static inline void kernel_poison_pages(struct page *page, int numpages)
+{
+ if (page_poisoning_enabled_static())
+ __kernel_poison_pages(page, numpages);
+}
+static inline void kernel_unpoison_pages(struct page *page, int numpages)
+{
+ if (page_poisoning_enabled_static())
+ __kernel_unpoison_pages(page, numpages);
+}
#else
static inline bool page_poisoning_enabled(void) { return false; }
-static inline void kernel_poison_pages(struct page *page, int numpages,
- int enable) { }
+static inline bool page_poisoning_enabled_static(void) { return false; }
+static inline void kernel_poison_pages(struct page *page, int numpages) { }
+static inline void kernel_unpoison_pages(struct page *page, int numpages) { }
#endif
DECLARE_STATIC_KEY_FALSE(init_on_alloc);
--- a/mm/page_alloc.c~mm-page_poison-use-static-key-more-efficiently
+++ a/mm/page_alloc.c
@@ -777,6 +777,17 @@ void init_mem_debugging_and_hardening(vo
static_branch_enable(&init_on_free);
}
+#ifdef CONFIG_PAGE_POISONING
+ /*
+ * Page poisoning is debug page alloc for some arches. If
+ * either of those options are enabled, enable poisoning.
+ */
+ if (page_poisoning_enabled() ||
+ (!IS_ENABLED(CONFIG_ARCH_SUPPORTS_DEBUG_PAGEALLOC) &&
+ debug_pagealloc_enabled()))
+ static_branch_enable(&_page_poisoning_enabled);
+#endif
+
#ifdef CONFIG_DEBUG_PAGEALLOC
if (!debug_pagealloc_enabled())
return;
@@ -1262,7 +1273,8 @@ static __always_inline bool free_pages_p
if (want_init_on_free())
kernel_init_free_pages(page, 1 << order);
- kernel_poison_pages(page, 1 << order, 0);
+ kernel_poison_pages(page, 1 << order);
+
/*
* arch_free_page() can make the page's contents inaccessible. s390
* does this. So nothing which can access the page's contents should
@@ -2219,7 +2231,7 @@ static inline int check_new_page(struct
static inline bool free_pages_prezeroed(void)
{
return (IS_ENABLED(CONFIG_PAGE_POISONING_ZERO) &&
- page_poisoning_enabled()) || want_init_on_free();
+ page_poisoning_enabled_static()) || want_init_on_free();
}
#ifdef CONFIG_DEBUG_VM
@@ -2281,7 +2293,7 @@ inline void post_alloc_hook(struct page
arch_alloc_page(page, order);
debug_pagealloc_map_pages(page, 1 << order);
kasan_alloc_pages(page, order);
- kernel_poison_pages(page, 1 << order, 1);
+ kernel_unpoison_pages(page, 1 << order);
set_page_owner(page, order, gfp_flags);
if (!free_pages_prezeroed() && want_init_on_alloc(gfp_flags))
--- a/mm/page_poison.c~mm-page_poison-use-static-key-more-efficiently
+++ a/mm/page_poison.c
@@ -8,45 +8,17 @@
#include <linux/ratelimit.h>
#include <linux/kasan.h>
-static DEFINE_STATIC_KEY_FALSE_RO(want_page_poisoning);
+bool _page_poisoning_enabled_early;
+EXPORT_SYMBOL(_page_poisoning_enabled_early);
+DEFINE_STATIC_KEY_FALSE(_page_poisoning_enabled);
+EXPORT_SYMBOL(_page_poisoning_enabled);
static int __init early_page_poison_param(char *buf)
{
- int ret;
- bool tmp;
-
- ret = strtobool(buf, &tmp);
- if (ret)
- return ret;
-
- if (tmp)
- static_branch_enable(&want_page_poisoning);
- else
- static_branch_disable(&want_page_poisoning);
-
- return 0;
+ return kstrtobool(buf, &_page_poisoning_enabled_early);
}
early_param("page_poison", early_page_poison_param);
-/**
- * page_poisoning_enabled - check if page poisoning is enabled
- *
- * Return true if page poisoning is enabled, or false if not.
- */
-bool page_poisoning_enabled(void)
-{
- /*
- * Assumes that debug_pagealloc_enabled is set before
- * memblock_free_all.
- * Page poisoning is debug page alloc for some arches. If
- * either of those options are enabled, enable poisoning.
- */
- return (static_branch_unlikely(&want_page_poisoning) ||
- (!IS_ENABLED(CONFIG_ARCH_SUPPORTS_DEBUG_PAGEALLOC) &&
- debug_pagealloc_enabled()));
-}
-EXPORT_SYMBOL_GPL(page_poisoning_enabled);
-
static void poison_page(struct page *page)
{
void *addr = kmap_atomic(page);
@@ -58,7 +30,7 @@ static void poison_page(struct page *pag
kunmap_atomic(addr);
}
-static void poison_pages(struct page *page, int n)
+void __kernel_poison_pages(struct page *page, int n)
{
int i;
@@ -117,7 +89,7 @@ static void unpoison_page(struct page *p
kunmap_atomic(addr);
}
-static void unpoison_pages(struct page *page, int n)
+void __kernel_unpoison_pages(struct page *page, int n)
{
int i;
@@ -125,17 +97,6 @@ static void unpoison_pages(struct page *
unpoison_page(page + i);
}
-void kernel_poison_pages(struct page *page, int numpages, int enable)
-{
- if (!page_poisoning_enabled())
- return;
-
- if (enable)
- unpoison_pages(page, numpages);
- else
- poison_pages(page, numpages);
-}
-
#ifndef CONFIG_ARCH_SUPPORTS_DEBUG_PAGEALLOC
void __kernel_map_pages(struct page *page, int numpages, int enable)
{
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 176/200] kernel/power: allow hibernation with page_poison sanity checking
2020-12-15 3:02 incoming Andrew Morton
` (174 preceding siblings ...)
2020-12-15 3:13 ` [patch 175/200] mm, page_poison: use static key more efficiently Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:13 ` [patch 177/200] mm, page_poison: remove CONFIG_PAGE_POISONING_NO_SANITY Andrew Morton
` (24 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: akpm, david, glider, keescook, labbott, linux-mm, mateusznosek0,
mhocko, mm-commits, rafael.j.wysocki, rppt, torvalds, vbabka
From: Vlastimil Babka <vbabka@suse.cz>
Subject: kernel/power: allow hibernation with page_poison sanity checking
Page poisoning used to be incompatible with hibernation, as the state of
poisoned pages was lost after resume, thus enabling CONFIG_HIBERNATION
forces CONFIG_PAGE_POISONING_NO_SANITY. For the same reason, the
poisoning with zeroes variant CONFIG_PAGE_POISONING_ZERO used to disable
hibernation. The latter restriction was removed by commit 1ad1410f632d
("PM / Hibernate: allow hibernation with PAGE_POISONING_ZERO") and
similarly for init_on_free by commit 18451f9f9e58 ("PM: hibernate: fix
crashes with init_on_free=1") by making sure free pages are cleared after
resume.
We can use the same mechanism to instead poison free pages with
PAGE_POISON after resume. This covers both zero and 0xAA patterns. Thus
we can remove the Kconfig restriction that disables page poison sanity
checking when hibernation is enabled.
Link: https://lkml.kernel.org/r/20201113104033.22907-4-vbabka@suse.cz
Signed-off-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> [hibernation]
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Mike Rapoport <rppt@linux.ibm.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Kees Cook <keescook@chromium.org>
Cc: Laura Abbott <labbott@kernel.org>
Cc: Mateusz Nosek <mateusznosek0@gmail.com>
Cc: Michal Hocko <mhocko@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/mm.h | 1 +
kernel/power/hibernate.c | 2 +-
kernel/power/power.h | 2 +-
kernel/power/snapshot.c | 14 +++++++++++---
mm/Kconfig.debug | 1 -
5 files changed, 14 insertions(+), 6 deletions(-)
--- a/include/linux/mm.h~kernel-power-allow-hibernation-with-page_poison-sanity-checking
+++ a/include/linux/mm.h
@@ -2903,6 +2903,7 @@ static inline void kernel_unpoison_pages
#else
static inline bool page_poisoning_enabled(void) { return false; }
static inline bool page_poisoning_enabled_static(void) { return false; }
+static inline void __kernel_poison_pages(struct page *page, int nunmpages) { }
static inline void kernel_poison_pages(struct page *page, int numpages) { }
static inline void kernel_unpoison_pages(struct page *page, int numpages) { }
#endif
--- a/kernel/power/hibernate.c~kernel-power-allow-hibernation-with-page_poison-sanity-checking
+++ a/kernel/power/hibernate.c
@@ -326,7 +326,7 @@ static int create_image(int platform_mod
if (!in_suspend) {
events_check_enabled = false;
- clear_free_pages();
+ clear_or_poison_free_pages();
}
platform_leave(platform_mode);
--- a/kernel/power/power.h~kernel-power-allow-hibernation-with-page_poison-sanity-checking
+++ a/kernel/power/power.h
@@ -106,7 +106,7 @@ extern int create_basic_memory_bitmaps(v
extern void free_basic_memory_bitmaps(void);
extern int hibernate_preallocate_memory(void);
-extern void clear_free_pages(void);
+extern void clear_or_poison_free_pages(void);
/**
* Auxiliary structure used for reading the snapshot image data and
--- a/kernel/power/snapshot.c~kernel-power-allow-hibernation-with-page_poison-sanity-checking
+++ a/kernel/power/snapshot.c
@@ -1178,7 +1178,15 @@ void free_basic_memory_bitmaps(void)
pr_debug("Basic memory bitmaps freed\n");
}
-void clear_free_pages(void)
+static void clear_or_poison_free_page(struct page *page)
+{
+ if (page_poisoning_enabled_static())
+ __kernel_poison_pages(page, 1);
+ else if (want_init_on_free())
+ clear_highpage(page);
+}
+
+void clear_or_poison_free_pages(void)
{
struct memory_bitmap *bm = free_pages_map;
unsigned long pfn;
@@ -1186,12 +1194,12 @@ void clear_free_pages(void)
if (WARN_ON(!(free_pages_map)))
return;
- if (IS_ENABLED(CONFIG_PAGE_POISONING_ZERO) || want_init_on_free()) {
+ if (page_poisoning_enabled() || want_init_on_free()) {
memory_bm_position_reset(bm);
pfn = memory_bm_next_pfn(bm);
while (pfn != BM_END_OF_MAP) {
if (pfn_valid(pfn))
- clear_highpage(pfn_to_page(pfn));
+ clear_or_poison_free_page(pfn_to_page(pfn));
pfn = memory_bm_next_pfn(bm);
}
--- a/mm/Kconfig.debug~kernel-power-allow-hibernation-with-page_poison-sanity-checking
+++ a/mm/Kconfig.debug
@@ -64,7 +64,6 @@ config PAGE_OWNER
config PAGE_POISONING
bool "Poison pages after freeing"
- select PAGE_POISONING_NO_SANITY if HIBERNATION
help
Fill the pages with poison patterns after free_pages() and verify
the patterns before alloc_pages. The filling of the memory helps
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 177/200] mm, page_poison: remove CONFIG_PAGE_POISONING_NO_SANITY
2020-12-15 3:02 incoming Andrew Morton
` (175 preceding siblings ...)
2020-12-15 3:13 ` [patch 176/200] kernel/power: allow hibernation with page_poison sanity checking Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:13 ` [patch 178/200] mm, page_poison: remove CONFIG_PAGE_POISONING_ZERO Andrew Morton
` (23 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: akpm, david, glider, keescook, labbott, linux-mm, mateusznosek0,
mhocko, mm-commits, rafael.j.wysocki, rppt, torvalds, vbabka
From: Vlastimil Babka <vbabka@suse.cz>
Subject: mm, page_poison: remove CONFIG_PAGE_POISONING_NO_SANITY
CONFIG_PAGE_POISONING_NO_SANITY skips the check on page alloc whether the
poison pattern was corrupted, suggesting a use-after-free. The motivation
to introduce it in commit 8823b1dbc05f ("mm/page_poison.c: enable
PAGE_POISONING as a separate option") was to simply sanitize freed pages,
optimally together with CONFIG_PAGE_POISONING_ZERO.
These days we have an init_on_free=1 boot option, which makes this use
case of page poisoning redundant. For sanitizing, writing zeroes is
sufficient, there is pretty much no benefit from writing the 0xAA poison
pattern to freed pages, without checking it back on alloc. Thus, remove
this option and suggest init_on_free instead in the main config's help.
Link: https://lkml.kernel.org/r/20201113104033.22907-5-vbabka@suse.cz
Signed-off-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: David Hildenbrand <david@redhat.com>
Cc: Mike Rapoport <rppt@linux.ibm.com>
Cc: Rafael J. Wysocki <rafael.j.wysocki@intel.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Kees Cook <keescook@chromium.org>
Cc: Laura Abbott <labbott@kernel.org>
Cc: Mateusz Nosek <mateusznosek0@gmail.com>
Cc: Michal Hocko <mhocko@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/virtio/virtio_balloon.c | 4 +---
mm/Kconfig.debug | 15 ++++-----------
mm/page_poison.c | 3 ---
3 files changed, 5 insertions(+), 17 deletions(-)
--- a/drivers/virtio/virtio_balloon.c~mm-page_poison-remove-config_page_poisoning_no_sanity
+++ a/drivers/virtio/virtio_balloon.c
@@ -1114,9 +1114,7 @@ static int virtballoon_validate(struct v
* page reporting as it could potentially change the contents
* of our free pages.
*/
- if (!want_init_on_free() &&
- (IS_ENABLED(CONFIG_PAGE_POISONING_NO_SANITY) ||
- !page_poisoning_enabled_static()))
+ if (!want_init_on_free() && !page_poisoning_enabled_static())
__virtio_clear_bit(vdev, VIRTIO_BALLOON_F_PAGE_POISON);
else if (!virtio_has_feature(vdev, VIRTIO_BALLOON_F_PAGE_POISON))
__virtio_clear_bit(vdev, VIRTIO_BALLOON_F_REPORTING);
--- a/mm/Kconfig.debug~mm-page_poison-remove-config_page_poisoning_no_sanity
+++ a/mm/Kconfig.debug
@@ -74,18 +74,11 @@ config PAGE_POISONING
Note that "poison" here is not the same thing as the "HWPoison"
for CONFIG_MEMORY_FAILURE. This is software poisoning only.
- If unsure, say N
-
-config PAGE_POISONING_NO_SANITY
- depends on PAGE_POISONING
- bool "Only poison, don't sanity check"
- help
- Skip the sanity checking on alloc, only fill the pages with
- poison on free. This reduces some of the overhead of the
- poisoning feature.
+ If you are only interested in sanitization of freed pages without
+ checking the poison pattern on alloc, you can boot the kernel with
+ "init_on_free=1" instead of enabling this.
- If you are only interested in sanitization, say Y. Otherwise
- say N.
+ If unsure, say N
config PAGE_POISONING_ZERO
bool "Use zero for poisoning instead of debugging value"
--- a/mm/page_poison.c~mm-page_poison-remove-config_page_poisoning_no_sanity
+++ a/mm/page_poison.c
@@ -51,9 +51,6 @@ static void check_poison_mem(unsigned ch
unsigned char *start;
unsigned char *end;
- if (IS_ENABLED(CONFIG_PAGE_POISONING_NO_SANITY))
- return;
-
start = memchr_inv(mem, PAGE_POISON, bytes);
if (!start)
return;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 178/200] mm, page_poison: remove CONFIG_PAGE_POISONING_ZERO
2020-12-15 3:02 incoming Andrew Morton
` (176 preceding siblings ...)
2020-12-15 3:13 ` [patch 177/200] mm, page_poison: remove CONFIG_PAGE_POISONING_NO_SANITY Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:13 ` [patch 179/200] userfaultfd: add UFFD_USER_MODE_ONLY Andrew Morton
` (22 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: akpm, david, glider, keescook, labbott, linux-mm, mateusznosek0,
mhocko, mm-commits, rafael.j.wysocki, rppt, torvalds, vbabka
From: Vlastimil Babka <vbabka@suse.cz>
Subject: mm, page_poison: remove CONFIG_PAGE_POISONING_ZERO
CONFIG_PAGE_POISONING_ZERO uses the zero pattern instead of 0xAA. It was
introduced by commit 1414c7f4f7d7 ("mm/page_poisoning.c: allow for zero
poisoning"), noting that using zeroes retains the benefit of sanitizing
content of freed pages, with the benefit of not having to zero them again
on alloc, and the downside of making some forms of corruption (stray
writes of NULLs) harder to detect than with the 0xAA pattern. Together
with CONFIG_PAGE_POISONING_NO_SANITY it made possible to sanitize the
contents on free without checking it back on alloc.
These days we have the init_on_free() option to achieve sanitization with
zeroes and to save clearing on alloc (and without checking on alloc).
Arguably if someone does choose to check the poison for corruption on
alloc, the savings of not clearing the page are secondary, and it makes
sense to always use the 0xAA poison pattern. Thus, remove the
CONFIG_PAGE_POISONING_ZERO option for being redundant.
Link: https://lkml.kernel.org/r/20201113104033.22907-6-vbabka@suse.cz
Signed-off-by: Vlastimil Babka <vbabka@suse.cz>
Acked-by: David Hildenbrand <david@redhat.com>
Cc: Mike Rapoport <rppt@linux.ibm.com>
Cc: Rafael J. Wysocki <rafael.j.wysocki@intel.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Kees Cook <keescook@chromium.org>
Cc: Laura Abbott <labbott@kernel.org>
Cc: Mateusz Nosek <mateusznosek0@gmail.com>
Cc: Michal Hocko <mhocko@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
include/linux/poison.h | 4 ----
mm/Kconfig.debug | 12 ------------
mm/page_alloc.c | 8 +-------
tools/include/linux/poison.h | 6 +-----
4 files changed, 2 insertions(+), 28 deletions(-)
--- a/include/linux/poison.h~mm-page_poison-remove-config_page_poisoning_zero
+++ a/include/linux/poison.h
@@ -27,11 +27,7 @@
#define TIMER_ENTRY_STATIC ((void *) 0x300 + POISON_POINTER_DELTA)
/********** mm/page_poison.c **********/
-#ifdef CONFIG_PAGE_POISONING_ZERO
-#define PAGE_POISON 0x00
-#else
#define PAGE_POISON 0xaa
-#endif
/********** mm/page_alloc.c ************/
--- a/mm/Kconfig.debug~mm-page_poison-remove-config_page_poisoning_zero
+++ a/mm/Kconfig.debug
@@ -80,18 +80,6 @@ config PAGE_POISONING
If unsure, say N
-config PAGE_POISONING_ZERO
- bool "Use zero for poisoning instead of debugging value"
- depends on PAGE_POISONING
- help
- Instead of using the existing poison value, fill the pages with
- zeros. This makes it harder to detect when errors are occurring
- due to sanitization but the zeroing at free means that it is
- no longer necessary to write zeros when GFP_ZERO is used on
- allocation.
-
- If unsure, say N
-
config DEBUG_PAGE_REF
bool "Enable tracepoint to track down page reference manipulation"
depends on DEBUG_KERNEL
--- a/mm/page_alloc.c~mm-page_poison-remove-config_page_poisoning_zero
+++ a/mm/page_alloc.c
@@ -2228,12 +2228,6 @@ static inline int check_new_page(struct
return 1;
}
-static inline bool free_pages_prezeroed(void)
-{
- return (IS_ENABLED(CONFIG_PAGE_POISONING_ZERO) &&
- page_poisoning_enabled_static()) || want_init_on_free();
-}
-
#ifdef CONFIG_DEBUG_VM
/*
* With DEBUG_VM enabled, order-0 pages are checked for expected state when
@@ -2296,7 +2290,7 @@ inline void post_alloc_hook(struct page
kernel_unpoison_pages(page, 1 << order);
set_page_owner(page, order, gfp_flags);
- if (!free_pages_prezeroed() && want_init_on_alloc(gfp_flags))
+ if (!want_init_on_free() && want_init_on_alloc(gfp_flags))
kernel_init_free_pages(page, 1 << order);
}
--- a/tools/include/linux/poison.h~mm-page_poison-remove-config_page_poisoning_zero
+++ a/tools/include/linux/poison.h
@@ -35,12 +35,8 @@
*/
#define TIMER_ENTRY_STATIC ((void *) 0x300 + POISON_POINTER_DELTA)
-/********** mm/debug-pagealloc.c **********/
-#ifdef CONFIG_PAGE_POISONING_ZERO
-#define PAGE_POISON 0x00
-#else
+/********** mm/page_poison.c **********/
#define PAGE_POISON 0xaa
-#endif
/********** mm/page_alloc.c ************/
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 179/200] userfaultfd: add UFFD_USER_MODE_ONLY
2020-12-15 3:02 incoming Andrew Morton
` (177 preceding siblings ...)
2020-12-15 3:13 ` [patch 178/200] mm, page_poison: remove CONFIG_PAGE_POISONING_ZERO Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:13 ` [patch 180/200] userfaultfd: add user-mode only option to unprivileged_userfaultfd sysctl knob Andrew Morton
` (21 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: aarcange, akpm, bigeasy, calin, corbet, dancol, dancol, ebiggers,
hannes, jeffv, jglisse, joel, kaleshsingh, keescook, linux-mm,
lokeshgidra, mcgrof, mchehab+huawei, mgorman, mm-commits, nigupta,
peterx, rppt, shli, stephen.smalley.work, surenb, torvalds,
vbabka, viro, yzaikin
From: Lokesh Gidra <lokeshgidra@google.com>
Subject: userfaultfd: add UFFD_USER_MODE_ONLY
Patch series "Control over userfaultfd kernel-fault handling", v6.
This patch series is split from [1]. The other series enables SELinux
support for userfaultfd file descriptors so that its creation and movement
can be controlled.
It has been demonstrated on various occasions that suspending kernel code
execution for an arbitrary amount of time at any access to userspace
memory (copy_from_user()/copy_to_user()/...) can be exploited to change
the intended behavior of the kernel. For instance, handling page faults
in kernel-mode using userfaultfd has been exploited in [2, 3]. Likewise,
FUSE, which is similar to userfaultfd in this respect, has been exploited
in [4, 5] for similar outcome.
This small patch series adds a new flag to userfaultfd(2) that allows
callers to give up the ability to handle kernel-mode faults with the
resulting UFFD file object. It then adds a 'user-mode only' option to the
unprivileged_userfaultfd sysctl knob to require unprivileged callers to
use this new flag.
The purpose of this new interface is to decrease the chance of an
unprivileged userfaultfd user taking advantage of userfaultfd to enhance
security vulnerabilities by lengthening the race window in kernel code.
[1] https://lore.kernel.org/lkml/20200211225547.235083-1-dancol@google.com/
[2] https://duasynt.com/blog/linux-kernel-heap-spray
[3] https://duasynt.com/blog/cve-2016-6187-heap-off-by-one-exploit
[4] https://googleprojectzero.blogspot.com/2016/06/exploiting-recursion-in-linux-kernel_20.html
[5] https://bugs.chromium.org/p/project-zero/issues/detail?id=808
This patch (of 2):
userfaultfd handles page faults from both user and kernel code. Add a new
UFFD_USER_MODE_ONLY flag for userfaultfd(2) that makes the resulting
userfaultfd object refuse to handle faults from kernel mode, treating
these faults as if SIGBUS were always raised, causing the kernel code to
fail with EFAULT.
A future patch adds a knob allowing administrators to give some processes
the ability to create userfaultfd file objects only if they pass
UFFD_USER_MODE_ONLY, reducing the likelihood that these processes will
exploit userfaultfd's ability to delay kernel page faults to open timing
windows for future exploits.
Link: https://lkml.kernel.org/r/20201120030411.2690816-1-lokeshgidra@google.com
Link: https://lkml.kernel.org/r/20201120030411.2690816-2-lokeshgidra@google.com
Signed-off-by: Daniel Colascione <dancol@google.com>
Signed-off-by: Lokesh Gidra <lokeshgidra@google.com>
Reviewed-by: Andrea Arcangeli <aarcange@redhat.com>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: <calin@google.com>
Cc: Daniel Colascione <dancol@dancol.org>
Cc: Eric Biggers <ebiggers@kernel.org>
Cc: Iurii Zaikin <yzaikin@google.com>
Cc: Jeff Vander Stoep <jeffv@google.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: "Joel Fernandes (Google)" <joel@joelfernandes.org>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Kalesh Singh <kaleshsingh@google.com>
Cc: Kees Cook <keescook@chromium.org>
Cc: Luis Chamberlain <mcgrof@kernel.org>
Cc: Mauro Carvalho Chehab <mchehab+huawei@kernel.org>
Cc: Mel Gorman <mgorman@techsingularity.net>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Nitin Gupta <nigupta@nvidia.com>
Cc: Peter Xu <peterx@redhat.com>
Cc: Sebastian Andrzej Siewior <bigeasy@linutronix.de>
Cc: Shaohua Li <shli@fb.com>
Cc: Stephen Smalley <stephen.smalley.work@gmail.com>
Cc: Suren Baghdasaryan <surenb@google.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
fs/userfaultfd.c | 10 +++++++++-
include/uapi/linux/userfaultfd.h | 9 +++++++++
2 files changed, 18 insertions(+), 1 deletion(-)
--- a/fs/userfaultfd.c~add-uffd_user_mode_only
+++ a/fs/userfaultfd.c
@@ -405,6 +405,13 @@ vm_fault_t handle_userfault(struct vm_fa
if (ctx->features & UFFD_FEATURE_SIGBUS)
goto out;
+ if ((vmf->flags & FAULT_FLAG_USER) == 0 &&
+ ctx->flags & UFFD_USER_MODE_ONLY) {
+ printk_once(KERN_WARNING "uffd: Set unprivileged_userfaultfd "
+ "sysctl knob to 1 if kernel faults must be handled "
+ "without obtaining CAP_SYS_PTRACE capability\n");
+ goto out;
+ }
/*
* If it's already released don't get it. This avoids to loop
@@ -1965,10 +1972,11 @@ SYSCALL_DEFINE1(userfaultfd, int, flags)
BUG_ON(!current->mm);
/* Check the UFFD_* constants for consistency. */
+ BUILD_BUG_ON(UFFD_USER_MODE_ONLY & UFFD_SHARED_FCNTL_FLAGS);
BUILD_BUG_ON(UFFD_CLOEXEC != O_CLOEXEC);
BUILD_BUG_ON(UFFD_NONBLOCK != O_NONBLOCK);
- if (flags & ~UFFD_SHARED_FCNTL_FLAGS)
+ if (flags & ~(UFFD_SHARED_FCNTL_FLAGS | UFFD_USER_MODE_ONLY))
return -EINVAL;
ctx = kmem_cache_alloc(userfaultfd_ctx_cachep, GFP_KERNEL);
--- a/include/uapi/linux/userfaultfd.h~add-uffd_user_mode_only
+++ a/include/uapi/linux/userfaultfd.h
@@ -257,4 +257,13 @@ struct uffdio_writeprotect {
__u64 mode;
};
+/*
+ * Flags for the userfaultfd(2) system call itself.
+ */
+
+/*
+ * Create a userfaultfd that can handle page faults only in user mode.
+ */
+#define UFFD_USER_MODE_ONLY 1
+
#endif /* _LINUX_USERFAULTFD_H */
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 180/200] userfaultfd: add user-mode only option to unprivileged_userfaultfd sysctl knob
2020-12-15 3:02 incoming Andrew Morton
` (178 preceding siblings ...)
2020-12-15 3:13 ` [patch 179/200] userfaultfd: add UFFD_USER_MODE_ONLY Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:13 ` [patch 181/200] userfaultfd: selftests: make __{s,u}64 format specifiers portable Andrew Morton
` (20 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: aarcange, akpm, bigeasy, calin, corbet, dancol, dancol, ebiggers,
hannes, jeffv, jglisse, joel, kaleshsingh, keescook, linux-mm,
lokeshgidra, mcgrof, mchehab+huawei, mgorman, mm-commits, nigupta,
peterx, rppt, shli, stephen.smalley.work, surenb, torvalds,
vbabka, viro, yzaikin
From: Lokesh Gidra <lokeshgidra@google.com>
Subject: userfaultfd: add user-mode only option to unprivileged_userfaultfd sysctl knob
With this change, when the knob is set to 0, it allows unprivileged users
to call userfaultfd, like when it is set to 1, but with the restriction
that page faults from only user-mode can be handled. In this mode, an
unprivileged user (without SYS_CAP_PTRACE capability) must pass
UFFD_USER_MODE_ONLY to userfaultd or the API will fail with EPERM.
This enables administrators to reduce the likelihood that an attacker with
access to userfaultfd can delay faulting kernel code to widen timing
windows for other exploits.
The default value of this knob is changed to 0. This is required for
correct functioning of pipe mutex. However, this will fail postcopy live
migration, which will be unnoticeable to the VM guests. To avoid this,
set 'vm.userfault = 1' in /sys/sysctl.conf.
The main reason this change is desirable as in the short term is that the
Android userland will behave as with the sysctl set to zero. So without
this commit, any Linux binary using userfaultfd to manage its memory would
behave differently if run within the Android userland. For more details,
refer to Andrea's reply [1].
[1] https://lore.kernel.org/lkml/20200904033438.GI9411@redhat.com/
Link: https://lkml.kernel.org/r/20201120030411.2690816-3-lokeshgidra@google.com
Signed-off-by: Lokesh Gidra <lokeshgidra@google.com>
Reviewed-by: Andrea Arcangeli <aarcange@redhat.com>
Cc: Kees Cook <keescook@chromium.org>
Cc: Jonathan Corbet <corbet@lwn.net>
Cc: Peter Xu <peterx@redhat.com>
Cc: Sebastian Andrzej Siewior <bigeasy@linutronix.de>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Stephen Smalley <stephen.smalley.work@gmail.com>
Cc: Eric Biggers <ebiggers@kernel.org>
Cc: Daniel Colascione <dancol@dancol.org>
Cc: "Joel Fernandes (Google)" <joel@joelfernandes.org>
Cc: Kalesh Singh <kaleshsingh@google.com>
Cc: Suren Baghdasaryan <surenb@google.com>
Cc: Jeff Vander Stoep <jeffv@google.com>
Cc: <calin@google.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Shaohua Li <shli@fb.com>
Cc: Jerome Glisse <jglisse@redhat.com>
Cc: Mauro Carvalho Chehab <mchehab+huawei@kernel.org>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Mel Gorman <mgorman@techsingularity.net>
Cc: Nitin Gupta <nigupta@nvidia.com>
Cc: Vlastimil Babka <vbabka@suse.cz>
Cc: Iurii Zaikin <yzaikin@google.com>
Cc: Luis Chamberlain <mcgrof@kernel.org>
Cc: Daniel Colascione <dancol@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/admin-guide/sysctl/vm.rst | 15 ++++++++++-----
fs/userfaultfd.c | 10 ++++++++--
2 files changed, 18 insertions(+), 7 deletions(-)
--- a/Documentation/admin-guide/sysctl/vm.rst~add-user-mode-only-option-to-unprivileged_userfaultfd-sysctl-knob
+++ a/Documentation/admin-guide/sysctl/vm.rst
@@ -873,12 +873,17 @@ file-backed pages is less than the high
unprivileged_userfaultfd
========================
-This flag controls whether unprivileged users can use the userfaultfd
-system calls. Set this to 1 to allow unprivileged users to use the
-userfaultfd system calls, or set this to 0 to restrict userfaultfd to only
-privileged users (with SYS_CAP_PTRACE capability).
+This flag controls the mode in which unprivileged users can use the
+userfaultfd system calls. Set this to 0 to restrict unprivileged users
+to handle page faults in user mode only. In this case, users without
+SYS_CAP_PTRACE must pass UFFD_USER_MODE_ONLY in order for userfaultfd to
+succeed. Prohibiting use of userfaultfd for handling faults from kernel
+mode may make certain vulnerabilities more difficult to exploit.
-The default value is 1.
+Set this to 1 to allow unprivileged users to use the userfaultfd system
+calls without any restrictions.
+
+The default value is 0.
user_reserve_kbytes
--- a/fs/userfaultfd.c~add-user-mode-only-option-to-unprivileged_userfaultfd-sysctl-knob
+++ a/fs/userfaultfd.c
@@ -28,7 +28,7 @@
#include <linux/security.h>
#include <linux/hugetlb.h>
-int sysctl_unprivileged_userfaultfd __read_mostly = 1;
+int sysctl_unprivileged_userfaultfd __read_mostly;
static struct kmem_cache *userfaultfd_ctx_cachep __read_mostly;
@@ -1966,8 +1966,14 @@ SYSCALL_DEFINE1(userfaultfd, int, flags)
struct userfaultfd_ctx *ctx;
int fd;
- if (!sysctl_unprivileged_userfaultfd && !capable(CAP_SYS_PTRACE))
+ if (!sysctl_unprivileged_userfaultfd &&
+ (flags & UFFD_USER_MODE_ONLY) == 0 &&
+ !capable(CAP_SYS_PTRACE)) {
+ printk_once(KERN_WARNING "uffd: Set unprivileged_userfaultfd "
+ "sysctl knob to 1 if kernel faults must be handled "
+ "without obtaining CAP_SYS_PTRACE capability\n");
return -EPERM;
+ }
BUG_ON(!current->mm);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 181/200] userfaultfd: selftests: make __{s,u}64 format specifiers portable
2020-12-15 3:02 incoming Andrew Morton
` (179 preceding siblings ...)
2020-12-15 3:13 ` [patch 180/200] userfaultfd: add user-mode only option to unprivileged_userfaultfd sysctl knob Andrew Morton
@ 2020-12-15 3:13 ` Andrew Morton
2020-12-15 3:14 ` [patch 182/200] userfaultfd/selftests: always dump something in modes Andrew Morton
` (19 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:13 UTC (permalink / raw)
To: aarcange, akpm, axelrasmussen, dgilbert, gthelen, joe, linux-mm,
mm-commits, peterx, rppt, shuah, torvalds
From: Axel Rasmussen <axelrasmussen@google.com>
Subject: userfaultfd: selftests: make __{s,u}64 format specifiers portable
On certain platforms (powerpcle is the one on which I ran into this),
"%Ld" and "%Lu" are unsuitable for printing __s64 and __u64, respectively,
resulting in build warnings. Cast to {u,}int64_t, and use the PRI{d,u}64
macros defined in inttypes.h to print them. This ought to be portable to
all platforms.
Splitting this off into a separate macro lets us remove some lines, and
get rid of some (I would argue) stylistically odd cases where we joined
printf() and exit() into a single statement with a ,.
Finally, this also fixes a "missing braces around initializer" warning
when we initialize prms in wp_range().
[axelrasmussen@google.com: v2]
Link: https://lkml.kernel.org/r/20201203180244.1811601-1-axelrasmussen@google.com
Link: https://lkml.kernel.org/r/20201202211542.1121189-1-axelrasmussen@google.com
Signed-off-by: Axel Rasmussen <axelrasmussen@google.com>
Acked-by: Peter Xu <peterx@redhat.com>
Cc: Shuah Khan <shuah@kernel.org>
Cc: Joe Perches <joe@perches.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: David Alan Gilbert <dgilbert@redhat.com>
Cc: Greg Thelen <gthelen@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
tools/testing/selftests/vm/userfaultfd.c | 81 +++++++++------------
1 file changed, 35 insertions(+), 46 deletions(-)
--- a/tools/testing/selftests/vm/userfaultfd.c~userfaultfd-selftests-make-__su64-format-specifiers-portable
+++ a/tools/testing/selftests/vm/userfaultfd.c
@@ -55,6 +55,8 @@
#include <setjmp.h>
#include <stdbool.h>
#include <assert.h>
+#include <inttypes.h>
+#include <stdint.h>
#include "../kselftest.h"
@@ -135,6 +137,13 @@ static void usage(void)
exit(1);
}
+#define uffd_error(code, fmt, ...) \
+ do { \
+ fprintf(stderr, fmt, ##__VA_ARGS__); \
+ fprintf(stderr, ": %" PRId64 "\n", (int64_t)(code)); \
+ exit(1); \
+ } while (0)
+
static void uffd_stats_reset(struct uffd_stats *uffd_stats,
unsigned long n_cpus)
{
@@ -338,7 +347,7 @@ static int my_bcmp(char *str1, char *str
static void wp_range(int ufd, __u64 start, __u64 len, bool wp)
{
- struct uffdio_writeprotect prms = { 0 };
+ struct uffdio_writeprotect prms;
/* Write protection page faults */
prms.range.start = start;
@@ -347,7 +356,8 @@ static void wp_range(int ufd, __u64 star
prms.mode = wp ? UFFDIO_WRITEPROTECT_MODE_WP : 0;
if (ioctl(ufd, UFFDIO_WRITEPROTECT, &prms)) {
- fprintf(stderr, "clear WP failed for address 0x%Lx\n", start);
+ fprintf(stderr, "clear WP failed for address 0x%" PRIx64 "\n",
+ (uint64_t)start);
exit(1);
}
}
@@ -481,14 +491,11 @@ static void retry_copy_page(int ufd, str
if (ioctl(ufd, UFFDIO_COPY, uffdio_copy)) {
/* real retval in ufdio_copy.copy */
if (uffdio_copy->copy != -EEXIST) {
- fprintf(stderr, "UFFDIO_COPY retry error %Ld\n",
- uffdio_copy->copy);
- exit(1);
+ uffd_error(uffdio_copy->copy,
+ "UFFDIO_COPY retry error");
}
- } else {
- fprintf(stderr, "UFFDIO_COPY retry unexpected %Ld\n",
- uffdio_copy->copy); exit(1);
- }
+ } else
+ uffd_error(uffdio_copy->copy, "UFFDIO_COPY retry unexpected");
}
static int __copy_page(int ufd, unsigned long offset, bool retry)
@@ -509,14 +516,10 @@ static int __copy_page(int ufd, unsigned
uffdio_copy.copy = 0;
if (ioctl(ufd, UFFDIO_COPY, &uffdio_copy)) {
/* real retval in ufdio_copy.copy */
- if (uffdio_copy.copy != -EEXIST) {
- fprintf(stderr, "UFFDIO_COPY error %Ld\n",
- uffdio_copy.copy);
- exit(1);
- }
+ if (uffdio_copy.copy != -EEXIST)
+ uffd_error(uffdio_copy.copy, "UFFDIO_COPY error");
} else if (uffdio_copy.copy != page_size) {
- fprintf(stderr, "UFFDIO_COPY unexpected copy %Ld\n",
- uffdio_copy.copy); exit(1);
+ uffd_error(uffdio_copy.copy, "UFFDIO_COPY unexpected copy");
} else {
if (test_uffdio_copy_eexist && retry) {
test_uffdio_copy_eexist = false;
@@ -795,7 +798,8 @@ static int userfaultfd_open(int features
return 1;
}
if (uffdio_api.api != UFFD_API) {
- fprintf(stderr, "UFFDIO_API error %Lu\n", uffdio_api.api);
+ fprintf(stderr, "UFFDIO_API error: %" PRIu64 "\n",
+ (uint64_t)uffdio_api.api);
return 1;
}
@@ -957,13 +961,12 @@ static void retry_uffdio_zeropage(int uf
offset);
if (ioctl(ufd, UFFDIO_ZEROPAGE, uffdio_zeropage)) {
if (uffdio_zeropage->zeropage != -EEXIST) {
- fprintf(stderr, "UFFDIO_ZEROPAGE retry error %Ld\n",
- uffdio_zeropage->zeropage);
- exit(1);
+ uffd_error(uffdio_zeropage->zeropage,
+ "UFFDIO_ZEROPAGE retry error");
}
} else {
- fprintf(stderr, "UFFDIO_ZEROPAGE retry unexpected %Ld\n",
- uffdio_zeropage->zeropage); exit(1);
+ uffd_error(uffdio_zeropage->zeropage,
+ "UFFDIO_ZEROPAGE retry unexpected");
}
}
@@ -972,6 +975,7 @@ static int __uffdio_zeropage(int ufd, un
struct uffdio_zeropage uffdio_zeropage;
int ret;
unsigned long has_zeropage;
+ __s64 res;
has_zeropage = uffd_test_ops->expected_ioctls & (1 << _UFFDIO_ZEROPAGE);
@@ -983,29 +987,17 @@ static int __uffdio_zeropage(int ufd, un
uffdio_zeropage.range.len = page_size;
uffdio_zeropage.mode = 0;
ret = ioctl(ufd, UFFDIO_ZEROPAGE, &uffdio_zeropage);
+ res = uffdio_zeropage.zeropage;
if (ret) {
/* real retval in ufdio_zeropage.zeropage */
if (has_zeropage) {
- if (uffdio_zeropage.zeropage == -EEXIST) {
- fprintf(stderr, "UFFDIO_ZEROPAGE -EEXIST\n");
- exit(1);
- } else {
- fprintf(stderr, "UFFDIO_ZEROPAGE error %Ld\n",
- uffdio_zeropage.zeropage);
- exit(1);
- }
- } else {
- if (uffdio_zeropage.zeropage != -EINVAL) {
- fprintf(stderr,
- "UFFDIO_ZEROPAGE not -EINVAL %Ld\n",
- uffdio_zeropage.zeropage);
- exit(1);
- }
- }
+ uffd_error(res, "UFFDIO_ZEROPAGE %s",
+ res == -EEXIST ? "-EEXIST" : "error");
+ } else if (res != -EINVAL)
+ uffd_error(res, "UFFDIO_ZEROPAGE not -EINVAL");
} else if (has_zeropage) {
- if (uffdio_zeropage.zeropage != page_size) {
- fprintf(stderr, "UFFDIO_ZEROPAGE unexpected %Ld\n",
- uffdio_zeropage.zeropage); exit(1);
+ if (res != page_size) {
+ uffd_error(res, "UFFDIO_ZEROPAGE unexpected");
} else {
if (test_uffdio_zeropage_eexist && retry) {
test_uffdio_zeropage_eexist = false;
@@ -1014,11 +1006,8 @@ static int __uffdio_zeropage(int ufd, un
}
return 1;
}
- } else {
- fprintf(stderr,
- "UFFDIO_ZEROPAGE succeeded %Ld\n",
- uffdio_zeropage.zeropage); exit(1);
- }
+ } else
+ uffd_error(res, "UFFDIO_ZEROPAGE succeeded");
return 0;
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 182/200] userfaultfd/selftests: always dump something in modes
2020-12-15 3:02 incoming Andrew Morton
` (180 preceding siblings ...)
2020-12-15 3:13 ` [patch 181/200] userfaultfd: selftests: make __{s,u}64 format specifiers portable Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 183/200] userfaultfd/selftests: fix retval check for userfaultfd_open() Andrew Morton
` (18 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: aarcange, akpm, linux-mm, mm-commits, peterx, rppt, torvalds
From: Peter Xu <peterx@redhat.com>
Subject: userfaultfd/selftests: always dump something in modes
Patch series "userfaultfd: selftests: Small fixes".
Some very trivial fixes that I kept locally to userfaultfd selftest
program.
This patch (of 3):
BOUNCE_POLL is a special bit that if cleared it means "READ" instead.
Dump that too otherwise we'll see tests with empty modes.
Link: https://lkml.kernel.org/r/20201208024709.7701-1-peterx@redhat.com
Link: https://lkml.kernel.org/r/20201208024709.7701-2-peterx@redhat.com
Signed-off-by: Peter Xu <peterx@redhat.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
tools/testing/selftests/vm/userfaultfd.c | 2 ++
1 file changed, 2 insertions(+)
--- a/tools/testing/selftests/vm/userfaultfd.c~userfaultfd-selftests-always-dump-something-in-modes
+++ a/tools/testing/selftests/vm/userfaultfd.c
@@ -1291,6 +1291,8 @@ static int userfaultfd_stress(void)
printf(" ver");
if (bounces & BOUNCE_POLL)
printf(" poll");
+ else
+ printf(" read");
printf(", ");
fflush(stdout);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 183/200] userfaultfd/selftests: fix retval check for userfaultfd_open()
2020-12-15 3:02 incoming Andrew Morton
` (181 preceding siblings ...)
2020-12-15 3:14 ` [patch 182/200] userfaultfd/selftests: always dump something in modes Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 184/200] userfaultfd/selftests: hint the test runner on required privilege Andrew Morton
` (17 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: aarcange, akpm, linux-mm, mm-commits, peterx, rppt, torvalds
From: Peter Xu <peterx@redhat.com>
Subject: userfaultfd/selftests: fix retval check for userfaultfd_open()
userfaultfd_open() returns 1 for errors rather than negatives. Fix it on
all the callers so when UFFDIO_API failed the test will bail out.
Link: https://lkml.kernel.org/r/20201208024709.7701-3-peterx@redhat.com
Signed-off-by: Peter Xu <peterx@redhat.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
tools/testing/selftests/vm/userfaultfd.c | 8 ++++----
1 file changed, 4 insertions(+), 4 deletions(-)
--- a/tools/testing/selftests/vm/userfaultfd.c~userfaultfd-selftests-fix-retval-check-for-userfaultfd_open
+++ a/tools/testing/selftests/vm/userfaultfd.c
@@ -1029,7 +1029,7 @@ static int userfaultfd_zeropage_test(voi
if (uffd_test_ops->release_pages(area_dst))
return 1;
- if (userfaultfd_open(0) < 0)
+ if (userfaultfd_open(0))
return 1;
uffdio_register.range.start = (unsigned long) area_dst;
uffdio_register.range.len = nr_pages * page_size;
@@ -1079,7 +1079,7 @@ static int userfaultfd_events_test(void)
features = UFFD_FEATURE_EVENT_FORK | UFFD_FEATURE_EVENT_REMAP |
UFFD_FEATURE_EVENT_REMOVE;
- if (userfaultfd_open(features) < 0)
+ if (userfaultfd_open(features))
return 1;
fcntl(uffd, F_SETFL, uffd_flags | O_NONBLOCK);
@@ -1151,7 +1151,7 @@ static int userfaultfd_sig_test(void)
return 1;
features = UFFD_FEATURE_EVENT_FORK|UFFD_FEATURE_SIGBUS;
- if (userfaultfd_open(features) < 0)
+ if (userfaultfd_open(features))
return 1;
fcntl(uffd, F_SETFL, uffd_flags | O_NONBLOCK);
@@ -1231,7 +1231,7 @@ static int userfaultfd_stress(void)
if (!area_dst)
return 1;
- if (userfaultfd_open(0) < 0)
+ if (userfaultfd_open(0))
return 1;
count_verify = malloc(nr_pages * sizeof(unsigned long long));
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 184/200] userfaultfd/selftests: hint the test runner on required privilege
2020-12-15 3:02 incoming Andrew Morton
` (182 preceding siblings ...)
2020-12-15 3:14 ` [patch 183/200] userfaultfd/selftests: fix retval check for userfaultfd_open() Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 185/200] mm/zswap: make struct kernel_param_ops definitions const Andrew Morton
` (16 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: aarcange, akpm, linux-mm, mm-commits, peterx, rppt, torvalds
From: Peter Xu <peterx@redhat.com>
Subject: userfaultfd/selftests: hint the test runner on required privilege
Now userfaultfd test program requires either root or ptrace privilege due
to the signal/event tests. When UFFDIO_API failed, hint the test runner
about this fact verbosely.
Link: https://lkml.kernel.org/r/20201208024709.7701-4-peterx@redhat.com
Signed-off-by: Peter Xu <peterx@redhat.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Mike Rapoport <rppt@linux.vnet.ibm.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
tools/testing/selftests/vm/userfaultfd.c | 3 ++-
1 file changed, 2 insertions(+), 1 deletion(-)
--- a/tools/testing/selftests/vm/userfaultfd.c~userfaultfd-selftests-hint-the-test-runner-on-required-privilege
+++ a/tools/testing/selftests/vm/userfaultfd.c
@@ -794,7 +794,8 @@ static int userfaultfd_open(int features
uffdio_api.api = UFFD_API;
uffdio_api.features = features;
if (ioctl(uffd, UFFDIO_API, &uffdio_api)) {
- fprintf(stderr, "UFFDIO_API\n");
+ fprintf(stderr, "UFFDIO_API failed.\nPlease make sure to "
+ "run with either root or ptrace capability.\n");
return 1;
}
if (uffdio_api.api != UFFD_API) {
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 185/200] mm/zswap: make struct kernel_param_ops definitions const
2020-12-15 3:02 incoming Andrew Morton
` (183 preceding siblings ...)
2020-12-15 3:14 ` [patch 184/200] userfaultfd/selftests: hint the test runner on required privilege Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 186/200] mm/zswap: fix passing zero to 'PTR_ERR' warning Andrew Morton
` (15 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: akpm, dan.carpenter, ddstreet, joe, linux-mm, mail, mm-commits,
sjenning, torvalds, vitaly.wool
From: Joe Perches <joe@perches.com>
Subject: mm/zswap: make struct kernel_param_ops definitions const
These should be const, so make it so.
Link: https://lkml.kernel.org/r/1791535ee0b00f4a5c68cc4a8adada06593ad8f1.1601770305.git.joe@perches.com
Signed-off-by: Joe Perches <joe@perches.com>
Cc: Seth Jennings <sjenning@redhat.com>
Cc: Dan Streetman <ddstreet@ieee.org>
Cc: Vitaly Wool <vitaly.wool@konsulko.com>
Cc: "Maciej S. Szmigiero" <mail@maciej.szmigiero.name>
Cc: Dan Carpenter <dan.carpenter@oracle.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/zswap.c | 6 +++---
1 file changed, 3 insertions(+), 3 deletions(-)
--- a/mm/zswap.c~mm-zswap-make-struct-kernel_param_ops-definitions-const
+++ a/mm/zswap.c
@@ -81,7 +81,7 @@ static bool zswap_pool_reached_full;
static bool zswap_enabled = IS_ENABLED(CONFIG_ZSWAP_DEFAULT_ON);
static int zswap_enabled_param_set(const char *,
const struct kernel_param *);
-static struct kernel_param_ops zswap_enabled_param_ops = {
+static const struct kernel_param_ops zswap_enabled_param_ops = {
.set = zswap_enabled_param_set,
.get = param_get_bool,
};
@@ -91,7 +91,7 @@ module_param_cb(enabled, &zswap_enabled_
static char *zswap_compressor = CONFIG_ZSWAP_COMPRESSOR_DEFAULT;
static int zswap_compressor_param_set(const char *,
const struct kernel_param *);
-static struct kernel_param_ops zswap_compressor_param_ops = {
+static const struct kernel_param_ops zswap_compressor_param_ops = {
.set = zswap_compressor_param_set,
.get = param_get_charp,
.free = param_free_charp,
@@ -102,7 +102,7 @@ module_param_cb(compressor, &zswap_compr
/* Compressed storage zpool to use */
static char *zswap_zpool_type = CONFIG_ZSWAP_ZPOOL_DEFAULT;
static int zswap_zpool_param_set(const char *, const struct kernel_param *);
-static struct kernel_param_ops zswap_zpool_param_ops = {
+static const struct kernel_param_ops zswap_zpool_param_ops = {
.set = zswap_zpool_param_set,
.get = param_get_charp,
.free = param_free_charp,
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 186/200] mm/zswap: fix passing zero to 'PTR_ERR' warning
2020-12-15 3:02 incoming Andrew Morton
` (184 preceding siblings ...)
2020-12-15 3:14 ` [patch 185/200] mm/zswap: make struct kernel_param_ops definitions const Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 187/200] mm/zswap: move to use crypto_acomp API for hardware acceleration Andrew Morton
` (14 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: akpm, david, ddstreet, linux-mm, mm-commits, sjenning, torvalds,
vitaly.wool, yuehaibing
From: YueHaibing <yuehaibing@huawei.com>
Subject: mm/zswap: fix passing zero to 'PTR_ERR' warning
Fix smatch warning:
mm/zswap.c:425 zswap_cpu_comp_prepare() warn: passing zero to 'PTR_ERR'
crypto_alloc_comp() never return NULL, use IS_ERR instead of
IS_ERR_OR_NULL to fix this.
Link: https://lkml.kernel.org/r/20201031055615.28080-1-yuehaibing@huawei.com
Fixes: f1c54846ee45 ("zswap: dynamic pool creation")
Signed-off-by: YueHaibing <yuehaibing@huawei.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Cc: Seth Jennings <sjenning@redhat.com>
Cc: Dan Streetman <ddstreet@ieee.org>
Cc: Vitaly Wool <vitaly.wool@konsulko.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/zswap.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/zswap.c~mm-zswap-fix-passing-zero-to-ptr_err-warning
+++ a/mm/zswap.c
@@ -421,7 +421,7 @@ static int zswap_cpu_comp_prepare(unsign
return 0;
tfm = crypto_alloc_comp(pool->tfm_name, 0, 0);
- if (IS_ERR_OR_NULL(tfm)) {
+ if (IS_ERR(tfm)) {
pr_err("could not alloc crypto comp %s : %ld\n",
pool->tfm_name, PTR_ERR(tfm));
return -ENOMEM;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 187/200] mm/zswap: move to use crypto_acomp API for hardware acceleration
2020-12-15 3:02 incoming Andrew Morton
` (185 preceding siblings ...)
2020-12-15 3:14 ` [patch 186/200] mm/zswap: fix passing zero to 'PTR_ERR' warning Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 188/200] mm/zsmalloc.c: rework the list_add code in insert_zspage() Andrew Morton
` (13 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: akpm, bigeasy, colin.king, davem, ddstreet, herbert, lgoncalv,
linux-mm, mahipalreddy2006, mm-commits, sjenning, song.bao.hua,
torvalds, vitalywool, wangzhou1
From: Barry Song <song.bao.hua@hisilicon.com>
Subject: mm/zswap: move to use crypto_acomp API for hardware acceleration
Right now, all new ZIP drivers are adapted to crypto_acomp APIs rather
than legacy crypto_comp APIs. Tradiontal ZIP drivers like lz4,lzo etc
have been also wrapped into acomp via scomp backend. But zswap.c is still
using the old APIs. That means zswap won't be able to work on any new ZIP
drivers in kernel.
This patch moves to use cryto_acomp APIs to fix the disconnected bridge
between new ZIP drivers and zswap. It is probably the first real user to
use acomp but perhaps not a good example to demonstrate how multiple acomp
requests can be executed in parallel in one acomp instance. frontswap is
doing page load and store page by page synchronously. swap_writepage()
depends on the completion of frontswap_store() to decide if it should call
__swap_writepage() to swap to disk.
However this patch creates multiple acomp instances, so multiple threads
running on multiple different cpus can actually do (de)compression
parallelly, leveraging the power of multiple ZIP hardware queues. This is
also consistent with frontswap's page management model.
The old zswap code uses atomic context and avoids the race conditions
while shared resources like zswap_dstmem are accessed. Here since acomp
can sleep, per-cpu mutex is used to replace preemption-disable.
While it is possible to make mm/page_io.c and mm/frontswap.c support async
(de)compression in some way, the entire design requires careful thinking
and performance evaluation. For the first step, the base with fixed
connection between ZIP drivers and zswap should be built.
Link: https://lkml.kernel.org/r/20201107065332.26992-1-song.bao.hua@hisilicon.com
Signed-off-by: Barry Song <song.bao.hua@hisilicon.com>
Acked-by: Vitaly Wool <vitalywool@gmail.com>
Cc: Luis Claudio R. Goncalves <lgoncalv@redhat.com>
Cc: Sebastian Andrzej Siewior <bigeasy@linutronix.de>
Cc: Herbert Xu <herbert@gondor.apana.org.au>
Cc: David S. Miller <davem@davemloft.net>
Cc: Mahipal Challa <mahipalreddy2006@gmail.com>
Cc: Seth Jennings <sjenning@redhat.com>
Cc: Dan Streetman <ddstreet@ieee.org>
Cc: Zhou Wang <wangzhou1@hisilicon.com>
Cc: Colin Ian King <colin.king@canonical.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/zswap.c | 185 ++++++++++++++++++++++++++++++++++++++-------------
1 file changed, 138 insertions(+), 47 deletions(-)
--- a/mm/zswap.c~mm-zswap-move-to-use-crypto_acomp-api-for-hardware-acceleration
+++ a/mm/zswap.c
@@ -24,8 +24,10 @@
#include <linux/rbtree.h>
#include <linux/swap.h>
#include <linux/crypto.h>
+#include <linux/scatterlist.h>
#include <linux/mempool.h>
#include <linux/zpool.h>
+#include <crypto/acompress.h>
#include <linux/mm_types.h>
#include <linux/page-flags.h>
@@ -127,9 +129,17 @@ module_param_named(same_filled_pages_ena
* data structures
**********************************/
+struct crypto_acomp_ctx {
+ struct crypto_acomp *acomp;
+ struct acomp_req *req;
+ struct crypto_wait wait;
+ u8 *dstmem;
+ struct mutex *mutex;
+};
+
struct zswap_pool {
struct zpool *zpool;
- struct crypto_comp * __percpu *tfm;
+ struct crypto_acomp_ctx __percpu *acomp_ctx;
struct kref kref;
struct list_head list;
struct work_struct release_work;
@@ -388,23 +398,43 @@ static struct zswap_entry *zswap_entry_f
* per-cpu code
**********************************/
static DEFINE_PER_CPU(u8 *, zswap_dstmem);
+/*
+ * If users dynamically change the zpool type and compressor at runtime, i.e.
+ * zswap is running, zswap can have more than one zpool on one cpu, but they
+ * are sharing dtsmem. So we need this mutex to be per-cpu.
+ */
+static DEFINE_PER_CPU(struct mutex *, zswap_mutex);
static int zswap_dstmem_prepare(unsigned int cpu)
{
+ struct mutex *mutex;
u8 *dst;
dst = kmalloc_node(PAGE_SIZE * 2, GFP_KERNEL, cpu_to_node(cpu));
if (!dst)
return -ENOMEM;
+ mutex = kmalloc_node(sizeof(*mutex), GFP_KERNEL, cpu_to_node(cpu));
+ if (!mutex) {
+ kfree(dst);
+ return -ENOMEM;
+ }
+
+ mutex_init(mutex);
per_cpu(zswap_dstmem, cpu) = dst;
+ per_cpu(zswap_mutex, cpu) = mutex;
return 0;
}
static int zswap_dstmem_dead(unsigned int cpu)
{
+ struct mutex *mutex;
u8 *dst;
+ mutex = per_cpu(zswap_mutex, cpu);
+ kfree(mutex);
+ per_cpu(zswap_mutex, cpu) = NULL;
+
dst = per_cpu(zswap_dstmem, cpu);
kfree(dst);
per_cpu(zswap_dstmem, cpu) = NULL;
@@ -415,30 +445,54 @@ static int zswap_dstmem_dead(unsigned in
static int zswap_cpu_comp_prepare(unsigned int cpu, struct hlist_node *node)
{
struct zswap_pool *pool = hlist_entry(node, struct zswap_pool, node);
- struct crypto_comp *tfm;
-
- if (WARN_ON(*per_cpu_ptr(pool->tfm, cpu)))
- return 0;
-
- tfm = crypto_alloc_comp(pool->tfm_name, 0, 0);
- if (IS_ERR(tfm)) {
- pr_err("could not alloc crypto comp %s : %ld\n",
- pool->tfm_name, PTR_ERR(tfm));
+ struct crypto_acomp_ctx *acomp_ctx = per_cpu_ptr(pool->acomp_ctx, cpu);
+ struct crypto_acomp *acomp;
+ struct acomp_req *req;
+
+ acomp = crypto_alloc_acomp_node(pool->tfm_name, 0, 0, cpu_to_node(cpu));
+ if (IS_ERR(acomp)) {
+ pr_err("could not alloc crypto acomp %s : %ld\n",
+ pool->tfm_name, PTR_ERR(acomp));
+ return PTR_ERR(acomp);
+ }
+ acomp_ctx->acomp = acomp;
+
+ req = acomp_request_alloc(acomp_ctx->acomp);
+ if (!req) {
+ pr_err("could not alloc crypto acomp_request %s\n",
+ pool->tfm_name);
+ crypto_free_acomp(acomp_ctx->acomp);
return -ENOMEM;
}
- *per_cpu_ptr(pool->tfm, cpu) = tfm;
+ acomp_ctx->req = req;
+
+ crypto_init_wait(&acomp_ctx->wait);
+ /*
+ * if the backend of acomp is async zip, crypto_req_done() will wakeup
+ * crypto_wait_req(); if the backend of acomp is scomp, the callback
+ * won't be called, crypto_wait_req() will return without blocking.
+ */
+ acomp_request_set_callback(req, CRYPTO_TFM_REQ_MAY_BACKLOG,
+ crypto_req_done, &acomp_ctx->wait);
+
+ acomp_ctx->mutex = per_cpu(zswap_mutex, cpu);
+ acomp_ctx->dstmem = per_cpu(zswap_dstmem, cpu);
+
return 0;
}
static int zswap_cpu_comp_dead(unsigned int cpu, struct hlist_node *node)
{
struct zswap_pool *pool = hlist_entry(node, struct zswap_pool, node);
- struct crypto_comp *tfm;
+ struct crypto_acomp_ctx *acomp_ctx = per_cpu_ptr(pool->acomp_ctx, cpu);
+
+ if (!IS_ERR_OR_NULL(acomp_ctx)) {
+ if (!IS_ERR_OR_NULL(acomp_ctx->req))
+ acomp_request_free(acomp_ctx->req);
+ if (!IS_ERR_OR_NULL(acomp_ctx->acomp))
+ crypto_free_acomp(acomp_ctx->acomp);
+ }
- tfm = *per_cpu_ptr(pool->tfm, cpu);
- if (!IS_ERR_OR_NULL(tfm))
- crypto_free_comp(tfm);
- *per_cpu_ptr(pool->tfm, cpu) = NULL;
return 0;
}
@@ -561,8 +615,9 @@ static struct zswap_pool *zswap_pool_cre
pr_debug("using %s zpool\n", zpool_get_type(pool->zpool));
strlcpy(pool->tfm_name, compressor, sizeof(pool->tfm_name));
- pool->tfm = alloc_percpu(struct crypto_comp *);
- if (!pool->tfm) {
+
+ pool->acomp_ctx = alloc_percpu(*pool->acomp_ctx);
+ if (!pool->acomp_ctx) {
pr_err("percpu alloc failed\n");
goto error;
}
@@ -585,7 +640,8 @@ static struct zswap_pool *zswap_pool_cre
return pool;
error:
- free_percpu(pool->tfm);
+ if (pool->acomp_ctx)
+ free_percpu(pool->acomp_ctx);
if (pool->zpool)
zpool_destroy_pool(pool->zpool);
kfree(pool);
@@ -596,14 +652,14 @@ static __init struct zswap_pool *__zswap
{
bool has_comp, has_zpool;
- has_comp = crypto_has_comp(zswap_compressor, 0, 0);
+ has_comp = crypto_has_acomp(zswap_compressor, 0, 0);
if (!has_comp && strcmp(zswap_compressor,
CONFIG_ZSWAP_COMPRESSOR_DEFAULT)) {
pr_err("compressor %s not available, using default %s\n",
zswap_compressor, CONFIG_ZSWAP_COMPRESSOR_DEFAULT);
param_free_charp(&zswap_compressor);
zswap_compressor = CONFIG_ZSWAP_COMPRESSOR_DEFAULT;
- has_comp = crypto_has_comp(zswap_compressor, 0, 0);
+ has_comp = crypto_has_acomp(zswap_compressor, 0, 0);
}
if (!has_comp) {
pr_err("default compressor %s not available\n",
@@ -639,7 +695,7 @@ static void zswap_pool_destroy(struct zs
zswap_pool_debug("destroying", pool);
cpuhp_state_remove_instance(CPUHP_MM_ZSWP_POOL_PREPARE, &pool->node);
- free_percpu(pool->tfm);
+ free_percpu(pool->acomp_ctx);
zpool_destroy_pool(pool->zpool);
kfree(pool);
}
@@ -723,7 +779,7 @@ static int __zswap_param_set(const char
}
type = s;
} else if (!compressor) {
- if (!crypto_has_comp(s, 0, 0)) {
+ if (!crypto_has_acomp(s, 0, 0)) {
pr_err("compressor %s not available\n", s);
return -ENOENT;
}
@@ -774,7 +830,7 @@ static int __zswap_param_set(const char
* failed, maybe both compressor and zpool params were bad.
* Allow changing this param, so pool creation will succeed
* when the other param is changed. We already verified this
- * param is ok in the zpool_has_pool() or crypto_has_comp()
+ * param is ok in the zpool_has_pool() or crypto_has_acomp()
* checks above.
*/
ret = param_set_charp(s, kp);
@@ -876,8 +932,10 @@ static int zswap_writeback_entry(struct
pgoff_t offset;
struct zswap_entry *entry;
struct page *page;
- struct crypto_comp *tfm;
- u8 *src, *dst;
+ struct scatterlist input, output;
+ struct crypto_acomp_ctx *acomp_ctx;
+
+ u8 *src;
unsigned int dlen;
int ret;
struct writeback_control wbc = {
@@ -916,14 +974,20 @@ static int zswap_writeback_entry(struct
case ZSWAP_SWAPCACHE_NEW: /* page is locked */
/* decompress */
+ acomp_ctx = raw_cpu_ptr(entry->pool->acomp_ctx);
+
dlen = PAGE_SIZE;
src = (u8 *)zhdr + sizeof(struct zswap_header);
- dst = kmap_atomic(page);
- tfm = *get_cpu_ptr(entry->pool->tfm);
- ret = crypto_comp_decompress(tfm, src, entry->length,
- dst, &dlen);
- put_cpu_ptr(entry->pool->tfm);
- kunmap_atomic(dst);
+
+ mutex_lock(acomp_ctx->mutex);
+ sg_init_one(&input, src, entry->length);
+ sg_init_table(&output, 1);
+ sg_set_page(&output, page, PAGE_SIZE, 0);
+ acomp_request_set_params(acomp_ctx->req, &input, &output, entry->length, dlen);
+ ret = crypto_wait_req(crypto_acomp_decompress(acomp_ctx->req), &acomp_ctx->wait);
+ dlen = acomp_ctx->req->dlen;
+ mutex_unlock(acomp_ctx->mutex);
+
BUG_ON(ret);
BUG_ON(dlen != PAGE_SIZE);
@@ -1004,7 +1068,8 @@ static int zswap_frontswap_store(unsigne
{
struct zswap_tree *tree = zswap_trees[type];
struct zswap_entry *entry, *dupentry;
- struct crypto_comp *tfm;
+ struct scatterlist input, output;
+ struct crypto_acomp_ctx *acomp_ctx;
int ret;
unsigned int hlen, dlen = PAGE_SIZE;
unsigned long handle, value;
@@ -1074,12 +1139,32 @@ static int zswap_frontswap_store(unsigne
}
/* compress */
- dst = get_cpu_var(zswap_dstmem);
- tfm = *get_cpu_ptr(entry->pool->tfm);
- src = kmap_atomic(page);
- ret = crypto_comp_compress(tfm, src, PAGE_SIZE, dst, &dlen);
- kunmap_atomic(src);
- put_cpu_ptr(entry->pool->tfm);
+ acomp_ctx = raw_cpu_ptr(entry->pool->acomp_ctx);
+
+ mutex_lock(acomp_ctx->mutex);
+
+ dst = acomp_ctx->dstmem;
+ sg_init_table(&input, 1);
+ sg_set_page(&input, page, PAGE_SIZE, 0);
+
+ /* zswap_dstmem is of size (PAGE_SIZE * 2). Reflect same in sg_list */
+ sg_init_one(&output, dst, PAGE_SIZE * 2);
+ acomp_request_set_params(acomp_ctx->req, &input, &output, PAGE_SIZE, dlen);
+ /*
+ * it maybe looks a little bit silly that we send an asynchronous request,
+ * then wait for its completion synchronously. This makes the process look
+ * synchronous in fact.
+ * Theoretically, acomp supports users send multiple acomp requests in one
+ * acomp instance, then get those requests done simultaneously. but in this
+ * case, frontswap actually does store and load page by page, there is no
+ * existing method to send the second page before the first page is done
+ * in one thread doing frontswap.
+ * but in different threads running on different cpu, we have different
+ * acomp instance, so multiple threads can do (de)compression in parallel.
+ */
+ ret = crypto_wait_req(crypto_acomp_compress(acomp_ctx->req), &acomp_ctx->wait);
+ dlen = acomp_ctx->req->dlen;
+
if (ret) {
ret = -EINVAL;
goto put_dstmem;
@@ -1103,7 +1188,7 @@ static int zswap_frontswap_store(unsigne
memcpy(buf, &zhdr, hlen);
memcpy(buf + hlen, dst, dlen);
zpool_unmap_handle(entry->pool->zpool, handle);
- put_cpu_var(zswap_dstmem);
+ mutex_unlock(acomp_ctx->mutex);
/* populate entry */
entry->offset = offset;
@@ -1131,7 +1216,7 @@ insert_entry:
return 0;
put_dstmem:
- put_cpu_var(zswap_dstmem);
+ mutex_unlock(acomp_ctx->mutex);
zswap_pool_put(entry->pool);
freepage:
zswap_entry_cache_free(entry);
@@ -1148,7 +1233,8 @@ static int zswap_frontswap_load(unsigned
{
struct zswap_tree *tree = zswap_trees[type];
struct zswap_entry *entry;
- struct crypto_comp *tfm;
+ struct scatterlist input, output;
+ struct crypto_acomp_ctx *acomp_ctx;
u8 *src, *dst;
unsigned int dlen;
int ret;
@@ -1175,11 +1261,16 @@ static int zswap_frontswap_load(unsigned
src = zpool_map_handle(entry->pool->zpool, entry->handle, ZPOOL_MM_RO);
if (zpool_evictable(entry->pool->zpool))
src += sizeof(struct zswap_header);
- dst = kmap_atomic(page);
- tfm = *get_cpu_ptr(entry->pool->tfm);
- ret = crypto_comp_decompress(tfm, src, entry->length, dst, &dlen);
- put_cpu_ptr(entry->pool->tfm);
- kunmap_atomic(dst);
+
+ acomp_ctx = raw_cpu_ptr(entry->pool->acomp_ctx);
+ mutex_lock(acomp_ctx->mutex);
+ sg_init_one(&input, src, entry->length);
+ sg_init_table(&output, 1);
+ sg_set_page(&output, page, PAGE_SIZE, 0);
+ acomp_request_set_params(acomp_ctx->req, &input, &output, entry->length, dlen);
+ ret = crypto_wait_req(crypto_acomp_decompress(acomp_ctx->req), &acomp_ctx->wait);
+ mutex_unlock(acomp_ctx->mutex);
+
zpool_unmap_handle(entry->pool->zpool, entry->handle);
BUG_ON(ret);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 188/200] mm/zsmalloc.c: rework the list_add code in insert_zspage()
2020-12-15 3:02 incoming Andrew Morton
` (186 preceding siblings ...)
2020-12-15 3:14 ` [patch 187/200] mm/zswap: move to use crypto_acomp API for hardware acceleration Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 189/200] mm/process_vm_access: remove redundant initialization of iov_r Andrew Morton
` (12 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: akpm, linmiaohe, linux-mm, minchan, mm-commits,
sergey.senozhatsky, torvalds
From: Miaohe Lin <linmiaohe@huawei.com>
Subject: mm/zsmalloc.c: rework the list_add code in insert_zspage()
Rework the list_add code to make it more readable and simple.
Link: https://lkml.kernel.org/r/20201015130107.65195-1-linmiaohe@huawei.com
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Acked-by: Minchan Kim <minchan@kernel.org>
Reviewed-by: Sergey Senozhatsky <sergey.senozhatsky@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/zsmalloc.c | 11 ++++-------
1 file changed, 4 insertions(+), 7 deletions(-)
--- a/mm/zsmalloc.c~zsmalloc-rework-the-list_add-code-in-insert_zspage
+++ a/mm/zsmalloc.c
@@ -726,13 +726,10 @@ static void insert_zspage(struct size_cl
* We want to see more ZS_FULL pages and less almost empty/full.
* Put pages with higher ->inuse first.
*/
- if (head) {
- if (get_zspage_inuse(zspage) < get_zspage_inuse(head)) {
- list_add(&zspage->list, &head->list);
- return;
- }
- }
- list_add(&zspage->list, &class->fullness_list[fullness]);
+ if (head && get_zspage_inuse(zspage) < get_zspage_inuse(head))
+ list_add(&zspage->list, &head->list);
+ else
+ list_add(&zspage->list, &class->fullness_list[fullness]);
}
/*
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 189/200] mm/process_vm_access: remove redundant initialization of iov_r
2020-12-15 3:02 incoming Andrew Morton
` (187 preceding siblings ...)
2020-12-15 3:14 ` [patch 188/200] mm/zsmalloc.c: rework the list_add code in insert_zspage() Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 190/200] zram: support page writeback Andrew Morton
` (11 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: akpm, colin.king, linux-mm, mm-commits, torvalds
From: Colin Ian King <colin.king@canonical.com>
Subject: mm/process_vm_access: remove redundant initialization of iov_r
The pointer iov_r is being initialized with a value that is never read and
it is being updated later with a new value. The initialization is
redundant and can be removed.
Addresses-Coverity: ("Unused value")
Link: https://lkml.kernel.org/r/20201102120614.694917-1-colin.king@canonical.com
Signed-off-by: Colin Ian King <colin.king@canonical.com>
Reviewed-by: Andrew Morton <akpm@linux-foundation.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/process_vm_access.c | 2 +-
1 file changed, 1 insertion(+), 1 deletion(-)
--- a/mm/process_vm_access.c~mm-process_vm_access-remove-redundant-initialization-of-iov_r
+++ a/mm/process_vm_access.c
@@ -260,7 +260,7 @@ static ssize_t process_vm_rw(pid_t pid,
struct iovec iovstack_l[UIO_FASTIOV];
struct iovec iovstack_r[UIO_FASTIOV];
struct iovec *iov_l = iovstack_l;
- struct iovec *iov_r = iovstack_r;
+ struct iovec *iov_r;
struct iov_iter iter;
ssize_t rc;
int dir = vm_write ? WRITE : READ;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 190/200] zram: support page writeback
2020-12-15 3:02 incoming Andrew Morton
` (188 preceding siblings ...)
2020-12-15 3:14 ` [patch 189/200] mm/process_vm_access: remove redundant initialization of iov_r Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 191/200] zram: add stat to gather incompressible pages since zram set up Andrew Morton
` (10 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: akpm, linux-mm, minchan, mm-commits, sergey.senozhatsky, torvalds
From: Minchan Kim <minchan@kernel.org>
Subject: zram: support page writeback
There is demand to writeback specific process pages to backing store
instead of all idles pages in the system due to storage wear out concerns
and to launching latency of apps which are most of the time idle but are
critical for resume latency.
This patch extends the writeback knob to support a specific page
writeback.
Link: https://lkml.kernel.org/r/20201020190506.3758660-1-minchan@kernel.org
Signed-off-by: Minchan Kim <minchan@kernel.org>
Reviewed-by: Sergey Senozhatsky <sergey.senozhatsky@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/admin-guide/blockdev/zram.rst | 5 ++++
drivers/block/zram/zram_drv.c | 21 ++++++++++++++----
2 files changed, 22 insertions(+), 4 deletions(-)
--- a/Documentation/admin-guide/blockdev/zram.rst~zram-support-a-page-writeback
+++ a/Documentation/admin-guide/blockdev/zram.rst
@@ -334,6 +334,11 @@ Admin can request writeback of those idl
With the command, zram writeback idle pages from memory to the storage.
+If admin want to write a specific page in zram device to backing device,
+they could write a page index into the interface.
+
+ echo "page_index=1251" > /sys/block/zramX/writeback
+
If there are lots of write IO with flash device, potentially, it has
flash wearout problem so that admin needs to design write limitation
to guarantee storage health for entire product life.
--- a/drivers/block/zram/zram_drv.c~zram-support-a-page-writeback
+++ a/drivers/block/zram/zram_drv.c
@@ -620,15 +620,19 @@ static int read_from_bdev_async(struct z
return 1;
}
+#define PAGE_WB_SIG "page_index="
+
+#define PAGE_WRITEBACK 0
#define HUGE_WRITEBACK 1
#define IDLE_WRITEBACK 2
+
static ssize_t writeback_store(struct device *dev,
struct device_attribute *attr, const char *buf, size_t len)
{
struct zram *zram = dev_to_zram(dev);
unsigned long nr_pages = zram->disksize >> PAGE_SHIFT;
- unsigned long index;
+ unsigned long index = 0;
struct bio bio;
struct bio_vec bio_vec;
struct page *page;
@@ -640,8 +644,17 @@ static ssize_t writeback_store(struct de
mode = IDLE_WRITEBACK;
else if (sysfs_streq(buf, "huge"))
mode = HUGE_WRITEBACK;
- else
- return -EINVAL;
+ else {
+ if (strncmp(buf, PAGE_WB_SIG, sizeof(PAGE_WB_SIG) - 1))
+ return -EINVAL;
+
+ ret = kstrtol(buf + sizeof(PAGE_WB_SIG) - 1, 10, &index);
+ if (ret || index >= nr_pages)
+ return -EINVAL;
+
+ nr_pages = 1;
+ mode = PAGE_WRITEBACK;
+ }
down_read(&zram->init_lock);
if (!init_done(zram)) {
@@ -660,7 +673,7 @@ static ssize_t writeback_store(struct de
goto release_init_lock;
}
- for (index = 0; index < nr_pages; index++) {
+ while (nr_pages--) {
struct bio_vec bvec;
bvec.bv_page = page;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 191/200] zram: add stat to gather incompressible pages since zram set up
2020-12-15 3:02 incoming Andrew Morton
` (189 preceding siblings ...)
2020-12-15 3:14 ` [patch 190/200] zram: support page writeback Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 192/200] zram: break the strict dependency from lzo Andrew Morton
` (9 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: akpm, linux-mm, minchan, mm-commits, sergey.senozhatsky, torvalds
From: Minchan Kim <minchan@kernel.org>
Subject: zram: add stat to gather incompressible pages since zram set up
Currently, zram supports the stat via /sys/block/zram/mm_stat to represent
how many of incompressible pages are stored at the moment but it couldn't
show how many times incompressible pages were wrote down since zram set
up. It's also good indication to see how zram is effective in the system.
Link: https://lkml.kernel.org/r/20201130201907.1284910-1-minchan@kernel.org
Signed-off-by: Minchan Kim <minchan@kernel.org>
Reviewed-by: Sergey Senozhatsky <sergey.senozhatsky@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
Documentation/admin-guide/blockdev/zram.rst | 1 +
drivers/block/zram/zram_drv.c | 6 ++++--
drivers/block/zram/zram_drv.h | 1 +
3 files changed, 6 insertions(+), 2 deletions(-)
--- a/Documentation/admin-guide/blockdev/zram.rst~zram-add-stat-to-gather-incompressible-pages-since-zram-set-up
+++ a/Documentation/admin-guide/blockdev/zram.rst
@@ -266,6 +266,7 @@ line of text and contains the following
No memory is allocated for such pages.
pages_compacted the number of pages freed during compaction
huge_pages the number of incompressible pages
+ huge_pages_since the number of incompressible pages since zram set up
================ =============================================================
File /sys/block/zram<id>/bd_stat
--- a/drivers/block/zram/zram_drv.c~zram-add-stat-to-gather-incompressible-pages-since-zram-set-up
+++ a/drivers/block/zram/zram_drv.c
@@ -1084,7 +1084,7 @@ static ssize_t mm_stat_show(struct devic
max_used = atomic_long_read(&zram->stats.max_used_pages);
ret = scnprintf(buf, PAGE_SIZE,
- "%8llu %8llu %8llu %8lu %8ld %8llu %8lu %8llu\n",
+ "%8llu %8llu %8llu %8lu %8ld %8llu %8lu %8llu %8llu\n",
orig_size << PAGE_SHIFT,
(u64)atomic64_read(&zram->stats.compr_data_size),
mem_used << PAGE_SHIFT,
@@ -1092,7 +1092,8 @@ static ssize_t mm_stat_show(struct devic
max_used << PAGE_SHIFT,
(u64)atomic64_read(&zram->stats.same_pages),
pool_stats.pages_compacted,
- (u64)atomic64_read(&zram->stats.huge_pages));
+ (u64)atomic64_read(&zram->stats.huge_pages),
+ (u64)atomic64_read(&zram->stats.huge_pages_since));
up_read(&zram->init_lock);
return ret;
@@ -1424,6 +1425,7 @@ out:
if (comp_len == PAGE_SIZE) {
zram_set_flag(zram, index, ZRAM_HUGE);
atomic64_inc(&zram->stats.huge_pages);
+ atomic64_inc(&zram->stats.huge_pages_since);
}
if (flags) {
--- a/drivers/block/zram/zram_drv.h~zram-add-stat-to-gather-incompressible-pages-since-zram-set-up
+++ a/drivers/block/zram/zram_drv.h
@@ -78,6 +78,7 @@ struct zram_stats {
atomic64_t notify_free; /* no. of swap slot free notifications */
atomic64_t same_pages; /* no. of same element filled pages */
atomic64_t huge_pages; /* no. of huge pages */
+ atomic64_t huge_pages_since; /* no. of huge pages since zram set up */
atomic64_t pages_stored; /* no. of pages currently stored */
atomic_long_t max_used_pages; /* no. of maximum pages stored */
atomic64_t writestall; /* no. of write slow paths */
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 192/200] zram: break the strict dependency from lzo
2020-12-15 3:02 incoming Andrew Morton
` (190 preceding siblings ...)
2020-12-15 3:14 ` [patch 191/200] zram: add stat to gather incompressible pages since zram set up Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 193/200] mm: fix kernel-doc markups Andrew Morton
` (8 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: akpm, linux-mm, minchan, mm-commits, rsalvaterra,
sergey.senozhatsky.work, torvalds
From: Rui Salvaterra <rsalvaterra@gmail.com>
Subject: zram: break the strict dependency from lzo
>From the beginning, the zram block device always enabled CRYPTO_LZO, since
lzo-rle is hardcoded as the fallback compression algorithm. As a consequence, on
systems where another compression algorithm is chosen (e.g. CRYPTO_ZSTD), the
lzo kernel module becomes unused, while still having to be built/loaded.
This patch removes the hardcoded lzo-rle dependency and allows the user to
select the default compression algorithm for zram at build time. The previous
behaviour is kept, as the default algorithm is still lzo-rle.
Link: https://lkml.kernel.org/r/20201207121245.50529-1-rsalvaterra@gmail.com
Signed-off-by: Rui Salvaterra <rsalvaterra@gmail.com>
Suggested-by: Sergey Senozhatsky <sergey.senozhatsky.work@gmail.com>
Suggested-by: Minchan Kim <minchan@kernel.org>
Acked-by: Minchan Kim <minchan@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
drivers/block/zram/Kconfig | 42 +++++++++++++++++++++++++++++++-
drivers/block/zram/zcomp.c | 2 +
drivers/block/zram/zram_drv.c | 2 -
3 files changed, 44 insertions(+), 2 deletions(-)
--- a/drivers/block/zram/Kconfig~zram-break-the-strict-dependency-from-lzo
+++ a/drivers/block/zram/Kconfig
@@ -2,7 +2,7 @@
config ZRAM
tristate "Compressed RAM block device support"
depends on BLOCK && SYSFS && ZSMALLOC && CRYPTO
- select CRYPTO_LZO
+ depends on CRYPTO_LZO || CRYPTO_ZSTD || CRYPTO_LZ4 || CRYPTO_LZ4HC || CRYPTO_842
help
Creates virtual block devices called /dev/zramX (X = 0, 1, ...).
Pages written to these disks are compressed and stored in memory
@@ -14,6 +14,46 @@ config ZRAM
See Documentation/admin-guide/blockdev/zram.rst for more information.
+choice
+ prompt "Default zram compressor"
+ default ZRAM_DEF_COMP_LZORLE
+ depends on ZRAM
+
+config ZRAM_DEF_COMP_LZORLE
+ bool "lzo-rle"
+ depends on CRYPTO_LZO
+
+config ZRAM_DEF_COMP_ZSTD
+ bool "zstd"
+ depends on CRYPTO_ZSTD
+
+config ZRAM_DEF_COMP_LZ4
+ bool "lz4"
+ depends on CRYPTO_LZ4
+
+config ZRAM_DEF_COMP_LZO
+ bool "lzo"
+ depends on CRYPTO_LZO
+
+config ZRAM_DEF_COMP_LZ4HC
+ bool "lz4hc"
+ depends on CRYPTO_LZ4HC
+
+config ZRAM_DEF_COMP_842
+ bool "842"
+ depends on CRYPTO_842
+
+endchoice
+
+config ZRAM_DEF_COMP
+ string
+ default "lzo-rle" if ZRAM_DEF_COMP_LZORLE
+ default "zstd" if ZRAM_DEF_COMP_ZSTD
+ default "lz4" if ZRAM_DEF_COMP_LZ4
+ default "lzo" if ZRAM_DEF_COMP_LZO
+ default "lz4hc" if ZRAM_DEF_COMP_LZ4HC
+ default "842" if ZRAM_DEF_COMP_842
+
config ZRAM_WRITEBACK
bool "Write back incompressible or idle page to backing device"
depends on ZRAM
--- a/drivers/block/zram/zcomp.c~zram-break-the-strict-dependency-from-lzo
+++ a/drivers/block/zram/zcomp.c
@@ -15,8 +15,10 @@
#include "zcomp.h"
static const char * const backends[] = {
+#if IS_ENABLED(CONFIG_CRYPTO_LZO)
"lzo",
"lzo-rle",
+#endif
#if IS_ENABLED(CONFIG_CRYPTO_LZ4)
"lz4",
#endif
--- a/drivers/block/zram/zram_drv.c~zram-break-the-strict-dependency-from-lzo
+++ a/drivers/block/zram/zram_drv.c
@@ -42,7 +42,7 @@ static DEFINE_IDR(zram_index_idr);
static DEFINE_MUTEX(zram_index_mutex);
static int zram_major;
-static const char *default_compressor = "lzo-rle";
+static const char *default_compressor = CONFIG_ZRAM_DEF_COMP;
/* Module params (documentation at end) */
static unsigned int num_devices = 1;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 193/200] mm: fix kernel-doc markups
2020-12-15 3:02 incoming Andrew Morton
` (191 preceding siblings ...)
2020-12-15 3:14 ` [patch 192/200] zram: break the strict dependency from lzo Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 194/200] mm: use sysfs_emit for struct kobject * uses Andrew Morton
` (7 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: akpm, linux-mm, mchehab+huawei, mm-commits, torvalds, willy
From: Mauro Carvalho Chehab <mchehab+huawei@kernel.org>
Subject: mm: fix kernel-doc markups
Kernel-doc markups should use this format:
identifier - description
Fix some issues on mm files:
1) The definition for get_user_pages_locked() doesn't follow it. Also,
it expects a short descrpition at the header, followed by a long one,
after the parameters. Fix it.
2) Kernel-doc requires that a kernel-doc markup to be immediately below
the function prototype, as otherwise it will rename it. So, move
get_pfnblock_flags_mask() description to the right place.
3) Make invalidate_mapping_pagevec() to also follow the expected
kernel-doc format.
While here, fix a few minor English syntax issues, as suggested
by Matthew:
will used -> will be used
similar with -> similar to
Link: https://lkml.kernel.org/r/80e85dddc92d333bc2159ee8a2294921612e8745.1605521731.git.mchehab+huawei@kernel.org
Signed-off-by: Mauro Carvalho Chehab <mchehab+huawei@kernel.org>
Suggested-by: Mattew Wilcox <willy@infradead.org> [English fixes]
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/gup.c | 24 +++++++++++++-----------
mm/page_alloc.c | 16 ++++++++--------
mm/truncate.c | 6 +++---
3 files changed, 24 insertions(+), 22 deletions(-)
--- a/mm/gup.c~mm-fix-kernel-doc-markups
+++ a/mm/gup.c
@@ -1845,7 +1845,19 @@ long get_user_pages(unsigned long start,
EXPORT_SYMBOL(get_user_pages);
/**
- * get_user_pages_locked() is suitable to replace the form:
+ * get_user_pages_locked() - variant of get_user_pages()
+ *
+ * @start: starting user address
+ * @nr_pages: number of pages from start to pin
+ * @gup_flags: flags modifying lookup behaviour
+ * @pages: array that receives pointers to the pages pinned.
+ * Should be at least nr_pages long. Or NULL, if caller
+ * only intends to ensure the pages are faulted in.
+ * @locked: pointer to lock flag indicating whether lock is held and
+ * subsequently whether VM_FAULT_RETRY functionality can be
+ * utilised. Lock must initially be held.
+ *
+ * It is suitable to replace the form:
*
* mmap_read_lock(mm);
* do_something()
@@ -1861,16 +1873,6 @@ EXPORT_SYMBOL(get_user_pages);
* if (locked)
* mmap_read_unlock(mm);
*
- * @start: starting user address
- * @nr_pages: number of pages from start to pin
- * @gup_flags: flags modifying lookup behaviour
- * @pages: array that receives pointers to the pages pinned.
- * Should be at least nr_pages long. Or NULL, if caller
- * only intends to ensure the pages are faulted in.
- * @locked: pointer to lock flag indicating whether lock is held and
- * subsequently whether VM_FAULT_RETRY functionality can be
- * utilised. Lock must initially be held.
- *
* We can leverage the VM_FAULT_RETRY functionality in the page fault
* paths better by using either get_user_pages_locked() or
* get_user_pages_unlocked().
--- a/mm/page_alloc.c~mm-fix-kernel-doc-markups
+++ a/mm/page_alloc.c
@@ -470,14 +470,6 @@ static inline int pfn_to_bitidx(struct p
return (pfn >> pageblock_order) * NR_PAGEBLOCK_BITS;
}
-/**
- * get_pfnblock_flags_mask - Return the requested group of flags for the pageblock_nr_pages block of pages
- * @page: The page within the block of interest
- * @pfn: The target page frame number
- * @mask: mask of bits that the caller is interested in
- *
- * Return: pageblock_bits flags
- */
static __always_inline
unsigned long __get_pfnblock_flags_mask(struct page *page,
unsigned long pfn,
@@ -496,6 +488,14 @@ unsigned long __get_pfnblock_flags_mask(
return (word >> bitidx) & mask;
}
+/**
+ * get_pfnblock_flags_mask - Return the requested group of flags for the pageblock_nr_pages block of pages
+ * @page: The page within the block of interest
+ * @pfn: The target page frame number
+ * @mask: mask of bits that the caller is interested in
+ *
+ * Return: pageblock_bits flags
+ */
unsigned long get_pfnblock_flags_mask(struct page *page, unsigned long pfn,
unsigned long mask)
{
--- a/mm/truncate.c~mm-fix-kernel-doc-markups
+++ a/mm/truncate.c
@@ -643,9 +643,9 @@ EXPORT_SYMBOL(invalidate_mapping_pages);
* @end: the offset 'to' which to invalidate (inclusive)
* @nr_pagevec: invalidate failed page number for caller
*
- * This helper is similar with invalidate_mapping_pages, except that it accounts
- * for pages that failed to invalidate on a pagevec and count them in
- * @nr_pagevec, which will used by the caller.
+ * This helper is similar to invalidate_mapping_pages(), except that it accounts
+ * for pages that are likely on a pagevec and counts them in @nr_pagevec, which
+ * will be used by the caller.
*/
void invalidate_mapping_pagevec(struct address_space *mapping,
pgoff_t start, pgoff_t end, unsigned long *nr_pagevec)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 194/200] mm: use sysfs_emit for struct kobject * uses
2020-12-15 3:02 incoming Andrew Morton
` (192 preceding siblings ...)
2020-12-15 3:14 ` [patch 193/200] mm: fix kernel-doc markups Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 195/200] mm: huge_memory: convert remaining use of sprintf to sysfs_emit and neatening Andrew Morton
` (6 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: akpm, cl, gregkh, hughd, iamjoonsoo.kim, joe, linux-mm,
mike.kravetz, mm-commits, penberg, rientjes, torvalds, willy
From: Joe Perches <joe@perches.com>
Subject: mm: use sysfs_emit for struct kobject * uses
Patch series "mm: Convert sysfs sprintf family to sysfs_emit", v2.
Use the new sysfs_emit family and not the sprintf family.
This patch (of 5):
Use the sysfs_emit function instead of the sprintf family.
Done with cocci script as in commit 3c6bff3cf988
("RDMA: Convert sysfs kobject * show functions to use sysfs_emit()")
Link: https://lkml.kernel.org/r/cover.1605376435.git.joe@perches.com
Link: https://lkml.kernel.org/r/9c249215bad6df616ba0410ad980042694970c1b.1605376435.git.joe@perches.com
Signed-off-by: Joe Perches <joe@perches.com>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Hugh Dickins <hughd@google.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: David Rientjes <rientjes@google.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/huge_memory.c | 28 ++++++++++++++++------------
mm/hugetlb.c | 13 +++++++------
mm/khugepaged.c | 22 +++++++++++-----------
mm/ksm.c | 32 ++++++++++++++++----------------
mm/swap_state.c | 3 ++-
5 files changed, 52 insertions(+), 46 deletions(-)
--- a/mm/huge_memory.c~mm-use-sysfs_emit-for-struct-kobject-uses
+++ a/mm/huge_memory.c
@@ -164,11 +164,11 @@ static ssize_t enabled_show(struct kobje
struct kobj_attribute *attr, char *buf)
{
if (test_bit(TRANSPARENT_HUGEPAGE_FLAG, &transparent_hugepage_flags))
- return sprintf(buf, "[always] madvise never\n");
+ return sysfs_emit(buf, "[always] madvise never\n");
else if (test_bit(TRANSPARENT_HUGEPAGE_REQ_MADV_FLAG, &transparent_hugepage_flags))
- return sprintf(buf, "always [madvise] never\n");
+ return sysfs_emit(buf, "always [madvise] never\n");
else
- return sprintf(buf, "always madvise [never]\n");
+ return sysfs_emit(buf, "always madvise [never]\n");
}
static ssize_t enabled_store(struct kobject *kobj,
@@ -233,14 +233,18 @@ static ssize_t defrag_show(struct kobjec
struct kobj_attribute *attr, char *buf)
{
if (test_bit(TRANSPARENT_HUGEPAGE_DEFRAG_DIRECT_FLAG, &transparent_hugepage_flags))
- return sprintf(buf, "[always] defer defer+madvise madvise never\n");
+ return sysfs_emit(buf,
+ "[always] defer defer+madvise madvise never\n");
if (test_bit(TRANSPARENT_HUGEPAGE_DEFRAG_KSWAPD_FLAG, &transparent_hugepage_flags))
- return sprintf(buf, "always [defer] defer+madvise madvise never\n");
+ return sysfs_emit(buf,
+ "always [defer] defer+madvise madvise never\n");
if (test_bit(TRANSPARENT_HUGEPAGE_DEFRAG_KSWAPD_OR_MADV_FLAG, &transparent_hugepage_flags))
- return sprintf(buf, "always defer [defer+madvise] madvise never\n");
+ return sysfs_emit(buf,
+ "always defer [defer+madvise] madvise never\n");
if (test_bit(TRANSPARENT_HUGEPAGE_DEFRAG_REQ_MADV_FLAG, &transparent_hugepage_flags))
- return sprintf(buf, "always defer defer+madvise [madvise] never\n");
- return sprintf(buf, "always defer defer+madvise madvise [never]\n");
+ return sysfs_emit(buf,
+ "always defer defer+madvise [madvise] never\n");
+ return sysfs_emit(buf, "always defer defer+madvise madvise [never]\n");
}
static ssize_t defrag_store(struct kobject *kobj,
@@ -281,10 +285,10 @@ static struct kobj_attribute defrag_attr
__ATTR(defrag, 0644, defrag_show, defrag_store);
static ssize_t use_zero_page_show(struct kobject *kobj,
- struct kobj_attribute *attr, char *buf)
+ struct kobj_attribute *attr, char *buf)
{
return single_hugepage_flag_show(kobj, attr, buf,
- TRANSPARENT_HUGEPAGE_USE_ZERO_PAGE_FLAG);
+ TRANSPARENT_HUGEPAGE_USE_ZERO_PAGE_FLAG);
}
static ssize_t use_zero_page_store(struct kobject *kobj,
struct kobj_attribute *attr, const char *buf, size_t count)
@@ -296,9 +300,9 @@ static struct kobj_attribute use_zero_pa
__ATTR(use_zero_page, 0644, use_zero_page_show, use_zero_page_store);
static ssize_t hpage_pmd_size_show(struct kobject *kobj,
- struct kobj_attribute *attr, char *buf)
+ struct kobj_attribute *attr, char *buf)
{
- return sprintf(buf, "%lu\n", HPAGE_PMD_SIZE);
+ return sysfs_emit(buf, "%lu\n", HPAGE_PMD_SIZE);
}
static struct kobj_attribute hpage_pmd_size_attr =
__ATTR_RO(hpage_pmd_size);
--- a/mm/hugetlb.c~mm-use-sysfs_emit-for-struct-kobject-uses
+++ a/mm/hugetlb.c
@@ -2760,7 +2760,7 @@ static ssize_t nr_hugepages_show_common(
else
nr_huge_pages = h->nr_huge_pages_node[nid];
- return sprintf(buf, "%lu\n", nr_huge_pages);
+ return sysfs_emit(buf, "%lu\n", nr_huge_pages);
}
static ssize_t __nr_hugepages_store_common(bool obey_mempolicy,
@@ -2833,7 +2833,8 @@ HSTATE_ATTR(nr_hugepages);
* huge page alloc/free.
*/
static ssize_t nr_hugepages_mempolicy_show(struct kobject *kobj,
- struct kobj_attribute *attr, char *buf)
+ struct kobj_attribute *attr,
+ char *buf)
{
return nr_hugepages_show_common(kobj, attr, buf);
}
@@ -2851,7 +2852,7 @@ static ssize_t nr_overcommit_hugepages_s
struct kobj_attribute *attr, char *buf)
{
struct hstate *h = kobj_to_hstate(kobj, NULL);
- return sprintf(buf, "%lu\n", h->nr_overcommit_huge_pages);
+ return sysfs_emit(buf, "%lu\n", h->nr_overcommit_huge_pages);
}
static ssize_t nr_overcommit_hugepages_store(struct kobject *kobj,
@@ -2889,7 +2890,7 @@ static ssize_t free_hugepages_show(struc
else
free_huge_pages = h->free_huge_pages_node[nid];
- return sprintf(buf, "%lu\n", free_huge_pages);
+ return sysfs_emit(buf, "%lu\n", free_huge_pages);
}
HSTATE_ATTR_RO(free_hugepages);
@@ -2897,7 +2898,7 @@ static ssize_t resv_hugepages_show(struc
struct kobj_attribute *attr, char *buf)
{
struct hstate *h = kobj_to_hstate(kobj, NULL);
- return sprintf(buf, "%lu\n", h->resv_huge_pages);
+ return sysfs_emit(buf, "%lu\n", h->resv_huge_pages);
}
HSTATE_ATTR_RO(resv_hugepages);
@@ -2914,7 +2915,7 @@ static ssize_t surplus_hugepages_show(st
else
surplus_huge_pages = h->surplus_huge_pages_node[nid];
- return sprintf(buf, "%lu\n", surplus_huge_pages);
+ return sysfs_emit(buf, "%lu\n", surplus_huge_pages);
}
HSTATE_ATTR_RO(surplus_hugepages);
--- a/mm/khugepaged.c~mm-use-sysfs_emit-for-struct-kobject-uses
+++ a/mm/khugepaged.c
@@ -126,7 +126,7 @@ static ssize_t scan_sleep_millisecs_show
struct kobj_attribute *attr,
char *buf)
{
- return sprintf(buf, "%u\n", khugepaged_scan_sleep_millisecs);
+ return sysfs_emit(buf, "%u\n", khugepaged_scan_sleep_millisecs);
}
static ssize_t scan_sleep_millisecs_store(struct kobject *kobj,
@@ -154,7 +154,7 @@ static ssize_t alloc_sleep_millisecs_sho
struct kobj_attribute *attr,
char *buf)
{
- return sprintf(buf, "%u\n", khugepaged_alloc_sleep_millisecs);
+ return sysfs_emit(buf, "%u\n", khugepaged_alloc_sleep_millisecs);
}
static ssize_t alloc_sleep_millisecs_store(struct kobject *kobj,
@@ -182,7 +182,7 @@ static ssize_t pages_to_scan_show(struct
struct kobj_attribute *attr,
char *buf)
{
- return sprintf(buf, "%u\n", khugepaged_pages_to_scan);
+ return sysfs_emit(buf, "%u\n", khugepaged_pages_to_scan);
}
static ssize_t pages_to_scan_store(struct kobject *kobj,
struct kobj_attribute *attr,
@@ -207,7 +207,7 @@ static ssize_t pages_collapsed_show(stru
struct kobj_attribute *attr,
char *buf)
{
- return sprintf(buf, "%u\n", khugepaged_pages_collapsed);
+ return sysfs_emit(buf, "%u\n", khugepaged_pages_collapsed);
}
static struct kobj_attribute pages_collapsed_attr =
__ATTR_RO(pages_collapsed);
@@ -216,7 +216,7 @@ static ssize_t full_scans_show(struct ko
struct kobj_attribute *attr,
char *buf)
{
- return sprintf(buf, "%u\n", khugepaged_full_scans);
+ return sysfs_emit(buf, "%u\n", khugepaged_full_scans);
}
static struct kobj_attribute full_scans_attr =
__ATTR_RO(full_scans);
@@ -225,7 +225,7 @@ static ssize_t khugepaged_defrag_show(st
struct kobj_attribute *attr, char *buf)
{
return single_hugepage_flag_show(kobj, attr, buf,
- TRANSPARENT_HUGEPAGE_DEFRAG_KHUGEPAGED_FLAG);
+ TRANSPARENT_HUGEPAGE_DEFRAG_KHUGEPAGED_FLAG);
}
static ssize_t khugepaged_defrag_store(struct kobject *kobj,
struct kobj_attribute *attr,
@@ -250,7 +250,7 @@ static ssize_t khugepaged_max_ptes_none_
struct kobj_attribute *attr,
char *buf)
{
- return sprintf(buf, "%u\n", khugepaged_max_ptes_none);
+ return sysfs_emit(buf, "%u\n", khugepaged_max_ptes_none);
}
static ssize_t khugepaged_max_ptes_none_store(struct kobject *kobj,
struct kobj_attribute *attr,
@@ -275,7 +275,7 @@ static ssize_t khugepaged_max_ptes_swap_
struct kobj_attribute *attr,
char *buf)
{
- return sprintf(buf, "%u\n", khugepaged_max_ptes_swap);
+ return sysfs_emit(buf, "%u\n", khugepaged_max_ptes_swap);
}
static ssize_t khugepaged_max_ptes_swap_store(struct kobject *kobj,
@@ -299,10 +299,10 @@ static struct kobj_attribute khugepaged_
khugepaged_max_ptes_swap_store);
static ssize_t khugepaged_max_ptes_shared_show(struct kobject *kobj,
- struct kobj_attribute *attr,
- char *buf)
+ struct kobj_attribute *attr,
+ char *buf)
{
- return sprintf(buf, "%u\n", khugepaged_max_ptes_shared);
+ return sysfs_emit(buf, "%u\n", khugepaged_max_ptes_shared);
}
static ssize_t khugepaged_max_ptes_shared_store(struct kobject *kobj,
--- a/mm/ksm.c~mm-use-sysfs_emit-for-struct-kobject-uses
+++ a/mm/ksm.c
@@ -2833,7 +2833,7 @@ static void wait_while_offlining(void)
static ssize_t sleep_millisecs_show(struct kobject *kobj,
struct kobj_attribute *attr, char *buf)
{
- return sprintf(buf, "%u\n", ksm_thread_sleep_millisecs);
+ return sysfs_emit(buf, "%u\n", ksm_thread_sleep_millisecs);
}
static ssize_t sleep_millisecs_store(struct kobject *kobj,
@@ -2857,7 +2857,7 @@ KSM_ATTR(sleep_millisecs);
static ssize_t pages_to_scan_show(struct kobject *kobj,
struct kobj_attribute *attr, char *buf)
{
- return sprintf(buf, "%u\n", ksm_thread_pages_to_scan);
+ return sysfs_emit(buf, "%u\n", ksm_thread_pages_to_scan);
}
static ssize_t pages_to_scan_store(struct kobject *kobj,
@@ -2880,7 +2880,7 @@ KSM_ATTR(pages_to_scan);
static ssize_t run_show(struct kobject *kobj, struct kobj_attribute *attr,
char *buf)
{
- return sprintf(buf, "%lu\n", ksm_run);
+ return sysfs_emit(buf, "%lu\n", ksm_run);
}
static ssize_t run_store(struct kobject *kobj, struct kobj_attribute *attr,
@@ -2927,9 +2927,9 @@ KSM_ATTR(run);
#ifdef CONFIG_NUMA
static ssize_t merge_across_nodes_show(struct kobject *kobj,
- struct kobj_attribute *attr, char *buf)
+ struct kobj_attribute *attr, char *buf)
{
- return sprintf(buf, "%u\n", ksm_merge_across_nodes);
+ return sysfs_emit(buf, "%u\n", ksm_merge_across_nodes);
}
static ssize_t merge_across_nodes_store(struct kobject *kobj,
@@ -2984,9 +2984,9 @@ KSM_ATTR(merge_across_nodes);
#endif
static ssize_t use_zero_pages_show(struct kobject *kobj,
- struct kobj_attribute *attr, char *buf)
+ struct kobj_attribute *attr, char *buf)
{
- return sprintf(buf, "%u\n", ksm_use_zero_pages);
+ return sysfs_emit(buf, "%u\n", ksm_use_zero_pages);
}
static ssize_t use_zero_pages_store(struct kobject *kobj,
struct kobj_attribute *attr,
@@ -3008,7 +3008,7 @@ KSM_ATTR(use_zero_pages);
static ssize_t max_page_sharing_show(struct kobject *kobj,
struct kobj_attribute *attr, char *buf)
{
- return sprintf(buf, "%u\n", ksm_max_page_sharing);
+ return sysfs_emit(buf, "%u\n", ksm_max_page_sharing);
}
static ssize_t max_page_sharing_store(struct kobject *kobj,
@@ -3049,21 +3049,21 @@ KSM_ATTR(max_page_sharing);
static ssize_t pages_shared_show(struct kobject *kobj,
struct kobj_attribute *attr, char *buf)
{
- return sprintf(buf, "%lu\n", ksm_pages_shared);
+ return sysfs_emit(buf, "%lu\n", ksm_pages_shared);
}
KSM_ATTR_RO(pages_shared);
static ssize_t pages_sharing_show(struct kobject *kobj,
struct kobj_attribute *attr, char *buf)
{
- return sprintf(buf, "%lu\n", ksm_pages_sharing);
+ return sysfs_emit(buf, "%lu\n", ksm_pages_sharing);
}
KSM_ATTR_RO(pages_sharing);
static ssize_t pages_unshared_show(struct kobject *kobj,
struct kobj_attribute *attr, char *buf)
{
- return sprintf(buf, "%lu\n", ksm_pages_unshared);
+ return sysfs_emit(buf, "%lu\n", ksm_pages_unshared);
}
KSM_ATTR_RO(pages_unshared);
@@ -3080,21 +3080,21 @@ static ssize_t pages_volatile_show(struc
*/
if (ksm_pages_volatile < 0)
ksm_pages_volatile = 0;
- return sprintf(buf, "%ld\n", ksm_pages_volatile);
+ return sysfs_emit(buf, "%ld\n", ksm_pages_volatile);
}
KSM_ATTR_RO(pages_volatile);
static ssize_t stable_node_dups_show(struct kobject *kobj,
struct kobj_attribute *attr, char *buf)
{
- return sprintf(buf, "%lu\n", ksm_stable_node_dups);
+ return sysfs_emit(buf, "%lu\n", ksm_stable_node_dups);
}
KSM_ATTR_RO(stable_node_dups);
static ssize_t stable_node_chains_show(struct kobject *kobj,
struct kobj_attribute *attr, char *buf)
{
- return sprintf(buf, "%lu\n", ksm_stable_node_chains);
+ return sysfs_emit(buf, "%lu\n", ksm_stable_node_chains);
}
KSM_ATTR_RO(stable_node_chains);
@@ -3103,7 +3103,7 @@ stable_node_chains_prune_millisecs_show(
struct kobj_attribute *attr,
char *buf)
{
- return sprintf(buf, "%u\n", ksm_stable_node_chains_prune_millisecs);
+ return sysfs_emit(buf, "%u\n", ksm_stable_node_chains_prune_millisecs);
}
static ssize_t
@@ -3127,7 +3127,7 @@ KSM_ATTR(stable_node_chains_prune_millis
static ssize_t full_scans_show(struct kobject *kobj,
struct kobj_attribute *attr, char *buf)
{
- return sprintf(buf, "%lu\n", ksm_scan.seqnr);
+ return sysfs_emit(buf, "%lu\n", ksm_scan.seqnr);
}
KSM_ATTR_RO(full_scans);
--- a/mm/swap_state.c~mm-use-sysfs_emit-for-struct-kobject-uses
+++ a/mm/swap_state.c
@@ -902,7 +902,8 @@ struct page *swapin_readahead(swp_entry_
static ssize_t vma_ra_enabled_show(struct kobject *kobj,
struct kobj_attribute *attr, char *buf)
{
- return sprintf(buf, "%s\n", enable_vma_readahead ? "true" : "false");
+ return sysfs_emit(buf, "%s\n",
+ enable_vma_readahead ? "true" : "false");
}
static ssize_t vma_ra_enabled_store(struct kobject *kobj,
struct kobj_attribute *attr,
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 195/200] mm: huge_memory: convert remaining use of sprintf to sysfs_emit and neatening
2020-12-15 3:02 incoming Andrew Morton
` (193 preceding siblings ...)
2020-12-15 3:14 ` [patch 194/200] mm: use sysfs_emit for struct kobject * uses Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 196/200] mm:backing-dev: use sysfs_emit in macro defining functions Andrew Morton
` (5 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: akpm, cl, gregkh, hughd, iamjoonsoo.kim, joe, linux-mm,
mike.kravetz, mm-commits, penberg, rientjes, torvalds, willy
From: Joe Perches <joe@perches.com>
Subject: mm: huge_memory: convert remaining use of sprintf to sysfs_emit and neatening
Convert the only use of sprintf with struct kobject * that the cocci
script could not convert.
Miscellanea:
o Neaten the uses of a constant string with sysfs_emit to use a const
char * to reduce overall object size
Link: https://lkml.kernel.org/r/7df6be66bbd68e1a0bca9d35aca1341dbf94d2a7.1605376435.git.joe@perches.com
Signed-off-by: Joe Perches <joe@perches.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org>
Cc: Hugh Dickins <hughd@google.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Pekka Enberg <penberg@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/huge_memory.c | 52 ++++++++++++++++++++++++++-------------------
1 file changed, 31 insertions(+), 21 deletions(-)
--- a/mm/huge_memory.c~mm-huge_memory-convert-remaining-use-of-sprintf-to-sysfs_emit-and-neatening
+++ a/mm/huge_memory.c
@@ -163,12 +163,17 @@ static struct shrinker huge_zero_page_sh
static ssize_t enabled_show(struct kobject *kobj,
struct kobj_attribute *attr, char *buf)
{
+ const char *output;
+
if (test_bit(TRANSPARENT_HUGEPAGE_FLAG, &transparent_hugepage_flags))
- return sysfs_emit(buf, "[always] madvise never\n");
- else if (test_bit(TRANSPARENT_HUGEPAGE_REQ_MADV_FLAG, &transparent_hugepage_flags))
- return sysfs_emit(buf, "always [madvise] never\n");
+ output = "[always] madvise never";
+ else if (test_bit(TRANSPARENT_HUGEPAGE_REQ_MADV_FLAG,
+ &transparent_hugepage_flags))
+ output = "always [madvise] never";
else
- return sysfs_emit(buf, "always madvise [never]\n");
+ output = "always madvise [never]";
+
+ return sysfs_emit(buf, "%s\n", output);
}
static ssize_t enabled_store(struct kobject *kobj,
@@ -200,11 +205,11 @@ static struct kobj_attribute enabled_att
__ATTR(enabled, 0644, enabled_show, enabled_store);
ssize_t single_hugepage_flag_show(struct kobject *kobj,
- struct kobj_attribute *attr, char *buf,
- enum transparent_hugepage_flag flag)
+ struct kobj_attribute *attr, char *buf,
+ enum transparent_hugepage_flag flag)
{
- return sprintf(buf, "%d\n",
- !!test_bit(flag, &transparent_hugepage_flags));
+ return sysfs_emit(buf, "%d\n",
+ !!test_bit(flag, &transparent_hugepage_flags));
}
ssize_t single_hugepage_flag_store(struct kobject *kobj,
@@ -232,19 +237,24 @@ ssize_t single_hugepage_flag_store(struc
static ssize_t defrag_show(struct kobject *kobj,
struct kobj_attribute *attr, char *buf)
{
- if (test_bit(TRANSPARENT_HUGEPAGE_DEFRAG_DIRECT_FLAG, &transparent_hugepage_flags))
- return sysfs_emit(buf,
- "[always] defer defer+madvise madvise never\n");
- if (test_bit(TRANSPARENT_HUGEPAGE_DEFRAG_KSWAPD_FLAG, &transparent_hugepage_flags))
- return sysfs_emit(buf,
- "always [defer] defer+madvise madvise never\n");
- if (test_bit(TRANSPARENT_HUGEPAGE_DEFRAG_KSWAPD_OR_MADV_FLAG, &transparent_hugepage_flags))
- return sysfs_emit(buf,
- "always defer [defer+madvise] madvise never\n");
- if (test_bit(TRANSPARENT_HUGEPAGE_DEFRAG_REQ_MADV_FLAG, &transparent_hugepage_flags))
- return sysfs_emit(buf,
- "always defer defer+madvise [madvise] never\n");
- return sysfs_emit(buf, "always defer defer+madvise madvise [never]\n");
+ const char *output;
+
+ if (test_bit(TRANSPARENT_HUGEPAGE_DEFRAG_DIRECT_FLAG,
+ &transparent_hugepage_flags))
+ output = "[always] defer defer+madvise madvise never";
+ else if (test_bit(TRANSPARENT_HUGEPAGE_DEFRAG_KSWAPD_FLAG,
+ &transparent_hugepage_flags))
+ output = "always [defer] defer+madvise madvise never";
+ else if (test_bit(TRANSPARENT_HUGEPAGE_DEFRAG_KSWAPD_OR_MADV_FLAG,
+ &transparent_hugepage_flags))
+ output = "always defer [defer+madvise] madvise never";
+ else if (test_bit(TRANSPARENT_HUGEPAGE_DEFRAG_REQ_MADV_FLAG,
+ &transparent_hugepage_flags))
+ output = "always defer defer+madvise [madvise] never";
+ else
+ output = "always defer defer+madvise madvise [never]";
+
+ return sysfs_emit(buf, "%s\n", output);
}
static ssize_t defrag_store(struct kobject *kobj,
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 196/200] mm:backing-dev: use sysfs_emit in macro defining functions
2020-12-15 3:02 incoming Andrew Morton
` (194 preceding siblings ...)
2020-12-15 3:14 ` [patch 195/200] mm: huge_memory: convert remaining use of sprintf to sysfs_emit and neatening Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 197/200] mm: shmem: convert shmem_enabled_show to use sysfs_emit_at Andrew Morton
` (4 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: akpm, cl, gregkh, hughd, iamjoonsoo.kim, joe, linux-mm,
mike.kravetz, mm-commits, penberg, rientjes, torvalds, willy
From: Joe Perches <joe@perches.com>
Subject: mm:backing-dev: use sysfs_emit in macro defining functions
The cocci script used in commit bdacbb8d04f ("mm: Use sysfs_emit for
struct kobject * uses") does not convert the name##_show macro because the
macro uses concatenation via ##.
Convert it by hand.
Link: https://lkml.kernel.org/r/45ec6cfc177d743f9c0ebaf35e43969dce43af42.1605376435.git.joe@perches.com
Signed-off-by: Joe Perches <joe@perches.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org>
Cc: Hugh Dickins <hughd@google.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Pekka Enberg <penberg@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/backing-dev.c | 8 ++++----
1 file changed, 4 insertions(+), 4 deletions(-)
--- a/mm/backing-dev.c~mm-backing-dev-use-sysfs_emit-in-macro-defining-functions
+++ a/mm/backing-dev.c
@@ -150,11 +150,11 @@ static ssize_t read_ahead_kb_store(struc
#define BDI_SHOW(name, expr) \
static ssize_t name##_show(struct device *dev, \
- struct device_attribute *attr, char *page) \
+ struct device_attribute *attr, char *buf) \
{ \
struct backing_dev_info *bdi = dev_get_drvdata(dev); \
\
- return snprintf(page, PAGE_SIZE-1, "%lld\n", (long long)expr); \
+ return sysfs_emit(buf, "%lld\n", (long long)expr); \
} \
static DEVICE_ATTR_RW(name);
@@ -200,11 +200,11 @@ BDI_SHOW(max_ratio, bdi->max_ratio)
static ssize_t stable_pages_required_show(struct device *dev,
struct device_attribute *attr,
- char *page)
+ char *buf)
{
dev_warn_once(dev,
"the stable_pages_required attribute has been removed. Use the stable_writes queue attribute instead.\n");
- return snprintf(page, PAGE_SIZE-1, "%d\n", 0);
+ return sysfs_emit(buf, "%d\n", 0);
}
static DEVICE_ATTR_RO(stable_pages_required);
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 197/200] mm: shmem: convert shmem_enabled_show to use sysfs_emit_at
2020-12-15 3:02 incoming Andrew Morton
` (195 preceding siblings ...)
2020-12-15 3:14 ` [patch 196/200] mm:backing-dev: use sysfs_emit in macro defining functions Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:14 ` [patch 198/200] mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at Andrew Morton
` (3 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: akpm, cl, gregkh, hughd, iamjoonsoo.kim, joe, linux-mm,
mike.kravetz, mm-commits, penberg, rientjes, torvalds, willy
From: Joe Perches <joe@perches.com>
Subject: mm: shmem: convert shmem_enabled_show to use sysfs_emit_at
Update the function to use sysfs_emit_at while neatening the uses of
sprintf and overwriting the last space char with a newline to avoid
possible output buffer overflow.
Miscellanea:
o in shmem_enabled_show, the removal of the indirected use of fmt
allows __printf verification
Link: https://lkml.kernel.org/r/b612a93825e5ea330cb68d2e8b516e9687a06cc6.1605376435.git.joe@perches.com
Signed-off-by: Joe Perches <joe@perches.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org>
Cc: Hugh Dickins <hughd@google.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Pekka Enberg <penberg@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/shmem.c | 21 ++++++++++++---------
1 file changed, 12 insertions(+), 9 deletions(-)
--- a/mm/shmem.c~mm-shmem-convert-shmem_enabled_show-to-use-sysfs_emit_at
+++ a/mm/shmem.c
@@ -4020,7 +4020,7 @@ out2:
#if defined(CONFIG_TRANSPARENT_HUGEPAGE) && defined(CONFIG_SYSFS)
static ssize_t shmem_enabled_show(struct kobject *kobj,
- struct kobj_attribute *attr, char *buf)
+ struct kobj_attribute *attr, char *buf)
{
static const int values[] = {
SHMEM_HUGE_ALWAYS,
@@ -4030,16 +4030,19 @@ static ssize_t shmem_enabled_show(struct
SHMEM_HUGE_DENY,
SHMEM_HUGE_FORCE,
};
- int i, count;
+ int len = 0;
+ int i;
- for (i = 0, count = 0; i < ARRAY_SIZE(values); i++) {
- const char *fmt = shmem_huge == values[i] ? "[%s] " : "%s ";
-
- count += sprintf(buf + count, fmt,
- shmem_format_huge(values[i]));
+ for (i = 0; i < ARRAY_SIZE(values); i++) {
+ len += sysfs_emit_at(buf, len,
+ shmem_huge == values[i] ? "%s[%s]" : "%s%s",
+ i ? " " : "",
+ shmem_format_huge(values[i]));
}
- buf[count - 1] = '\n';
- return count;
+
+ len += sysfs_emit_at(buf, len, "\n");
+
+ return len;
}
static ssize_t shmem_enabled_store(struct kobject *kobj,
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 198/200] mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at
2020-12-15 3:02 incoming Andrew Morton
` (196 preceding siblings ...)
2020-12-15 3:14 ` [patch 197/200] mm: shmem: convert shmem_enabled_show to use sysfs_emit_at Andrew Morton
@ 2020-12-15 3:14 ` Andrew Morton
2020-12-15 3:15 ` [patch 199/200] mm: fix fall-through warnings for Clang Andrew Morton
` (2 subsequent siblings)
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:14 UTC (permalink / raw)
To: akpm, cl, gregkh, hughd, iamjoonsoo.kim, joe, linux-mm,
mike.kravetz, mm-commits, penberg, rientjes, torvalds, willy
From: Joe Perches <joe@perches.com>
Subject: mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at
Convert the unbounded uses of sprintf to sysfs_emit.
A few conversions may now not end in a newline if the output buffer is
overflowed.
Link: https://lkml.kernel.org/r/0c90a90f466167f8c37de4b737553cf49c4a277f.1605376435.git.joe@perches.com
Signed-off-by: Joe Perches <joe@perches.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org>
Cc: Hugh Dickins <hughd@google.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Pekka Enberg <penberg@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/slub.c | 146 ++++++++++++++++++++++++++--------------------------
1 file changed, 75 insertions(+), 71 deletions(-)
--- a/mm/slub.c~mm-slub-convert-sysfs-sprintf-family-to-sysfs_emit-sysfs_emit_at
+++ a/mm/slub.c
@@ -4724,7 +4724,7 @@ static void process_slab(struct loc_trac
}
static int list_locations(struct kmem_cache *s, char *buf,
- enum track_item alloc)
+ enum track_item alloc)
{
int len = 0;
unsigned long i;
@@ -4734,7 +4734,7 @@ static int list_locations(struct kmem_ca
if (!alloc_loc_track(&t, PAGE_SIZE / sizeof(struct location),
GFP_KERNEL)) {
- return sprintf(buf, "Out of memory\n");
+ return sysfs_emit(buf, "Out of memory\n");
}
/* Push back cpu slabs */
flush_all(s);
@@ -4757,50 +4757,45 @@ static int list_locations(struct kmem_ca
for (i = 0; i < t.count; i++) {
struct location *l = &t.loc[i];
- if (len > PAGE_SIZE - KSYM_SYMBOL_LEN - 100)
- break;
- len += sprintf(buf + len, "%7ld ", l->count);
+ len += sysfs_emit_at(buf, len, "%7ld ", l->count);
if (l->addr)
- len += sprintf(buf + len, "%pS", (void *)l->addr);
+ len += sysfs_emit_at(buf, len, "%pS", (void *)l->addr);
else
- len += sprintf(buf + len, "<not-available>");
+ len += sysfs_emit_at(buf, len, "<not-available>");
- if (l->sum_time != l->min_time) {
- len += sprintf(buf + len, " age=%ld/%ld/%ld",
- l->min_time,
- (long)div_u64(l->sum_time, l->count),
- l->max_time);
- } else
- len += sprintf(buf + len, " age=%ld",
- l->min_time);
+ if (l->sum_time != l->min_time)
+ len += sysfs_emit_at(buf, len, " age=%ld/%ld/%ld",
+ l->min_time,
+ (long)div_u64(l->sum_time,
+ l->count),
+ l->max_time);
+ else
+ len += sysfs_emit_at(buf, len, " age=%ld", l->min_time);
if (l->min_pid != l->max_pid)
- len += sprintf(buf + len, " pid=%ld-%ld",
- l->min_pid, l->max_pid);
+ len += sysfs_emit_at(buf, len, " pid=%ld-%ld",
+ l->min_pid, l->max_pid);
else
- len += sprintf(buf + len, " pid=%ld",
- l->min_pid);
+ len += sysfs_emit_at(buf, len, " pid=%ld",
+ l->min_pid);
if (num_online_cpus() > 1 &&
- !cpumask_empty(to_cpumask(l->cpus)) &&
- len < PAGE_SIZE - 60)
- len += scnprintf(buf + len, PAGE_SIZE - len - 50,
- " cpus=%*pbl",
- cpumask_pr_args(to_cpumask(l->cpus)));
-
- if (nr_online_nodes > 1 && !nodes_empty(l->nodes) &&
- len < PAGE_SIZE - 60)
- len += scnprintf(buf + len, PAGE_SIZE - len - 50,
- " nodes=%*pbl",
- nodemask_pr_args(&l->nodes));
+ !cpumask_empty(to_cpumask(l->cpus)))
+ len += sysfs_emit_at(buf, len, " cpus=%*pbl",
+ cpumask_pr_args(to_cpumask(l->cpus)));
+
+ if (nr_online_nodes > 1 && !nodes_empty(l->nodes))
+ len += sysfs_emit_at(buf, len, " nodes=%*pbl",
+ nodemask_pr_args(&l->nodes));
- len += sprintf(buf + len, "\n");
+ len += sysfs_emit_at(buf, len, "\n");
}
free_loc_track(&t);
if (!t.count)
- len += sprintf(buf, "No data\n");
+ len += sysfs_emit_at(buf, len, "No data\n");
+
return len;
}
#endif /* CONFIG_SLUB_DEBUG */
@@ -4897,12 +4892,13 @@ __setup("slub_memcg_sysfs=", setup_slub_
#endif
static ssize_t show_slab_objects(struct kmem_cache *s,
- char *buf, unsigned long flags)
+ char *buf, unsigned long flags)
{
unsigned long total = 0;
int node;
int x;
unsigned long *nodes;
+ int len = 0;
nodes = kcalloc(nr_node_ids, sizeof(unsigned long), GFP_KERNEL);
if (!nodes)
@@ -4991,15 +4987,19 @@ static ssize_t show_slab_objects(struct
nodes[node] += x;
}
}
- x = sprintf(buf, "%lu", total);
+
+ len += sysfs_emit_at(buf, len, "%lu", total);
#ifdef CONFIG_NUMA
- for (node = 0; node < nr_node_ids; node++)
+ for (node = 0; node < nr_node_ids; node++) {
if (nodes[node])
- x += sprintf(buf + x, " N%d=%lu",
- node, nodes[node]);
+ len += sysfs_emit_at(buf, len, " N%d=%lu",
+ node, nodes[node]);
+ }
#endif
+ len += sysfs_emit_at(buf, len, "\n");
kfree(nodes);
- return x + sprintf(buf + x, "\n");
+
+ return len;
}
#define to_slab_attr(n) container_of(n, struct slab_attribute, attr)
@@ -5021,37 +5021,37 @@ struct slab_attribute {
static ssize_t slab_size_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%u\n", s->size);
+ return sysfs_emit(buf, "%u\n", s->size);
}
SLAB_ATTR_RO(slab_size);
static ssize_t align_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%u\n", s->align);
+ return sysfs_emit(buf, "%u\n", s->align);
}
SLAB_ATTR_RO(align);
static ssize_t object_size_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%u\n", s->object_size);
+ return sysfs_emit(buf, "%u\n", s->object_size);
}
SLAB_ATTR_RO(object_size);
static ssize_t objs_per_slab_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%u\n", oo_objects(s->oo));
+ return sysfs_emit(buf, "%u\n", oo_objects(s->oo));
}
SLAB_ATTR_RO(objs_per_slab);
static ssize_t order_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%u\n", oo_order(s->oo));
+ return sysfs_emit(buf, "%u\n", oo_order(s->oo));
}
SLAB_ATTR_RO(order);
static ssize_t min_partial_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%lu\n", s->min_partial);
+ return sysfs_emit(buf, "%lu\n", s->min_partial);
}
static ssize_t min_partial_store(struct kmem_cache *s, const char *buf,
@@ -5071,7 +5071,7 @@ SLAB_ATTR(min_partial);
static ssize_t cpu_partial_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%u\n", slub_cpu_partial(s));
+ return sysfs_emit(buf, "%u\n", slub_cpu_partial(s));
}
static ssize_t cpu_partial_store(struct kmem_cache *s, const char *buf,
@@ -5096,13 +5096,13 @@ static ssize_t ctor_show(struct kmem_cac
{
if (!s->ctor)
return 0;
- return sprintf(buf, "%pS\n", s->ctor);
+ return sysfs_emit(buf, "%pS\n", s->ctor);
}
SLAB_ATTR_RO(ctor);
static ssize_t aliases_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%d\n", s->refcount < 0 ? 0 : s->refcount - 1);
+ return sysfs_emit(buf, "%d\n", s->refcount < 0 ? 0 : s->refcount - 1);
}
SLAB_ATTR_RO(aliases);
@@ -5135,7 +5135,7 @@ static ssize_t slabs_cpu_partial_show(st
int objects = 0;
int pages = 0;
int cpu;
- int len;
+ int len = 0;
for_each_online_cpu(cpu) {
struct page *page;
@@ -5148,52 +5148,53 @@ static ssize_t slabs_cpu_partial_show(st
}
}
- len = sprintf(buf, "%d(%d)", objects, pages);
+ len += sysfs_emit_at(buf, len, "%d(%d)", objects, pages);
#ifdef CONFIG_SMP
for_each_online_cpu(cpu) {
struct page *page;
page = slub_percpu_partial(per_cpu_ptr(s->cpu_slab, cpu));
-
- if (page && len < PAGE_SIZE - 20)
- len += sprintf(buf + len, " C%d=%d(%d)", cpu,
- page->pobjects, page->pages);
+ if (page)
+ len += sysfs_emit_at(buf, len, " C%d=%d(%d)",
+ cpu, page->pobjects, page->pages);
}
#endif
- return len + sprintf(buf + len, "\n");
+ len += sysfs_emit_at(buf, len, "\n");
+
+ return len;
}
SLAB_ATTR_RO(slabs_cpu_partial);
static ssize_t reclaim_account_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%d\n", !!(s->flags & SLAB_RECLAIM_ACCOUNT));
+ return sysfs_emit(buf, "%d\n", !!(s->flags & SLAB_RECLAIM_ACCOUNT));
}
SLAB_ATTR_RO(reclaim_account);
static ssize_t hwcache_align_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%d\n", !!(s->flags & SLAB_HWCACHE_ALIGN));
+ return sysfs_emit(buf, "%d\n", !!(s->flags & SLAB_HWCACHE_ALIGN));
}
SLAB_ATTR_RO(hwcache_align);
#ifdef CONFIG_ZONE_DMA
static ssize_t cache_dma_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%d\n", !!(s->flags & SLAB_CACHE_DMA));
+ return sysfs_emit(buf, "%d\n", !!(s->flags & SLAB_CACHE_DMA));
}
SLAB_ATTR_RO(cache_dma);
#endif
static ssize_t usersize_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%u\n", s->usersize);
+ return sysfs_emit(buf, "%u\n", s->usersize);
}
SLAB_ATTR_RO(usersize);
static ssize_t destroy_by_rcu_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%d\n", !!(s->flags & SLAB_TYPESAFE_BY_RCU));
+ return sysfs_emit(buf, "%d\n", !!(s->flags & SLAB_TYPESAFE_BY_RCU));
}
SLAB_ATTR_RO(destroy_by_rcu);
@@ -5212,33 +5213,33 @@ SLAB_ATTR_RO(total_objects);
static ssize_t sanity_checks_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%d\n", !!(s->flags & SLAB_CONSISTENCY_CHECKS));
+ return sysfs_emit(buf, "%d\n", !!(s->flags & SLAB_CONSISTENCY_CHECKS));
}
SLAB_ATTR_RO(sanity_checks);
static ssize_t trace_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%d\n", !!(s->flags & SLAB_TRACE));
+ return sysfs_emit(buf, "%d\n", !!(s->flags & SLAB_TRACE));
}
SLAB_ATTR_RO(trace);
static ssize_t red_zone_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%d\n", !!(s->flags & SLAB_RED_ZONE));
+ return sysfs_emit(buf, "%d\n", !!(s->flags & SLAB_RED_ZONE));
}
SLAB_ATTR_RO(red_zone);
static ssize_t poison_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%d\n", !!(s->flags & SLAB_POISON));
+ return sysfs_emit(buf, "%d\n", !!(s->flags & SLAB_POISON));
}
SLAB_ATTR_RO(poison);
static ssize_t store_user_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%d\n", !!(s->flags & SLAB_STORE_USER));
+ return sysfs_emit(buf, "%d\n", !!(s->flags & SLAB_STORE_USER));
}
SLAB_ATTR_RO(store_user);
@@ -5282,7 +5283,7 @@ SLAB_ATTR_RO(free_calls);
#ifdef CONFIG_FAILSLAB
static ssize_t failslab_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%d\n", !!(s->flags & SLAB_FAILSLAB));
+ return sysfs_emit(buf, "%d\n", !!(s->flags & SLAB_FAILSLAB));
}
SLAB_ATTR_RO(failslab);
#endif
@@ -5306,7 +5307,7 @@ SLAB_ATTR(shrink);
#ifdef CONFIG_NUMA
static ssize_t remote_node_defrag_ratio_show(struct kmem_cache *s, char *buf)
{
- return sprintf(buf, "%u\n", s->remote_node_defrag_ratio / 10);
+ return sysfs_emit(buf, "%u\n", s->remote_node_defrag_ratio / 10);
}
static ssize_t remote_node_defrag_ratio_store(struct kmem_cache *s,
@@ -5333,7 +5334,7 @@ static int show_stat(struct kmem_cache *
{
unsigned long sum = 0;
int cpu;
- int len;
+ int len = 0;
int *data = kmalloc_array(nr_cpu_ids, sizeof(int), GFP_KERNEL);
if (!data)
@@ -5346,16 +5347,19 @@ static int show_stat(struct kmem_cache *
sum += x;
}
- len = sprintf(buf, "%lu", sum);
+ len += sysfs_emit_at(buf, len, "%lu", sum);
#ifdef CONFIG_SMP
for_each_online_cpu(cpu) {
- if (data[cpu] && len < PAGE_SIZE - 20)
- len += sprintf(buf + len, " C%d=%u", cpu, data[cpu]);
+ if (data[cpu])
+ len += sysfs_emit_at(buf, len, " C%d=%u",
+ cpu, data[cpu]);
}
#endif
kfree(data);
- return len + sprintf(buf + len, "\n");
+ len += sysfs_emit_at(buf, len, "\n");
+
+ return len;
}
static void clear_stat(struct kmem_cache *s, enum stat_item si)
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 199/200] mm: fix fall-through warnings for Clang
2020-12-15 3:02 incoming Andrew Morton
` (197 preceding siblings ...)
2020-12-15 3:14 ` [patch 198/200] mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at Andrew Morton
@ 2020-12-15 3:15 ` Andrew Morton
2020-12-15 3:15 ` [patch 200/200] mm: cleanup kstrto*() usage Andrew Morton
2020-12-15 3:25 ` incoming Linus Torvalds
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:15 UTC (permalink / raw)
To: akpm, gustavoars, linux-mm, mm-commits, torvalds
From: "Gustavo A. R. Silva" <gustavoars@kernel.org>
Subject: mm: fix fall-through warnings for Clang
In preparation to enable -Wimplicit-fallthrough for Clang, fix a couple of
warnings by explicitly adding a break statement instead of just letting
the code fall through to the next, and by adding a fallthrough
pseudo-keyword in places where the code is intended to fall through.
Link: https://github.com/KSPP/linux/issues/115
Link: https://lkml.kernel.org/r/f5756988b8842a3f10008fbc5b0a654f828920a9.1605896059.git.gustavoars@kernel.org
Signed-off-by: Gustavo A. R. Silva <gustavoars@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/mm_init.c | 1 +
mm/vmscan.c | 1 +
2 files changed, 2 insertions(+)
--- a/mm/mm_init.c~mm-fix-fall-through-warnings-for-clang
+++ a/mm/mm_init.c
@@ -173,6 +173,7 @@ static int __meminit mm_compute_batch_no
case MEM_ONLINE:
case MEM_OFFLINE:
mm_compute_batch(sysctl_overcommit_memory);
+ break;
default:
break;
}
--- a/mm/vmscan.c~mm-fix-fall-through-warnings-for-clang
+++ a/mm/vmscan.c
@@ -1369,6 +1369,7 @@ static unsigned int shrink_page_list(str
if (PageDirty(page) || PageWriteback(page))
goto keep_locked;
mapping = page_mapping(page);
+ fallthrough;
case PAGE_CLEAN:
; /* try to free the page below */
}
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* [patch 200/200] mm: cleanup kstrto*() usage
2020-12-15 3:02 incoming Andrew Morton
` (198 preceding siblings ...)
2020-12-15 3:15 ` [patch 199/200] mm: fix fall-through warnings for Clang Andrew Morton
@ 2020-12-15 3:15 ` Andrew Morton
2020-12-15 3:25 ` incoming Linus Torvalds
200 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 3:15 UTC (permalink / raw)
To: adobriyan, akpm, linux-mm, mm-commits, torvalds
From: Alexey Dobriyan <adobriyan@gmail.com>
Subject: mm: cleanup kstrto*() usage
Range checks can folded into proper conversion function. kstrto*() exist
for all arithmetic types.
Link: https://lkml.kernel.org/r/20201122123759.GC92364@localhost.localdomain
Signed-off-by: Alexey Dobriyan <adobriyan@gmail.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
mm/khugepaged.c | 18 +++++++++---------
mm/ksm.c | 18 +++++++++---------
2 files changed, 18 insertions(+), 18 deletions(-)
--- a/mm/khugepaged.c~mm-cleanup-kstrto-usage
+++ a/mm/khugepaged.c
@@ -133,11 +133,11 @@ static ssize_t scan_sleep_millisecs_stor
struct kobj_attribute *attr,
const char *buf, size_t count)
{
- unsigned long msecs;
+ unsigned int msecs;
int err;
- err = kstrtoul(buf, 10, &msecs);
- if (err || msecs > UINT_MAX)
+ err = kstrtouint(buf, 10, &msecs);
+ if (err)
return -EINVAL;
khugepaged_scan_sleep_millisecs = msecs;
@@ -161,11 +161,11 @@ static ssize_t alloc_sleep_millisecs_sto
struct kobj_attribute *attr,
const char *buf, size_t count)
{
- unsigned long msecs;
+ unsigned int msecs;
int err;
- err = kstrtoul(buf, 10, &msecs);
- if (err || msecs > UINT_MAX)
+ err = kstrtouint(buf, 10, &msecs);
+ if (err)
return -EINVAL;
khugepaged_alloc_sleep_millisecs = msecs;
@@ -188,11 +188,11 @@ static ssize_t pages_to_scan_store(struc
struct kobj_attribute *attr,
const char *buf, size_t count)
{
+ unsigned int pages;
int err;
- unsigned long pages;
- err = kstrtoul(buf, 10, &pages);
- if (err || !pages || pages > UINT_MAX)
+ err = kstrtouint(buf, 10, &pages);
+ if (err || !pages)
return -EINVAL;
khugepaged_pages_to_scan = pages;
--- a/mm/ksm.c~mm-cleanup-kstrto-usage
+++ a/mm/ksm.c
@@ -2840,11 +2840,11 @@ static ssize_t sleep_millisecs_store(str
struct kobj_attribute *attr,
const char *buf, size_t count)
{
- unsigned long msecs;
+ unsigned int msecs;
int err;
- err = kstrtoul(buf, 10, &msecs);
- if (err || msecs > UINT_MAX)
+ err = kstrtouint(buf, 10, &msecs);
+ if (err)
return -EINVAL;
ksm_thread_sleep_millisecs = msecs;
@@ -2864,11 +2864,11 @@ static ssize_t pages_to_scan_store(struc
struct kobj_attribute *attr,
const char *buf, size_t count)
{
+ unsigned int nr_pages;
int err;
- unsigned long nr_pages;
- err = kstrtoul(buf, 10, &nr_pages);
- if (err || nr_pages > UINT_MAX)
+ err = kstrtouint(buf, 10, &nr_pages);
+ if (err)
return -EINVAL;
ksm_thread_pages_to_scan = nr_pages;
@@ -2886,11 +2886,11 @@ static ssize_t run_show(struct kobject *
static ssize_t run_store(struct kobject *kobj, struct kobj_attribute *attr,
const char *buf, size_t count)
{
+ unsigned int flags;
int err;
- unsigned long flags;
- err = kstrtoul(buf, 10, &flags);
- if (err || flags > UINT_MAX)
+ err = kstrtouint(buf, 10, &flags);
+ if (err)
return -EINVAL;
if (flags > KSM_RUN_UNMERGE)
return -EINVAL;
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-12-15 3:02 incoming Andrew Morton
` (199 preceding siblings ...)
2020-12-15 3:15 ` [patch 200/200] mm: cleanup kstrto*() usage Andrew Morton
@ 2020-12-15 3:25 ` Linus Torvalds
2020-12-15 3:30 ` incoming Linus Torvalds
200 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2020-12-15 3:25 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM
On Mon, Dec 14, 2020 at 7:02 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442.
I haven't actually processed the patches yet, but I have a question
for Konstantin wrt b4.
All the patches except for _one_ get a nice little green check-mark
next to them when I use 'git am' on this series.
The one that did not was [patch 192/200].
I have no idea why - and it doesn't matter a lot to me, it just stood
out as being different. I'm assuming Andrew has started doing patch
attestation, and that patch failed. But if so, maybe Konstantin wants
to know what went wrong.
Konstantin?
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-12-15 3:25 ` incoming Linus Torvalds
@ 2020-12-15 3:30 ` Linus Torvalds
2020-12-15 14:04 ` incoming Konstantin Ryabitsev
0 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2020-12-15 3:30 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM
On Mon, Dec 14, 2020 at 7:25 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> All the patches except for _one_ get a nice little green check-mark
> next to them when I use 'git am' on this series.
>
> The one that did not was [patch 192/200].
>
> I have no idea why
Hmm. It looks like that patch is the only one in the series with the
">From" marker in the commit message, from the silly "clarify that
this isn't the first line in a new message in mbox format".
And "b4 am" has turned the single ">" into two, making the stupid
marker worse, and actually corrupting the end result.
Coincidence? Or cause?
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: [patch 020/200] dma-buf: use krealloc_array()
2020-12-15 3:04 ` [patch 020/200] dma-buf: " Andrew Morton
@ 2020-12-15 7:42 ` Christian König
0 siblings, 0 replies; 419+ messages in thread
From: Christian König @ 2020-12-15 7:42 UTC (permalink / raw)
To: Andrew Morton, airlied, alexander.shishkin, andriy.shevchenko,
bgolaszewski, bp, bp, cl, daniel.vetter, daniel, gustavo,
iamjoonsoo.kim, james.morse, jasowang, linus.walleij, linux-mm,
maarten.lankhorst, mchehab, mm-commits, mripard, mst, penberg,
perex, rientjes, rric, sumit.semwal, tiwai, tiwai, tony.luck,
torvalds, tzimmermann, vbabka
Am 15.12.20 um 04:04 schrieb Andrew Morton:
> From: Bartosz Golaszewski <bgolaszewski@baylibre.com>
> Subject: dma-buf: use krealloc_array()
>
> Use the helper that checks for overflows internally instead of manually
> calculating the size of the new array.
>
> Link: https://nam11.safelinks.protection.outlook.com/?url=https%3A%2F%2Flkml.kernel.org%2Fr%2F20201109110654.12547-10-brgl%40bgdev.pl&data=04%7C01%7Cchristian.koenig%40amd.com%7C6b47239993c14bae4a2608d8a0a622ec%7C3dd8961fe4884e608e11a82d994e183d%7C0%7C0%7C637435982788605958%7CUnknown%7CTWFpbGZsb3d8eyJWIjoiMC4wLjAwMDAiLCJQIjoiV2luMzIiLCJBTiI6Ik1haWwiLCJXVCI6Mn0%3D%7C1000&sdata=nXA6nN0XwBzItUWV8izu5MEsUboZ8dSJUr88geKWsuY%3D&reserved=0
> Signed-off-by: Bartosz Golaszewski <bgolaszewski@baylibre.com>
> Acked-by: Christian König <christian.koenig@amd.com>
> Cc: Alexander Shishkin <alexander.shishkin@linux.intel.com>
> Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com>
> Cc: Borislav Petkov <bp@alien8.de>
> Cc: Borislav Petkov <bp@suse.de>
> Cc: Christoph Lameter <cl@linux.com>
> Cc: Daniel Vetter <daniel@ffwll.ch>
> Cc: Daniel Vetter <daniel.vetter@ffwll.ch>
> Cc: David Airlie <airlied@linux.ie>
> Cc: David Rientjes <rientjes@google.com>
> Cc: Gustavo Padovan <gustavo@padovan.org>
> Cc: James Morse <james.morse@arm.com>
> Cc: Jaroslav Kysela <perex@perex.cz>
> Cc: Jason Wang <jasowang@redhat.com>
> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
> Cc: Linus Walleij <linus.walleij@linaro.org>
> Cc: Maarten Lankhorst <maarten.lankhorst@linux.intel.com>
> Cc: Mauro Carvalho Chehab <mchehab@kernel.org>
> Cc: Maxime Ripard <mripard@kernel.org>
> Cc: "Michael S . Tsirkin" <mst@redhat.com>
> Cc: Pekka Enberg <penberg@kernel.org>
> Cc: Robert Richter <rric@kernel.org>
> Cc: Sumit Semwal <sumit.semwal@linaro.org>
> Cc: Takashi Iwai <tiwai@suse.com>
> Cc: Takashi Iwai <tiwai@suse.de>
> Cc: Thomas Zimmermann <tzimmermann@suse.de>
> Cc: Tony Luck <tony.luck@intel.com>
> Cc: Vlastimil Babka <vbabka@suse.cz>
> Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
Reviewed-by: Christian König <christian.koenig@amd.com>
> ---
>
> drivers/dma-buf/sync_file.c | 3 +--
> 1 file changed, 1 insertion(+), 2 deletions(-)
>
> --- a/drivers/dma-buf/sync_file.c~dma-buf-use-krealloc_array
> +++ a/drivers/dma-buf/sync_file.c
> @@ -270,8 +270,7 @@ static struct sync_file *sync_file_merge
> fences[i++] = dma_fence_get(a_fences[0]);
>
> if (num_fences > i) {
> - nfences = krealloc(fences, i * sizeof(*fences),
> - GFP_KERNEL);
> + nfences = krealloc_array(fences, i, sizeof(*fences), GFP_KERNEL);
> if (!nfences)
> goto err;
>
> _
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-12-15 3:30 ` incoming Linus Torvalds
@ 2020-12-15 14:04 ` Konstantin Ryabitsev
0 siblings, 0 replies; 419+ messages in thread
From: Konstantin Ryabitsev @ 2020-12-15 14:04 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Andrew Morton, mm-commits, Linux-MM
On Mon, Dec 14, 2020 at 07:30:54PM -0800, Linus Torvalds wrote:
> > All the patches except for _one_ get a nice little green check-mark
> > next to them when I use 'git am' on this series.
> >
> > The one that did not was [patch 192/200].
> >
> > I have no idea why
>
> Hmm. It looks like that patch is the only one in the series with the
> ">From" marker in the commit message, from the silly "clarify that
> this isn't the first line in a new message in mbox format".
>
> And "b4 am" has turned the single ">" into two, making the stupid
> marker worse, and actually corrupting the end result.
It's a bug in b4 that I overlooked. Public-inbox emits mboxrd-formatted
.mbox files, while Python's mailbox.mbox consumes mboxo only. The main
distinction between the two is precisely that mboxrd will convert
">From " into ">>From " in an attempt to avoid corruption during
escape/unescape (it didn't end up fixing the problem 100% and mostly
introduced incompatibilities like this one).
I have a fix in master/stable-0.6.y and I'll release a 0.6.2 before the
end of the week.
Thanks for the report.
-K
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: [patch 012/200] mm: slab: clarify krealloc()'s behavior with __GFP_ZERO
2020-12-15 3:03 ` [patch 012/200] mm: slab: clarify krealloc()'s behavior with __GFP_ZERO Andrew Morton
@ 2020-12-15 14:30 ` Christian König
2020-12-15 19:08 ` Andy Shevchenko
0 siblings, 1 reply; 419+ messages in thread
From: Christian König @ 2020-12-15 14:30 UTC (permalink / raw)
To: Andrew Morton, airlied, alexander.shishkin, andriy.shevchenko,
bgolaszewski, bp, bp, cl, daniel.vetter, daniel, gustavo,
iamjoonsoo.kim, james.morse, jasowang, linus.walleij, linux-mm,
maarten.lankhorst, mchehab, mm-commits, mripard, mst, penberg,
perex, rientjes, rric, sumit.semwal, tiwai, tiwai, tony.luck,
torvalds, tzimmermann, vbabka
Am 15.12.20 um 04:03 schrieb Andrew Morton:
> From: Bartosz Golaszewski <bgolaszewski@baylibre.com>
> Subject: mm: slab: clarify krealloc()'s behavior with __GFP_ZERO
>
> Patch series "slab: provide and use krealloc_array()", v3.
>
> Andy brought to my attention the fact that users allocating an array of
> equally sized elements should check if the size multiplication doesn't
> overflow. This is why we have helpers like kmalloc_array().
>
> However we don't have krealloc_array() equivalent and there are many users
> who do their own multiplication when calling krealloc() for arrays.
>
> This series provides krealloc_array() and uses it in a couple places.
>
> A separate series will follow adding devm_krealloc_array() which is needed
> in the xilinx adc driver.
>
>
> This patch (of 9):
>
> __GFP_ZERO is ignored by krealloc() (unless we fall-back to kmalloc()
> path, in which case it's honored). Point that out in the kerneldoc.
>
> Link: https://lkml.kernel.org/r/20201109110654.12547-1-brgl@bgdev.pl
> Link: https://lkml.kernel.org/r/20201109110654.12547-2-brgl@bgdev.pl
> Signed-off-by: Bartosz Golaszewski <bgolaszewski@baylibre.com>
> Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com>
> Cc: Sumit Semwal <sumit.semwal@linaro.org>
> Cc: Gustavo Padovan <gustavo@padovan.org>
> Cc: Christian Knig <christian.koenig@amd.com>
> Cc: Mauro Carvalho Chehab <mchehab@kernel.org>
> Cc: Borislav Petkov <bp@alien8.de>
> Cc: Tony Luck <tony.luck@intel.com>
> Cc: James Morse <james.morse@arm.com>
> Cc: Robert Richter <rric@kernel.org>
> Cc: Maarten Lankhorst <maarten.lankhorst@linux.intel.com>
> Cc: Maxime Ripard <mripard@kernel.org>
> Cc: Thomas Zimmermann <tzimmermann@suse.de>
> Cc: David Airlie <airlied@linux.ie>
> Cc: Daniel Vetter <daniel@ffwll.ch>
> Cc: Alexander Shishkin <alexander.shishkin@linux.intel.com>
> Cc: Linus Walleij <linus.walleij@linaro.org>
> Cc: "Michael S . Tsirkin" <mst@redhat.com>
> Cc: Jason Wang <jasowang@redhat.com>
> Cc: Christoph Lameter <cl@linux.com>
> Cc: Pekka Enberg <penberg@kernel.org>
> Cc: David Rientjes <rientjes@google.com>
> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
> Cc: Jaroslav Kysela <perex@perex.cz>
> Cc: Takashi Iwai <tiwai@suse.com>
> Cc: Borislav Petkov <bp@suse.de>
> Cc: Daniel Vetter <daniel.vetter@ffwll.ch>
> Cc: Takashi Iwai <tiwai@suse.de>
> Cc: Vlastimil Babka <vbabka@suse.cz>
> Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
> ---
>
> mm/slab_common.c | 6 +++---
> 1 file changed, 3 insertions(+), 3 deletions(-)
>
> --- a/mm/slab_common.c~mm-slab-clarify-kreallocs-behavior-with-__gfp_zero
> +++ a/mm/slab_common.c
> @@ -1091,9 +1091,9 @@ static __always_inline void *__do_kreall
> * @flags: the type of memory to allocate.
> *
> * The contents of the object pointed to are preserved up to the
> - * lesser of the new and old sizes. If @p is %NULL, krealloc()
> - * behaves exactly like kmalloc(). If @new_size is 0 and @p is not a
> - * %NULL pointer, the object pointed to is freed.
> + * lesser of the new and old sizes (__GFP_ZERO flag is effectively ignored).
> + * If @p is %NULL, krealloc() behaves exactly like kmalloc(). If @new_size
> + * is 0 and @p is not a %NULL pointer, the object pointed to is freed.
Question: Can the fact that __GFP_ZERO is effectively ignored cause an
information leak if new size is larger than old size and the array is
somehow copied to user space?
I think the answer is no, but just wanted to double check. Maybe we
should note that here.
Thanks,
Christian.
> *
> * Return: pointer to the allocated memory or %NULL in case of error
> */
> _
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: [patch 022/200] mm/slab: rerform init_on_free earlier
2020-12-15 3:04 ` [patch 022/200] mm/slab: rerform init_on_free earlier Andrew Morton
@ 2020-12-15 16:45 ` Alexander Potapenko
2020-12-15 20:46 ` Alexander Popov
0 siblings, 1 reply; 419+ messages in thread
From: Alexander Potapenko @ 2020-12-15 16:45 UTC (permalink / raw)
To: Andrew Morton
Cc: Alexander Popov, Christoph Lameter, Joonsoo Kim,
Linux Memory Management List, mm-commits, Pekka Enberg,
David Rientjes, Linus Torvalds
On Tue, Dec 15, 2020 at 4:04 AM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> From: Alexander Popov <alex.popov@linux.com>
> Subject: mm/slab: rerform init_on_free earlier
Nit: s/rerform/perform
>
> Currently in CONFIG_SLAB init_on_free happens too late, and heap objects
> go to the heap quarantine not being erased.
>
> Lets move init_on_free clearing before calling kasan_slab_free(). In that
> case heap quarantine will store erased objects, similarly to CONFIG_SLUB=y
> behavior.
>
> Link: https://lkml.kernel.org/r/20201210183729.1261524-1-alex.popov@linux.com
> Signed-off-by: Alexander Popov <alex.popov@linux.com>
> Reviewed-by: Alexander Potapenko <glider@google.com>
> Acked-by: David Rientjes <rientjes@google.com>
> Acked-by: Joonsoo Kim <iamjoonsoo.kim@lge.com>
> Cc: Christoph Lameter <cl@linux.com>
> Cc: Pekka Enberg <penberg@kernel.org>
> Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
> ---
>
> mm/slab.c | 5 +++--
> 1 file changed, 3 insertions(+), 2 deletions(-)
>
> --- a/mm/slab.c~mm-slab-perform-init_on_free-earlier
> +++ a/mm/slab.c
> @@ -3417,6 +3417,9 @@ free_done:
> static __always_inline void __cache_free(struct kmem_cache *cachep, void *objp,
> unsigned long caller)
> {
> + if (unlikely(slab_want_init_on_free(cachep)))
> + memset(objp, 0, cachep->object_size);
> +
> /* Put the object into the quarantine, don't touch it for now. */
> if (kasan_slab_free(cachep, objp, _RET_IP_))
> return;
> @@ -3435,8 +3438,6 @@ void ___cache_free(struct kmem_cache *ca
> struct array_cache *ac = cpu_cache_get(cachep);
>
> check_irq_off();
> - if (unlikely(slab_want_init_on_free(cachep)))
> - memset(objp, 0, cachep->object_size);
> kmemleak_free_recursive(objp, cachep->flags);
> objp = cache_free_debugcheck(cachep, objp, caller);
> memcg_slab_free_hook(cachep, &objp, 1);
> _
--
Alexander Potapenko
Software Engineer
Google Germany GmbH
Erika-Mann-Straße, 33
80636 München
Geschäftsführer: Paul Manicle, Halimah DeLaine Prado
Registergericht und -nummer: Hamburg, HRB 86891
Sitz der Gesellschaft: Hamburg
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: [patch 012/200] mm: slab: clarify krealloc()'s behavior with __GFP_ZERO
2020-12-15 14:30 ` Christian König
@ 2020-12-15 19:08 ` Andy Shevchenko
2020-12-16 7:47 ` Christian König
0 siblings, 1 reply; 419+ messages in thread
From: Andy Shevchenko @ 2020-12-15 19:08 UTC (permalink / raw)
To: Christian König
Cc: Andrew Morton, airlied, alexander.shishkin, bgolaszewski, bp, bp,
cl, daniel.vetter, daniel, gustavo, iamjoonsoo.kim, james.morse,
jasowang, linus.walleij, linux-mm, maarten.lankhorst, mchehab,
mm-commits, mripard, mst, penberg, perex, rientjes, rric,
sumit.semwal, tiwai, tiwai, tony.luck, torvalds, tzimmermann,
vbabka
On Tue, Dec 15, 2020 at 03:30:44PM +0100, Christian König wrote:
> Am 15.12.20 um 04:03 schrieb Andrew Morton:
...
> Question: Can the fact that __GFP_ZERO is effectively ignored cause an
> information leak if new size is larger than old size and the array is
> somehow copied to user space?
>
> I think the answer is no, but just wanted to double check. Maybe we should
> note that here.
kmalloc()/kmalloc_array()/etc has the same. Should it be mentioned there as well?
--
With Best Regards,
Andy Shevchenko
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: [patch 075/200] mm: speedup mremap on 1GB or larger regions
2020-12-15 3:07 ` [patch 075/200] mm: speedup mremap on 1GB or larger regions Andrew Morton
@ 2020-12-15 19:52 ` Linus Torvalds
2020-12-15 23:16 ` Kalesh Singh
0 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2020-12-15 19:52 UTC (permalink / raw)
To: Andrew Morton
Cc: almasrymina, Aneesh Kumar K.V, Anshuman Khandual, Arnd Bergmann,
Brian Geffon, Borislav Petkov, Catalin Marinas, Christian Brauner,
Dave Hansen, Frederic Weisbecker, gshan, hnaveed, Peter Anvin,
John Hubbard, justin.he, kaleshsingh, Kees Cook,
Kirill A . Shutemov, Krzysztof Kozlowski, Linux-MM, linuxram,
kernel test robot, Lokesh Gidra, Mark Rutland, Masahiro Yamada,
Masami Hiramatsu, minchan, Ingo Molnar, mm-commits,
Peter Zijlstra, Ralph Campbell, Mike Rapoport, Sami Tolvanen,
sandipan, Shuah Khan, SeongJae Park, Steven Price,
Suren Baghdasaryan, Thomas Gleixner, Will Deacon, ziy
On Mon, Dec 14, 2020 at 7:07 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> From: Kalesh Singh <kaleshsingh@google.com>
> Subject: mm: speedup mremap on 1GB or larger regions
>
> Android needs to move large memory regions for garbage collection. The GC
> requires moving physical pages of multi-gigabyte heap using mremap.
> During this move, the application threads have to be paused for
> correctness. It is critical to keep this pause as short as possible to
> avoid jitters during user interaction.
It would have been good to add a pointer to the PMD case we did earlier..
Also, a few comments on the actual performance in practice would be
nice. Does this actually *trigger* on Android in practice?
I can well imagine the PMD case triggering easily, but are there
real-life Android loads that really do gigabyte heaps? That sounds a
bit odd to me.
So I don't have any complaints about the patch, but I just wonder how
_realistic_ this actually is, particularly the alleged 13x improvement
in timing...
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-12-15 20:32 Andrew Morton
2020-12-15 21:00 ` incoming Linus Torvalds
2020-12-15 22:48 ` incoming Linus Torvalds
0 siblings, 2 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 20:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
- more MM work: a memcg scalability improvememt
19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.
Subsystems affected by this patch series:
Alex Shi <alex.shi@linux.alibaba.com>:
Patch series "per memcg lru lock", v21:
mm/thp: move lru_add_page_tail() to huge_memory.c
mm/thp: use head for head page in lru_add_page_tail()
mm/thp: simplify lru_add_page_tail()
mm/thp: narrow lru locking
mm/vmscan: remove unnecessary lruvec adding
mm/rmap: stop store reordering issue on page->mapping
Hugh Dickins <hughd@google.com>:
mm: page_idle_get_page() does not need lru_lock
Alex Shi <alex.shi@linux.alibaba.com>:
mm/memcg: add debug checking in lock_page_memcg
mm/swap.c: fold vm event PGROTATED into pagevec_move_tail_fn
mm/lru: move lock into lru_note_cost
mm/vmscan: remove lruvec reget in move_pages_to_lru
mm/mlock: remove lru_lock on TestClearPageMlocked
mm/mlock: remove __munlock_isolate_lru_page()
mm/lru: introduce TestClearPageLRU()
mm/compaction: do page isolation first in compaction
mm/swap.c: serialize memcg changes in pagevec_lru_move_fn
mm/lru: replace pgdat lru_lock with lruvec lock
Alexander Duyck <alexander.h.duyck@linux.intel.com>:
mm/lru: introduce relock_page_lruvec()
Hugh Dickins <hughd@google.com>:
mm/lru: revise the comments of lru_lock
Documentation/admin-guide/cgroup-v1/memcg_test.rst | 15 -
Documentation/admin-guide/cgroup-v1/memory.rst | 23 -
Documentation/trace/events-kmem.rst | 2
Documentation/vm/unevictable-lru.rst | 22 -
include/linux/memcontrol.h | 110 +++++++
include/linux/mm_types.h | 2
include/linux/mmzone.h | 6
include/linux/page-flags.h | 1
include/linux/swap.h | 4
mm/compaction.c | 98 ++++---
mm/filemap.c | 4
mm/huge_memory.c | 109 ++++---
mm/memcontrol.c | 84 +++++-
mm/mlock.c | 93 ++----
mm/mmzone.c | 1
mm/page_alloc.c | 1
mm/page_idle.c | 4
mm/rmap.c | 12
mm/swap.c | 292 ++++++++-------------
mm/vmscan.c | 239 ++++++++---------
mm/workingset.c | 2
21 files changed, 644 insertions(+), 480 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: [patch 022/200] mm/slab: rerform init_on_free earlier
2020-12-15 16:45 ` Alexander Potapenko
@ 2020-12-15 20:46 ` Alexander Popov
2020-12-15 21:08 ` Alexander Popov
0 siblings, 1 reply; 419+ messages in thread
From: Alexander Popov @ 2020-12-15 20:46 UTC (permalink / raw)
To: Alexander Potapenko, Andrew Morton
Cc: Christoph Lameter, Joonsoo Kim, Linux Memory Management List,
mm-commits, Pekka Enberg, David Rientjes, Linus Torvalds
On 15.12.2020 19:45, Alexander Potapenko wrote:
> On Tue, Dec 15, 2020 at 4:04 AM Andrew Morton <akpm@linux-foundation.org> wrote:
>>
>> From: Alexander Popov <alex.popov@linux.com>
>> Subject: mm/slab: rerform init_on_free earlier
>
> Nit: s/rerform/perform
Right, thanks, Alexander!
Andrew, should I resend the patch?
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-12-15 20:32 incoming Andrew Morton
@ 2020-12-15 21:00 ` Linus Torvalds
2020-12-15 22:48 ` incoming Linus Torvalds
1 sibling, 0 replies; 419+ messages in thread
From: Linus Torvalds @ 2020-12-15 21:00 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> - more MM work: a memcg scalability improvememt
>
> 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.
I'm not seeing patch 10/19 at all.
And patch 19/19 is corrupted and has an attachment with a '^P'
character in it. I could fix it up, but with the missing patch in the
middle I'm not going to even try. 'b4' is also very unhappy about that
patch 19/19.
I don't know what went wrong, but I'll ignore this send - please
re-send the series at your leisure, ok?
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: [patch 022/200] mm/slab: rerform init_on_free earlier
2020-12-15 20:46 ` Alexander Popov
@ 2020-12-15 21:08 ` Alexander Popov
0 siblings, 0 replies; 419+ messages in thread
From: Alexander Popov @ 2020-12-15 21:08 UTC (permalink / raw)
To: Alexander Potapenko, Andrew Morton
Cc: Christoph Lameter, Joonsoo Kim, Linux Memory Management List,
mm-commits, Pekka Enberg, David Rientjes, Linus Torvalds
On 15.12.2020 23:46, Alexander Popov wrote:
> On 15.12.2020 19:45, Alexander Potapenko wrote:
>> On Tue, Dec 15, 2020 at 4:04 AM Andrew Morton <akpm@linux-foundation.org> wrote:
>>>
>>> From: Alexander Popov <alex.popov@linux.com>
>>> Subject: mm/slab: rerform init_on_free earlier
>>
>> Nit: s/rerform/perform
>
> Right, thanks, Alexander!
>
> Andrew, should I resend the patch?
Hm, this typo is not from my patch.
I guess my resending is not needed.
Best regards,
Alexander
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-12-15 20:32 incoming Andrew Morton
2020-12-15 21:00 ` incoming Linus Torvalds
@ 2020-12-15 22:48 ` Linus Torvalds
2020-12-15 22:49 ` incoming Linus Torvalds
1 sibling, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2020-12-15 22:48 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> - more MM work: a memcg scalability improvememt
>
> 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.
With your re-send, I get all patches, but they don't actually apply cleanly.
Is that base correct?
I get
error: patch failed: mm/huge_memory.c:2750
error: mm/huge_memory.c: patch does not apply
Patch failed at 0004 mm/thp: narrow lru locking
for that patch "[patch 04/19] mm/thp: narrow lru locking", and that's
definitely true: the patch fragment has
@@ -2750,7 +2751,7 @@ int split_huge_page_to_list(struct page
__dec_lruvec_page_state(head, NR_FILE_THPS);
}
- __split_huge_page(page, list, end, flags);
+ __split_huge_page(page, list, end);
ret = 0;
} else {
if (IS_ENABLED(CONFIG_DEBUG_VM) && mapcount) {
but that __dec_lruvec_page_state() conversion was done by your
previous commit series.
So I have the feeling that what you actually mean by "base" isn't
actually really the base for that series at all..
I will try to apply it on top of my merge of your previous series instead.
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-12-15 22:48 ` incoming Linus Torvalds
@ 2020-12-15 22:49 ` Linus Torvalds
2020-12-15 22:55 ` incoming Andrew Morton
0 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2020-12-15 22:49 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> I will try to apply it on top of my merge of your previous series instead.
Yes, then it applies cleanly. So apparently we just have different
concepts of what really constitutes a "base" for applying your series.
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-12-15 22:49 ` incoming Linus Torvalds
@ 2020-12-15 22:55 ` Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-15 22:55 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Linux-MM, mm-commits
On Tue, 15 Dec 2020 14:49:24 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > I will try to apply it on top of my merge of your previous series instead.
>
> Yes, then it applies cleanly. So apparently we just have different
> concepts of what really constitutes a "base" for applying your series.
>
oop, sorry, yes, the "based on" thing was wrong because I had two
series in flight simultaneously. I've never tried that before..
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: [patch 075/200] mm: speedup mremap on 1GB or larger regions
2020-12-15 19:52 ` Linus Torvalds
@ 2020-12-15 23:16 ` Kalesh Singh
0 siblings, 0 replies; 419+ messages in thread
From: Kalesh Singh @ 2020-12-15 23:16 UTC (permalink / raw)
To: Linus Torvalds
Cc: Andrew Morton, Mina Almasry, Aneesh Kumar K.V, Anshuman Khandual,
Arnd Bergmann, Brian Geffon, Borislav Petkov, Catalin Marinas,
Christian Brauner, Dave Hansen, Frederic Weisbecker, Gavin Shan,
Hassan Naveed, Peter Anvin, John Hubbard, Jia He, Kees Cook,
Kirill A . Shutemov, Krzysztof Kozlowski, Linux-MM, Ram Pai,
kernel test robot, Lokesh Gidra, Mark Rutland, Masahiro Yamada,
Masami Hiramatsu, Minchan Kim, Ingo Molnar, mm-commits,
Peter Zijlstra, Ralph Campbell, Mike Rapoport, Sami Tolvanen,
Sandipan Das, Shuah Khan, SeongJae Park, Steven Price,
Suren Baghdasaryan, Thomas Gleixner, Will Deacon, Zi Yan
On Tue, Dec 15, 2020 at 2:59 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> On Mon, Dec 14, 2020 at 7:07 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > From: Kalesh Singh <kaleshsingh@google.com>
> > Subject: mm: speedup mremap on 1GB or larger regions
> >
> > Android needs to move large memory regions for garbage collection. The GC
> > requires moving physical pages of multi-gigabyte heap using mremap.
> > During this move, the application threads have to be paused for
> > correctness. It is critical to keep this pause as short as possible to
> > avoid jitters during user interaction.
>
> It would have been good to add a pointer to the PMD case we did earlier..
>
> Also, a few comments on the actual performance in practice would be
> nice. Does this actually *trigger* on Android in practice?
>
> I can well imagine the PMD case triggering easily, but are there
> real-life Android loads that really do gigabyte heaps? That sounds a
> bit odd to me.
>
> So I don't have any complaints about the patch, but I just wonder how
> _realistic_ this actually is, particularly the alleged 13x improvement
> in timing...
>
Hi Linus,
The new GC for Android requires moving the Java heap pages to a
separate location during a stop-the-world pause (when application
threads are paused). Once this is done, with the help of userfaultfd,
the heap can be concurrently compacted while application threads are
making progress.
Given that Android apps are highly susceptible to response time, we
need this pause to be as small as possible (not more than a few
microseconds). The dominating factor during this pause is the mremap
operation and therefore this optimization is essential.
As of today, the Java heaps on Android are up to 1GB in virtual memory
size. However, the new GC algorithm makes it multi-gigabyte. Even
though the heap consumption in terms of physical memory is not going
to be more than a few hundred MBs, the physical pages will be
scattered across the entire virtual memory range. Therefore, this
optimization will reduce the number of iterations required to finish
the mremap operation.
Example scenario:
Let's say that our heap is 8GB in virtual memory size and 128MB (a
realistic heap occupancy) in physical memory size at the time of a
mremap operation. That means we have 32K 4KB physical pages in there.
A) Worst case scenario: every 4KB physical page is mapped to a unique PMD entry
1) With only the PMD optimization the loop will make 32K iterations.
2) With the PUD optimization the loop will make 8 iterations.
B) Best case scenario: all pages are compacted in one corner of the heap, then
1) With only the PMD optimization the loop will make 64 iterations.
2) With the PUD optimization the loop will make only 1 iteration.
Even in the best case we are reducing the number of iterations by 64x.
The optimization will be useful even if not all of the virtual address
range is mapped.
Thanks,
Kalesh
> Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-12-16 4:41 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-16 4:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- lots of little subsystems
- a few post-linux-next MM material. Most of this awaits more merging
of other trees.
95 patches, based on 489e9fea66f31086f85d9a18e61e4791d94a56a4.
Subsystems affected by this patch series:
mm/swap
mm/memory-hotplug
alpha
procfs
misc
core-kernel
bitmap
lib
lz4
bitops
checkpatch
nilfs
kdump
rapidio
gcov
bfs
relay
resource
ubsan
reboot
fault-injection
lzo
apparmor
mm/pagemap
mm/cleanups
mm/gup
Subsystem: mm/swap
Zhaoyang Huang <huangzhaoyang@gmail.com>:
mm: fix a race on nr_swap_pages
Subsystem: mm/memory-hotplug
Laurent Dufour <ldufour@linux.ibm.com>:
mm/memory_hotplug: quieting offline operation
Subsystem: alpha
Thomas Gleixner <tglx@linutronix.de>:
alpha: replace bogus in_interrupt()
Subsystem: procfs
Randy Dunlap <rdunlap@infradead.org>:
procfs: delete duplicated words + other fixes
Anand K Mistry <amistry@google.com>:
proc: provide details on indirect branch speculation
Alexey Dobriyan <adobriyan@gmail.com>:
proc: fix lookup in /proc/net subdirectories after setns(2)
Hui Su <sh_def@163.com>:
fs/proc: make pde_get() return nothing
Subsystem: misc
Christophe Leroy <christophe.leroy@csgroup.eu>:
asm-generic: force inlining of get_order() to work around gcc10 poor decision
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: split out mathematical helpers
Subsystem: core-kernel
Hui Su <sh_def@163.com>:
kernel/acct.c: use #elif instead of #end and #elif
Subsystem: bitmap
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
include/linux/bitmap.h: convert bitmap_empty() / bitmap_full() to return boolean
"Ma, Jianpeng" <jianpeng.ma@intel.com>:
bitmap: remove unused function declaration
Subsystem: lib
Geert Uytterhoeven <geert@linux-m68k.org>:
lib/test_free_pages.c: add basic progress indicators
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
Patch series "] lib/stackdepot.c: Replace one-element array with flexible-array member":
lib/stackdepot.c: replace one-element array with flexible-array member
lib/stackdepot.c: use flex_array_size() helper in memcpy()
lib/stackdepot.c: use array_size() helper in jhash2()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
lib/test_lockup.c: minimum fix to get it compiled on PREEMPT_RT
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
lib/list_kunit: follow new file name convention for KUnit tests
lib/linear_ranges_kunit: follow new file name convention for KUnit tests
lib/bits_kunit: follow new file name convention for KUnit tests
lib/cmdline: fix get_option() for strings starting with hyphen
lib/cmdline: allow NULL to be an output for get_option()
lib/cmdline_kunit: add a new test suite for cmdline API
Jakub Jelinek <jakub@redhat.com>:
ilog2: improve ilog2 for constant arguments
Nick Desaulniers <ndesaulniers@google.com>:
lib/string: remove unnecessary #undefs
Daniel Axtens <dja@axtens.net>:
Patch series "Fortify strscpy()", v7:
lib: string.h: detect intra-object overflow in fortified string functions
lkdtm: tests for FORTIFY_SOURCE
Francis Laniel <laniel_francis@privacyrequired.com>:
string.h: add FORTIFY coverage for strscpy()
drivers/misc/lkdtm: add new file in LKDTM to test fortified strscpy
drivers/misc/lkdtm/lkdtm.h: correct wrong filenames in comment
Alexey Dobriyan <adobriyan@gmail.com>:
lib: cleanup kstrto*() usage
Subsystem: lz4
Gao Xiang <hsiangkao@redhat.com>:
lib/lz4: explicitly support in-place decompression
Subsystem: bitops
Syed Nayyar Waris <syednwaris@gmail.com>:
Patch series "Introduce the for_each_set_clump macro", v12:
bitops: introduce the for_each_set_clump macro
lib/test_bitmap.c: add for_each_set_clump test cases
gpio: thunderx: utilize for_each_set_clump macro
gpio: xilinx: utilize generic bitmap_get_value and _set_value
Subsystem: checkpatch
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: add new exception to repeated word check
Aditya Srivastava <yashsri421@gmail.com>:
checkpatch: fix false positives in REPEATED_WORD warning
Łukasz Stelmach <l.stelmach@samsung.com>:
checkpatch: ignore generated CamelCase defines and enum values
Joe Perches <joe@perches.com>:
checkpatch: prefer static const declarations
checkpatch: allow --fix removal of unnecessary break statements
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: extend attributes check to handle more patterns
Tom Rix <trix@redhat.com>:
checkpatch: add a fixer for missing newline at eof
Joe Perches <joe@perches.com>:
checkpatch: update __attribute__((section("name"))) quote removal
Aditya Srivastava <yashsri421@gmail.com>:
checkpatch: add fix option for GERRIT_CHANGE_ID
Joe Perches <joe@perches.com>:
checkpatch: add __alias and __weak to suggested __attribute__ conversions
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: improve email parsing
checkpatch: fix spelling errors and remove repeated word
Aditya Srivastava <yashsri421@gmail.com>:
checkpatch: avoid COMMIT_LOG_LONG_LINE warning for signature tags
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: fix unescaped left brace
Aditya Srivastava <yashsri421@gmail.com>:
checkpatch: add fix option for ASSIGNMENT_CONTINUATIONS
checkpatch: add fix option for LOGICAL_CONTINUATIONS
checkpatch: add fix and improve warning msg for non-standard signature
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: add warning for unnecessary use of %h[xudi] and %hh[xudi]
checkpatch: add warning for lines starting with a '#' in commit log
checkpatch: fix TYPO_SPELLING check for words with apostrophe
Joe Perches <joe@perches.com>:
checkpatch: add printk_once and printk_ratelimit to prefer pr_<level> warning
Subsystem: nilfs
Alex Shi <alex.shi@linux.alibaba.com>:
fs/nilfs2: remove some unused macros to tame gcc
Subsystem: kdump
Alexander Egorenkov <egorenar@linux.ibm.com>:
kdump: append uts_namespace.name offset to VMCOREINFO
Subsystem: rapidio
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
rapidio: remove unused rio_get_asm() and rio_get_device()
Subsystem: gcov
Nick Desaulniers <ndesaulniers@google.com>:
gcov: remove support for GCC < 4.9
Alex Shi <alex.shi@linux.alibaba.com>:
gcov: fix kernel-doc markup issue
Subsystem: bfs
Randy Dunlap <rdunlap@infradead.org>:
bfs: don't use WARNING: string when it's just info.
Subsystem: relay
Jani Nikula <jani.nikula@intel.com>:
Patch series "relay: cleanup and const callbacks", v2:
relay: remove unused buf_mapped and buf_unmapped callbacks
relay: require non-NULL callbacks in relay_open()
relay: make create_buf_file and remove_buf_file callbacks mandatory
relay: allow the use of const callback structs
drm/i915: make relay callbacks const
ath10k: make relay callbacks const
ath11k: make relay callbacks const
ath9k: make relay callbacks const
blktrace: make relay callbacks const
Subsystem: resource
Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
kernel/resource.c: fix kernel-doc markups
Subsystem: ubsan
Kees Cook <keescook@chromium.org>:
Patch series "Clean up UBSAN Makefile", v2:
ubsan: remove redundant -Wno-maybe-uninitialized
ubsan: move cc-option tests into Kconfig
ubsan: disable object-size sanitizer under GCC
ubsan: disable UBSAN_TRAP for all*config
ubsan: enable for all*config builds
ubsan: remove UBSAN_MISC in favor of individual options
ubsan: expand tests and reporting
Dmitry Vyukov <dvyukov@google.com>:
kcov: don't instrument with UBSAN
Zou Wei <zou_wei@huawei.com>:
lib/ubsan.c: mark type_check_kinds with static keyword
Subsystem: reboot
Matteo Croce <mcroce@microsoft.com>:
reboot: refactor and comment the cpu selection code
reboot: allow to specify reboot mode via sysfs
reboot: remove cf9_safe from allowed types and rename cf9_force
Patch series "reboot: sysfs improvements":
reboot: allow to override reboot type if quirks are found
reboot: hide from sysfs not applicable settings
Subsystem: fault-injection
Barnabás Pőcze <pobrn@protonmail.com>:
fault-injection: handle EI_ETYPE_TRUE
Subsystem: lzo
Jason Yan <yanaijie@huawei.com>:
lib/lzo/lzo1x_compress.c: make lzogeneric1x_1_compress() static
Subsystem: apparmor
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
apparmor: remove duplicate macro list_entry_is_head()
Subsystem: mm/pagemap
Christoph Hellwig <hch@lst.de>:
Patch series "simplify follow_pte a bit":
mm: unexport follow_pte_pmd
mm: simplify follow_pte{,pmd}
Subsystem: mm/cleanups
Haitao Shi <shihaitao1@huawei.com>:
mm: fix some spelling mistakes in comments
Subsystem: mm/gup
Jann Horn <jannh@google.com>:
mmap locking API: don't check locking if the mm isn't live yet
mm/gup: assert that the mmap lock is held in __get_user_pages()
Documentation/ABI/testing/sysfs-kernel-reboot | 32
Documentation/admin-guide/kdump/vmcoreinfo.rst | 6
Documentation/dev-tools/ubsan.rst | 1
Documentation/filesystems/proc.rst | 2
MAINTAINERS | 5
arch/alpha/kernel/process.c | 2
arch/powerpc/kernel/vmlinux.lds.S | 4
arch/s390/pci/pci_mmio.c | 4
drivers/gpio/gpio-thunderx.c | 11
drivers/gpio/gpio-xilinx.c | 61 -
drivers/gpu/drm/i915/gt/uc/intel_guc_log.c | 2
drivers/misc/lkdtm/Makefile | 1
drivers/misc/lkdtm/bugs.c | 50 +
drivers/misc/lkdtm/core.c | 3
drivers/misc/lkdtm/fortify.c | 82 ++
drivers/misc/lkdtm/lkdtm.h | 19
drivers/net/wireless/ath/ath10k/spectral.c | 2
drivers/net/wireless/ath/ath11k/spectral.c | 2
drivers/net/wireless/ath/ath9k/common-spectral.c | 2
drivers/rapidio/rio.c | 81 --
fs/bfs/inode.c | 2
fs/dax.c | 9
fs/exec.c | 8
fs/nfs/callback_proc.c | 5
fs/nilfs2/segment.c | 5
fs/proc/array.c | 28
fs/proc/base.c | 2
fs/proc/generic.c | 24
fs/proc/internal.h | 10
fs/proc/proc_net.c | 20
include/asm-generic/bitops/find.h | 19
include/asm-generic/getorder.h | 2
include/linux/bitmap.h | 67 +-
include/linux/bitops.h | 24
include/linux/dcache.h | 1
include/linux/iommu-helper.h | 4
include/linux/kernel.h | 173 -----
include/linux/log2.h | 3
include/linux/math.h | 177 +++++
include/linux/mm.h | 6
include/linux/mm_types.h | 10
include/linux/mmap_lock.h | 16
include/linux/proc_fs.h | 8
include/linux/rcu_node_tree.h | 2
include/linux/relay.h | 29
include/linux/rio_drv.h | 3
include/linux/string.h | 75 +-
include/linux/units.h | 2
kernel/Makefile | 3
kernel/acct.c | 7
kernel/crash_core.c | 1
kernel/fail_function.c | 6
kernel/gcov/gcc_4_7.c | 10
kernel/reboot.c | 308 ++++++++-
kernel/relay.c | 111 ---
kernel/resource.c | 24
kernel/trace/blktrace.c | 2
lib/Kconfig.debug | 11
lib/Kconfig.ubsan | 154 +++-
lib/Makefile | 7
lib/bits_kunit.c | 75 ++
lib/cmdline.c | 20
lib/cmdline_kunit.c | 100 +++
lib/errname.c | 1
lib/error-inject.c | 2
lib/errseq.c | 1
lib/find_bit.c | 17
lib/linear_ranges_kunit.c | 228 +++++++
lib/list-test.c | 748 -----------------------
lib/list_kunit.c | 748 +++++++++++++++++++++++
lib/lz4/lz4_decompress.c | 6
lib/lz4/lz4defs.h | 1
lib/lzo/lzo1x_compress.c | 2
lib/math/div64.c | 4
lib/math/int_pow.c | 2
lib/math/int_sqrt.c | 3
lib/math/reciprocal_div.c | 9
lib/stackdepot.c | 11
lib/string.c | 4
lib/test_bitmap.c | 143 ++++
lib/test_bits.c | 75 --
lib/test_firmware.c | 9
lib/test_free_pages.c | 5
lib/test_kmod.c | 26
lib/test_linear_ranges.c | 228 -------
lib/test_lockup.c | 16
lib/test_ubsan.c | 74 ++
lib/ubsan.c | 2
mm/filemap.c | 2
mm/gup.c | 2
mm/huge_memory.c | 2
mm/khugepaged.c | 2
mm/memblock.c | 2
mm/memory.c | 36 -
mm/memory_hotplug.c | 2
mm/migrate.c | 2
mm/page_ext.c | 2
mm/swapfile.c | 11
scripts/Makefile.ubsan | 49 -
scripts/checkpatch.pl | 495 +++++++++++----
security/apparmor/apparmorfs.c | 3
tools/testing/selftests/lkdtm/tests.txt | 1
102 files changed, 3022 insertions(+), 1899 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: [patch 012/200] mm: slab: clarify krealloc()'s behavior with __GFP_ZERO
2020-12-15 19:08 ` Andy Shevchenko
@ 2020-12-16 7:47 ` Christian König
2020-12-16 11:23 ` Andy Shevchenko
0 siblings, 1 reply; 419+ messages in thread
From: Christian König @ 2020-12-16 7:47 UTC (permalink / raw)
To: Andy Shevchenko
Cc: Andrew Morton, airlied, alexander.shishkin, bgolaszewski, bp, bp,
cl, daniel.vetter, daniel, gustavo, iamjoonsoo.kim, james.morse,
jasowang, linus.walleij, linux-mm, maarten.lankhorst, mchehab,
mm-commits, mripard, mst, penberg, perex, rientjes, rric,
sumit.semwal, tiwai, tiwai, tony.luck, torvalds, tzimmermann,
vbabka
Am 15.12.20 um 20:08 schrieb Andy Shevchenko:
> On Tue, Dec 15, 2020 at 03:30:44PM +0100, Christian König wrote:
>> Am 15.12.20 um 04:03 schrieb Andrew Morton:
> ...
>
>> Question: Can the fact that __GFP_ZERO is effectively ignored cause an
>> information leak if new size is larger than old size and the array is
>> somehow copied to user space?
>>
>> I think the answer is no, but just wanted to double check. Maybe we should
>> note that here.
> kmalloc()/kmalloc_array()/etc has the same. Should it be mentioned there as well?
No, they don't. If kmalloc()/kmalloc_array() would ignore __GFP_ZERO we
would have quite a problem.
It is only krealloc()/krealloc_array() which ignore __GFP_ZERO when they
don't reallocate memory because newsize is smaller than oldsize. In
other words the freed up space is not cleared in any way.
Christian.
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: [patch 012/200] mm: slab: clarify krealloc()'s behavior with __GFP_ZERO
2020-12-16 7:47 ` Christian König
@ 2020-12-16 11:23 ` Andy Shevchenko
0 siblings, 0 replies; 419+ messages in thread
From: Andy Shevchenko @ 2020-12-16 11:23 UTC (permalink / raw)
To: Christian König
Cc: Andrew Morton, airlied, alexander.shishkin, bgolaszewski, bp, bp,
cl, daniel.vetter, daniel, gustavo, iamjoonsoo.kim, james.morse,
jasowang, linus.walleij, linux-mm, maarten.lankhorst, mchehab,
mm-commits, mripard, mst, penberg, perex, rientjes, rric,
sumit.semwal, tiwai, tiwai, tony.luck, torvalds, tzimmermann,
vbabka
On Wed, Dec 16, 2020 at 08:47:25AM +0100, Christian König wrote:
> Am 15.12.20 um 20:08 schrieb Andy Shevchenko:
> > On Tue, Dec 15, 2020 at 03:30:44PM +0100, Christian König wrote:
> > > Am 15.12.20 um 04:03 schrieb Andrew Morton:
> > ...
> >
> > > Question: Can the fact that __GFP_ZERO is effectively ignored cause an
> > > information leak if new size is larger than old size and the array is
> > > somehow copied to user space?
> > >
> > > I think the answer is no, but just wanted to double check. Maybe we should
> > > note that here.
> > kmalloc()/kmalloc_array()/etc has the same. Should it be mentioned there as well?
>
> No, they don't. If kmalloc()/kmalloc_array() would ignore __GFP_ZERO we
> would have quite a problem.
>
> It is only krealloc()/krealloc_array() which ignore __GFP_ZERO when they
> don't reallocate memory because newsize is smaller than oldsize. In other
> words the freed up space is not cleared in any way.
Yes, true. So, you meant that comment now a bit misleading. I agree.
--
With Best Regards,
Andy Shevchenko
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-12-18 22:00 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-18 22:00 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
78 patches, based on a409ed156a90093a03fe6a93721ddf4c591eac87.
Subsystems affected by this patch series:
mm/memcg
epoll
mm/kasan
mm/cleanups
epoll
Subsystem: mm/memcg
Alex Shi <alex.shi@linux.alibaba.com>:
Patch series "bail out early for memcg disable":
mm/memcg: bail early from swap accounting if memcg disabled
mm/memcg: warning on !memcg after readahead page charged
Wei Yang <richard.weiyang@gmail.com>:
mm/memcg: remove unused definitions
Shakeel Butt <shakeelb@google.com>:
mm, kvm: account kvm_vcpu_mmap to kmemcg
Hui Su <sh_def@163.com>:
mm/memcontrol:rewrite mem_cgroup_page_lruvec()
Subsystem: epoll
Soheil Hassas Yeganeh <soheil@google.com>:
Patch series "simplify ep_poll":
epoll: check for events when removing a timed out thread from the wait queue
epoll: simplify signal handling
epoll: pull fatal signal checks into ep_send_events()
epoll: move eavail next to the list_empty_careful check
epoll: simplify and optimize busy loop logic
epoll: pull all code between fetch_events and send_event into the loop
epoll: replace gotos with a proper loop
epoll: eliminate unnecessary lock for zero timeout
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: add hardware tag-based mode for arm64", v11:
kasan: drop unnecessary GPL text from comment headers
kasan: KASAN_VMALLOC depends on KASAN_GENERIC
kasan: group vmalloc code
kasan: shadow declarations only for software modes
kasan: rename (un)poison_shadow to (un)poison_range
kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_*
kasan: only build init.c for software modes
kasan: split out shadow.c from common.c
kasan: define KASAN_MEMORY_PER_SHADOW_PAGE
kasan: rename report and tags files
kasan: don't duplicate config dependencies
kasan: hide invalid free check implementation
kasan: decode stack frame only with KASAN_STACK_ENABLE
kasan, arm64: only init shadow for software modes
kasan, arm64: only use kasan_depth for software modes
kasan, arm64: move initialization message
kasan, arm64: rename kasan_init_tags and mark as __init
kasan: rename addr_has_shadow to addr_has_metadata
kasan: rename print_shadow_for_address to print_memory_metadata
kasan: rename SHADOW layout macros to META
kasan: separate metadata_fetch_row for each mode
kasan: introduce CONFIG_KASAN_HW_TAGS
Vincenzo Frascino <vincenzo.frascino@arm.com>:
arm64: enable armv8.5-a asm-arch option
arm64: mte: add in-kernel MTE helpers
arm64: mte: reset the page tag in page->flags
arm64: mte: add in-kernel tag fault handler
arm64: kasan: allow enabling in-kernel MTE
arm64: mte: convert gcr_user into an exclude mask
arm64: mte: switch GCR_EL1 in kernel entry and exit
kasan, mm: untag page address in free_reserved_area
Andrey Konovalov <andreyknvl@google.com>:
arm64: kasan: align allocations for HW_TAGS
arm64: kasan: add arch layer for memory tagging helpers
kasan: define KASAN_GRANULE_SIZE for HW_TAGS
kasan, x86, s390: update undef CONFIG_KASAN
kasan, arm64: expand CONFIG_KASAN checks
kasan, arm64: implement HW_TAGS runtime
kasan, arm64: print report from tag fault handler
kasan, mm: reset tags when accessing metadata
kasan, arm64: enable CONFIG_KASAN_HW_TAGS
kasan: add documentation for hardware tag-based mode
Vincenzo Frascino <vincenzo.frascino@arm.com>:
kselftest/arm64: check GCR_EL1 after context switch
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: boot parameters for hardware tag-based mode", v4:
kasan: simplify quarantine_put call site
kasan: rename get_alloc/free_info
kasan: introduce set_alloc_info
kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK
kasan: allow VMAP_STACK for HW_TAGS mode
kasan: remove __kasan_unpoison_stack
kasan: inline kasan_reset_tag for tag-based modes
kasan: inline random_tag for HW_TAGS
kasan: open-code kasan_unpoison_slab
kasan: inline (un)poison_range and check_invalid_free
kasan: add and integrate kasan boot parameters
kasan, mm: check kasan_enabled in annotations
kasan, mm: rename kasan_poison_kfree
kasan: don't round_up too much
kasan: simplify assign_tag and set_tag calls
kasan: clarify comment in __kasan_kfree_large
kasan: sanitize objects when metadata doesn't fit
kasan, mm: allow cache merging with no metadata
kasan: update documentation
Subsystem: mm/cleanups
Colin Ian King <colin.king@canonical.com>:
mm/Kconfig: fix spelling mistake "whats" -> "what's"
Subsystem: epoll
Willem de Bruijn <willemb@google.com>:
Patch series "add epoll_pwait2 syscall", v4:
epoll: convert internal api to timespec64
epoll: add syscall epoll_pwait2
epoll: wire up syscall epoll_pwait2
selftests/filesystems: expand epoll with epoll_pwait2
Documentation/dev-tools/kasan.rst | 274 +-
arch/Kconfig | 8
arch/alpha/kernel/syscalls/syscall.tbl | 1
arch/arm/tools/syscall.tbl | 1
arch/arm64/Kconfig | 9
arch/arm64/Makefile | 7
arch/arm64/include/asm/assembler.h | 2
arch/arm64/include/asm/cache.h | 3
arch/arm64/include/asm/esr.h | 1
arch/arm64/include/asm/kasan.h | 17
arch/arm64/include/asm/memory.h | 15
arch/arm64/include/asm/mte-def.h | 16
arch/arm64/include/asm/mte-kasan.h | 67
arch/arm64/include/asm/mte.h | 22
arch/arm64/include/asm/processor.h | 2
arch/arm64/include/asm/string.h | 5
arch/arm64/include/asm/uaccess.h | 23
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 2
arch/arm64/kernel/asm-offsets.c | 3
arch/arm64/kernel/cpufeature.c | 3
arch/arm64/kernel/entry.S | 41
arch/arm64/kernel/head.S | 2
arch/arm64/kernel/hibernate.c | 5
arch/arm64/kernel/image-vars.h | 2
arch/arm64/kernel/kaslr.c | 3
arch/arm64/kernel/module.c | 6
arch/arm64/kernel/mte.c | 124 +
arch/arm64/kernel/setup.c | 2
arch/arm64/kernel/sleep.S | 2
arch/arm64/kernel/smp.c | 2
arch/arm64/lib/mte.S | 16
arch/arm64/mm/copypage.c | 9
arch/arm64/mm/fault.c | 59
arch/arm64/mm/kasan_init.c | 41
arch/arm64/mm/mteswap.c | 9
arch/arm64/mm/proc.S | 23
arch/arm64/mm/ptdump.c | 6
arch/ia64/kernel/syscalls/syscall.tbl | 1
arch/m68k/kernel/syscalls/syscall.tbl | 1
arch/microblaze/kernel/syscalls/syscall.tbl | 1
arch/mips/kernel/syscalls/syscall_n32.tbl | 1
arch/mips/kernel/syscalls/syscall_n64.tbl | 1
arch/mips/kernel/syscalls/syscall_o32.tbl | 1
arch/parisc/kernel/syscalls/syscall.tbl | 1
arch/powerpc/kernel/syscalls/syscall.tbl | 1
arch/s390/boot/string.c | 1
arch/s390/kernel/syscalls/syscall.tbl | 1
arch/sh/kernel/syscalls/syscall.tbl | 1
arch/sparc/kernel/syscalls/syscall.tbl | 1
arch/x86/boot/compressed/misc.h | 1
arch/x86/entry/syscalls/syscall_32.tbl | 1
arch/x86/entry/syscalls/syscall_64.tbl | 1
arch/x86/kernel/acpi/wakeup_64.S | 2
arch/x86/kvm/x86.c | 2
arch/xtensa/kernel/syscalls/syscall.tbl | 1
fs/eventpoll.c | 359 ++-
include/linux/compat.h | 6
include/linux/kasan-checks.h | 2
include/linux/kasan.h | 423 ++--
include/linux/memcontrol.h | 137 -
include/linux/mm.h | 24
include/linux/mmdebug.h | 13
include/linux/moduleloader.h | 3
include/linux/page-flags-layout.h | 2
include/linux/sched.h | 2
include/linux/string.h | 2
include/linux/syscalls.h | 5
include/uapi/asm-generic/unistd.h | 4
init/init_task.c | 2
kernel/fork.c | 4
kernel/sys_ni.c | 2
lib/Kconfig.kasan | 71
lib/test_kasan.c | 2
lib/test_kasan_module.c | 2
mm/Kconfig | 2
mm/kasan/Makefile | 33
mm/kasan/common.c | 1006 ++--------
mm/kasan/generic.c | 72
mm/kasan/generic_report.c | 13
mm/kasan/hw_tags.c | 294 ++
mm/kasan/init.c | 25
mm/kasan/kasan.h | 204 +-
mm/kasan/quarantine.c | 35
mm/kasan/report.c | 363 +--
mm/kasan/report_generic.c | 169 +
mm/kasan/report_hw_tags.c | 44
mm/kasan/report_sw_tags.c | 22
mm/kasan/shadow.c | 541 +++++
mm/kasan/sw_tags.c | 34
mm/kasan/tags.c | 7
mm/kasan/tags_report.c | 7
mm/memcontrol.c | 53
mm/mempool.c | 4
mm/page_alloc.c | 9
mm/page_poison.c | 2
mm/ptdump.c | 13
mm/slab_common.c | 5
mm/slub.c | 29
scripts/Makefile.lib | 2
tools/testing/selftests/arm64/mte/Makefile | 2
tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c | 155 +
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 72
virt/kvm/coalesced_mmio.c | 2
virt/kvm/kvm_main.c | 2
105 files changed, 3268 insertions(+), 1873 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-12-22 19:58 Andrew Morton
2020-12-22 21:43 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2020-12-22 19:58 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e.
Subsystems affected by this patch series:
mm/kasan
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: add hardware tag-based mode for arm64", v11:
kasan: drop unnecessary GPL text from comment headers
kasan: KASAN_VMALLOC depends on KASAN_GENERIC
kasan: group vmalloc code
kasan: shadow declarations only for software modes
kasan: rename (un)poison_shadow to (un)poison_range
kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_*
kasan: only build init.c for software modes
kasan: split out shadow.c from common.c
kasan: define KASAN_MEMORY_PER_SHADOW_PAGE
kasan: rename report and tags files
kasan: don't duplicate config dependencies
kasan: hide invalid free check implementation
kasan: decode stack frame only with KASAN_STACK_ENABLE
kasan, arm64: only init shadow for software modes
kasan, arm64: only use kasan_depth for software modes
kasan, arm64: move initialization message
kasan, arm64: rename kasan_init_tags and mark as __init
kasan: rename addr_has_shadow to addr_has_metadata
kasan: rename print_shadow_for_address to print_memory_metadata
kasan: rename SHADOW layout macros to META
kasan: separate metadata_fetch_row for each mode
kasan: introduce CONFIG_KASAN_HW_TAGS
Vincenzo Frascino <vincenzo.frascino@arm.com>:
arm64: enable armv8.5-a asm-arch option
arm64: mte: add in-kernel MTE helpers
arm64: mte: reset the page tag in page->flags
arm64: mte: add in-kernel tag fault handler
arm64: kasan: allow enabling in-kernel MTE
arm64: mte: convert gcr_user into an exclude mask
arm64: mte: switch GCR_EL1 in kernel entry and exit
kasan, mm: untag page address in free_reserved_area
Andrey Konovalov <andreyknvl@google.com>:
arm64: kasan: align allocations for HW_TAGS
arm64: kasan: add arch layer for memory tagging helpers
kasan: define KASAN_GRANULE_SIZE for HW_TAGS
kasan, x86, s390: update undef CONFIG_KASAN
kasan, arm64: expand CONFIG_KASAN checks
kasan, arm64: implement HW_TAGS runtime
kasan, arm64: print report from tag fault handler
kasan, mm: reset tags when accessing metadata
kasan, arm64: enable CONFIG_KASAN_HW_TAGS
kasan: add documentation for hardware tag-based mode
Vincenzo Frascino <vincenzo.frascino@arm.com>:
kselftest/arm64: check GCR_EL1 after context switch
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: boot parameters for hardware tag-based mode", v4:
kasan: simplify quarantine_put call site
kasan: rename get_alloc/free_info
kasan: introduce set_alloc_info
kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK
kasan: allow VMAP_STACK for HW_TAGS mode
kasan: remove __kasan_unpoison_stack
kasan: inline kasan_reset_tag for tag-based modes
kasan: inline random_tag for HW_TAGS
kasan: open-code kasan_unpoison_slab
kasan: inline (un)poison_range and check_invalid_free
kasan: add and integrate kasan boot parameters
kasan, mm: check kasan_enabled in annotations
kasan, mm: rename kasan_poison_kfree
kasan: don't round_up too much
kasan: simplify assign_tag and set_tag calls
kasan: clarify comment in __kasan_kfree_large
kasan: sanitize objects when metadata doesn't fit
kasan, mm: allow cache merging with no metadata
kasan: update documentation
Documentation/dev-tools/kasan.rst | 274 ++-
arch/Kconfig | 8
arch/arm64/Kconfig | 9
arch/arm64/Makefile | 7
arch/arm64/include/asm/assembler.h | 2
arch/arm64/include/asm/cache.h | 3
arch/arm64/include/asm/esr.h | 1
arch/arm64/include/asm/kasan.h | 17
arch/arm64/include/asm/memory.h | 15
arch/arm64/include/asm/mte-def.h | 16
arch/arm64/include/asm/mte-kasan.h | 67
arch/arm64/include/asm/mte.h | 22
arch/arm64/include/asm/processor.h | 2
arch/arm64/include/asm/string.h | 5
arch/arm64/include/asm/uaccess.h | 23
arch/arm64/kernel/asm-offsets.c | 3
arch/arm64/kernel/cpufeature.c | 3
arch/arm64/kernel/entry.S | 41
arch/arm64/kernel/head.S | 2
arch/arm64/kernel/hibernate.c | 5
arch/arm64/kernel/image-vars.h | 2
arch/arm64/kernel/kaslr.c | 3
arch/arm64/kernel/module.c | 6
arch/arm64/kernel/mte.c | 124 +
arch/arm64/kernel/setup.c | 2
arch/arm64/kernel/sleep.S | 2
arch/arm64/kernel/smp.c | 2
arch/arm64/lib/mte.S | 16
arch/arm64/mm/copypage.c | 9
arch/arm64/mm/fault.c | 59
arch/arm64/mm/kasan_init.c | 41
arch/arm64/mm/mteswap.c | 9
arch/arm64/mm/proc.S | 23
arch/arm64/mm/ptdump.c | 6
arch/s390/boot/string.c | 1
arch/x86/boot/compressed/misc.h | 1
arch/x86/kernel/acpi/wakeup_64.S | 2
include/linux/kasan-checks.h | 2
include/linux/kasan.h | 423 ++++-
include/linux/mm.h | 24
include/linux/moduleloader.h | 3
include/linux/page-flags-layout.h | 2
include/linux/sched.h | 2
include/linux/string.h | 2
init/init_task.c | 2
kernel/fork.c | 4
lib/Kconfig.kasan | 71
lib/test_kasan.c | 2
lib/test_kasan_module.c | 2
mm/kasan/Makefile | 33
mm/kasan/common.c | 1006 +++-----------
mm/kasan/generic.c | 72 -
mm/kasan/generic_report.c | 13
mm/kasan/hw_tags.c | 276 +++
mm/kasan/init.c | 25
mm/kasan/kasan.h | 195 ++
mm/kasan/quarantine.c | 35
mm/kasan/report.c | 363 +----
mm/kasan/report_generic.c | 169 ++
mm/kasan/report_hw_tags.c | 44
mm/kasan/report_sw_tags.c | 22
mm/kasan/shadow.c | 528 +++++++
mm/kasan/sw_tags.c | 34
mm/kasan/tags.c | 7
mm/kasan/tags_report.c | 7
mm/mempool.c | 4
mm/page_alloc.c | 9
mm/page_poison.c | 2
mm/ptdump.c | 13
mm/slab_common.c | 5
mm/slub.c | 29
scripts/Makefile.lib | 2
tools/testing/selftests/arm64/mte/Makefile | 2
tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c | 155 ++
74 files changed, 2869 insertions(+), 1553 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2020-12-22 19:58 incoming Andrew Morton
@ 2020-12-22 21:43 ` Linus Torvalds
0 siblings, 0 replies; 419+ messages in thread
From: Linus Torvalds @ 2020-12-22 21:43 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, Dec 22, 2020 at 11:58 AM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> 60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e.
I see that you enabled renaming in the patches. Lovely.
Can you also enable it in the diffstat?
> 74 files changed, 2869 insertions(+), 1553 deletions(-)
With -M in the diffstat, you should have seen
72 files changed, 2775 insertions(+), 1460 deletions(-)
and if you add "--summary", you'll also see the rename part ofthe file
create/delete summary:
rename mm/kasan/{tags_report.c => report_sw_tags.c} (78%)
which is often nice to see in addition to the line stats..
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: [patch 086/200] mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio
2020-12-15 3:08 ` [patch 086/200] mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio Andrew Morton
@ 2020-12-28 17:59 ` Brian Geffon
0 siblings, 0 replies; 419+ messages in thread
From: Brian Geffon @ 2020-12-28 17:59 UTC (permalink / raw)
To: Andrew Morton
Cc: catalin.marinas, dan.carpenter, dan.j.williams, dave.jiang, dima,
Hugh Dickins, Jason Gunthorpe, jhubbard, Kirill A. Shutemov,
linux-mm, linux, luto, Mike Kravetz, Minchan Kim, mingo,
mm-commits, rcampbell, tglx, Linus Torvalds, tsbogend,
Vlastimil Babka, viro, vishal.l.verma, Will Deacon
I don't think this situation can ever happen MREMAP_DONTUNMAP is
already restricted to anonymous mappings (defined as not having
vm_ops) and vma_to_resize checks that the mapping is anonymous before
move_vma is called.
On Mon, Dec 14, 2020 at 7:08 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> From: Dmitry Safonov <dima@arista.com>
> Subject: mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio
>
> As kernel expect to see only one of such mappings, any further operations
> on the VMA-copy may be unexpected by the kernel. Maybe it's being on the
> safe side, but there doesn't seem to be any expected use-case for this, so
> restrict it now.
>
> Link: https://lkml.kernel.org/r/20201013013416.390574-4-dima@arista.com
> Fixes: commit e346b3813067 ("mm/mremap: add MREMAP_DONTUNMAP to mremap()")
> Signed-off-by: Dmitry Safonov <dima@arista.com>
> Cc: Alexander Viro <viro@zeniv.linux.org.uk>
> Cc: Andy Lutomirski <luto@kernel.org>
> Cc: Brian Geffon <bgeffon@google.com>
> Cc: Catalin Marinas <catalin.marinas@arm.com>
> Cc: Dan Carpenter <dan.carpenter@oracle.com>
> Cc: Dan Williams <dan.j.williams@intel.com>
> Cc: Dave Jiang <dave.jiang@intel.com>
> Cc: Hugh Dickins <hughd@google.com>
> Cc: Ingo Molnar <mingo@redhat.com>
> Cc: Jason Gunthorpe <jgg@ziepe.ca>
> Cc: John Hubbard <jhubbard@nvidia.com>
> Cc: "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>
> Cc: Mike Kravetz <mike.kravetz@oracle.com>
> Cc: Minchan Kim <minchan@kernel.org>
> Cc: Ralph Campbell <rcampbell@nvidia.com>
> Cc: Russell King <linux@armlinux.org.uk>
> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
> Cc: Thomas Gleixner <tglx@linutronix.de>
> Cc: Vishal Verma <vishal.l.verma@intel.com>
> Cc: Vlastimil Babka <vbabka@suse.cz>
> Cc: Will Deacon <will@kernel.org>
> Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
> ---
>
> arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 2 +-
> fs/aio.c | 5 ++++-
> include/linux/mm.h | 2 +-
> mm/mmap.c | 6 +++++-
> mm/mremap.c | 2 +-
> 5 files changed, 12 insertions(+), 5 deletions(-)
>
> --- a/arch/x86/kernel/cpu/resctrl/pseudo_lock.c~mremap-dont-allow-mremap_dontunmap-on-special_mappings-and-aio
> +++ a/arch/x86/kernel/cpu/resctrl/pseudo_lock.c
> @@ -1458,7 +1458,7 @@ static int pseudo_lock_dev_release(struc
> return 0;
> }
>
> -static int pseudo_lock_dev_mremap(struct vm_area_struct *area)
> +static int pseudo_lock_dev_mremap(struct vm_area_struct *area, unsigned long flags)
> {
> /* Not supported */
> return -EINVAL;
> --- a/fs/aio.c~mremap-dont-allow-mremap_dontunmap-on-special_mappings-and-aio
> +++ a/fs/aio.c
> @@ -324,13 +324,16 @@ static void aio_free_ring(struct kioctx
> }
> }
>
> -static int aio_ring_mremap(struct vm_area_struct *vma)
> +static int aio_ring_mremap(struct vm_area_struct *vma, unsigned long flags)
> {
> struct file *file = vma->vm_file;
> struct mm_struct *mm = vma->vm_mm;
> struct kioctx_table *table;
> int i, res = -EINVAL;
>
> + if (flags & MREMAP_DONTUNMAP)
> + return -EINVAL;
> +
> spin_lock(&mm->ioctx_lock);
> rcu_read_lock();
> table = rcu_dereference(mm->ioctx_table);
> --- a/include/linux/mm.h~mremap-dont-allow-mremap_dontunmap-on-special_mappings-and-aio
> +++ a/include/linux/mm.h
> @@ -558,7 +558,7 @@ struct vm_operations_struct {
> void (*open)(struct vm_area_struct * area);
> void (*close)(struct vm_area_struct * area);
> int (*split)(struct vm_area_struct * area, unsigned long addr);
> - int (*mremap)(struct vm_area_struct * area);
> + int (*mremap)(struct vm_area_struct *area, unsigned long flags);
> vm_fault_t (*fault)(struct vm_fault *vmf);
> vm_fault_t (*huge_fault)(struct vm_fault *vmf,
> enum page_entry_size pe_size);
> --- a/mm/mmap.c~mremap-dont-allow-mremap_dontunmap-on-special_mappings-and-aio
> +++ a/mm/mmap.c
> @@ -3405,10 +3405,14 @@ static const char *special_mapping_name(
> return ((struct vm_special_mapping *)vma->vm_private_data)->name;
> }
>
> -static int special_mapping_mremap(struct vm_area_struct *new_vma)
> +static int special_mapping_mremap(struct vm_area_struct *new_vma,
> + unsigned long flags)
> {
> struct vm_special_mapping *sm = new_vma->vm_private_data;
>
> + if (flags & MREMAP_DONTUNMAP)
> + return -EINVAL;
> +
> if (WARN_ON_ONCE(current->mm != new_vma->vm_mm))
> return -EFAULT;
>
> --- a/mm/mremap.c~mremap-dont-allow-mremap_dontunmap-on-special_mappings-and-aio
> +++ a/mm/mremap.c
> @@ -534,7 +534,7 @@ static unsigned long move_vma(struct vm_
> if (moved_len < old_len) {
> err = -ENOMEM;
> } else if (vma->vm_ops && vma->vm_ops->mremap) {
> - err = vma->vm_ops->mremap(new_vma);
> + err = vma->vm_ops->mremap(new_vma, flags);
> }
>
> if (unlikely(err)) {
> _
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2020-12-29 23:13 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2020-12-29 23:13 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
16 patches, based on dea8dcf2a9fa8cc540136a6cd885c3beece16ec3.
Subsystems affected by this patch series:
mm/selftests
mm/hugetlb
kbuild
checkpatch
mm/pagecache
mm/mremap
mm/kasan
misc
lib
mm/slub
Subsystem: mm/selftests
Harish <harish@linux.ibm.com>:
selftests/vm: fix building protection keys test
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
mm/hugetlb: fix deadlock in hugetlb_cow error path
Subsystem: kbuild
Masahiro Yamada <masahiroy@kernel.org>:
Revert "kbuild: avoid static_assert for genksyms"
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: prefer strscpy to strlcpy
Subsystem: mm/pagecache
Souptick Joarder <jrdr.linux@gmail.com>:
mm: add prototype for __add_to_page_cache_locked()
Baoquan He <bhe@redhat.com>:
mm: memmap defer init doesn't work as expected
Subsystem: mm/mremap
Kalesh Singh <kaleshsingh@google.com>:
mm/mremap.c: fix extent calculation
Nicholas Piggin <npiggin@gmail.com>:
mm: generalise COW SMC TLB flushing race comment
Subsystem: mm/kasan
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: fix null pointer dereference in kasan_record_aux_stack
Subsystem: misc
Randy Dunlap <rdunlap@infradead.org>:
local64.h: make <asm/local64.h> mandatory
Huang Shijie <sjhuang@iluvatar.ai>:
sizes.h: add SZ_8G/SZ_16G/SZ_32G macros
Josh Poimboeuf <jpoimboe@redhat.com>:
kdev_t: always inline major/minor helper functions
Subsystem: lib
Huang Shijie <sjhuang@iluvatar.ai>:
lib/genalloc: fix the overflow when size is too big
Ilya Leoshkevich <iii@linux.ibm.com>:
lib/zlib: fix inflating zlib streams on s390
Randy Dunlap <rdunlap@infradead.org>:
zlib: move EXPORT_SYMBOL() and MODULE_LICENSE() out of dfltcc_syms.c
Subsystem: mm/slub
Roman Gushchin <guro@fb.com>:
mm: slub: call account_slab_page() after slab page initialization
arch/alpha/include/asm/local64.h | 1 -
arch/arc/include/asm/Kbuild | 1 -
arch/arm/include/asm/Kbuild | 1 -
arch/arm64/include/asm/Kbuild | 1 -
arch/csky/include/asm/Kbuild | 1 -
arch/h8300/include/asm/Kbuild | 1 -
arch/hexagon/include/asm/Kbuild | 1 -
arch/ia64/include/asm/local64.h | 1 -
arch/ia64/mm/init.c | 4 ++--
arch/m68k/include/asm/Kbuild | 1 -
arch/microblaze/include/asm/Kbuild | 1 -
arch/mips/include/asm/Kbuild | 1 -
arch/nds32/include/asm/Kbuild | 1 -
arch/openrisc/include/asm/Kbuild | 1 -
arch/parisc/include/asm/Kbuild | 1 -
arch/powerpc/include/asm/Kbuild | 1 -
arch/riscv/include/asm/Kbuild | 1 -
arch/s390/include/asm/Kbuild | 1 -
arch/sh/include/asm/Kbuild | 1 -
arch/sparc/include/asm/Kbuild | 1 -
arch/x86/include/asm/local64.h | 1 -
arch/xtensa/include/asm/Kbuild | 1 -
include/asm-generic/Kbuild | 1 +
include/linux/build_bug.h | 5 -----
include/linux/kdev_t.h | 22 +++++++++++-----------
include/linux/mm.h | 12 ++++++++++--
include/linux/sizes.h | 3 +++
lib/genalloc.c | 25 +++++++++++++------------
lib/zlib_dfltcc/Makefile | 2 +-
lib/zlib_dfltcc/dfltcc.c | 6 +++++-
lib/zlib_dfltcc/dfltcc_deflate.c | 3 +++
lib/zlib_dfltcc/dfltcc_inflate.c | 4 ++--
lib/zlib_dfltcc/dfltcc_syms.c | 17 -----------------
mm/hugetlb.c | 22 +++++++++++++++++++++-
mm/kasan/generic.c | 2 ++
mm/memory.c | 8 +++++---
mm/memory_hotplug.c | 2 +-
mm/mremap.c | 4 +++-
mm/page_alloc.c | 8 +++++---
mm/slub.c | 5 ++---
scripts/checkpatch.pl | 6 ++++++
tools/testing/selftests/vm/Makefile | 10 +++++-----
42 files changed, 101 insertions(+), 91 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-01-12 23:48 Andrew Morton
2021-01-15 23:32 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2021-01-12 23:48 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c.
Subsystems affected by this patch series:
mm/slub
mm/pagealloc
mm/memcg
mm/kasan
mm/vmalloc
mm/migration
mm/hugetlb
MAINTAINERS
mm/memory-failure
mm/process_vm_access
Subsystem: mm/slub
Jann Horn <jannh@google.com>:
mm, slub: consider rest of partial list if acquire_slab() fails
Subsystem: mm/pagealloc
Hailong liu <liu.hailong6@zte.com.cn>:
mm/page_alloc: add a missing mm_page_alloc_zone_locked() tracepoint
Subsystem: mm/memcg
Hugh Dickins <hughd@google.com>:
mm/memcontrol: fix warning in mem_cgroup_page_lruvec()
Subsystem: mm/kasan
Hailong Liu <liu.hailong6@zte.com.cn>:
arm/kasan: fix the array size of kasan_early_shadow_pte[]
Subsystem: mm/vmalloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/vmalloc.c: fix potential memory leak
Subsystem: mm/migration
Jan Stancek <jstancek@redhat.com>:
mm: migrate: initialize err in do_migrate_pages
Subsystem: mm/hugetlb
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: fix potential missing huge page size info
Subsystem: MAINTAINERS
Vlastimil Babka <vbabka@suse.cz>:
MAINTAINERS: add Vlastimil as slab allocators maintainer
Subsystem: mm/memory-failure
Oscar Salvador <osalvador@suse.de>:
mm,hwpoison: fix printing of page flags
Subsystem: mm/process_vm_access
Andrew Morton <akpm@linux-foundation.org>:
mm/process_vm_access.c: include compat.h
MAINTAINERS | 1 +
include/linux/kasan.h | 6 +++++-
include/linux/memcontrol.h | 2 +-
mm/hugetlb.c | 2 +-
mm/kasan/init.c | 3 ++-
mm/memory-failure.c | 2 +-
mm/mempolicy.c | 2 +-
mm/page_alloc.c | 31 ++++++++++++++++---------------
mm/process_vm_access.c | 1 +
mm/slub.c | 2 +-
mm/vmalloc.c | 4 +++-
11 files changed, 33 insertions(+), 23 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-01-12 23:48 incoming Andrew Morton
@ 2021-01-15 23:32 ` Linus Torvalds
0 siblings, 0 replies; 419+ messages in thread
From: Linus Torvalds @ 2021-01-15 23:32 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, Jan 12, 2021 at 3:48 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c.
Whee. I had completely dropped the ball on this - I had built my usual
"akpm" branch with the patches, but then had completely forgotten
about it after doing my basic build tests.
I tend to leave it for a while to see if people send belated ACK/NAK's
for the patches, but that "for a while" is typically "overnight", not
several days.
So if you ever notice that I haven't merged your patch submission, and
you haven't seen me comment on them, feel free to ping me to remind
me.
Because it might just have gotten lost in the shuffle for some random
reason. Admittedly it's rare - I think this is the first time I just
randomly noticed three days later that I'd never done the actual merge
of the patch-series).
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-01-24 5:00 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-01-24 5:00 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
19 patches, based on e1ae4b0be15891faf46d390e9f3dc9bd71a8cae1.
Subsystems affected by this patch series:
mm/pagealloc
mm/memcg
mm/kasan
ubsan
mm/memory-failure
mm/highmem
proc
MAINTAINERS
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: fix initialization of struct page for holes in memory layout", v3:
x86/setup: don't remove E820_TYPE_RAM for pfn 0
mm: fix initialization of struct page for holes in memory layout
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: optimize objcg stock draining
Shakeel Butt <shakeelb@google.com>:
mm: memcg: fix memcg file_dirty numa stat
mm: fix numa stats for thp migration
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: prevent starvation when writing memory.high
Subsystem: mm/kasan
Lecopzer Chen <lecopzer@gmail.com>:
kasan: fix unaligned address is unhandled in kasan_remove_zero_shadow
kasan: fix incorrect arguments passing in kasan_add_zero_shadow
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix HW_TAGS boot parameters
kasan, mm: fix conflicts with init_on_alloc/free
kasan, mm: fix resetting page_alloc tags for HW_TAGS
Subsystem: ubsan
Arnd Bergmann <arnd@arndb.de>:
ubsan: disable unsigned-overflow check for i386
Subsystem: mm/memory-failure
Dan Williams <dan.j.williams@intel.com>:
mm: fix page reference leak in soft_offline_page()
Subsystem: mm/highmem
Thomas Gleixner <tglx@linutronix.de>:
Patch series "mm/highmem: Fix fallout from generic kmap_local conversions":
sparc/mm/highmem: flush cache and TLB
mm/highmem: prepare for overriding set_pte_at()
mips/mm/highmem: use set_pte() for kmap_local()
powerpc/mm/highmem: use __set_pte_at() for kmap_local()
Subsystem: proc
Xiaoming Ni <nixiaoming@huawei.com>:
proc_sysctl: fix oops caused by incorrect command parameters
Subsystem: MAINTAINERS
Nathan Chancellor <natechancellor@gmail.com>:
MAINTAINERS: add a couple more files to the Clang/LLVM section
Documentation/dev-tools/kasan.rst | 27 ++---------
MAINTAINERS | 2
arch/mips/include/asm/highmem.h | 1
arch/powerpc/include/asm/highmem.h | 2
arch/sparc/include/asm/highmem.h | 9 ++-
arch/x86/kernel/setup.c | 20 +++-----
fs/proc/proc_sysctl.c | 7 ++-
lib/Kconfig.ubsan | 1
mm/highmem.c | 7 ++-
mm/kasan/hw_tags.c | 77 +++++++++++++--------------------
mm/kasan/init.c | 23 +++++----
mm/memcontrol.c | 11 +---
mm/memory-failure.c | 20 ++++++--
mm/migrate.c | 27 ++++++-----
mm/page_alloc.c | 86 ++++++++++++++++++++++---------------
mm/slub.c | 7 +--
16 files changed, 173 insertions(+), 154 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-02-05 2:31 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-02-05 2:31 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
18 patches, based on 5c279c4cf206e03995e04fd3404fa95ffd243a97.
Subsystems affected by this patch series:
mm/hugetlb
mm/compaction
mm/vmalloc
gcov
mm/shmem
mm/memblock
mailmap
mm/pagecache
mm/kasan
ubsan
mm/hugetlb
MAINTAINERS
Subsystem: mm/hugetlb
Muchun Song <songmuchun@bytedance.com>:
mm: hugetlbfs: fix cannot migrate the fallocated HugeTLB page
mm: hugetlb: fix a race between freeing and dissolving the page
mm: hugetlb: fix a race between isolating and freeing page
mm: hugetlb: remove VM_BUG_ON_PAGE from page_huge_active
mm: migrate: do not migrate HugeTLB page whose refcount is one
Subsystem: mm/compaction
Rokudo Yan <wu-yan@tcl.com>:
mm, compaction: move high_pfn to the for loop scope
Subsystem: mm/vmalloc
Rick Edgecombe <rick.p.edgecombe@intel.com>:
mm/vmalloc: separate put pages and flush VM flags
Subsystem: gcov
Johannes Berg <johannes.berg@intel.com>:
init/gcov: allow CONFIG_CONSTRUCTORS on UML to fix module gcov
Subsystem: mm/shmem
Hugh Dickins <hughd@google.com>:
mm: thp: fix MADV_REMOVE deadlock on shmem THP
Subsystem: mm/memblock
Roman Gushchin <guro@fb.com>:
memblock: do not start bottom-up allocations with kernel_end
Subsystem: mailmap
Viresh Kumar <viresh.kumar@linaro.org>:
mailmap: fix name/email for Viresh Kumar
Manivannan Sadhasivam <manivannan.sadhasivam@linaro.org>:
mailmap: add entries for Manivannan Sadhasivam
Subsystem: mm/pagecache
Waiman Long <longman@redhat.com>:
mm/filemap: add missing mem_cgroup_uncharge() to __add_to_page_cache_locked()
Subsystem: mm/kasan
Vincenzo Frascino <vincenzo.frascino@arm.com>:
Patch series "kasan: Fix metadata detection for KASAN_HW_TAGS", v5:
kasan: add explicit preconditions to kasan_report()
kasan: make addr_has_metadata() return true for valid addresses
Subsystem: ubsan
Nathan Chancellor <nathan@kernel.org>:
ubsan: implement __ubsan_handle_alignment_assumption
Subsystem: mm/hugetlb
Muchun Song <songmuchun@bytedance.com>:
mm: hugetlb: fix missing put_page in gather_surplus_pages()
Subsystem: MAINTAINERS
Nathan Chancellor <nathan@kernel.org>:
MAINTAINERS/.mailmap: use my @kernel.org address
.mailmap | 5 ++++
MAINTAINERS | 2 -
fs/hugetlbfs/inode.c | 3 +-
include/linux/hugetlb.h | 2 +
include/linux/kasan.h | 7 ++++++
include/linux/vmalloc.h | 9 +-------
init/Kconfig | 1
init/main.c | 8 ++++++-
kernel/gcov/Kconfig | 2 -
lib/ubsan.c | 31 ++++++++++++++++++++++++++++
lib/ubsan.h | 6 +++++
mm/compaction.c | 3 +-
mm/filemap.c | 4 +++
mm/huge_memory.c | 37 ++++++++++++++++++++-------------
mm/hugetlb.c | 53 ++++++++++++++++++++++++++++++++++++++++++------
mm/kasan/kasan.h | 2 -
mm/memblock.c | 49 +++++---------------------------------------
mm/migrate.c | 6 +++++
18 files changed, 153 insertions(+), 77 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-02-09 21:41 Andrew Morton
2021-02-10 19:30 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2021-02-09 21:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
14 patches, based on e0756cfc7d7cd08c98a53b6009c091a3f6a50be6.
Subsystems affected by this patch series:
squashfs
mm/kasan
firmware
mm/mremap
mm/tmpfs
mm/selftests
MAINTAINERS
mm/memcg
mm/slub
nilfs2
Subsystem: squashfs
Phillip Lougher <phillip@squashfs.org.uk>:
Patch series "Squashfs: fix BIO migration regression and add sanity checks":
squashfs: avoid out of bounds writes in decompressors
squashfs: add more sanity checks in id lookup
squashfs: add more sanity checks in inode lookup
squashfs: add more sanity checks in xattr id lookup
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix stack traces dependency for HW_TAGS
Subsystem: firmware
Fangrui Song <maskray@google.com>:
firmware_loader: align .builtin_fw to 8
Subsystem: mm/mremap
Arnd Bergmann <arnd@arndb.de>:
mm/mremap: fix BUILD_BUG_ON() error in get_extent
Subsystem: mm/tmpfs
Seth Forshee <seth.forshee@canonical.com>:
tmpfs: disallow CONFIG_TMPFS_INODE64 on s390
tmpfs: disallow CONFIG_TMPFS_INODE64 on alpha
Subsystem: mm/selftests
Rong Chen <rong.a.chen@intel.com>:
selftests/vm: rename file run_vmtests to run_vmtests.sh
Subsystem: MAINTAINERS
Andrey Ryabinin <ryabinin.a.a@gmail.com>:
MAINTAINERS: update Andrey Ryabinin's email address
Subsystem: mm/memcg
Johannes Weiner <hannes@cmpxchg.org>:
Revert "mm: memcontrol: avoid workload stalls when lowering memory.high"
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: better heuristic for number of cpus when calculating slab order
Subsystem: nilfs2
Joachim Henke <joachim.henke@t-systems.com>:
nilfs2: make splice write available again
.mailmap | 1
Documentation/dev-tools/kasan.rst | 3 -
MAINTAINERS | 2 -
fs/Kconfig | 4 +-
fs/nilfs2/file.c | 1
fs/squashfs/block.c | 8 ++++
fs/squashfs/export.c | 41 +++++++++++++++++++----
fs/squashfs/id.c | 40 ++++++++++++++++++-----
fs/squashfs/squashfs_fs_sb.h | 1
fs/squashfs/super.c | 6 +--
fs/squashfs/xattr.h | 10 +++++
fs/squashfs/xattr_id.c | 66 ++++++++++++++++++++++++++++++++------
include/asm-generic/vmlinux.lds.h | 2 -
mm/kasan/hw_tags.c | 8 +---
mm/memcontrol.c | 5 +-
mm/mremap.c | 5 +-
mm/slub.c | 18 +++++++++-
17 files changed, 172 insertions(+), 49 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-02-09 21:41 incoming Andrew Morton
@ 2021-02-10 19:30 ` Linus Torvalds
0 siblings, 0 replies; 419+ messages in thread
From: Linus Torvalds @ 2021-02-10 19:30 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
Hah. This series shows a small deficiency in your scripting wrt the diffstat:
On Tue, Feb 9, 2021 at 1:41 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> .mailmap | 1
...
> mm/slub.c | 18 +++++++++-
> 17 files changed, 172 insertions(+), 49 deletions(-)
It actually has 18 files changed, but one of them is a pure rename (no
change to the content), and apparently your diffstat tool can't handle
that case.
It *should* have ended with
...
mm/slub.c | 18 +++++-
.../selftests/vm/{run_vmtests => run_vmtests.sh} | 0
18 files changed, 172 insertions(+), 49 deletions(-)
rename tools/testing/selftests/vm/{run_vmtests => run_vmtests.sh} (100%)
if you'd done a proper "git diff -M --stat --summary" of the series.
[ Ok, by default git would actually have said
18 files changed, 171 insertions(+), 48 deletions(-)
but it looks like you use the patience diff option, which gives that
extra insertion/deletion line because it generates the diff a bit
differently ]
Not a big deal,, but it made me briefly wonder "why doesn't my
diffstat match yours".
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-02-13 4:52 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-02-13 4:52 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
6 patches, based on dcc0b49040c70ad827a7f3d58a21b01fdb14e749.
Subsystems affected by this patch series:
mm/pagemap
scripts
MAINTAINERS
h8300
Subsystem: mm/pagemap
Mike Rapoport <rppt@linux.ibm.com>:
m68k: make __pfn_to_phys() and __phys_to_pfn() available for !MMU
Subsystem: scripts
Rong Chen <rong.a.chen@intel.com>:
scripts/recordmcount.pl: support big endian for ARCH sh
Subsystem: MAINTAINERS
Andrey Konovalov <andreyknvl@google.com>:
MAINTAINERS: update KASAN file list
MAINTAINERS: update Andrey Konovalov's email address
MAINTAINERS: add Andrey Konovalov to KASAN reviewers
Subsystem: h8300
Randy Dunlap <rdunlap@infradead.org>:
h8300: fix PREEMPTION build, TI_PRE_COUNT undefined
MAINTAINERS | 8 +++++---
arch/h8300/kernel/asm-offsets.c | 3 +++
arch/m68k/include/asm/page.h | 2 +-
scripts/recordmcount.pl | 6 +++++-
4 files changed, 14 insertions(+), 5 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-02-24 19:58 Andrew Morton
2021-02-24 21:30 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2021-02-24 19:58 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
A few small subsystems and some of MM.
173 patches, based on c03c21ba6f4e95e406a1a7b4c34ef334b977c194.
Subsystems affected by this patch series:
hexagon
scripts
ntfs
ocfs2
vfs
mm/slab-generic
mm/slab
mm/slub
mm/debug
mm/pagecache
mm/swap
mm/memcg
mm/pagemap
mm/mprotect
mm/mremap
mm/page-reporting
mm/vmalloc
mm/kasan
mm/pagealloc
mm/memory-failure
mm/hugetlb
mm/vmscan
mm/z3fold
mm/compaction
mm/mempolicy
mm/oom-kill
mm/hugetlbfs
mm/migration
Subsystem: hexagon
Randy Dunlap <rdunlap@infradead.org>:
hexagon: remove CONFIG_EXPERIMENTAL from defconfigs
Subsystem: scripts
tangchunyou <tangchunyou@yulong.com>:
scripts/spelling.txt: increase error-prone spell checking
zuoqilin <zuoqilin@yulong.com>:
scripts/spelling.txt: check for "exeeds"
dingsenjie <dingsenjie@yulong.com>:
scripts/spelling.txt: add "allocted" and "exeeds" typo
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ntfs
Randy Dunlap <rdunlap@infradead.org>:
ntfs: layout.h: delete duplicated words
Rustam Kovhaev <rkovhaev@gmail.com>:
ntfs: check for valid standard information attribute
Subsystem: ocfs2
Yi Li <yili@winhong.com>:
ocfs2: remove redundant conditional before iput
guozh <guozh88@chinatelecom.cn>:
ocfs2: clean up some definitions which are not used any more
Dan Carpenter <dan.carpenter@oracle.com>:
ocfs2: fix a use after free on error
Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
ocfs2: simplify the calculation of variables
Subsystem: vfs
Randy Dunlap <rdunlap@infradead.org>:
fs: delete repeated words in comments
Alexey Dobriyan <adobriyan@gmail.com>:
ramfs: support O_TMPFILE
Subsystem: mm/slab-generic
Jacob Wen <jian.w.wen@oracle.com>:
mm, tracing: record slab name for kmem_cache_free()
Nikolay Borisov <nborisov@suse.com>:
mm/sl?b.c: remove ctor argument from kmem_cache_flags
Subsystem: mm/slab
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/slab: minor coding style tweaks
Subsystem: mm/slub
Johannes Berg <johannes.berg@intel.com>:
mm/slub: disable user tracing for kmemleak caches by default
Vlastimil Babka <vbabka@suse.cz>:
Patch series "mm, slab, slub: remove cpu and memory hotplug locks":
mm, slub: stop freeing kmem_cache_node structures on node offline
mm, slab, slub: stop taking memory hotplug lock
mm, slab, slub: stop taking cpu hotplug lock
mm, slub: splice cpu and page freelists in deactivate_slab()
mm, slub: remove slub_memcg_sysfs boot param and CONFIG_SLUB_MEMCG_SYSFS_ON
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/slub: minor coding style tweaks
Subsystem: mm/debug
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/debug: improve memcg debugging
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/debug_vm_pgtable: Some minor updates", v3:
mm/debug_vm_pgtable/basic: add validation for dirtiness after write protect
mm/debug_vm_pgtable/basic: iterate over entire protection_map[]
Miaohe Lin <linmiaohe@huawei.com>:
mm/page_owner: use helper function zone_end_pfn() to get end_pfn
Subsystem: mm/pagecache
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm/filemap: remove unused parameter and change to void type for replace_page_cache_page()
Pavel Begunkov <asml.silence@gmail.com>:
mm/filemap: don't revert iter on -EIOCBQUEUED
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Refactor generic_file_buffered_read", v5:
mm/filemap: rename generic_file_buffered_read subfunctions
mm/filemap: remove dynamically allocated array from filemap_read
mm/filemap: convert filemap_get_pages to take a pagevec
mm/filemap: use head pages in generic_file_buffered_read
mm/filemap: pass a sleep state to put_and_wait_on_page_locked
mm/filemap: support readpage splitting a page
mm/filemap: inline __wait_on_page_locked_async into caller
mm/filemap: don't call ->readpage if IOCB_WAITQ is set
mm/filemap: change filemap_read_page calling conventions
mm/filemap: change filemap_create_page calling conventions
mm/filemap: convert filemap_update_page to return an errno
mm/filemap: move the iocb checks into filemap_update_page
mm/filemap: add filemap_range_uptodate
mm/filemap: split filemap_readahead out of filemap_get_pages
mm/filemap: restructure filemap_get_pages
mm/filemap: don't relock the page after calling readpage
Christoph Hellwig <hch@lst.de>:
mm/filemap: rename generic_file_buffered_read to filemap_read
mm/filemap: simplify generic_file_read_iter
Yang Guo <guoyang2@huawei.com>:
fs/buffer.c: add checking buffer head stat before clear
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: backing-dev: Remove duplicated macro definition
Subsystem: mm/swap
Yang Li <abaci-bugfix@linux.alibaba.com>:
mm/swap_slots.c: remove redundant NULL check
Stephen Zhang <stephenzhangzsd@gmail.com>:
mm/swapfile.c: fix debugging information problem
Georgi Djakov <georgi.djakov@linaro.org>:
mm/page_io: use pr_alert_ratelimited for swap read/write errors
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
mm/swap_state: constify static struct attribute_group
Yu Zhao <yuzhao@google.com>:
mm/swap: don't SetPageWorkingset unconditionally during swapin
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: pre-allocate obj_cgroups for slab caches with SLAB_ACCOUNT
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: optimize per-lruvec stats counter memory usage
Patch series "Convert all THP vmstat counters to pages", v6:
mm: memcontrol: fix NR_ANON_THPS accounting in charge moving
mm: memcontrol: convert NR_ANON_THPS account to pages
mm: memcontrol: convert NR_FILE_THPS account to pages
mm: memcontrol: convert NR_SHMEM_THPS account to pages
mm: memcontrol: convert NR_SHMEM_PMDMAPPED account to pages
mm: memcontrol: convert NR_FILE_PMDMAPPED account to pages
mm: memcontrol: make the slab calculation consistent
Alex Shi <alex.shi@linux.alibaba.com>:
mm/memcg: revise the using condition of lock_page_lruvec function series
mm/memcg: remove rcu locking for lock_page_lruvec function series
Shakeel Butt <shakeelb@google.com>:
mm: memcg: add swapcache stat for memcg v2
Roman Gushchin <guro@fb.com>:
mm: kmem: make __memcg_kmem_(un)charge static
Feng Tang <feng.tang@intel.com>:
mm: page_counter: re-layout structure to reduce false sharing
Yang Li <abaci-bugfix@linux.alibaba.com>:
mm/memcontrol: remove redundant NULL check
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: replace the loop with a list_for_each_entry()
Shakeel Butt <shakeelb@google.com>:
mm/list_lru.c: remove kvfree_rcu_local()
Johannes Weiner <hannes@cmpxchg.org>:
fs: buffer: use raw page_memcg() on locked page
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: fix swap undercounting in cgroup2
mm: memcontrol: fix get_active_memcg return value
mm: memcontrol: fix slub memory accounting
Subsystem: mm/pagemap
Adrian Huang <ahuang12@lenovo.com>:
mm/mmap.c: remove unnecessary local variable
Miaohe Lin <linmiaohe@huawei.com>:
mm/memory.c: fix potential pte_unmap_unlock pte error
mm/pgtable-generic.c: simplify the VM_BUG_ON condition in pmdp_huge_clear_flush()
mm/pgtable-generic.c: optimize the VM_BUG_ON condition in pmdp_huge_clear_flush()
mm/memory.c: fix potential pte_unmap_unlock pte error
Subsystem: mm/mprotect
Tianjia Zhang <tianjia.zhang@linux.alibaba.com>:
mm/mprotect.c: optimize error detection in do_mprotect_pkey()
Subsystem: mm/mremap
Li Xinhai <lixinhai.lxh@gmail.com>:
mm: rmap: explicitly reset vma->anon_vma in unlink_anon_vmas()
mm: mremap: unlink anon_vmas when mremap with MREMAP_DONTUNMAP success
Subsystem: mm/page-reporting
sh <sh_def@163.com>:
mm/page_reporting: use list_entry_is_head() in page_reporting_cycle()
Subsystem: mm/vmalloc
Yang Li <abaci-bugfix@linux.alibaba.com>:
vmalloc: remove redundant NULL check
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: HW_TAGS tests support and fixes", v4:
kasan: prefix global functions with kasan_
kasan: clarify HW_TAGS impact on TBI
kasan: clean up comments in tests
kasan: add macros to simplify checking test constraints
kasan: add match-all tag tests
kasan, arm64: allow using KUnit tests with HW_TAGS mode
kasan: rename CONFIG_TEST_KASAN_MODULE
kasan: add compiler barriers to KUNIT_EXPECT_KASAN_FAIL
kasan: adapt kmalloc_uaf2 test to HW_TAGS mode
kasan: fix memory corruption in kasan_bitops_tags test
kasan: move _RET_IP_ to inline wrappers
kasan: fix bug detection via ksize for HW_TAGS mode
kasan: add proper page allocator tests
kasan: add a test for kmem_cache_alloc/free_bulk
kasan: don't run tests when KASAN is not enabled
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: remove redundant config option
Subsystem: mm/pagealloc
Baoquan He <bhe@redhat.com>:
Patch series "mm: clean up names and parameters of memmap_init_xxxx functions", v5:
mm: fix prototype warning from kernel test robot
mm: rename memmap_init() and memmap_init_zone()
mm: simplify parater of function memmap_init_zone()
mm: simplify parameter of setup_usemap()
mm: remove unneeded local variable in free_area_init_core
David Hildenbrand <david@redhat.com>:
Patch series "mm: simplify free_highmem_page() and free_reserved_page()":
video: fbdev: acornfb: remove free_unused_pages()
mm: simplify free_highmem_page() and free_reserved_page()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/gfp: add kernel-doc for gfp_t
Subsystem: mm/memory-failure
Aili Yao <yaoaili@kingsoft.com>:
mm,hwpoison: send SIGBUS to PF_MCE_EARLY processes on action required events
Subsystem: mm/hugetlb
Bibo Mao <maobibo@loongson.cn>:
mm/huge_memory.c: update tlb entry if pmd is changed
MIPS: do not call flush_tlb_all when setting pmd entry
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: fix potential double free in hugetlb_register_node() error path
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/hugetlb.c: fix unnecessary address expansion of pmd sharing
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: avoid unnecessary hugetlb_acct_memory() call
mm/hugetlb: use helper huge_page_order and pages_per_huge_page
mm/hugetlb: fix use after free when subpool max_hpages accounting is not enabled
Jiapeng Zhong <abaci-bugfix@linux.alibaba.com>:
mm/hugetlb: simplify the calculation of variables
Joao Martins <joao.m.martins@oracle.com>:
Patch series "mm/hugetlb: follow_hugetlb_page() improvements", v2:
mm/hugetlb: grab head page refcount once for group of subpages
mm/hugetlb: refactor subpage recording
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: fix some comment typos
Yanfei Xu <yanfei.xu@windriver.com>:
mm/hugetlb: remove redundant check in preparing and destroying gigantic page
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/hugetlb.c: fix typos in comments
Miaohe Lin <linmiaohe@huawei.com>:
mm/huge_memory.c: remove unused return value of set_huge_zero_page()
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/pmem: avoid inserting hugepage PTE entry with fsdax if hugepage support is disabled
Miaohe Lin <linmiaohe@huawei.com>:
hugetlb_cgroup: use helper pages_per_huge_page() in hugetlb_cgroup
mm/hugetlb: use helper function range_in_vma() in page_table_shareable()
mm/hugetlb: remove unnecessary VM_BUG_ON_PAGE on putback_active_hugepage()
mm/hugetlb: use helper huge_page_size() to get hugepage size
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: fix update_and_free_page contig page struct assumption
hugetlb: fix copy_huge_page_from_user contig page struct assumption
Chen Wandun <chenwandun@huawei.com>:
mm/hugetlb: suppress wrong warning info when alloc gigantic page
Subsystem: mm/vmscan
Alex Shi <alex.shi@linux.alibaba.com>:
mm/vmscan: __isolate_lru_page_prepare() cleanup
Miaohe Lin <linmiaohe@huawei.com>:
mm/workingset.c: avoid unnecessary max_nodes estimation in count_shadow_nodes()
Yu Zhao <yuzhao@google.com>:
Patch series "mm: lru related cleanups", v2:
mm/vmscan.c: use add_page_to_lru_list()
include/linux/mm_inline.h: shuffle lru list addition and deletion functions
mm: don't pass "enum lru_list" to lru list addition functions
mm/swap.c: don't pass "enum lru_list" to trace_mm_lru_insertion()
mm/swap.c: don't pass "enum lru_list" to del_page_from_lru_list()
mm: add __clear_page_lru_flags() to replace page_off_lru()
mm: VM_BUG_ON lru page flags
include/linux/mm_inline.h: fold page_lru_base_type() into its sole caller
include/linux/mm_inline.h: fold __update_lru_size() into its sole caller
mm/vmscan.c: make lruvec_lru_size() static
Oscar Salvador <osalvador@suse.de>:
mm: workingset: clarify eviction order and distance calculation
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "create hugetlb flags to consolidate state", v3:
hugetlb: use page.private for hugetlb specific page flags
hugetlb: convert page_huge_active() HPageMigratable flag
hugetlb: convert PageHugeTemporary() to HPageTemporary flag
hugetlb: convert PageHugeFreed to HPageFreed flag
include/linux/hugetlb.h: add synchronization information for new hugetlb specific flags
hugetlb: fix uninitialized subpool pointer
Dave Hansen <dave.hansen@linux.intel.com>:
mm/vmscan: restore zone_reclaim_mode ABI
Subsystem: mm/z3fold
Miaohe Lin <linmiaohe@huawei.com>:
z3fold: remove unused attribute for release_z3fold_page
z3fold: simplify the zhdr initialization code in init_z3fold_page()
Subsystem: mm/compaction
Alex Shi <alex.shi@linux.alibaba.com>:
mm/compaction: remove rcu_read_lock during page compaction
Miaohe Lin <linmiaohe@huawei.com>:
mm/compaction: remove duplicated VM_BUG_ON_PAGE !PageLocked
Charan Teja Reddy <charante@codeaurora.org>:
mm/compaction: correct deferral logic for proactive compaction
Wonhyuk Yang <vvghjk1234@gmail.com>:
mm/compaction: fix misbehaviors of fast_find_migrateblock()
Vlastimil Babka <vbabka@suse.cz>:
mm, compaction: make fast_isolate_freepages() stay within zone
Subsystem: mm/mempolicy
Huang Ying <ying.huang@intel.com>:
numa balancing: migrate on fault among multiple bound nodes
Miaohe Lin <linmiaohe@huawei.com>:
mm/mempolicy: use helper range_in_vma() in queue_pages_test_walk()
Subsystem: mm/oom-kill
Tang Yizhou <tangyizhou@huawei.com>:
mm, oom: fix a comment in dump_task()
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
mm/hugetlb: change hugetlb_reserve_pages() to type bool
hugetlbfs: remove special hugetlbfs_set_page_dirty()
Miaohe Lin <linmiaohe@huawei.com>:
hugetlbfs: remove useless BUG_ON(!inode) in hugetlbfs_setattr()
hugetlbfs: use helper macro default_hstate in init_hugetlbfs_fs
hugetlbfs: correct obsolete function name in hugetlbfs_read_iter()
hugetlbfs: remove meaningless variable avoid_reserve
hugetlbfs: make hugepage size conversion more readable
hugetlbfs: correct some obsolete comments about inode i_mutex
hugetlbfs: fix some comment typos
hugetlbfs: remove unneeded return value of hugetlb_vmtruncate()
Subsystem: mm/migration
Chengyang Fan <cy.fan@huawei.com>:
mm/migrate: remove unneeded semicolons
Documentation/admin-guide/cgroup-v2.rst | 4
Documentation/admin-guide/kernel-parameters.txt | 8
Documentation/admin-guide/sysctl/vm.rst | 10
Documentation/core-api/mm-api.rst | 7
Documentation/dev-tools/kasan.rst | 24
Documentation/vm/arch_pgtable_helpers.rst | 8
arch/arm64/include/asm/memory.h | 1
arch/arm64/include/asm/mte-kasan.h | 12
arch/arm64/kernel/mte.c | 12
arch/arm64/kernel/sleep.S | 2
arch/arm64/mm/fault.c | 20
arch/hexagon/configs/comet_defconfig | 1
arch/ia64/include/asm/pgtable.h | 6
arch/ia64/mm/init.c | 18
arch/mips/mm/pgtable-32.c | 1
arch/mips/mm/pgtable-64.c | 1
arch/x86/kernel/acpi/wakeup_64.S | 2
drivers/base/node.c | 33
drivers/video/fbdev/acornfb.c | 34
fs/block_dev.c | 2
fs/btrfs/file.c | 2
fs/buffer.c | 7
fs/dcache.c | 4
fs/direct-io.c | 4
fs/exec.c | 4
fs/fhandle.c | 2
fs/fuse/dev.c | 6
fs/hugetlbfs/inode.c | 72 --
fs/ntfs/inode.c | 6
fs/ntfs/layout.h | 4
fs/ocfs2/cluster/heartbeat.c | 8
fs/ocfs2/dlm/dlmast.c | 10
fs/ocfs2/dlm/dlmcommon.h | 4
fs/ocfs2/refcounttree.c | 2
fs/ocfs2/super.c | 2
fs/pipe.c | 2
fs/proc/meminfo.c | 10
fs/proc/vmcore.c | 7
fs/ramfs/inode.c | 13
include/linux/fs.h | 4
include/linux/gfp.h | 14
include/linux/highmem-internal.h | 5
include/linux/huge_mm.h | 15
include/linux/hugetlb.h | 98 ++
include/linux/kasan-checks.h | 6
include/linux/kasan.h | 39 -
include/linux/memcontrol.h | 43 -
include/linux/migrate.h | 2
include/linux/mm.h | 28
include/linux/mm_inline.h | 123 +--
include/linux/mmzone.h | 30
include/linux/page-flags.h | 6
include/linux/page_counter.h | 9
include/linux/pagemap.h | 5
include/linux/swap.h | 8
include/trace/events/kmem.h | 24
include/trace/events/pagemap.h | 11
include/uapi/linux/mempolicy.h | 4
init/Kconfig | 14
lib/Kconfig.kasan | 14
lib/Makefile | 2
lib/test_kasan.c | 446 ++++++++----
lib/test_kasan_module.c | 5
mm/backing-dev.c | 6
mm/compaction.c | 73 +-
mm/debug.c | 10
mm/debug_vm_pgtable.c | 86 ++
mm/filemap.c | 859 +++++++++++-------------
mm/gup.c | 5
mm/huge_memory.c | 28
mm/hugetlb.c | 376 ++++------
mm/hugetlb_cgroup.c | 6
mm/kasan/common.c | 60 -
mm/kasan/generic.c | 40 -
mm/kasan/hw_tags.c | 16
mm/kasan/kasan.h | 87 +-
mm/kasan/quarantine.c | 22
mm/kasan/report.c | 15
mm/kasan/report_generic.c | 10
mm/kasan/report_hw_tags.c | 8
mm/kasan/report_sw_tags.c | 8
mm/kasan/shadow.c | 27
mm/kasan/sw_tags.c | 22
mm/khugepaged.c | 6
mm/list_lru.c | 12
mm/memcontrol.c | 309 ++++----
mm/memory-failure.c | 34
mm/memory.c | 24
mm/memory_hotplug.c | 11
mm/mempolicy.c | 18
mm/mempool.c | 2
mm/migrate.c | 10
mm/mlock.c | 3
mm/mmap.c | 4
mm/mprotect.c | 7
mm/mremap.c | 8
mm/oom_kill.c | 5
mm/page_alloc.c | 70 -
mm/page_io.c | 12
mm/page_owner.c | 4
mm/page_reporting.c | 2
mm/pgtable-generic.c | 9
mm/rmap.c | 35
mm/shmem.c | 2
mm/slab.c | 21
mm/slab.h | 20
mm/slab_common.c | 40 -
mm/slob.c | 2
mm/slub.c | 169 ++--
mm/swap.c | 54 -
mm/swap_slots.c | 3
mm/swap_state.c | 31
mm/swapfile.c | 8
mm/vmscan.c | 100 +-
mm/vmstat.c | 14
mm/workingset.c | 7
mm/z3fold.c | 11
scripts/Makefile.kasan | 10
scripts/spelling.txt | 30
tools/objtool/check.c | 2
120 files changed, 2249 insertions(+), 1954 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-02-24 19:58 incoming Andrew Morton
@ 2021-02-24 21:30 ` Linus Torvalds
2021-02-24 21:37 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2021-02-24 21:30 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Wed, Feb 24, 2021 at 11:58 AM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> A few small subsystems and some of MM.
Hmm. I haven't bisected things yet, but I suspect it's something with
the KASAN patches. With this all applied, I get:
lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
and
lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
larger than 2048 bytes [-Wframe-larger-than=]
which is obviously not really acceptable. A 11kB stack frame _will_
cause issues.
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-02-24 21:30 ` incoming Linus Torvalds
@ 2021-02-24 21:37 ` Linus Torvalds
2021-02-25 8:53 ` incoming Arnd Bergmann
0 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2021-02-24 21:37 UTC (permalink / raw)
To: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor,
Arnd Bergmann, Andrey Konovalov
Cc: Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko
On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Hmm. I haven't bisected things yet, but I suspect it's something with
> the KASAN patches. With this all applied, I get:
>
> lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
>
> and
>
> lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> larger than 2048 bytes [-Wframe-larger-than=]
>
> which is obviously not really acceptable. A 11kB stack frame _will_
> cause issues.
A quick bisect shoes that this was introduced by "[patch 101/173]
kasan: remove redundant config option".
I didn't check what part of that patch screws up, but it's definitely
doing something bad.
I will drop that patch.
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-02-24 21:37 ` incoming Linus Torvalds
@ 2021-02-25 8:53 ` Arnd Bergmann
2021-02-25 9:12 ` incoming Andrey Ryabinin
0 siblings, 1 reply; 419+ messages in thread
From: Arnd Bergmann @ 2021-02-25 8:53 UTC (permalink / raw)
To: Linus Torvalds
Cc: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor,
Arnd Bergmann, Andrey Konovalov, Linux-MM, mm-commits,
Andrey Ryabinin, Alexander Potapenko
On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > Hmm. I haven't bisected things yet, but I suspect it's something with
> > the KASAN patches. With this all applied, I get:
> >
> > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> >
> > and
> >
> > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > larger than 2048 bytes [-Wframe-larger-than=]
> >
> > which is obviously not really acceptable. A 11kB stack frame _will_
> > cause issues.
>
> A quick bisect shoes that this was introduced by "[patch 101/173]
> kasan: remove redundant config option".
>
> I didn't check what part of that patch screws up, but it's definitely
> doing something bad.
I'm not sure why that patch surfaced the bug, but it's worth pointing
out that the underlying problem is asan-stack in combination
with the structleak plugin. This will happen for every user of kunit.
I sent a series[1] out earlier this year to turn off the structleak
plugin as an alternative workaround, but need to follow up on
the remaining patches. Someone suggested adding a more
generic way to turn off the plugin for a file instead of open-coding
the CLFAGS_REMOVE_*.o Makefile bit, which would help.
I am also still hoping that someone can come up with a way
to make kunit work better with the structleak plugin, as there
shouldn't be a fundamental reason why it can't work, just that
it the code pattern triggers a particularly bad case in the compiler.
Arnd
[1] https://lore.kernel.org/lkml/20210125124533.101339-1-arnd@kernel.org/
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-02-25 8:53 ` incoming Arnd Bergmann
@ 2021-02-25 9:12 ` Andrey Ryabinin
2021-02-25 11:07 ` incoming Walter Wu
0 siblings, 1 reply; 419+ messages in thread
From: Andrey Ryabinin @ 2021-02-25 9:12 UTC (permalink / raw)
To: Arnd Bergmann
Cc: Linus Torvalds, Andrew Morton, Walter Wu, Dmitry Vyukov,
Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM,
mm-commits, Andrey Ryabinin, Alexander Potapenko
On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote:
>
> On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> > <torvalds@linux-foundation.org> wrote:
> > >
> > > Hmm. I haven't bisected things yet, but I suspect it's something with
> > > the KASAN patches. With this all applied, I get:
> > >
> > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> > >
> > > and
> > >
> > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > > larger than 2048 bytes [-Wframe-larger-than=]
> > >
> > > which is obviously not really acceptable. A 11kB stack frame _will_
> > > cause issues.
> >
> > A quick bisect shoes that this was introduced by "[patch 101/173]
> > kasan: remove redundant config option".
> >
> > I didn't check what part of that patch screws up, but it's definitely
> > doing something bad.
>
> I'm not sure why that patch surfaced the bug, but it's worth pointing
> out that the underlying problem is asan-stack in combination
> with the structleak plugin. This will happen for every user of kunit.
>
The patch didn't update KASAN_STACK dependency in kconfig:
config GCC_PLUGIN_STRUCTLEAK_BYREF
....
depends on !(KASAN && KASAN_STACK=1)
This 'depends on' stopped working with the patch
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-02-25 9:12 ` incoming Andrey Ryabinin
@ 2021-02-25 11:07 ` Walter Wu
0 siblings, 0 replies; 419+ messages in thread
From: Walter Wu @ 2021-02-25 11:07 UTC (permalink / raw)
To: Andrey Ryabinin
Cc: Arnd Bergmann, Linus Torvalds, Andrew Morton, Dmitry Vyukov,
Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM,
mm-commits, Andrey Ryabinin, Alexander Potapenko
Hi Andrey,
On Thu, 2021-02-25 at 12:12 +0300, Andrey Ryabinin wrote:
> On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote:
> >
> > On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
> > <torvalds@linux-foundation.org> wrote:
> > >
> > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> > > <torvalds@linux-foundation.org> wrote:
> > > >
> > > > Hmm. I haven't bisected things yet, but I suspect it's something with
> > > > the KASAN patches. With this all applied, I get:
> > > >
> > > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > > > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> > > >
> > > > and
> > > >
> > > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > > > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > > > larger than 2048 bytes [-Wframe-larger-than=]
> > > >
> > > > which is obviously not really acceptable. A 11kB stack frame _will_
> > > > cause issues.
> > >
> > > A quick bisect shoes that this was introduced by "[patch 101/173]
> > > kasan: remove redundant config option".
> > >
> > > I didn't check what part of that patch screws up, but it's definitely
> > > doing something bad.
> >
> > I'm not sure why that patch surfaced the bug, but it's worth pointing
> > out that the underlying problem is asan-stack in combination
> > with the structleak plugin. This will happen for every user of kunit.
> >
>
> The patch didn't update KASAN_STACK dependency in kconfig:
> config GCC_PLUGIN_STRUCTLEAK_BYREF
> ....
> depends on !(KASAN && KASAN_STACK=1)
>
> This 'depends on' stopped working with the patch
Thanks for pointing out this problem. I will re-send that patch.
Walter
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-02-26 1:14 Andrew Morton
2021-02-26 17:55 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2021-02-26 1:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- The rest of MM.
Includes kfence - another runtime memory validator. Not as
thorough as KASAN, but it has unmeasurable overhead and is intended
to be usable in production builds.
- Everything else
118 patches, based on 6fbd6cf85a3be127454a1ad58525a3adcf8612ab.
Subsystems affected by this patch series:
mm/thp
mm/cma
mm/vmstat
mm/memory-hotplug
mm/mlock
mm/rmap
mm/zswap
mm/zsmalloc
mm/cleanups
mm/kfence
mm/kasan2
alpha
procfs
sysctl
misc
core-kernel
MAINTAINERS
lib
bitops
checkpatch
init
coredump
seq_file
gdb
ubsan
initramfs
mm/pagemap2
Subsystem: mm/thp
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Overhaul multi-page lookups for THP", v4:
mm: make pagecache tagged lookups return only head pages
mm/shmem: use pagevec_lookup in shmem_unlock_mapping
mm/swap: optimise get_shadow_from_swap_cache
mm: add FGP_ENTRY
mm/filemap: rename find_get_entry to mapping_get_entry
mm/filemap: add helper for finding pages
mm/filemap: add mapping_seek_hole_data
iomap: use mapping_seek_hole_data
mm: add and use find_lock_entries
mm: add an 'end' parameter to find_get_entries
mm: add an 'end' parameter to pagevec_lookup_entries
mm: remove nr_entries parameter from pagevec_lookup_entries
mm: pass pvec directly to find_get_entries
mm: remove pagevec_lookup_entries
Rik van Riel <riel@surriel.com>:
Patch series "mm,thp,shm: limit shmem THP alloc gfp_mask", v6:
mm,thp,shmem: limit shmem THP alloc gfp_mask
mm,thp,shm: limit gfp mask to no more than specified
mm,thp,shmem: make khugepaged obey tmpfs mount flags
mm,shmem,thp: limit shmem THP allocations to requested zones
Subsystem: mm/cma
Roman Gushchin <guro@fb.com>:
mm: cma: allocate cma areas bottom-up
David Hildenbrand <david@redhat.com>:
mm/cma: expose all pages to the buddy if activation of an area fails
mm/page_alloc: count CMA pages per zone and print them in /proc/zoneinfo
Patrick Daly <pdaly@codeaurora.org>:
mm: cma: print region name on failure
Subsystem: mm/vmstat
Johannes Weiner <hannes@cmpxchg.org>:
mm: vmstat: fix NOHZ wakeups for node stat changes
mm: vmstat: add some comments on internal storage of byte items
Jiang Biao <benbjiang@tencent.com>:
mm/vmstat.c: erase latency in vmstat_shepherd
Subsystem: mm/memory-hotplug
Dan Williams <dan.j.williams@intel.com>:
Patch series "mm: Fix pfn_to_online_page() with respect to ZONE_DEVICE", v4:
mm: move pfn_to_online_page() out of line
mm: teach pfn_to_online_page() to consider subsection validity
mm: teach pfn_to_online_page() about ZONE_DEVICE section collisions
mm: fix memory_failure() handling of dax-namespace metadata
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/memory_hotplug: rename all existing 'memhp' into 'mhp'
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: MEMHP_MERGE_RESOURCE -> MHP_MERGE_RESOURCE
Miaohe Lin <linmiaohe@huawei.com>:
mm/memory_hotplug: use helper function zone_end_pfn() to get end_pfn
David Hildenbrand <david@redhat.com>:
drivers/base/memory: don't store phys_device in memory blocks
Documentation: sysfs/memory: clarify some memory block device properties
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/memory_hotplug: Pre-validate the address range with platform", v5:
mm/memory_hotplug: prevalidate the address range being added with platform
arm64/mm: define arch_get_mappable_range()
s390/mm: define arch_get_mappable_range()
David Hildenbrand <david@redhat.com>:
virtio-mem: check against mhp_get_pluggable_range() which memory we can hotplug
Subsystem: mm/mlock
Miaohe Lin <linmiaohe@huawei.com>:
mm/mlock: stop counting mlocked pages when none vma is found
Subsystem: mm/rmap
Miaohe Lin <linmiaohe@huawei.com>:
mm/rmap: correct some obsolete comments of anon_vma
mm/rmap: remove unneeded semicolon in page_not_mapped()
mm/rmap: fix obsolete comment in __page_check_anon_rmap()
mm/rmap: use page_not_mapped in try_to_unmap()
mm/rmap: correct obsolete comment of page_get_anon_vma()
mm/rmap: fix potential pte_unmap on an not mapped pte
Subsystem: mm/zswap
Randy Dunlap <rdunlap@infradead.org>:
mm: zswap: clean up confusing comment
Tian Tao <tiantao6@hisilicon.com>:
Patch series "Fix the compatibility of zsmalloc and zswap":
mm/zswap: add the flag can_sleep_mapped
mm: set the sleep_mapped to true for zbud and z3fold
Subsystem: mm/zsmalloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/zsmalloc.c: convert to use kmem_cache_zalloc in cache_alloc_zspage()
Rokudo Yan <wu-yan@tcl.com>:
zsmalloc: account the number of compacted pages correctly
Miaohe Lin <linmiaohe@huawei.com>:
mm/zsmalloc.c: use page_private() to access page->private
Subsystem: mm/cleanups
Guo Ren <guoren@linux.alibaba.com>:
mm: page-flags.h: Typo fix (It -> If)
Daniel Vetter <daniel.vetter@ffwll.ch>:
mm/dmapool: use might_alloc()
mm/backing-dev.c: use might_alloc()
Stephen Zhang <stephenzhangzsd@gmail.com>:
mm/early_ioremap.c: use __func__ instead of function name
Subsystem: mm/kfence
Alexander Potapenko <glider@google.com>:
Patch series "KFENCE: A low-overhead sampling-based memory safety error detector", v7:
mm: add Kernel Electric-Fence infrastructure
x86, kfence: enable KFENCE for x86
Marco Elver <elver@google.com>:
arm64, kfence: enable KFENCE for ARM64
kfence: use pt_regs to generate stack trace on faults
Alexander Potapenko <glider@google.com>:
mm, kfence: insert KFENCE hooks for SLAB
mm, kfence: insert KFENCE hooks for SLUB
kfence, kasan: make KFENCE compatible with KASAN
Marco Elver <elver@google.com>:
kfence, Documentation: add KFENCE documentation
kfence: add test suite
MAINTAINERS: add entry for KFENCE
kfence: report sensitive information based on no_hash_pointers
Alexander Potapenko <glider@google.com>:
Patch series "Add error_report_end tracepoint to KFENCE and KASAN", v3:
tracing: add error_report_end trace point
kfence: use error_report_end tracepoint
kasan: use error_report_end tracepoint
Subsystem: mm/kasan2
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: optimizations and fixes for HW_TAGS", v4:
kasan, mm: don't save alloc stacks twice
kasan, mm: optimize kmalloc poisoning
kasan: optimize large kmalloc poisoning
kasan: clean up setting free info in kasan_slab_free
kasan: unify large kfree checks
kasan: rework krealloc tests
kasan, mm: fail krealloc on freed objects
kasan, mm: optimize krealloc poisoning
kasan: ensure poisoning size alignment
arm64: kasan: simplify and inline MTE functions
kasan: inline HW_TAGS helper functions
kasan: clarify that only first bug is reported in HW_TAGS
Subsystem: alpha
Randy Dunlap <rdunlap@infradead.org>:
alpha: remove CONFIG_EXPERIMENTAL from defconfigs
Subsystem: procfs
Helge Deller <deller@gmx.de>:
proc/wchan: use printk format instead of lookup_symbol_name()
Josef Bacik <josef@toxicpanda.com>:
proc: use kvzalloc for our kernel buffer
Subsystem: sysctl
Lin Feng <linf@wangsu.com>:
sysctl.c: fix underflow value setting risk in vm_table
Subsystem: misc
Randy Dunlap <rdunlap@infradead.org>:
include/linux: remove repeated words
Miguel Ojeda <ojeda@kernel.org>:
treewide: Miguel has moved
Subsystem: core-kernel
Hubert Jasudowicz <hubert.jasudowicz@gmail.com>:
groups: use flexible-array member in struct group_info
groups: simplify struct group_info allocation
Randy Dunlap <rdunlap@infradead.org>:
kernel: delete repeated words in comments
Subsystem: MAINTAINERS
Vlastimil Babka <vbabka@suse.cz>:
MAINTAINERS: add uapi directories to API/ABI section
Subsystem: lib
Huang Shijie <sjhuang@iluvatar.ai>:
lib/genalloc.c: change return type to unsigned long for bitmap_set_ll
Francis Laniel <laniel_francis@privacyrequired.com>:
string.h: move fortified functions definitions in a dedicated header.
Yogesh Lal <ylal@codeaurora.org>:
lib: stackdepot: add support to configure STACK_HASH_SIZE
Vijayanand Jitta <vjitta@codeaurora.org>:
lib: stackdepot: add support to disable stack depot
lib: stackdepot: fix ignoring return value warning
Masahiro Yamada <masahiroy@kernel.org>:
lib/cmdline: remove an unneeded local variable in next_arg()
Subsystem: bitops
Geert Uytterhoeven <geert+renesas@glider.be>:
include/linux/bitops.h: spelling s/synomyn/synonym/
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: improve blank line after declaration test
Peng Wang <rocking@linux.alibaba.com>:
checkpatch: ignore warning designated initializers using NR_CPUS
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: trivial style fixes
Joe Perches <joe@perches.com>:
checkpatch: prefer ftrace over function entry/exit printks
checkpatch: improve TYPECAST_INT_CONSTANT test message
Aditya Srivastava <yashsri421@gmail.com>:
checkpatch: add warning for avoiding .L prefix symbols in assembly files
Joe Perches <joe@perches.com>:
checkpatch: add kmalloc_array_node to unnecessary OOM message check
Chris Down <chris@chrisdown.name>:
checkpatch: don't warn about colon termination in linker scripts
Song Liu <songliubraving@fb.com>:
checkpatch: do not apply "initialise globals to 0" check to BPF progs
Subsystem: init
Masahiro Yamada <masahiroy@kernel.org>:
init/version.c: remove Version_<LINUX_VERSION_CODE> symbol
init: clean up early_param_on_off() macro
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
init/Kconfig: fix a typo in CC_VERSION_TEXT help text
Subsystem: coredump
Ira Weiny <ira.weiny@intel.com>:
fs/coredump: use kmap_local_page()
Subsystem: seq_file
NeilBrown <neilb@suse.de>:
Patch series "Fix some seq_file users that were recently broken":
seq_file: document how per-entry resources are managed.
x86: fix seq_file iteration for pat/memtype.c
Subsystem: gdb
George Prekas <prekageo@amazon.com>:
scripts/gdb: fix list_for_each
Sumit Garg <sumit.garg@linaro.org>:
kgdb: fix to kill breakpoints on initmem after boot
Subsystem: ubsan
Andrey Ryabinin <ryabinin.a.a@gmail.com>:
ubsan: remove overflow checks
Subsystem: initramfs
Florian Fainelli <f.fainelli@gmail.com>:
initramfs: panic with memory information
Subsystem: mm/pagemap2
Huang Pei <huangpei@loongson.cn>:
MIPS: make userspace mapping young by default
.mailmap | 1
CREDITS | 9
Documentation/ABI/testing/sysfs-devices-memory | 58 -
Documentation/admin-guide/auxdisplay/cfag12864b.rst | 2
Documentation/admin-guide/auxdisplay/ks0108.rst | 2
Documentation/admin-guide/kernel-parameters.txt | 6
Documentation/admin-guide/mm/memory-hotplug.rst | 20
Documentation/dev-tools/index.rst | 1
Documentation/dev-tools/kasan.rst | 8
Documentation/dev-tools/kfence.rst | 318 +++++++
Documentation/filesystems/seq_file.rst | 6
MAINTAINERS | 26
arch/alpha/configs/defconfig | 1
arch/arm64/Kconfig | 1
arch/arm64/include/asm/cache.h | 1
arch/arm64/include/asm/kasan.h | 1
arch/arm64/include/asm/kfence.h | 26
arch/arm64/include/asm/mte-def.h | 2
arch/arm64/include/asm/mte-kasan.h | 65 +
arch/arm64/include/asm/mte.h | 2
arch/arm64/kernel/mte.c | 46 -
arch/arm64/lib/mte.S | 16
arch/arm64/mm/fault.c | 8
arch/arm64/mm/mmu.c | 23
arch/mips/mm/cache.c | 30
arch/s390/mm/init.c | 1
arch/s390/mm/vmem.c | 14
arch/x86/Kconfig | 1
arch/x86/include/asm/kfence.h | 76 +
arch/x86/mm/fault.c | 10
arch/x86/mm/pat/memtype.c | 4
drivers/auxdisplay/cfag12864b.c | 4
drivers/auxdisplay/cfag12864bfb.c | 4
drivers/auxdisplay/ks0108.c | 4
drivers/base/memory.c | 35
drivers/block/zram/zram_drv.c | 2
drivers/hv/hv_balloon.c | 2
drivers/virtio/virtio_mem.c | 43
drivers/xen/balloon.c | 2
fs/coredump.c | 4
fs/iomap/seek.c | 125 --
fs/proc/base.c | 21
fs/proc/proc_sysctl.c | 4
include/linux/bitops.h | 2
include/linux/cfag12864b.h | 2
include/linux/cred.h | 2
include/linux/fortify-string.h | 302 ++++++
include/linux/gfp.h | 2
include/linux/init.h | 4
include/linux/kasan.h | 25
include/linux/kfence.h | 230 +++++
include/linux/kgdb.h | 2
include/linux/khugepaged.h | 2
include/linux/ks0108.h | 2
include/linux/mdev.h | 2
include/linux/memory.h | 3
include/linux/memory_hotplug.h | 33
include/linux/memremap.h | 6
include/linux/mmzone.h | 49 -
include/linux/page-flags.h | 4
include/linux/pagemap.h | 10
include/linux/pagevec.h | 10
include/linux/pgtable.h | 8
include/linux/ptrace.h | 2
include/linux/rmap.h | 3
include/linux/slab_def.h | 3
include/linux/slub_def.h | 3
include/linux/stackdepot.h | 9
include/linux/string.h | 282 ------
include/linux/vmstat.h | 6
include/linux/zpool.h | 3
include/linux/zsmalloc.h | 2
include/trace/events/error_report.h | 74 +
include/uapi/linux/firewire-cdev.h | 2
include/uapi/linux/input.h | 2
init/Kconfig | 2
init/initramfs.c | 19
init/main.c | 6
init/version.c | 8
kernel/debug/debug_core.c | 11
kernel/events/core.c | 8
kernel/events/uprobes.c | 2
kernel/groups.c | 7
kernel/locking/rtmutex.c | 4
kernel/locking/rwsem.c | 2
kernel/locking/semaphore.c | 2
kernel/sched/fair.c | 2
kernel/sched/membarrier.c | 2
kernel/sysctl.c | 8
kernel/trace/Makefile | 1
kernel/trace/error_report-traces.c | 12
lib/Kconfig | 9
lib/Kconfig.debug | 1
lib/Kconfig.kfence | 84 +
lib/Kconfig.ubsan | 17
lib/cmdline.c | 7
lib/genalloc.c | 3
lib/stackdepot.c | 41
lib/test_kasan.c | 111 ++
lib/test_ubsan.c | 49 -
lib/ubsan.c | 68 -
mm/Makefile | 1
mm/backing-dev.c | 3
mm/cma.c | 64 -
mm/dmapool.c | 3
mm/early_ioremap.c | 12
mm/filemap.c | 361 +++++---
mm/huge_memory.c | 6
mm/internal.h | 6
mm/kasan/common.c | 213 +++-
mm/kasan/generic.c | 3
mm/kasan/hw_tags.c | 2
mm/kasan/kasan.h | 97 +-
mm/kasan/report.c | 8
mm/kasan/shadow.c | 78 +
mm/kfence/Makefile | 6
mm/kfence/core.c | 875 +++++++++++++++++++-
mm/kfence/kfence.h | 126 ++
mm/kfence/kfence_test.c | 860 +++++++++++++++++++
mm/kfence/report.c | 350 ++++++--
mm/khugepaged.c | 22
mm/memory-failure.c | 6
mm/memory.c | 4
mm/memory_hotplug.c | 178 +++-
mm/memremap.c | 23
mm/mlock.c | 2
mm/page_alloc.c | 1
mm/rmap.c | 24
mm/shmem.c | 160 +--
mm/slab.c | 38
mm/slab_common.c | 29
mm/slub.c | 63 +
mm/swap.c | 54 -
mm/swap_state.c | 7
mm/truncate.c | 141 ---
mm/vmstat.c | 35
mm/z3fold.c | 1
mm/zbud.c | 1
mm/zpool.c | 13
mm/zsmalloc.c | 22
mm/zswap.c | 57 +
samples/auxdisplay/cfag12864b-example.c | 2
scripts/Makefile.ubsan | 2
scripts/checkpatch.pl | 152 ++-
scripts/gdb/linux/lists.py | 5
145 files changed, 5046 insertions(+), 1682 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-02-26 1:14 incoming Andrew Morton
@ 2021-02-26 17:55 ` Linus Torvalds
2021-02-26 19:16 ` incoming Andrew Morton
0 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2021-02-26 17:55 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> - The rest of MM.
>
> Includes kfence - another runtime memory validator. Not as
> thorough as KASAN, but it has unmeasurable overhead and is intended
> to be usable in production builds.
>
> - Everything else
Just to clarify: you have nothing else really pending?
I'm hoping to just do -rc1 this weekend after all - despite my late
start due to loss of power for several days.
I'll allow late stragglers with good reason through, but the fewer of
those there are, the better, of course.
Thanks,
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-02-26 17:55 ` incoming Linus Torvalds
@ 2021-02-26 19:16 ` Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-02-26 19:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, Linux-MM
On Fri, 26 Feb 2021 09:55:27 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > - The rest of MM.
> >
> > Includes kfence - another runtime memory validator. Not as
> > thorough as KASAN, but it has unmeasurable overhead and is intended
> > to be usable in production builds.
> >
> > - Everything else
>
> Just to clarify: you have nothing else really pending?
Yes, that's it from me for -rc1.
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-03-13 5:06 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-03-13 5:06 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
29 patches, based on f78d76e72a4671ea52d12752d92077788b4f5d50.
Subsystems affected by this patch series:
mm/memblock
core-kernel
kconfig
mm/pagealloc
fork
mm/hugetlb
mm/highmem
binfmt
MAINTAINERS
kbuild
mm/kfence
mm/oom-kill
mm/madvise
mm/kasan
mm/userfaultfd
mm/memory-failure
ia64
mm/memcg
mm/zram
Subsystem: mm/memblock
Arnd Bergmann <arnd@arndb.de>:
memblock: fix section mismatch warning
Subsystem: core-kernel
Arnd Bergmann <arnd@arndb.de>:
stop_machine: mark helpers __always_inline
Subsystem: kconfig
Masahiro Yamada <masahiroy@kernel.org>:
init/Kconfig: make COMPILE_TEST depend on HAS_IOMEM
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
mm/page_alloc.c: refactor initialization of struct page for holes in memory layout
Subsystem: fork
Fenghua Yu <fenghua.yu@intel.com>:
mm/fork: clear PASID for new mm
Subsystem: mm/hugetlb
Peter Xu <peterx@redhat.com>:
Patch series "mm/hugetlb: Early cow on fork, and a few cleanups", v5:
hugetlb: dedup the code to add a new file_region
hugetlb: break earlier in add_reservation_in_range() when we can
mm: introduce page_needs_cow_for_dma() for deciding whether cow
mm: use is_cow_mapping() across tree where proper
hugetlb: do early cow when page pinned on src mm
Subsystem: mm/highmem
OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
mm/highmem.c: fix zero_user_segments() with start > end
Subsystem: binfmt
Lior Ribak <liorribak@gmail.com>:
binfmt_misc: fix possible deadlock in bm_register_write
Subsystem: MAINTAINERS
Vlastimil Babka <vbabka@suse.cz>:
MAINTAINERS: exclude uapi directories in API/ABI section
Subsystem: kbuild
Arnd Bergmann <arnd@arndb.de>:
linux/compiler-clang.h: define HAVE_BUILTIN_BSWAP*
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: fix printk format for ptrdiff_t
kfence, slab: fix cache_alloc_debugcheck_after() for bulk allocations
kfence: fix reports if constant function prefixes exist
Subsystem: mm/oom-kill
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
include/linux/sched/mm.h: use rcu_dereference in in_vfork()
Subsystem: mm/madvise
Suren Baghdasaryan <surenb@google.com>:
mm/madvise: replace ptrace attach requirement for process_madvise
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan, mm: fix crash with HW_TAGS and DEBUG_PAGEALLOC
kasan: fix KASAN_STACK dependency for HW_TAGS
Subsystem: mm/userfaultfd
Nadav Amit <namit@vmware.com>:
mm/userfaultfd: fix memory corruption due to writeprotect
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm, hwpoison: do not lock page again when me_huge_page() successfully recovers
Subsystem: ia64
Sergei Trofimovich <slyfox@gentoo.org>:
ia64: fix ia64_syscall_get_set_arguments() for break-based syscalls
ia64: fix ptrace(PTRACE_SYSCALL_INFO_EXIT) sign
Subsystem: mm/memcg
Zhou Guanghui <zhouguanghui1@huawei.com>:
mm/memcg: rename mem_cgroup_split_huge_fixup to split_page_memcg and add nr_pages argument
mm/memcg: set memcg when splitting page
Subsystem: mm/zram
Minchan Kim <minchan@kernel.org>:
zram: fix return value on writeback_store
zram: fix broken page writeback
MAINTAINERS | 4
arch/ia64/include/asm/syscall.h | 2
arch/ia64/kernel/ptrace.c | 24 +++-
drivers/block/zram/zram_drv.c | 17 +-
drivers/gpu/drm/vmwgfx/vmwgfx_page_dirty.c | 4
drivers/gpu/drm/vmwgfx/vmwgfx_ttm_glue.c | 2
fs/binfmt_misc.c | 29 ++---
fs/proc/task_mmu.c | 2
include/linux/compiler-clang.h | 6 +
include/linux/memblock.h | 4
include/linux/memcontrol.h | 6 -
include/linux/mm.h | 21 +++
include/linux/mm_types.h | 1
include/linux/sched/mm.h | 3
include/linux/stop_machine.h | 11 +
init/Kconfig | 3
kernel/fork.c | 8 +
lib/Kconfig.kasan | 1
mm/highmem.c | 17 ++
mm/huge_memory.c | 10 -
mm/hugetlb.c | 123 +++++++++++++++------
mm/internal.h | 5
mm/kfence/report.c | 30 +++--
mm/madvise.c | 13 ++
mm/memcontrol.c | 15 +-
mm/memory-failure.c | 4
mm/memory.c | 16 +-
mm/page_alloc.c | 167 ++++++++++++++---------------
mm/slab.c | 2
29 files changed, 334 insertions(+), 216 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-03-25 4:36 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-03-25 4:36 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
14 patches, based on 7acac4b3196caee5e21fb5ea53f8bc124e6a16fc.
Subsystems affected by this patch series:
mm/hugetlb
mm/kasan
mm/gup
mm/selftests
mm/z3fold
squashfs
ia64
gcov
mm/kfence
mm/memblock
mm/highmem
mailmap
Subsystem: mm/hugetlb
Miaohe Lin <linmiaohe@huawei.com>:
hugetlb_cgroup: fix imbalanced css_get and css_put pair for shared mappings
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix per-page tags for non-page_alloc pages
Subsystem: mm/gup
Sean Christopherson <seanjc@google.com>:
mm/mmu_notifiers: ensure range_end() is paired with range_start()
Subsystem: mm/selftests
Rong Chen <rong.a.chen@intel.com>:
selftests/vm: fix out-of-tree build
Subsystem: mm/z3fold
Thomas Hebb <tommyhebb@gmail.com>:
z3fold: prevent reclaim/free race for headless pages
Subsystem: squashfs
Sean Nyekjaer <sean@geanix.com>:
squashfs: fix inode lookup sanity checks
Phillip Lougher <phillip@squashfs.org.uk>:
squashfs: fix xattr id and id lookup sanity checks
Subsystem: ia64
Sergei Trofimovich <slyfox@gentoo.org>:
ia64: mca: allocate early mca with GFP_ATOMIC
ia64: fix format strings for err_inject
Subsystem: gcov
Nick Desaulniers <ndesaulniers@google.com>:
gcov: fix clang-11+ support
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: make compatible with kmemleak
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
mm: memblock: fix section mismatch warning again
Subsystem: mm/highmem
Ira Weiny <ira.weiny@intel.com>:
mm/highmem: fix CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP
Subsystem: mailmap
Andrey Konovalov <andreyknvl@google.com>:
mailmap: update Andrey Konovalov's email address
.mailmap | 1
arch/ia64/kernel/err_inject.c | 22 +++++------
arch/ia64/kernel/mca.c | 2 -
fs/squashfs/export.c | 8 +++-
fs/squashfs/id.c | 6 ++-
fs/squashfs/squashfs_fs.h | 1
fs/squashfs/xattr_id.c | 6 ++-
include/linux/hugetlb_cgroup.h | 15 ++++++-
include/linux/memblock.h | 4 +-
include/linux/mm.h | 18 +++++++--
include/linux/mmu_notifier.h | 10 ++---
kernel/gcov/clang.c | 69 ++++++++++++++++++++++++++++++++++++
mm/highmem.c | 4 +-
mm/hugetlb.c | 41 +++++++++++++++++++--
mm/hugetlb_cgroup.c | 10 ++++-
mm/kfence/core.c | 9 ++++
mm/kmemleak.c | 3 +
mm/mmu_notifier.c | 23 ++++++++++++
mm/z3fold.c | 16 +++++++-
tools/testing/selftests/vm/Makefile | 4 +-
20 files changed, 230 insertions(+), 42 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-04-09 20:26 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-04-09 20:26 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
16 patches, based on 17e7124aad766b3f158943acb51467f86220afe9.
Subsystems affected by this patch series:
MAINTAINERS
mailmap
mm/kasan
mm/gup
nds32
gcov
ocfs2
ia64
mm/pagecache
mm/kasan
mm/kfence
lib
Subsystem: MAINTAINERS
Marek Behún <kabel@kernel.org>:
MAINTAINERS: update CZ.NIC's Turris information
treewide: change my e-mail address, fix my name
Subsystem: mailmap
Jordan Crouse <jordan@cosmicpenguin.net>:
mailmap: update email address for Jordan Crouse
Matthew Wilcox <willy@infradead.org>:
.mailmap: fix old email addresses
Subsystem: mm/kasan
Arnd Bergmann <arnd@arndb.de>:
kasan: fix hwasan build for gcc
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: remove redundant config option
Subsystem: mm/gup
Aili Yao <yaoaili@kingsoft.com>:
mm/gup: check page posion status for coredump.
Subsystem: nds32
Mike Rapoport <rppt@linux.ibm.com>:
nds32: flush_dcache_page: use page_mapping_file to avoid races with swapoff
Subsystem: gcov
Nick Desaulniers <ndesaulniers@google.com>:
gcov: re-fix clang-11+ support
Subsystem: ocfs2
Wengang Wang <wen.gang.wang@oracle.com>:
ocfs2: fix deadlock between setattr and dio_end_io_write
Subsystem: ia64
Sergei Trofimovich <slyfox@gentoo.org>:
ia64: fix user_stack_pointer() for ptrace()
Subsystem: mm/pagecache
Jack Qiu <jack.qiu@huawei.com>:
fs: direct-io: fix missing sdio->boundary
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix conflict with page poisoning
Andrew Morton <akpm@linux-foundation.org>:
lib/test_kasan_module.c: suppress unused var warning
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence, x86: fix preemptible warning on KPTI-enabled systems
Subsystem: lib
Julian Braha <julianbraha@gmail.com>:
lib: fix kconfig dependency on ARCH_WANT_FRAME_POINTERS
.mailmap | 7 ++
Documentation/ABI/testing/debugfs-moxtet | 4 -
Documentation/ABI/testing/debugfs-turris-mox-rwtm | 2
Documentation/ABI/testing/sysfs-bus-moxtet-devices | 6 +-
Documentation/ABI/testing/sysfs-class-led-driver-turris-omnia | 2
Documentation/ABI/testing/sysfs-firmware-turris-mox-rwtm | 10 +--
Documentation/devicetree/bindings/leds/cznic,turris-omnia-leds.yaml | 2
MAINTAINERS | 13 +++-
arch/arm64/boot/dts/marvell/armada-3720-turris-mox.dts | 2
arch/arm64/kernel/sleep.S | 2
arch/ia64/include/asm/ptrace.h | 8 --
arch/nds32/mm/cacheflush.c | 2
arch/x86/include/asm/kfence.h | 7 ++
arch/x86/kernel/acpi/wakeup_64.S | 2
drivers/bus/moxtet.c | 4 -
drivers/firmware/turris-mox-rwtm.c | 4 -
drivers/gpio/gpio-moxtet.c | 4 -
drivers/leds/leds-turris-omnia.c | 4 -
drivers/mailbox/armada-37xx-rwtm-mailbox.c | 4 -
drivers/watchdog/armada_37xx_wdt.c | 4 -
fs/direct-io.c | 5 +
fs/ocfs2/aops.c | 11 ---
fs/ocfs2/file.c | 8 ++
include/dt-bindings/bus/moxtet.h | 2
include/linux/armada-37xx-rwtm-mailbox.h | 2
include/linux/kasan.h | 2
include/linux/moxtet.h | 2
kernel/gcov/clang.c | 29 ++++++----
lib/Kconfig.debug | 6 +-
lib/Kconfig.kasan | 9 ---
lib/test_kasan_module.c | 2
mm/gup.c | 4 +
mm/internal.h | 20 ++++++
mm/kasan/common.c | 2
mm/kasan/kasan.h | 2
mm/kasan/report_generic.c | 2
mm/page_poison.c | 4 +
scripts/Makefile.kasan | 18 ++++--
security/Kconfig.hardening | 4 -
39 files changed, 136 insertions(+), 91 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-04-16 22:45 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-04-16 22:45 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
12 patches, based on 06c2aac4014c38247256fe49c61b7f55890271e7.
Subsystems affected by this patch series:
mm/documentation
mm/kasan
csky
ia64
mm/pagemap
gcov
lib
Subsystem: mm/documentation
Randy Dunlap <rdunlap@infradead.org>:
mm: eliminate "expecting prototype" kernel-doc warnings
Subsystem: mm/kasan
Arnd Bergmann <arnd@arndb.de>:
kasan: fix hwasan build for gcc
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: remove redundant config option
Subsystem: csky
Randy Dunlap <rdunlap@infradead.org>:
csky: change a Kconfig symbol name to fix e1000 build error
Subsystem: ia64
Randy Dunlap <rdunlap@infradead.org>:
ia64: remove duplicate entries in generic_defconfig
ia64: fix discontig.c section mismatches
John Paul Adrian Glaubitz <glaubitz () physik ! fu-berlin ! de>:
ia64: tools: remove inclusion of ia64-specific version of errno.h header
John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>:
ia64: tools: remove duplicate definition of ia64_mf() on ia64
Subsystem: mm/pagemap
Zack Rusin <zackr@vmware.com>:
mm/mapping_dirty_helpers: guard hugepage pud's usage
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm: ptdump: fix build failure
Subsystem: gcov
Johannes Berg <johannes.berg@intel.com>:
gcov: clang: fix clang-11+ build
Subsystem: lib
Randy Dunlap <rdunlap@infradead.org>:
lib: remove "expecting prototype" kernel-doc warnings
arch/arm64/kernel/sleep.S | 2 +-
arch/csky/Kconfig | 2 +-
arch/csky/include/asm/page.h | 2 +-
arch/ia64/configs/generic_defconfig | 2 --
arch/ia64/mm/discontig.c | 6 +++---
arch/x86/kernel/acpi/wakeup_64.S | 2 +-
include/linux/kasan.h | 2 +-
kernel/gcov/clang.c | 2 +-
lib/Kconfig.kasan | 9 ++-------
lib/earlycpio.c | 4 ++--
lib/lru_cache.c | 3 ++-
lib/parman.c | 4 ++--
lib/radix-tree.c | 11 ++++++-----
mm/kasan/common.c | 2 +-
mm/kasan/kasan.h | 2 +-
mm/kasan/report_generic.c | 2 +-
mm/mapping_dirty_helpers.c | 2 ++
mm/mmu_gather.c | 29 +++++++++++++++++++----------
mm/oom_kill.c | 2 +-
mm/ptdump.c | 2 +-
mm/shuffle.c | 4 ++--
scripts/Makefile.kasan | 22 ++++++++++++++--------
security/Kconfig.hardening | 4 ++--
tools/arch/ia64/include/asm/barrier.h | 3 ---
tools/include/uapi/asm/errno.h | 2 --
25 files changed, 67 insertions(+), 60 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-04-23 21:28 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-04-23 21:28 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
5 patches, based on 5bfc75d92efd494db37f5c4c173d3639d4772966.
Subsystems affected by this patch series:
coda
overlayfs
mm/pagecache
mm/memcg
Subsystem: coda
Christian König <christian.koenig@amd.com>:
coda: fix reference counting in coda_file_mmap error path
Subsystem: overlayfs
Christian König <christian.koenig@amd.com>:
ovl: fix reference counting in ovl_mmap error path
Subsystem: mm/pagecache
Hugh Dickins <hughd@google.com>:
mm/filemap: fix find_lock_entries hang on 32-bit THP
mm/filemap: fix mapping_seek_hole_data on THP & 32-bit
Subsystem: mm/memcg
Vasily Averin <vvs@virtuozzo.com>:
tools/cgroup/slabinfo.py: updated to work on current kernel
fs/coda/file.c | 6 +++---
fs/overlayfs/file.c | 11 +----------
mm/filemap.c | 31 +++++++++++++++++++------------
tools/cgroup/memcg_slabinfo.py | 8 ++++----
4 files changed, 27 insertions(+), 29 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-04-30 5:52 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-04-30 5:52 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
A few misc subsystems and some of MM.
178 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0.
Subsystems affected by this patch series:
ia64
kbuild
scripts
sh
ocfs2
kfifo
vfs
kernel/watchdog
mm/slab-generic
mm/slub
mm/kmemleak
mm/debug
mm/pagecache
mm/msync
mm/gup
mm/memremap
mm/memcg
mm/pagemap
mm/mremap
mm/dma
mm/sparsemem
mm/vmalloc
mm/documentation
mm/kasan
mm/initialization
mm/pagealloc
mm/memory-failure
Subsystem: ia64
Zhang Yunkai <zhang.yunkai@zte.com.cn>:
arch/ia64/kernel/head.S: remove duplicate include
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
arch/ia64/kernel/fsys.S: fix typos
arch/ia64/include/asm/pgtable.h: minor typo fixes
Valentin Schneider <valentin.schneider@arm.com>:
ia64: ensure proper NUMA distance and possible map initialization
Sergei Trofimovich <slyfox@gentoo.org>:
ia64: drop unused IA64_FW_EMU ifdef
ia64: simplify code flow around swiotlb init
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
ia64: trivial spelling fixes
Sergei Trofimovich <slyfox@gentoo.org>:
ia64: fix EFI_DEBUG build
ia64: mca: always make IA64_MCA_DEBUG an expression
ia64: drop marked broken DISCONTIGMEM and VIRTUAL_MEM_MAP
ia64: module: fix symbolizer crash on fdescr
Subsystem: kbuild
Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
include/linux/compiler-gcc.h: sparse can do constant folding of __builtin_bswap*()
Subsystem: scripts
Tom Saeger <tom.saeger@oracle.com>:
scripts/spelling.txt: add entries for recent discoveries
Wan Jiabing <wanjiabing@vivo.com>:
scripts: a new script for checking duplicate struct declaration
Subsystem: sh
Zhang Yunkai <zhang.yunkai@zte.com.cn>:
arch/sh/include/asm/tlb.h: remove duplicate include
Subsystem: ocfs2
Yang Li <yang.lee@linux.alibaba.com>:
ocfs2: replace DEFINE_SIMPLE_ATTRIBUTE with DEFINE_DEBUGFS_ATTRIBUTE
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: map flags directly in flags_to_o2dlm()
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
ocfs2: fix a typo
Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
ocfs2/dlm: remove unused function
Subsystem: kfifo
Dan Carpenter <dan.carpenter@oracle.com>:
kfifo: fix ternary sign extension bugs
Subsystem: vfs
Randy Dunlap <rdunlap@infradead.org>:
vfs: fs_parser: clean up kernel-doc warnings
Subsystem: kernel/watchdog
Petr Mladek <pmladek@suse.com>:
Patch series "watchdog/softlockup: Report overall time and some cleanup", v2:
watchdog: rename __touch_watchdog() to a better descriptive name
watchdog: explicitly update timestamp when reporting softlockup
watchdog/softlockup: report the overall time of softlockups
watchdog/softlockup: remove logic that tried to prevent repeated reports
watchdog: fix barriers when printing backtraces from all CPUs
watchdog: cleanup handling of false positives
Subsystem: mm/slab-generic
Rafael Aquini <aquini@redhat.com>:
mm/slab_common: provide "slab_merge" option for !IS_ENABLED(CONFIG_SLAB_MERGE_DEFAULT) builds
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: enable slub_debug static key when creating cache with explicit debug flags
Oliver Glitta <glittao@gmail.com>:
kunit: add a KUnit test for SLUB debugging functionality
slub: remove resiliency_test() function
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
mm/slub.c: trivial typo fixes
Subsystem: mm/kmemleak
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
mm/kmemleak.c: fix a typo
Subsystem: mm/debug
Georgi Djakov <georgi.djakov@linaro.org>:
mm/page_owner: record the timestamp of all pages during free
zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>:
mm, page_owner: remove unused parameter in __set_page_owner_handle
Sergei Trofimovich <slyfox@gentoo.org>:
mm: page_owner: fetch backtrace only for tracked pages
mm: page_owner: use kstrtobool() to parse bool option
mm: page_owner: detect page_owner recursion via task_struct
mm: page_poison: print page info when corruption is caught
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/memtest: add ARCH_USE_MEMTEST
Subsystem: mm/pagecache
Jens Axboe <axboe@kernel.dk>:
Patch series "Improve IOCB_NOWAIT O_DIRECT reads", v3:
mm: provide filemap_range_needs_writeback() helper
mm: use filemap_range_needs_writeback() for O_DIRECT reads
iomap: use filemap_range_needs_writeback() for O_DIRECT reads
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap: use filemap_read_page in filemap_fault
mm/filemap: drop check for truncated page after I/O
Johannes Weiner <hannes@cmpxchg.org>:
mm: page-writeback: simplify memcg handling in test_clear_page_writeback()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: move page_mapping_file to pagemap.h
Rui Sun <sunrui26@huawei.com>:
mm/filemap: update stale comment
Subsystem: mm/msync
Nikita Ermakov <sh1r4s3@mail.si-head.nl>:
mm/msync: exit early when the flags is an MS_ASYNC and start < vm_start
Subsystem: mm/gup
Joao Martins <joao.m.martins@oracle.com>:
Patch series "mm/gup: page unpining improvements", v4:
mm/gup: add compound page list iterator
mm/gup: decrement head page once for group of subpages
mm/gup: add a range variant of unpin_user_pages_dirty_lock()
RDMA/umem: batch page unpin in __ib_umem_release()
Yang Shi <shy828301@gmail.com>:
mm: gup: remove FOLL_SPLIT
Subsystem: mm/memremap
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/memremap.c: fix improper SPDX comment style
Subsystem: mm/memcg
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: fix kernel stack account
Shakeel Butt <shakeelb@google.com>:
memcg: cleanup root memcg checks
memcg: enable memcg oom-kill for __GFP_NOFAIL
Johannes Weiner <hannes@cmpxchg.org>:
Patch series "mm: memcontrol: switch to rstat", v3:
mm: memcontrol: fix cpuhotplug statistics flushing
mm: memcontrol: kill mem_cgroup_nodeinfo()
mm: memcontrol: privatize memcg_page_state query functions
cgroup: rstat: support cgroup1
cgroup: rstat: punt root-level optimization to individual controllers
mm: memcontrol: switch to rstat
mm: memcontrol: consolidate lruvec stat flushing
kselftests: cgroup: update kmem test for new vmstat implementation
Shakeel Butt <shakeelb@google.com>:
memcg: charge before adding to swapcache on swapin
Muchun Song <songmuchun@bytedance.com>:
Patch series "Use obj_cgroup APIs to charge kmem pages", v5:
mm: memcontrol: slab: fix obtain a reference to a freeing memcg
mm: memcontrol: introduce obj_cgroup_{un}charge_pages
mm: memcontrol: directly access page->memcg_data in mm/page_alloc.c
mm: memcontrol: change ug->dummy_page only if memcg changed
mm: memcontrol: use obj_cgroup APIs to charge kmem pages
mm: memcontrol: inline __memcg_kmem_{un}charge() into obj_cgroup_{un}charge_pages()
mm: memcontrol: move PageMemcgKmem to the scope of CONFIG_MEMCG_KMEM
Wan Jiabing <wanjiabing@vivo.com>:
linux/memcontrol.h: remove duplicate struct declaration
Johannes Weiner <hannes@cmpxchg.org>:
mm: page_counter: mitigate consequences of a page_counter underflow
Subsystem: mm/pagemap
Wang Qing <wangqing@vivo.com>:
mm/memory.c: do_numa_page(): delete bool "migrated"
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/interval_tree: add comments to improve code readability
Oscar Salvador <osalvador@suse.de>:
Patch series "Cleanup and fixups for vmemmap handling", v6:
x86/vmemmap: drop handling of 4K unaligned vmemmap range
x86/vmemmap: drop handling of 1GB vmemmap ranges
x86/vmemmap: handle unpopulated sub-pmd ranges
x86/vmemmap: optimize for consecutive sections in partial populated PMDs
Ovidiu Panait <ovidiu.panait@windriver.com>:
mm, tracing: improve rss_stat tracepoint message
Christoph Hellwig <hch@lst.de>:
Patch series "add remap_pfn_range_notrack instead of reinventing it in i915", v2:
mm: add remap_pfn_range_notrack
mm: add a io_mapping_map_user helper
i915: use io_mapping_map_user
i915: fix remap_io_sg to verify the pgprot
Huang Ying <ying.huang@intel.com>:
NUMA balancing: reduce TLB flush via delaying mapping on hint page fault
Subsystem: mm/mremap
Brian Geffon <bgeffon@google.com>:
Patch series "mm: Extend MREMAP_DONTUNMAP to non-anonymous mappings", v5:
mm: extend MREMAP_DONTUNMAP to non-anonymous mappings
Revert "mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio"
selftests: add a MREMAP_DONTUNMAP selftest for shmem
Subsystem: mm/dma
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/dmapool: switch from strlcpy to strscpy
Subsystem: mm/sparsemem
Wang Wensheng <wangwensheng4@huawei.com>:
mm/sparse: add the missing sparse_buffer_fini() in error branch
Subsystem: mm/vmalloc
Christoph Hellwig <hch@lst.de>:
Patch series "remap_vmalloc_range cleanups":
samples/vfio-mdev/mdpy: use remap_vmalloc_range
mm: unexport remap_vmalloc_range_partial
Serapheim Dimitropoulos <serapheim.dimitro@delphix.com>:
mm/vmalloc: use rb_tree instead of list for vread() lookups
Nicholas Piggin <npiggin@gmail.com>:
Patch series "huge vmalloc mappings", v13:
ARM: mm: add missing pud_page define to 2-level page tables
mm/vmalloc: fix HUGE_VMAP regression by enabling huge pages in vmalloc_to_page
mm: apply_to_pte_range warn and fail if a large pte is encountered
mm/vmalloc: rename vmap_*_range vmap_pages_*_range
mm/ioremap: rename ioremap_*_range to vmap_*_range
mm: HUGE_VMAP arch support cleanup
powerpc: inline huge vmap supported functions
arm64: inline huge vmap supported functions
x86: inline huge vmap supported functions
mm/vmalloc: provide fallback arch huge vmap support functions
mm: move vmap_range from mm/ioremap.c to mm/vmalloc.c
mm/vmalloc: add vmap_range_noflush variant
mm/vmalloc: hugepage vmalloc mappings
Patch series "mm/vmalloc: cleanup after hugepage series", v2:
mm/vmalloc: remove map_kernel_range
kernel/dma: remove unnecessary unmap_kernel_range
powerpc/xive: remove unnecessary unmap_kernel_range
mm/vmalloc: remove unmap_kernel_range
mm/vmalloc: improve allocation failure error messages
Vijayanand Jitta <vjitta@codeaurora.org>:
mm: vmalloc: prevent use after free in _vm_unmap_aliases
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
lib/test_vmalloc.c: remove two kvfree_rcu() tests
lib/test_vmalloc.c: add a new 'nr_threads' parameter
vm/test_vmalloc.sh: adapt for updated driver interface
mm/vmalloc: refactor the preloading loagic
mm/vmalloc: remove an empty line
Subsystem: mm/documentation
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/doc: fix fault_flag_allow_retry_first kerneldoc
mm/doc: fix page_maybe_dma_pinned kerneldoc
mm/doc: turn fault flags into an enum
mm/doc: add mm.h and mm_types.h to the mm-api document
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
Patch series "kernel-doc and MAINTAINERS clean-up":
MAINTAINERS: assign pagewalk.h to MEMORY MANAGEMENT
pagewalk: prefix struct kernel-doc descriptions
Subsystem: mm/kasan
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/kasan: switch from strlcpy to strscpy
Peter Collingbourne <pcc@google.com>:
kasan: fix kasan_byte_accessible() to be consistent with actual checks
Andrey Konovalov <andreyknvl@google.com>:
kasan: initialize shadow to TAG_INVALID for SW_TAGS
mm, kasan: don't poison boot memory with tag-based modes
Patch series "kasan: integrate with init_on_alloc/free", v3:
arm64: kasan: allow to init memory when setting tags
kasan: init memory in kasan_(un)poison for HW_TAGS
kasan, mm: integrate page_alloc init with HW_TAGS
kasan, mm: integrate slab init_on_alloc with HW_TAGS
kasan, mm: integrate slab init_on_free with HW_TAGS
kasan: docs: clean up sections
kasan: docs: update overview section
kasan: docs: update usage section
kasan: docs: update error reports section
kasan: docs: update boot parameters section
kasan: docs: update GENERIC implementation details section
kasan: docs: update SW_TAGS implementation details section
kasan: docs: update HW_TAGS implementation details section
kasan: docs: update shadow memory section
kasan: docs: update ignoring accesses section
kasan: docs: update tests section
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: record task_work_add() call stack
Andrey Konovalov <andreyknvl@google.com>:
kasan: detect false-positives in tests
Zqiang <qiang.zhang@windriver.com>:
irq_work: record irq_work_queue() call stack
Subsystem: mm/initialization
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: move mem_init_print_info() into mm_init()
Subsystem: mm/pagealloc
David Hildenbrand <david@redhat.com>:
mm/page_alloc: drop pr_info_ratelimited() in alloc_contig_range()
Minchan Kim <minchan@kernel.org>:
mm: remove lru_add_drain_all in alloc_contig_range
Yu Zhao <yuzhao@google.com>:
include/linux/page-flags-layout.h: correctly determine LAST_CPUPID_WIDTH
include/linux/page-flags-layout.h: cleanups
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Rationalise __alloc_pages wrappers", v3:
mm/page_alloc: rename alloc_mask to alloc_gfp
mm/page_alloc: rename gfp_mask to gfp
mm/page_alloc: combine __alloc_pages and __alloc_pages_nodemask
mm/mempolicy: rename alloc_pages_current to alloc_pages
mm/mempolicy: rewrite alloc_pages documentation
mm/mempolicy: rewrite alloc_pages_vma documentation
mm/mempolicy: fix mpol_misplaced kernel-doc
Minchan Kim <minchan@kernel.org>:
mm: page_alloc: dump migrate-failed pages
Geert Uytterhoeven <geert@linux-m68k.org>:
mm/Kconfig: remove default DISCONTIGMEM_MANUAL
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm, page_alloc: avoid page_to_pfn() in move_freepages()
zhouchuangao <zhouchuangao@vivo.com>:
mm/page_alloc: duplicate include linux/vmalloc.h
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Introduce a bulk order-0 page allocator with two in-tree users", v6:
mm/page_alloc: rename alloced to allocated
mm/page_alloc: add a bulk page allocator
mm/page_alloc: add an array-based interface to the bulk page allocator
Jesper Dangaard Brouer <brouer@redhat.com>:
mm/page_alloc: optimize code layout for __alloc_pages_bulk
mm/page_alloc: inline __rmqueue_pcplist
Chuck Lever <chuck.lever@oracle.com>:
Patch series "SUNRPC consumer for the bulk page allocator":
SUNRPC: set rq_page_end differently
SUNRPC: refresh rq_pages using a bulk page allocator
Jesper Dangaard Brouer <brouer@redhat.com>:
net: page_pool: refactor dma_map into own function page_pool_dma_map
net: page_pool: use alloc_pages_bulk in refill code path
Sergei Trofimovich <slyfox@gentoo.org>:
mm: page_alloc: ignore init_on_free=1 for debug_pagealloc=1
huxiang <huxiang@uniontech.com>:
mm/page_alloc: redundant definition variables of pfn in for loop
Mike Rapoport <rppt@linux.ibm.com>:
mm/mmzone.h: fix existing kernel-doc comments and link them to core-api
Subsystem: mm/memory-failure
Jane Chu <jane.chu@oracle.com>:
mm/memory-failure: unnecessary amount of unmapping
Documentation/admin-guide/kernel-parameters.txt | 7
Documentation/admin-guide/mm/transhuge.rst | 2
Documentation/core-api/cachetlb.rst | 4
Documentation/core-api/mm-api.rst | 6
Documentation/dev-tools/kasan.rst | 355 +++++-----
Documentation/vm/page_owner.rst | 2
Documentation/vm/transhuge.rst | 5
MAINTAINERS | 1
arch/Kconfig | 11
arch/alpha/mm/init.c | 1
arch/arc/mm/init.c | 1
arch/arm/Kconfig | 1
arch/arm/include/asm/pgtable-3level.h | 2
arch/arm/include/asm/pgtable.h | 3
arch/arm/mm/copypage-v4mc.c | 1
arch/arm/mm/copypage-v6.c | 1
arch/arm/mm/copypage-xscale.c | 1
arch/arm/mm/init.c | 2
arch/arm64/Kconfig | 1
arch/arm64/include/asm/memory.h | 4
arch/arm64/include/asm/mte-kasan.h | 39 -
arch/arm64/include/asm/vmalloc.h | 38 -
arch/arm64/mm/init.c | 4
arch/arm64/mm/mmu.c | 36 -
arch/csky/abiv1/cacheflush.c | 1
arch/csky/mm/init.c | 1
arch/h8300/mm/init.c | 2
arch/hexagon/mm/init.c | 1
arch/ia64/Kconfig | 23
arch/ia64/configs/bigsur_defconfig | 1
arch/ia64/include/asm/meminit.h | 11
arch/ia64/include/asm/module.h | 6
arch/ia64/include/asm/page.h | 25
arch/ia64/include/asm/pgtable.h | 7
arch/ia64/kernel/Makefile | 2
arch/ia64/kernel/acpi.c | 7
arch/ia64/kernel/efi.c | 11
arch/ia64/kernel/fsys.S | 4
arch/ia64/kernel/head.S | 6
arch/ia64/kernel/ia64_ksyms.c | 12
arch/ia64/kernel/machine_kexec.c | 2
arch/ia64/kernel/mca.c | 4
arch/ia64/kernel/module.c | 29
arch/ia64/kernel/pal.S | 6
arch/ia64/mm/Makefile | 1
arch/ia64/mm/contig.c | 4
arch/ia64/mm/discontig.c | 21
arch/ia64/mm/fault.c | 15
arch/ia64/mm/init.c | 221 ------
arch/m68k/mm/init.c | 1
arch/microblaze/mm/init.c | 1
arch/mips/Kconfig | 1
arch/mips/loongson64/numa.c | 1
arch/mips/mm/cache.c | 1
arch/mips/mm/init.c | 1
arch/mips/sgi-ip27/ip27-memory.c | 1
arch/nds32/mm/init.c | 1
arch/nios2/mm/cacheflush.c | 1
arch/nios2/mm/init.c | 1
arch/openrisc/mm/init.c | 2
arch/parisc/mm/init.c | 2
arch/powerpc/Kconfig | 1
arch/powerpc/include/asm/vmalloc.h | 34 -
arch/powerpc/kernel/isa-bridge.c | 4
arch/powerpc/kernel/pci_64.c | 2
arch/powerpc/mm/book3s64/radix_pgtable.c | 29
arch/powerpc/mm/ioremap.c | 2
arch/powerpc/mm/mem.c | 1
arch/powerpc/sysdev/xive/common.c | 4
arch/riscv/mm/init.c | 1
arch/s390/mm/init.c | 2
arch/sh/include/asm/tlb.h | 10
arch/sh/mm/cache-sh4.c | 1
arch/sh/mm/cache-sh7705.c | 1
arch/sh/mm/init.c | 1
arch/sparc/include/asm/pgtable_32.h | 3
arch/sparc/mm/init_32.c | 2
arch/sparc/mm/init_64.c | 1
arch/sparc/mm/tlb.c | 1
arch/um/kernel/mem.c | 1
arch/x86/Kconfig | 1
arch/x86/include/asm/vmalloc.h | 42 -
arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 2
arch/x86/mm/init_32.c | 2
arch/x86/mm/init_64.c | 222 ++++--
arch/x86/mm/ioremap.c | 33
arch/x86/mm/pgtable.c | 13
arch/xtensa/Kconfig | 1
arch/xtensa/mm/init.c | 1
block/blk-cgroup.c | 17
drivers/gpu/drm/i915/Kconfig | 1
drivers/gpu/drm/i915/gem/i915_gem_mman.c | 9
drivers/gpu/drm/i915/i915_drv.h | 3
drivers/gpu/drm/i915/i915_mm.c | 117 ---
drivers/infiniband/core/umem.c | 12
drivers/pci/pci.c | 2
fs/aio.c | 5
fs/fs_parser.c | 2
fs/iomap/direct-io.c | 24
fs/ocfs2/blockcheck.c | 2
fs/ocfs2/dlm/dlmrecovery.c | 7
fs/ocfs2/stack_o2cb.c | 36 -
fs/ocfs2/stackglue.c | 2
include/linux/compiler-gcc.h | 8
include/linux/fs.h | 2
include/linux/gfp.h | 45 -
include/linux/io-mapping.h | 3
include/linux/io.h | 9
include/linux/kasan.h | 51 +
include/linux/memcontrol.h | 271 ++++----
include/linux/mm.h | 50 -
include/linux/mmzone.h | 43 -
include/linux/page-flags-layout.h | 64 -
include/linux/pagemap.h | 10
include/linux/pagewalk.h | 4
include/linux/sched.h | 4
include/linux/slab.h | 2
include/linux/slub_def.h | 2
include/linux/vmalloc.h | 73 +-
include/linux/vmstat.h | 24
include/net/page_pool.h | 2
include/trace/events/kmem.h | 24
init/main.c | 2
kernel/cgroup/cgroup.c | 34 -
kernel/cgroup/rstat.c | 61 +
kernel/dma/remap.c | 1
kernel/fork.c | 13
kernel/irq_work.c | 7
kernel/task_work.c | 3
kernel/watchdog.c | 102 +--
lib/Kconfig.debug | 14
lib/Makefile | 1
lib/test_kasan.c | 59 -
lib/test_slub.c | 124 +++
lib/test_vmalloc.c | 128 +--
mm/Kconfig | 4
mm/Makefile | 1
mm/debug_vm_pgtable.c | 4
mm/dmapool.c | 2
mm/filemap.c | 61 +
mm/gup.c | 145 +++-
mm/hugetlb.c | 2
mm/internal.h | 25
mm/interval_tree.c | 2
mm/io-mapping.c | 29
mm/ioremap.c | 361 ++--------
mm/kasan/common.c | 53 -
mm/kasan/generic.c | 12
mm/kasan/kasan.h | 28
mm/kasan/report_generic.c | 2
mm/kasan/shadow.c | 10
mm/kasan/sw_tags.c | 12
mm/kmemleak.c | 2
mm/memcontrol.c | 798 ++++++++++++------------
mm/memory-failure.c | 2
mm/memory.c | 191 +++--
mm/mempolicy.c | 78 --
mm/mempool.c | 4
mm/memremap.c | 2
mm/migrate.c | 2
mm/mm_init.c | 4
mm/mmap.c | 6
mm/mremap.c | 6
mm/msync.c | 6
mm/page-writeback.c | 9
mm/page_alloc.c | 430 +++++++++---
mm/page_counter.c | 8
mm/page_owner.c | 68 --
mm/page_poison.c | 6
mm/percpu-vm.c | 7
mm/slab.c | 43 -
mm/slab.h | 24
mm/slab_common.c | 10
mm/slub.c | 215 ++----
mm/sparse.c | 1
mm/swap_state.c | 13
mm/util.c | 10
mm/vmalloc.c | 728 ++++++++++++++++-----
net/core/page_pool.c | 127 ++-
net/sunrpc/svc_xprt.c | 38 -
samples/kfifo/bytestream-example.c | 8
samples/kfifo/inttype-example.c | 8
samples/kfifo/record-example.c | 8
samples/vfio-mdev/mdpy.c | 4
scripts/checkdeclares.pl | 53 +
scripts/spelling.txt | 26
tools/testing/selftests/cgroup/test_kmem.c | 22
tools/testing/selftests/vm/mremap_dontunmap.c | 52 +
tools/testing/selftests/vm/test_vmalloc.sh | 21
189 files changed, 3642 insertions(+), 3013 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-05-05 1:32 Andrew Morton
2021-05-05 1:47 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
The remainder of the main mm/ queue.
143 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus
previously sent patches.
Subsystems affected by this patch series:
mm/pagecache
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/compaction
mm/migration
mm/cma
mm/ksm
mm/vmstat
mm/mmap
mm/kconfig
mm/util
mm/memory-hotplug
mm/zswap
mm/zsmalloc
mm/highmem
mm/cleanups
mm/kfence
Subsystem: mm/pagecache
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Remove nrexceptional tracking", v2:
mm: introduce and use mapping_empty()
mm: stop accounting shadow entries
dax: account DAX entries as nrpages
mm: remove nrexceptional from inode
Hugh Dickins <hughd@google.com>:
mm: remove nrexceptional from inode: remove BUG_ON
Subsystem: mm/hugetlb
Peter Xu <peterx@redhat.com>:
Patch series "hugetlb: Disable huge pmd unshare for uffd-wp", v4:
hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share()
hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled
mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h
hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: remove redundant reservation check condition in alloc_huge_page()
Anshuman Khandual <anshuman.khandual@arm.com>:
mm: generalize HUGETLB_PAGE_SIZE_VARIABLE
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Some cleanups for hugetlb":
mm/hugetlb: use some helper functions to cleanup code
mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state()
mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate()
mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page()
mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case
Patch series "Cleanup and fixup for khugepaged", v2:
khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps()
khugepaged: reuse the smp_wmb() inside __SetPageUptodate()
khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter()
khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate()
mm/huge_memory.c: remove unnecessary local variable ret2
Patch series "Some cleanups for huge_memory", v3:
mm/huge_memory.c: rework the function vma_adjust_trans_huge()
mm/huge_memory.c: make get_huge_zero_page() return bool
mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly
mm/huge_memory.c: remove redundant PageCompound() check
mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG
mm/huge_memory.c: use helper function migration_entry_to_page()
Yanfei Xu <yanfei.xu@windriver.com>:
mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup for khugepaged":
khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp()
khugepaged: remove unnecessary out label in collapse_huge_page()
khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd()
Zi Yan <ziy@nvidia.com>:
mm: huge_memory: a new debugfs interface for splitting THP tests
mm: huge_memory: debugfs for file-backed THP split
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for hugetlb", v2:
mm/hugeltb: remove redundant VM_BUG_ON() in region_add()
mm/hugeltb: simplify the return code of __vma_reservation_common()
mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages()
mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts()
mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages()
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "make hugetlb put_page safe for all calling contexts", v5:
mm/cma: change cma mutex to irq safe spinlock
hugetlb: no need to drop hugetlb_lock to call cma_release
hugetlb: add per-hstate mutex to synchronize user adjustments
hugetlb: create remove_hugetlb_page() to separate functionality
hugetlb: call update_and_free_page without hugetlb_lock
hugetlb: change free_pool_huge_page to remove_pool_huge_page
hugetlb: make free_huge_page irq safe
hugetlb: add lockdep_assert_held() calls for hugetlb_lock
Oscar Salvador <osalvador@suse.de>:
Patch series "Make alloc_contig_range handle Hugetlb pages", v10:
mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range
mm,compaction: let isolate_migratepages_{range,block} return error codes
mm,hugetlb: drop clearing of flag from prep_new_huge_page
mm,hugetlb: split prep_new_huge_page functionality
mm: make alloc_contig_range handle free hugetlb pages
mm: make alloc_contig_range handle in-use hugetlb pages
mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig
Subsystem: mm/userfaultfd
Axel Rasmussen <axelrasmussen@google.com>:
Patch series "userfaultfd: add minor fault handling", v9:
userfaultfd: add minor fault registration mode
userfaultfd: disable huge PMD sharing for MINOR registered VMAs
userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled
userfaultfd: add UFFDIO_CONTINUE ioctl
userfaultfd: update documentation to describe minor fault handling
userfaultfd/selftests: add test exercising minor fault handling
Subsystem: mm/vmscan
Dave Hansen <dave.hansen@linux.intel.com>:
mm/vmscan: move RECLAIM* bits to uapi header
mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks
Yang Shi <shy828301@gmail.com>:
Patch series "Make shrinker's nr_deferred memcg aware", v10:
mm: vmscan: use nid from shrink_control for tracepoint
mm: vmscan: consolidate shrinker_maps handling code
mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation
mm: vmscan: remove memcg_shrinker_map_size
mm: vmscan: use kvfree_rcu instead of call_rcu
mm: memcontrol: rename shrinker_map to shrinker_info
mm: vmscan: add shrinker_info_protected() helper
mm: vmscan: use a new flag to indicate shrinker is registered
mm: vmscan: add per memcg shrinker nr_deferred
mm: vmscan: use per memcg nr_deferred of shrinker
mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers
mm: memcontrol: reparent nr_deferred when memcg offline
mm: vmscan: shrink deferred objects proportional to priority
Subsystem: mm/compaction
Pintu Kumar <pintu@codeaurora.org>:
mm/compaction: remove unused variable sysctl_compact_memory
Charan Teja Reddy <charante@codeaurora.org>:
mm: compaction: update the COMPACT[STALL|FAIL] events properly
Subsystem: mm/migration
Minchan Kim <minchan@kernel.org>:
mm: disable LRU pagevec during the migration temporarily
mm: replace migrate_[prep|finish] with lru_cache_[disable|enable]
mm: fs: invalidate BH LRU during page migration
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for mm/migrate.c", v3:
mm/migrate.c: make putback_movable_page() static
mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case
mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page()
mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole()
Revert "mm: migrate: skip shared exec THP for NUMA balancing"
Subsystem: mm/cma
Minchan Kim <minchan@kernel.org>:
mm: vmstat: add cma statistics
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: cma: use pr_err_ratelimited for CMA warning
Liam Mark <lmark@codeaurora.org>:
mm: cma: add trace events for CMA alloc perf testing
Minchan Kim <minchan@kernel.org>:
mm: cma: support sysfs
mm: cma: add the CMA instance name to cma trace events
mm: use proper type for cma_[alloc|release]
Subsystem: mm/ksm
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for ksm":
ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search()
ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()
ksm: remove dedicated macro KSM_FLAG_MASK
ksm: fix potential missing rmap_item for stable_node
Chengyang Fan <cy.fan@huawei.com>:
mm/ksm: remove unused parameter from remove_trailing_rmap_items()
Subsystem: mm/vmstat
Hugh Dickins <hughd@google.com>:
mm: restore node stat checking in /proc/sys/vm/stat_refresh
mm: no more EINVAL from /proc/sys/vm/stat_refresh
mm: /proc/sys/vm/stat_refresh skip checking known negative stats
mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats
Saravanan D <saravanand@fb.com>:
x86/mm: track linear mapping split events
Subsystem: mm/mmap
Liam Howlett <liam.howlett@oracle.com>:
mm/mmap.c: don't unlock VMAs in remap_file_pages()
Subsystem: mm/kconfig
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm: some config cleanups", v2:
mm: generalize ARCH_HAS_CACHE_LINE_SIZE
mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE]
mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION
mm: drop redundant ARCH_ENABLE_SPLIT_PMD_PTLOCK
mm: drop redundant HAVE_ARCH_TRANSPARENT_HUGEPAGE
Subsystem: mm/util
Joe Perches <joe@perches.com>:
mm/util.c: reduce mem_dump_obj() object size
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
mm/util.c: fix typo
Subsystem: mm/memory-hotplug
Pavel Tatashin <pasha.tatashin@soleen.com>:
Patch series "prohibit pinning pages in ZONE_MOVABLE", v11:
mm/gup: don't pin migrated cma pages in movable zone
mm/gup: check every subpage of a compound page during isolation
mm/gup: return an error on migration failure
mm/gup: check for isolation errors
mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN
mm: apply per-task gfp constraints in fast path
mm: honor PF_MEMALLOC_PIN for all movable pages
mm/gup: do not migrate zero page
mm/gup: migrate pinned pages out of movable zone
memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning
mm/gup: change index type to long as it counts pages
mm/gup: longterm pin migration cleanup
selftests/vm: gup_test: fix test flag
selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages
Mel Gorman <mgorman@techsingularity.net>:
mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove
Oscar Salvador <osalvador@suse.de>:
Patch series "Allocate memmap from hotadded memory (per device)", v10:
drivers/base/memory: introduce memory_block_{online,offline}
mm,memory_hotplug: relax fully spanned sections check
David Hildenbrand <david@redhat.com>:
mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count()
Oscar Salvador <osalvador@suse.de>:
mm,memory_hotplug: allocate memmap from the added memory range
acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported
mm,memory_hotplug: add kernel boot option to enable memmap_on_memory
x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
Subsystem: mm/zswap
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/zswap.c: switch from strlcpy to strscpy
Subsystem: mm/zsmalloc
zhouchuangao <zhouchuangao@vivo.com>:
mm/zsmalloc: use BUG_ON instead of if condition followed by BUG.
Subsystem: mm/highmem
Ira Weiny <ira.weiny@intel.com>:
Patch series "btrfs: Convert kmap/memset/kunmap to memzero_user()":
iov_iter: lift memzero_page() to highmem.h
btrfs: use memzero_page() instead of open coded kmap pattern
songqiang <songqiang@uniontech.com>:
mm/highmem.c: fix coding style issue
Subsystem: mm/cleanups
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/mempool: minor coding style tweaks
Zhang Yunkai <zhang.yunkai@zte.com.cn>:
mm/process_vm_access.c: remove duplicate include
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: zero guard page after out-of-bounds access
Patch series "kfence: optimize timer scheduling", v2:
kfence: await for allocation using wait_event
kfence: maximize allocation wait timeout duration
kfence: use power-efficient work queue to run delayed work
Documentation/ABI/testing/sysfs-kernel-mm-cma | 25
Documentation/admin-guide/kernel-parameters.txt | 17
Documentation/admin-guide/mm/memory-hotplug.rst | 9
Documentation/admin-guide/mm/userfaultfd.rst | 105 +-
arch/arc/Kconfig | 9
arch/arm/Kconfig | 10
arch/arm64/Kconfig | 34
arch/arm64/mm/hugetlbpage.c | 7
arch/ia64/Kconfig | 14
arch/ia64/mm/hugetlbpage.c | 3
arch/mips/Kconfig | 6
arch/mips/mm/hugetlbpage.c | 4
arch/parisc/Kconfig | 5
arch/parisc/mm/hugetlbpage.c | 2
arch/powerpc/Kconfig | 17
arch/powerpc/mm/hugetlbpage.c | 3
arch/powerpc/platforms/Kconfig.cputype | 16
arch/riscv/Kconfig | 5
arch/s390/Kconfig | 12
arch/s390/mm/hugetlbpage.c | 2
arch/sh/Kconfig | 7
arch/sh/mm/Kconfig | 8
arch/sh/mm/hugetlbpage.c | 2
arch/sparc/mm/hugetlbpage.c | 2
arch/x86/Kconfig | 33
arch/x86/mm/pat/set_memory.c | 8
drivers/acpi/acpi_memhotplug.c | 5
drivers/base/memory.c | 105 ++
fs/Kconfig | 5
fs/block_dev.c | 2
fs/btrfs/compression.c | 5
fs/btrfs/extent_io.c | 22
fs/btrfs/inode.c | 33
fs/btrfs/reflink.c | 6
fs/btrfs/zlib.c | 5
fs/btrfs/zstd.c | 5
fs/buffer.c | 36
fs/dax.c | 8
fs/gfs2/glock.c | 3
fs/hugetlbfs/inode.c | 9
fs/inode.c | 11
fs/proc/task_mmu.c | 3
fs/userfaultfd.c | 149 +++
include/linux/buffer_head.h | 4
include/linux/cma.h | 4
include/linux/compaction.h | 1
include/linux/fs.h | 2
include/linux/gfp.h | 2
include/linux/highmem.h | 7
include/linux/huge_mm.h | 3
include/linux/hugetlb.h | 37
include/linux/memcontrol.h | 27
include/linux/memory.h | 8
include/linux/memory_hotplug.h | 15
include/linux/memremap.h | 2
include/linux/migrate.h | 11
include/linux/mm.h | 28
include/linux/mmzone.h | 20
include/linux/pagemap.h | 5
include/linux/pgtable.h | 12
include/linux/sched.h | 2
include/linux/sched/mm.h | 27
include/linux/shrinker.h | 7
include/linux/swap.h | 21
include/linux/userfaultfd_k.h | 55 +
include/linux/vm_event_item.h | 8
include/trace/events/cma.h | 92 +-
include/trace/events/migrate.h | 25
include/trace/events/mmflags.h | 7
include/uapi/linux/mempolicy.h | 7
include/uapi/linux/userfaultfd.h | 36
init/Kconfig | 5
kernel/sysctl.c | 2
lib/Kconfig.kfence | 1
lib/iov_iter.c | 8
mm/Kconfig | 28
mm/Makefile | 6
mm/cma.c | 70 +
mm/cma.h | 25
mm/cma_debug.c | 8
mm/cma_sysfs.c | 112 ++
mm/compaction.c | 113 ++
mm/filemap.c | 24
mm/frontswap.c | 12
mm/gup.c | 264 +++---
mm/gup_test.c | 29
mm/gup_test.h | 3
mm/highmem.c | 11
mm/huge_memory.c | 326 +++++++-
mm/hugetlb.c | 843 ++++++++++++++--------
mm/hugetlb_cgroup.c | 9
mm/internal.h | 10
mm/kfence/core.c | 61 +
mm/khugepaged.c | 63 -
mm/ksm.c | 17
mm/list_lru.c | 6
mm/memcontrol.c | 137 ---
mm/memory_hotplug.c | 220 +++++
mm/mempolicy.c | 16
mm/mempool.c | 2
mm/migrate.c | 103 --
mm/mlock.c | 4
mm/mmap.c | 18
mm/oom_kill.c | 2
mm/page_alloc.c | 83 +-
mm/process_vm_access.c | 1
mm/shmem.c | 2
mm/sparse.c | 4
mm/swap.c | 69 +
mm/swap_state.c | 4
mm/swapfile.c | 4
mm/truncate.c | 19
mm/userfaultfd.c | 39 -
mm/util.c | 26
mm/vmalloc.c | 2
mm/vmscan.c | 543 +++++++++-----
mm/vmstat.c | 45 -
mm/workingset.c | 1
mm/zsmalloc.c | 6
mm/zswap.c | 2
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 1
tools/testing/selftests/vm/gup_test.c | 38
tools/testing/selftests/vm/split_huge_page_test.c | 400 ++++++++++
tools/testing/selftests/vm/userfaultfd.c | 164 ++++
125 files changed, 3596 insertions(+), 1668 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-05-05 1:32 incoming Andrew Morton
@ 2021-05-05 1:47 ` Linus Torvalds
2021-05-05 3:16 ` incoming Andrew Morton
0 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2021-05-05 1:47 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 143 patches
Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.
Maybe just some mail delay? But at least right now
https://lore.kernel.org/mm-commits/
doesn't show them (and thus 'b4' doesn't work).
I'll check again later.
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-05-05 1:47 ` incoming Linus Torvalds
@ 2021-05-05 3:16 ` Andrew Morton
2021-05-05 17:10 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2021-05-05 3:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Linux-MM, mm-commits
On Tue, 4 May 2021 18:47:19 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 143 patches
>
> Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.
>
> Maybe just some mail delay? But at least right now
>
> https://lore.kernel.org/mm-commits/
>
> doesn't show them (and thus 'b4' doesn't work).
>
> I'll check again later.
>
Well that's strange. I see all three via cc:me, but not on linux-mm or
mm-commits.
Let me resend right now with the same in-reply-to. Hopefully they will
land in the correct place.
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-05-05 3:16 ` incoming Andrew Morton
@ 2021-05-05 17:10 ` Linus Torvalds
2021-05-05 17:44 ` incoming Andrew Morton
0 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2021-05-05 17:10 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits
On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> Let me resend right now with the same in-reply-to. Hopefully they will
> land in the correct place.
Well, you re-sent it twice, and I have three copies in my own mailbox,
bot they still don't show up on the mm-commits mailing list.
So the list hates them for some odd reason.
I've picked them up locally, but adding Konstantin to the participants
to see if he can see what's up.
Konstantin: patches 103/106/107 are missing on lore out of Andrew's
series of 143. Odd.
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-05-05 17:10 ` incoming Linus Torvalds
@ 2021-05-05 17:44 ` Andrew Morton
2021-05-06 3:19 ` incoming Anshuman Khandual
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2021-05-05 17:44 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits
[-- Attachment #1: Type: text/plain, Size: 1387 bytes --]
On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > Let me resend right now with the same in-reply-to. Hopefully they will
> > land in the correct place.
>
> Well, you re-sent it twice, and I have three copies in my own mailbox,
> bot they still don't show up on the mm-commits mailing list.
>
> So the list hates them for some odd reason.
>
> I've picked them up locally, but adding Konstantin to the participants
> to see if he can see what's up.
>
> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
> series of 143. Odd.
It's weird. They don't turn up on linux-mm either, and that's running
at kvack.org, also majordomo. They don't get through when sent with
either heirloom-mailx or with sylpheed.
Also, it seems that when Anshuman originally sent the patch, linux-mm
and linux-kernel didn't send it back out. So perhaps a spam filter
triggered?
I'm seeing
https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/
which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
server massacred that patch series. Searching
https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
email series.
One of the emails (as sent my me) is attached, if that helps.
[-- Attachment #2: x.txt --]
[-- Type: text/plain, Size: 21048 bytes --]
Return-Path: <akpm@linux-foundation.org>
X-Spam-Checker-Version: SpamAssassin 3.4.1 (2015-04-28) on y
X-Spam-Level: (none)
X-Spam-Status: No, score=-101.5 required=2.5 tests=BAYES_00,T_DKIM_INVALID,
USER_IN_WHITELIST autolearn=ham autolearn_force=no version=3.4.1
Received: from localhost.localdomain (localhost.localdomain [127.0.0.1])
by localhost.localdomain (8.15.2/8.15.2/Debian-8ubuntu1) with ESMTP id 1453H2fk032202
for <akpm@localhost>; Tue, 4 May 2021 20:17:03 -0700
Received: from imap.fastmail.com [66.111.4.135]
by localhost.localdomain with IMAP (fetchmail-6.3.26)
for <akpm@localhost> (single-drop); Tue, 04 May 2021 20:17:03 -0700 (PDT)
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
by sloti11d1t06 (Cyrus 3.5.0-alpha0-442-g5daca166b9-fm-20210428.001-g5daca166) with LMTPA;
Tue, 04 May 2021 23:16:31 -0400
X-Cyrus-Session-Id: sloti11d1t06-1620184591-1699471-2-6359664467419938249
X-Sieve: CMU Sieve 3.0
X-Resolved-to: akpm@mbx.kernel.org
X-Delivered-to: akpm@mbx.kernel.org
X-Mail-from: akpm@linux-foundation.org
Received: from mx6 ([10.202.2.205])
by compute1.internal (LMTPProxy); Tue, 04 May 2021 23:16:31 -0400
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
by mailmx.nyi.internal (Postfix) with ESMTP id 40796C800E1
for <akpm@mbx.kernel.org>; Tue, 4 May 2021 23:16:31 -0400 (EDT)
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
by mx6.messagingengine.com (Authentication Milter) with ESMTP
id 14870833D7F;
Tue, 4 May 2021 23:16:31 -0400
ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=messagingengine.com; s=fm2; t=
1620184591; b=FBo7Gf3JFN+4QYg5Byan0oNm6RESv+sIf5HcaslVNsUd9SOTGS
yI0+IsXr1CUpGH783hE6fmgEq9SyfOwQVZjdikLaJS1+7u0JtfAYQFU3RORCtXlr
djJWrScfjVa8nAHX4rQCtzvtPYuzx5w7cTgGgeILgoJMxgLj7EC9xcT8BIf68+9W
Lw+ohAmcuiKhL2ez+de4SMuwdh3dh2FwAIHQOsSjEU1/NV+WGxMLwYbxWgTrqQGH
RQIzFNdq30qslW9huK47+e80uHOX2tXwxtshwbThFEn458bdV5LL6Y8Oh4ZWMbv1
tFgTt515DVedonZknxc07XsXtAjaJyB8bfHw==
ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d=
messagingengine.com; h=date:from:to:subject:message-id
:in-reply-to; s=fm2; t=1620184591; bh=LuH7mbm3+zp863vKBEqKeoZtnp
uFxYpIb5oTVwf56Es=; b=m5E1fbz2b+an/X406oY3BuG0Zm4/W05vWAki8Lsnud
gPCc1LfPUFSuXaMppcEDPbLKprp4hH3T52itK4pivXMQCLEOyme7kVStaLMVTiky
Xxqh5ZdhOWvygBfda/GjfuLBSbbj2gfm8HPKpbL7CA5foelknIBhJHDzGkJyxetZ
YagZfVvtdo2OEwnC1mmjUCpKPO5+m5kaZO0ol6rPdl+TV0MKGhjLg+/i6Ia+0nFp
zDwV4VeACvVcGb2xY7KG5Z+BtqVxeVFn+w5JcqpWUtxEKoSBR4bWARzjwHg6eouh
7psOOKPTt/NzDKk+3f49lso5KlPiTF2xEU/+5SIttCkQ==
ARC-Authentication-Results: i=2; mx6.messagingengine.com;
arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
smtp.remote-ip=209.85.215.198;
bimi=skipped (DMARC did not pass);
dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
header.s=korg x-bits=1024;
dmarc=none policy.published-domain-policy=none
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,d=none,d.eval=none) policy.policy-from=p
header.from=linux-foundation.org;
iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
spf=pass smtp.mailfrom=akpm@linux-foundation.org
smtp.helo=mail-pg1-f198.google.com;
x-aligned-from=pass (Address match);
x-arc-spf=pass
(google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
x-arc-domain=google.com (Trusted from aar.1.google.com);
x-csa=none;
x-google-dkim=fail (message has been altered, 2048-bit rsa key)
header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
x-me-sender=none;
x-ptr=pass smtp.helo=mail-pg1-f198.google.com
policy.ptr=mail-pg1-f198.google.com;
x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
(MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
(MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
smtp.bits=256/256;
x-vs=clean score=40 state=0
Authentication-Results: mx6.messagingengine.com;
arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
smtp.remote-ip=209.85.215.198;
bimi=skipped (DMARC did not pass);
dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
header.s=korg x-bits=1024;
dmarc=none policy.published-domain-policy=none
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,d=none,d.eval=none) policy.policy-from=p
header.from=linux-foundation.org;
iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
spf=pass smtp.mailfrom=akpm@linux-foundation.org
smtp.helo=mail-pg1-f198.google.com;
x-aligned-from=pass (Address match);
x-arc-spf=pass
(google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
x-arc-domain=google.com (Trusted from aar.1.google.com);
x-csa=none;
x-google-dkim=fail (message has been altered, 2048-bit rsa key)
header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
x-me-sender=none;
x-ptr=pass smtp.helo=mail-pg1-f198.google.com
policy.ptr=mail-pg1-f198.google.com;
x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
(MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
(MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
smtp.bits=256/256;
x-vs=clean score=40 state=0
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrvdefjedgieegucetufdoteggodetrfdotf
fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu
rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucgoufhorhhtvggutfgvtg
hiphdvucdlgedtmdenucfjughrpeffhffvuffkjggfsedttdertddtredtnecuhfhrohhm
peetnhgurhgvficuofhorhhtohhnuceorghkphhmsehlihhnuhigqdhfohhunhgurghtih
honhdrohhrgheqnecuggftrfgrthhtvghrnhepjeevfeduveffvddvudetkefhgeduveeu
geevvdfhhfevhfekkedtieefgfduheeinecuffhomhgrihhnpehkvghrnhgvlhdrohhrgh
enucfkphepvddtledrkeehrddvudehrdduleekpdduleekrddugeehrddvledrleelnecu
uegrugftvghpuhhtkfhppeduleekrddugeehrddvledrleelnecuvehluhhsthgvrhfuih
iivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudehrdduleekpdhhvghl
ohepmhgrihhlqdhpghduqdhfudelkedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomh
epoegrkhhpmheslhhinhhugidqfhhouhhnuggrthhiohhnrdhorhhgqe
X-ME-VSScore: 40
X-ME-VSCategory: clean
X-ME-CSA: none
Received-SPF: pass
(linux-foundation.org: Sender is authorized to use 'akpm@linux-foundation.org' in 'mfrom' identity (mechanism 'include:_spf.google.com' matched))
receiver=mx6.messagingengine.com;
identity=mailfrom;
envelope-from="akpm@linux-foundation.org";
helo=mail-pg1-f198.google.com;
client-ip=209.85.215.198
Received: from mail-pg1-f198.google.com (mail-pg1-f198.google.com [209.85.215.198])
(using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)
key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256)
(No client certificate requested)
by mx6.messagingengine.com (Postfix) with ESMTPS
for <akpm@mbx.kernel.org>; Tue, 4 May 2021 23:16:31 -0400 (EDT)
Received: by mail-pg1-f198.google.com with SMTP id g5-20020a63f4050000b02901f6c7b9a6d0so593624pgi.5
for <akpm@mbx.kernel.org>; Tue, 04 May 2021 20:16:30 -0700 (PDT)
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=1e100.net; s=20161025;
h=x-gm-message-state:dkim-signature:date:from:to:subject:message-id
:in-reply-to:user-agent;
bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
b=VZuDOxUfeHXJz1/CiFfcxuMVHkmW5RznvqYS+Py8Ub6nHHXprQJGE9Ze3WgH+1ylSe
NJLEC7xgv15SR9A+e/MT4RTj3OVOwtd1Zi2vPav39a9K4tP+2uL2Ei+5d7FtT3LLZsjo
feek/DqCGSkJ/EC5woLyU9BBkfLUuQ9/2HiDCk10BMetEfWdor69Slb39NOXES8br02X
25Btabu9ZCWroyjQj7W5gwGr5Z6Hs2nbnnfAb+e92FalcUD/4ql77lNzRcWGi4/9TT8s
ntqI2g46Xv+k5LURaRH5CRBpxkkKgzcrioRPYFUHkEgOEWy1hPzg9QPk8ZO35Xm9R9d2
vl3Q==
X-Gm-Message-State: AOAM531IlYUTVWcMrsTunnxZWB7SKeeOmoZj5mZ1A5tl7N/JlZUueN8L
tvyRKnvxHr6a5mDaGHN9Tb1N/iCzT0U5oQgRVTxTnj1qFGibRa9+leLQNKX0aGlNg9JiaMfromb
xyOlCUpVXOlVvchuwTUSTn7rXum+Hh3PWQZm5II/EX+0AkzKqez62Z8U=
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203271pjq.53.1620184589161;
Tue, 04 May 2021 20:16:29 -0700 (PDT)
X-Google-Smtp-Source: ABdhPJxffoGdRqAjUagWoMVD5p/Lk1KTEDftEhkWh8ewatgDmZLlxh0lO1hxYIdYYwoO5dsJ/i0z
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203198pjq.53.1620184588109;
Tue, 04 May 2021 20:16:28 -0700 (PDT)
ARC-Seal: i=1; a=rsa-sha256; t=1620184588; cv=none;
d=google.com; s=arc-20160816;
b=Fr2b2AMXJr6OeNpSql45tq1korkuDOunp7t+DpARuEBnwvQnKfagyipQ93jywsRf/c
/i/mP2eTmJwOLWNORClh1MGF/0VfBx1ULoB9W4CI3LpVgGFXGGFis8LTcvUYD5yvhlsV
50rm2j34iS9lyo04FB/hbhGkwLtUhz2PGkLGuqHspTd+pUpUCf5SLxGJbZC5uCcUEsbO
8WSDBWyvaCPjFzJQZK60gK70ticKW+fCG1xHtOG4qsFCbqEpFKBy8eVK83OBazo/dQDr
DOheWNWyw2o/WMP4GpZMvZuj30dx3j8xnBahIpnMIQJaog6wLMcVX9pkQ8UJym3/PGNm
pO/g==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816;
h=user-agent:in-reply-to:message-id:subject:to:from:date
:dkim-signature;
bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
b=vVN16NPMKjoxSJQ6b36VXFCkZqnmG7wABfilgE069txZqmHpEMyZb8lRStkHy557LM
Kn7UfJFP3xwsP8ZTCipVDZ6tpFW/hYFU9o4th9G8asWs+MOf9xpWX2LQZ1FTmaao2Fg5
uCHypz39cnAh0Z1EJfNsTcaTGIrkbBd6zje+mtBgs8hnfH8HcWBYTPCHCCx950Z928tb
XOPd/Igs7yzD1ioBiGXZj/ciwPbWVTaZXBg4JOZSApxkDMfuMyfyLLOs++EVkyxJHUme
TmgwvLkixcwEtKF7gIeqEhwvOUSVvilLuJLFVaLumwTcjJ1amVfGcJhBE7LIM9C3SMpA
rOOg==
ARC-Authentication-Results: i=1; mx.google.com;
dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: from mail.kernel.org (mail.kernel.org. [198.145.29.99])
by mx.google.com with ESMTPS id c85si20173199pfb.8.2021.05.04.20.16.27
(version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128);
Tue, 04 May 2021 20:16:28 -0700 (PDT)
Received-SPF: pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) client-ip=198.145.29.99;
Authentication-Results: mx.google.com;
dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: by mail.kernel.org (Postfix) with ESMTPSA id A4DB4610D2;
Wed, 5 May 2021 03:16:26 +0000 (UTC)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=linux-foundation.org;
s=korg; t=1620184587;
bh=TxN4wgKcKf2UUem+5pL09m9GL/7U592mEalo2U6vwAU=;
h=Date:From:To:Subject:In-Reply-To:From;
b=Gdz/3wY9ktH3hOmn2DAOkfh0JXwPdMJ8xsNQFa9eI25K39Z3iHdRGo9jX3QtMDtog
D4Zakt52CQCYsV91c9oCai8KnCTkkAjJq/Ez7p8UHpz97Go3yYYxqg6DDl6d8HCQvN
H47dTaZAgeH2sw29bjB9fRzNuTx7k4RAPlqZIpiE=
Date: Tue, 04 May 2021 20:16:26 -0700
From: Andrew Morton <akpm@linux-foundation.org>
To: akpm@linux-foundation.org, anshuman.khandual@arm.com, aou@eecs.berkeley.edu, arnd@arndb.de, benh@kernel.crashing.org, borntraeger@de.ibm.com, bp@alien8.de, catalin.marinas@arm.com, dalias@libc.org, deller@gmx.de, gor@linux.ibm.com, hca@linux.ibm.com, hpa@zytor.com, James.Bottomley@HansenPartnership.com, linux-mm@kvack.org, linux@armlinux.org.uk, mingo@redhat.com, mm-commits@vger.kernel.org, mpe@ellerman.id.au, palmerdabbelt@google.com, paul.walmsley@sifive.com, paulus@samba.org, tglx@linutronix.de, torvalds@linux-foundation.org, tsbogend@alpha.franken.de, vgupta@synopsys.com, viro@zeniv.linux.org.uk, will@kernel.org, ysato@users.osdn.me
Subject: [patch 103/143] mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
Message-ID: <20210505031626.c8o4WL7KE%akpm@linux-foundation.org>
In-Reply-To: <20210504183219.a3cc46aee4013d77402276c5@linux-foundation.org>
User-Agent: s-nail v14.8.16
X-Gm-Original-To: akpm@linux-foundation.org
From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
SYS_SUPPORTS_HUGETLBFS config has duplicate definitions on platforms that
subscribe it. Instead, just make it a generic option which can be
selected on applicable platforms. Also rename it as
ARCH_SUPPORTS_HUGETLBFS instead. This reduces code duplication and makes
it cleaner.
Link: https://lkml.kernel.org/r/1617259448-22529-3-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com> [arm64]
Acked-by: Palmer Dabbelt <palmerdabbelt@google.com> [riscv]
Acked-by: Michael Ellerman <mpe@ellerman.id.au> [powerpc]
Cc: Russell King <linux@armlinux.org.uk>
Cc: Will Deacon <will@kernel.org>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com>
Cc: Helge Deller <deller@gmx.de>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Cc: Rich Felker <dalias@libc.org>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/arm/Kconfig | 5 +----
arch/arm64/Kconfig | 4 +---
arch/mips/Kconfig | 6 +-----
arch/parisc/Kconfig | 5 +----
arch/powerpc/Kconfig | 3 ---
arch/powerpc/platforms/Kconfig.cputype | 6 +++---
arch/riscv/Kconfig | 5 +----
arch/sh/Kconfig | 5 +----
fs/Kconfig | 5 ++++-
9 files changed, 13 insertions(+), 31 deletions(-)
--- a/arch/arm64/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm64/Kconfig
@@ -73,6 +73,7 @@ config ARM64
select ARCH_USE_QUEUED_SPINLOCKS
select ARCH_USE_SYM_ANNOTATIONS
select ARCH_SUPPORTS_DEBUG_PAGEALLOC
+ select ARCH_SUPPORTS_HUGETLBFS
select ARCH_SUPPORTS_MEMORY_FAILURE
select ARCH_SUPPORTS_SHADOW_CALL_STACK if CC_HAVE_SHADOW_CALL_STACK
select ARCH_SUPPORTS_LTO_CLANG if CPU_LITTLE_ENDIAN
@@ -1072,9 +1073,6 @@ config HW_PERF_EVENTS
def_bool y
depends on ARM_PMU
-config SYS_SUPPORTS_HUGETLBFS
- def_bool y
-
config ARCH_HAS_FILTER_PGPROT
def_bool y
--- a/arch/arm/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm/Kconfig
@@ -31,6 +31,7 @@ config ARM
select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT if CPU_V7
select ARCH_SUPPORTS_ATOMIC_RMW
+ select ARCH_SUPPORTS_HUGETLBFS if ARM_LPAE
select ARCH_USE_BUILTIN_BSWAP
select ARCH_USE_CMPXCHG_LOCKREF
select ARCH_USE_MEMTEST
@@ -1511,10 +1512,6 @@ config HW_PERF_EVENTS
def_bool y
depends on ARM_PMU
-config SYS_SUPPORTS_HUGETLBFS
- def_bool y
- depends on ARM_LPAE
-
config HAVE_ARCH_TRANSPARENT_HUGEPAGE
def_bool y
depends on ARM_LPAE
--- a/arch/mips/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/mips/Kconfig
@@ -19,6 +19,7 @@ config MIPS
select ARCH_USE_MEMTEST
select ARCH_USE_QUEUED_RWLOCKS
select ARCH_USE_QUEUED_SPINLOCKS
+ select ARCH_SUPPORTS_HUGETLBFS if CPU_SUPPORTS_HUGEPAGES
select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
select ARCH_WANT_IPC_PARSE_VERSION
select ARCH_WANT_LD_ORPHAN_WARN
@@ -1287,11 +1288,6 @@ config SYS_SUPPORTS_BIG_ENDIAN
config SYS_SUPPORTS_LITTLE_ENDIAN
bool
-config SYS_SUPPORTS_HUGETLBFS
- bool
- depends on CPU_SUPPORTS_HUGEPAGES
- default y
-
config MIPS_HUGE_TLB_SUPPORT
def_bool HUGETLB_PAGE || TRANSPARENT_HUGEPAGE
--- a/arch/parisc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/parisc/Kconfig
@@ -12,6 +12,7 @@ config PARISC
select ARCH_HAS_STRICT_KERNEL_RWX
select ARCH_HAS_UBSAN_SANITIZE_ALL
select ARCH_NO_SG_CHAIN
+ select ARCH_SUPPORTS_HUGETLBFS if PA20
select ARCH_SUPPORTS_MEMORY_FAILURE
select DMA_OPS
select RTC_CLASS
@@ -138,10 +139,6 @@ config PGTABLE_LEVELS
default 3 if 64BIT && PARISC_PAGE_SIZE_4KB
default 2
-config SYS_SUPPORTS_HUGETLBFS
- def_bool y if PA20
-
-
menu "Processor type and features"
choice
--- a/arch/powerpc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/Kconfig
@@ -697,9 +697,6 @@ config ARCH_SPARSEMEM_DEFAULT
def_bool y
depends on PPC_BOOK3S_64
-config SYS_SUPPORTS_HUGETLBFS
- bool
-
config ILLEGAL_POINTER_VALUE
hex
# This is roughly half way between the top of user space and the bottom
--- a/arch/powerpc/platforms/Kconfig.cputype~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/platforms/Kconfig.cputype
@@ -40,8 +40,8 @@ config PPC_85xx
config PPC_8xx
bool "Freescale 8xx"
+ select ARCH_SUPPORTS_HUGETLBFS
select FSL_SOC
- select SYS_SUPPORTS_HUGETLBFS
select PPC_HAVE_KUEP
select PPC_HAVE_KUAP
select HAVE_ARCH_VMAP_STACK
@@ -95,9 +95,9 @@ config PPC_BOOK3S_64
bool "Server processors"
select PPC_FPU
select PPC_HAVE_PMU_SUPPORT
- select SYS_SUPPORTS_HUGETLBFS
select HAVE_ARCH_TRANSPARENT_HUGEPAGE
select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE
+ select ARCH_SUPPORTS_HUGETLBFS
select ARCH_SUPPORTS_NUMA_BALANCING
select IRQ_WORK
select PPC_MM_SLICES
@@ -278,9 +278,9 @@ config FSL_BOOKE
# this is for common code between PPC32 & PPC64 FSL BOOKE
config PPC_FSL_BOOK3E
bool
+ select ARCH_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
select FSL_EMB_PERFMON
select PPC_SMP_MUXED_IPI
- select SYS_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
select PPC_DOORBELL
default y if FSL_BOOKE
--- a/arch/riscv/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/riscv/Kconfig
@@ -30,6 +30,7 @@ config RISCV
select ARCH_HAS_STRICT_KERNEL_RWX if MMU
select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT
+ select ARCH_SUPPORTS_HUGETLBFS if MMU
select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
select ARCH_WANT_FRAME_POINTERS
select ARCH_WANT_HUGE_PMD_SHARE if 64BIT
@@ -165,10 +166,6 @@ config ARCH_WANT_GENERAL_HUGETLB
config ARCH_SUPPORTS_UPROBES
def_bool y
-config SYS_SUPPORTS_HUGETLBFS
- depends on MMU
- def_bool y
-
config STACKTRACE_SUPPORT
def_bool y
--- a/arch/sh/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/sh/Kconfig
@@ -101,9 +101,6 @@ config SYS_SUPPORTS_APM_EMULATION
bool
select ARCH_SUSPEND_POSSIBLE
-config SYS_SUPPORTS_HUGETLBFS
- bool
-
config SYS_SUPPORTS_SMP
bool
@@ -175,12 +172,12 @@ config CPU_SH3
config CPU_SH4
bool
+ select ARCH_SUPPORTS_HUGETLBFS if MMU
select CPU_HAS_INTEVT
select CPU_HAS_SR_RB
select CPU_HAS_FPU if !CPU_SH4AL_DSP
select SH_INTC
select SYS_SUPPORTS_SH_TMU
- select SYS_SUPPORTS_HUGETLBFS if MMU
config CPU_SH4A
bool
--- a/fs/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/fs/Kconfig
@@ -223,10 +223,13 @@ config TMPFS_INODE64
If unsure, say N.
+config ARCH_SUPPORTS_HUGETLBFS
+ def_bool n
+
config HUGETLBFS
bool "HugeTLB file system support"
depends on X86 || IA64 || SPARC64 || (S390 && 64BIT) || \
- SYS_SUPPORTS_HUGETLBFS || BROKEN
+ ARCH_SUPPORTS_HUGETLBFS || BROKEN
help
hugetlbfs is a filesystem backing for HugeTLB pages, based on
ramfs. For architectures that support it, say Y here and read
_
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-05-05 17:44 ` incoming Andrew Morton
@ 2021-05-06 3:19 ` Anshuman Khandual
0 siblings, 0 replies; 419+ messages in thread
From: Anshuman Khandual @ 2021-05-06 3:19 UTC (permalink / raw)
To: Andrew Morton, Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits
On 5/5/21 11:14 PM, Andrew Morton wrote:
> On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
>
>> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>>> Let me resend right now with the same in-reply-to. Hopefully they will
>>> land in the correct place.
>> Well, you re-sent it twice, and I have three copies in my own mailbox,
>> bot they still don't show up on the mm-commits mailing list.
>>
>> So the list hates them for some odd reason.
>>
>> I've picked them up locally, but adding Konstantin to the participants
>> to see if he can see what's up.
>>
>> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
>> series of 143. Odd.
> It's weird. They don't turn up on linux-mm either, and that's running
> at kvack.org, also majordomo. They don't get through when sent with
> either heirloom-mailx or with sylpheed.
>
> Also, it seems that when Anshuman originally sent the patch, linux-mm
> and linux-kernel didn't send it back out. So perhaps a spam filter
> triggered?
>
> I'm seeing
>
> https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/
>
> which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
> server massacred that patch series. Searching
> https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
> email series.
Yeah these patches faced problem from the very beginning getting
into the MM/LKML list for some strange reason.
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-05-07 1:01 Andrew Morton
2021-05-07 7:12 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2021-05-07 1:01 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
This is everything else from -mm for this merge window, with the
possible exception of Mike Rapoport's "secretmem" syscall patch series
(https://lkml.kernel.org/r/20210303162209.8609-1-rppt@kernel.org).
I've been wobbly about the secretmem patches due to doubts about
whether the feature is sufficiently useful to justify inclusion, but
developers are now weighing in with helpful information and I've asked Mike
for an extensively updated [0/n] changelog. This will take a few days
to play out so it is possible that I will prevail upon you for a post-rc1
merge. If that's a problem, there's always 5.13-rc1.
91 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus
previously sent patches.
Thanks.
Subsystems affected by this patch series:
alpha
procfs
sysctl
misc
core-kernel
bitmap
lib
compat
checkpatch
epoll
isofs
nilfs2
hpfs
exit
fork
kexec
gcov
panic
delayacct
gdb
resource
selftests
async
initramfs
ipc
mm/cleanups
drivers/char
mm/slub
spelling
Subsystem: alpha
Randy Dunlap <rdunlap@infradead.org>:
alpha: eliminate old-style function definitions
alpha: csum_partial_copy.c: add function prototypes from <net/checksum.h>
Subsystem: procfs
Colin Ian King <colin.king@canonical.com>:
fs/proc/generic.c: fix incorrect pde_is_permanent check
Alexey Dobriyan <adobriyan@gmail.com>:
proc: save LOC in __xlate_proc_name()
proc: mandate ->proc_lseek in "struct proc_ops"
proc: delete redundant subset=pid check
selftests: proc: test subset=pid
Subsystem: sysctl
zhouchuangao <zhouchuangao@vivo.com>:
proc/sysctl: fix function name error in comments
Subsystem: misc
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
include: remove pagemap.h from blkdev.h
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: drop inclusion in bitmap.h
Wan Jiabing <wanjiabing@vivo.com>:
linux/profile.h: remove unnecessary declaration
Subsystem: core-kernel
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
kernel/async.c: fix pr_debug statement
kernel/cred.c: make init_groups static
Subsystem: bitmap
Yury Norov <yury.norov@gmail.com>:
Patch series "lib/find_bit: fast path for small bitmaps", v6:
tools: disable -Wno-type-limits
tools: bitmap: sync function declarations with the kernel
tools: sync BITMAP_LAST_WORD_MASK() macro with the kernel
arch: rearrange headers inclusion order in asm/bitops for m68k, sh and h8300
lib: extend the scope of small_const_nbits() macro
tools: sync small_const_nbits() macro with the kernel
lib: inline _find_next_bit() wrappers
tools: sync find_next_bit implementation
lib: add fast path for find_next_*_bit()
lib: add fast path for find_first_*_bit() and find_last_bit()
tools: sync lib/find_bit implementation
MAINTAINERS: add entry for the bitmap API
Subsystem: lib
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
lib/bch.c: fix a typo in the file bch.c
Wang Qing <wangqing@vivo.com>:
lib: fix inconsistent indenting in process_bit1()
ToastC <mrtoastcheng@gmail.com>:
lib/list_sort.c: fix typo in function description
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
lib/genalloc.c: Fix a typo
Richard Fitzgerald <rf@opensource.cirrus.com>:
lib: crc8: pointer to data block should be const
Zqiang <qiang.zhang@windriver.com>:
lib: stackdepot: turn depot_lock spinlock to raw_spinlock
Alex Shi <alexs@kernel.org>:
lib/percpu_counter: tame kernel-doc compile warning
lib/genalloc: add parameter description to fix doc compile warning
Randy Dunlap <rdunlap@infradead.org>:
lib: parser: clean up kernel-doc
Subsystem: compat
Masahiro Yamada <masahiroy@kernel.org>:
include/linux/compat.h: remove unneeded declaration from COMPAT_SYSCALL_DEFINEx()
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: warn when missing newline in return sysfs_emit() formats
Vincent Mailhol <mailhol.vincent@wanadoo.fr>:
checkpatch: exclude four preprocessor sub-expressions from MACRO_ARG_REUSE
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
checkpatch: improve ALLOC_ARRAY_ARGS test
Subsystem: epoll
Davidlohr Bueso <dave@stgolabs.net>:
Patch series "fs/epoll: restore user-visible behavior upon event ready":
kselftest: introduce new epoll test case
fs/epoll: restore waking from ep_done_scan()
Subsystem: isofs
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
isofs: fix fall-through warnings for Clang
Subsystem: nilfs2
Liu xuzhi <liu.xuzhi@zte.com.cn>:
fs/nilfs2: fix misspellings using codespell tool
Lu Jialin <lujialin4@huawei.com>:
nilfs2: fix typos in comments
Subsystem: hpfs
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
hpfs: replace one-element array with flexible-array member
Subsystem: exit
Jim Newsome <jnewsome@torproject.org>:
do_wait: make PIDTYPE_PID case O(1) instead of O(n)
Subsystem: fork
Rolf Eike Beer <eb@emlix.com>:
kernel/fork.c: simplify copy_mm()
Xiaofeng Cao <cxfcosmos@gmail.com>:
kernel/fork.c: fix typos
Subsystem: kexec
Saeed Mirzamohammadi <saeed.mirzamohammadi@oracle.com>:
kernel/crash_core: add crashkernel=auto for vmcore creation
Joe LeVeque <jolevequ@microsoft.com>:
kexec: Add kexec reboot string
Jia-Ju Bai <baijiaju1990@gmail.com>:
kernel: kexec_file: fix error return code of kexec_calculate_store_digests()
Pavel Tatashin <pasha.tatashin@soleen.com>:
kexec: dump kmessage before machine_kexec
Subsystem: gcov
Johannes Berg <johannes.berg@intel.com>:
gcov: combine common code
gcov: simplify buffer allocation
gcov: use kvmalloc()
Nick Desaulniers <ndesaulniers@google.com>:
gcov: clang: drop support for clang-10 and older
Subsystem: panic
He Ying <heying24@huawei.com>:
smp: kernel/panic.c - silence warnings
Subsystem: delayacct
Yafang Shao <laoar.shao@gmail.com>:
delayacct: clear right task's flag after blkio completes
Subsystem: gdb
Johannes Berg <johannes.berg@intel.com>:
gdb: lx-symbols: store the abspath()
Barry Song <song.bao.hua@hisilicon.com>:
Patch series "scripts/gdb: clarify the platforms supporting lx_current and add arm64 support", v2:
scripts/gdb: document lx_current is only supported by x86
scripts/gdb: add lx_current support for arm64
Subsystem: resource
David Hildenbrand <david@redhat.com>:
Patch series "kernel/resource: make walk_system_ram_res() and walk_mem_res() search the whole tree", v2:
kernel/resource: make walk_system_ram_res() find all busy IORESOURCE_SYSTEM_RAM resources
kernel/resource: make walk_mem_res() find all busy IORESOURCE_MEM resources
kernel/resource: remove first_lvl / siblings_only logic
Alistair Popple <apopple@nvidia.com>:
kernel/resource: allow region_intersects users to hold resource_lock
kernel/resource: refactor __request_region to allow external locking
kernel/resource: fix locking in request_free_mem_region
Subsystem: selftests
Zhang Yunkai <zhang.yunkai@zte.com.cn>:
selftests: remove duplicate include
Subsystem: async
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
kernel/async.c: stop guarding pr_debug() statements
kernel/async.c: remove async_unregister_domain()
Subsystem: initramfs
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
Patch series "background initramfs unpacking, and CONFIG_MODPROBE_PATH", v3:
init/initramfs.c: do unpacking asynchronously
modules: add CONFIG_MODPROBE_PATH
Subsystem: ipc
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
ipc/sem.c: mundane typo fixes
Subsystem: mm/cleanups
Shijie Luo <luoshijie1@huawei.com>:
mm: fix some typos and code style problems
Subsystem: drivers/char
David Hildenbrand <david@redhat.com>:
Patch series "drivers/char: remove /dev/kmem for good":
drivers/char: remove /dev/kmem for good
mm: remove xlate_dev_kmem_ptr()
mm/vmalloc: remove vwrite()
Subsystem: mm/slub
Maninder Singh <maninder1.s@samsung.com>:
arm: print alloc free paths for address in registers
Subsystem: spelling
Drew Fustini <drew@beagleboard.org>:
scripts/spelling.txt: add "overlfow"
zuoqilin <zuoqilin@yulong.com>:
scripts/spelling.txt: Add "diabled" typo
Drew Fustini <drew@beagleboard.org>:
scripts/spelling.txt: add "overflw"
Colin Ian King <colin.king@canonical.com>:
mm/slab.c: fix spelling mistake "disired" -> "desired"
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
include/linux/pgtable.h: few spelling fixes
zhouchuangao <zhouchuangao@vivo.com>:
kernel/umh.c: fix some spelling mistakes
Xiaofeng Cao <cxfcosmos@gmail.com>:
kernel/user_namespace.c: fix typos
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
kernel/up.c: fix typo
Xiaofeng Cao <caoxiaofeng@yulong.com>:
kernel/sys.c: fix typo
dingsenjie <dingsenjie@yulong.com>:
fs: fat: fix spelling typo of values
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
ipc/sem.c: spelling fix
Masahiro Yamada <masahiroy@kernel.org>:
treewide: remove editor modelines and cruft
Ingo Molnar <mingo@kernel.org>:
mm: fix typos in comments
Lu Jialin <lujialin4@huawei.com>:
mm: fix typos in comments
Documentation/admin-guide/devices.txt | 2
Documentation/admin-guide/kdump/kdump.rst | 3
Documentation/admin-guide/kernel-parameters.txt | 18
Documentation/dev-tools/gdb-kernel-debugging.rst | 4
MAINTAINERS | 16
arch/Kconfig | 20
arch/alpha/include/asm/io.h | 5
arch/alpha/kernel/pc873xx.c | 4
arch/alpha/lib/csum_partial_copy.c | 1
arch/arm/configs/dove_defconfig | 1
arch/arm/configs/magician_defconfig | 1
arch/arm/configs/moxart_defconfig | 1
arch/arm/configs/mps2_defconfig | 1
arch/arm/configs/mvebu_v5_defconfig | 1
arch/arm/configs/xcep_defconfig | 1
arch/arm/include/asm/bug.h | 1
arch/arm/include/asm/io.h | 5
arch/arm/kernel/process.c | 11
arch/arm/kernel/traps.c | 1
arch/h8300/include/asm/bitops.h | 8
arch/hexagon/configs/comet_defconfig | 1
arch/hexagon/include/asm/io.h | 1
arch/ia64/include/asm/io.h | 1
arch/ia64/include/asm/uaccess.h | 18
arch/m68k/atari/time.c | 7
arch/m68k/configs/amcore_defconfig | 1
arch/m68k/include/asm/bitops.h | 6
arch/m68k/include/asm/io_mm.h | 5
arch/mips/include/asm/io.h | 5
arch/openrisc/configs/or1ksim_defconfig | 1
arch/parisc/include/asm/io.h | 5
arch/parisc/include/asm/pdc_chassis.h | 1
arch/powerpc/include/asm/io.h | 5
arch/s390/include/asm/io.h | 5
arch/sh/configs/edosk7705_defconfig | 1
arch/sh/configs/se7206_defconfig | 1
arch/sh/configs/sh2007_defconfig | 1
arch/sh/configs/sh7724_generic_defconfig | 1
arch/sh/configs/sh7770_generic_defconfig | 1
arch/sh/configs/sh7785lcr_32bit_defconfig | 1
arch/sh/include/asm/bitops.h | 5
arch/sh/include/asm/io.h | 5
arch/sparc/configs/sparc64_defconfig | 1
arch/sparc/include/asm/io_64.h | 5
arch/um/drivers/cow.h | 7
arch/xtensa/configs/xip_kc705_defconfig | 1
block/blk-settings.c | 1
drivers/auxdisplay/panel.c | 7
drivers/base/firmware_loader/main.c | 2
drivers/block/brd.c | 1
drivers/block/loop.c | 1
drivers/char/Kconfig | 10
drivers/char/mem.c | 231 --------
drivers/gpu/drm/qxl/qxl_drv.c | 1
drivers/isdn/capi/kcapi_proc.c | 1
drivers/md/bcache/super.c | 1
drivers/media/usb/pwc/pwc-uncompress.c | 3
drivers/net/ethernet/adaptec/starfire.c | 8
drivers/net/ethernet/amd/atarilance.c | 8
drivers/net/ethernet/amd/pcnet32.c | 7
drivers/net/wireless/intersil/hostap/hostap_proc.c | 1
drivers/net/wireless/intersil/orinoco/orinoco_nortel.c | 8
drivers/net/wireless/intersil/orinoco/orinoco_pci.c | 8
drivers/net/wireless/intersil/orinoco/orinoco_plx.c | 8
drivers/net/wireless/intersil/orinoco/orinoco_tmd.c | 8
drivers/nvdimm/btt.c | 1
drivers/nvdimm/pmem.c | 1
drivers/parport/parport_ip32.c | 12
drivers/platform/x86/dell/dell_rbu.c | 3
drivers/scsi/53c700.c | 1
drivers/scsi/53c700.h | 1
drivers/scsi/ch.c | 6
drivers/scsi/esas2r/esas2r_main.c | 1
drivers/scsi/ips.c | 20
drivers/scsi/ips.h | 20
drivers/scsi/lasi700.c | 1
drivers/scsi/megaraid/mbox_defs.h | 2
drivers/scsi/megaraid/mega_common.h | 2
drivers/scsi/megaraid/megaraid_mbox.c | 2
drivers/scsi/megaraid/megaraid_mbox.h | 2
drivers/scsi/qla1280.c | 12
drivers/scsi/scsicam.c | 1
drivers/scsi/sni_53c710.c | 1
drivers/video/fbdev/matrox/matroxfb_base.c | 9
drivers/video/fbdev/vga16fb.c | 10
fs/configfs/configfs_internal.h | 4
fs/configfs/dir.c | 4
fs/configfs/file.c | 4
fs/configfs/inode.c | 4
fs/configfs/item.c | 4
fs/configfs/mount.c | 4
fs/configfs/symlink.c | 4
fs/eventpoll.c | 6
fs/fat/fatent.c | 2
fs/hpfs/hpfs.h | 3
fs/isofs/rock.c | 1
fs/nfs/dir.c | 7
fs/nfs/nfs4proc.c | 6
fs/nfs/nfs4renewd.c | 6
fs/nfs/nfs4state.c | 6
fs/nfs/nfs4xdr.c | 6
fs/nfsd/nfs4proc.c | 6
fs/nfsd/nfs4xdr.c | 6
fs/nfsd/xdr4.h | 6
fs/nilfs2/cpfile.c | 2
fs/nilfs2/ioctl.c | 4
fs/nilfs2/segment.c | 4
fs/nilfs2/the_nilfs.c | 2
fs/ocfs2/acl.c | 4
fs/ocfs2/acl.h | 4
fs/ocfs2/alloc.c | 4
fs/ocfs2/alloc.h | 4
fs/ocfs2/aops.c | 4
fs/ocfs2/aops.h | 4
fs/ocfs2/blockcheck.c | 4
fs/ocfs2/blockcheck.h | 4
fs/ocfs2/buffer_head_io.c | 4
fs/ocfs2/buffer_head_io.h | 4
fs/ocfs2/cluster/heartbeat.c | 4
fs/ocfs2/cluster/heartbeat.h | 4
fs/ocfs2/cluster/masklog.c | 4
fs/ocfs2/cluster/masklog.h | 4
fs/ocfs2/cluster/netdebug.c | 4
fs/ocfs2/cluster/nodemanager.c | 4
fs/ocfs2/cluster/nodemanager.h | 4
fs/ocfs2/cluster/ocfs2_heartbeat.h | 4
fs/ocfs2/cluster/ocfs2_nodemanager.h | 4
fs/ocfs2/cluster/quorum.c | 4
fs/ocfs2/cluster/quorum.h | 4
fs/ocfs2/cluster/sys.c | 4
fs/ocfs2/cluster/sys.h | 4
fs/ocfs2/cluster/tcp.c | 4
fs/ocfs2/cluster/tcp.h | 4
fs/ocfs2/cluster/tcp_internal.h | 4
fs/ocfs2/dcache.c | 4
fs/ocfs2/dcache.h | 4
fs/ocfs2/dir.c | 4
fs/ocfs2/dir.h | 4
fs/ocfs2/dlm/dlmapi.h | 4
fs/ocfs2/dlm/dlmast.c | 4
fs/ocfs2/dlm/dlmcommon.h | 4
fs/ocfs2/dlm/dlmconvert.c | 4
fs/ocfs2/dlm/dlmconvert.h | 4
fs/ocfs2/dlm/dlmdebug.c | 4
fs/ocfs2/dlm/dlmdebug.h | 4
fs/ocfs2/dlm/dlmdomain.c | 4
fs/ocfs2/dlm/dlmdomain.h | 4
fs/ocfs2/dlm/dlmlock.c | 4
fs/ocfs2/dlm/dlmmaster.c | 4
fs/ocfs2/dlm/dlmrecovery.c | 4
fs/ocfs2/dlm/dlmthread.c | 4
fs/ocfs2/dlm/dlmunlock.c | 4
fs/ocfs2/dlmfs/dlmfs.c | 4
fs/ocfs2/dlmfs/userdlm.c | 4
fs/ocfs2/dlmfs/userdlm.h | 4
fs/ocfs2/dlmglue.c | 4
fs/ocfs2/dlmglue.h | 4
fs/ocfs2/export.c | 4
fs/ocfs2/export.h | 4
fs/ocfs2/extent_map.c | 4
fs/ocfs2/extent_map.h | 4
fs/ocfs2/file.c | 4
fs/ocfs2/file.h | 4
fs/ocfs2/filecheck.c | 4
fs/ocfs2/filecheck.h | 4
fs/ocfs2/heartbeat.c | 4
fs/ocfs2/heartbeat.h | 4
fs/ocfs2/inode.c | 4
fs/ocfs2/inode.h | 4
fs/ocfs2/journal.c | 4
fs/ocfs2/journal.h | 4
fs/ocfs2/localalloc.c | 4
fs/ocfs2/localalloc.h | 4
fs/ocfs2/locks.c | 4
fs/ocfs2/locks.h | 4
fs/ocfs2/mmap.c | 4
fs/ocfs2/move_extents.c | 4
fs/ocfs2/move_extents.h | 4
fs/ocfs2/namei.c | 4
fs/ocfs2/namei.h | 4
fs/ocfs2/ocfs1_fs_compat.h | 4
fs/ocfs2/ocfs2.h | 4
fs/ocfs2/ocfs2_fs.h | 4
fs/ocfs2/ocfs2_ioctl.h | 4
fs/ocfs2/ocfs2_lockid.h | 4
fs/ocfs2/ocfs2_lockingver.h | 4
fs/ocfs2/refcounttree.c | 4
fs/ocfs2/refcounttree.h | 4
fs/ocfs2/reservations.c | 4
fs/ocfs2/reservations.h | 4
fs/ocfs2/resize.c | 4
fs/ocfs2/resize.h | 4
fs/ocfs2/slot_map.c | 4
fs/ocfs2/slot_map.h | 4
fs/ocfs2/stack_o2cb.c | 4
fs/ocfs2/stack_user.c | 4
fs/ocfs2/stackglue.c | 4
fs/ocfs2/stackglue.h | 4
fs/ocfs2/suballoc.c | 4
fs/ocfs2/suballoc.h | 4
fs/ocfs2/super.c | 4
fs/ocfs2/super.h | 4
fs/ocfs2/symlink.c | 4
fs/ocfs2/symlink.h | 4
fs/ocfs2/sysfile.c | 4
fs/ocfs2/sysfile.h | 4
fs/ocfs2/uptodate.c | 4
fs/ocfs2/uptodate.h | 4
fs/ocfs2/xattr.c | 4
fs/ocfs2/xattr.h | 4
fs/proc/generic.c | 13
fs/proc/inode.c | 18
fs/proc/proc_sysctl.c | 2
fs/reiserfs/procfs.c | 10
include/asm-generic/bitops/find.h | 108 +++
include/asm-generic/bitops/le.h | 38 +
include/asm-generic/bitsperlong.h | 12
include/asm-generic/io.h | 11
include/linux/align.h | 15
include/linux/async.h | 1
include/linux/bitmap.h | 11
include/linux/bitops.h | 12
include/linux/blkdev.h | 1
include/linux/compat.h | 1
include/linux/configfs.h | 4
include/linux/crc8.h | 2
include/linux/cred.h | 1
include/linux/delayacct.h | 20
include/linux/fs.h | 2
include/linux/genl_magic_func.h | 1
include/linux/genl_magic_struct.h | 1
include/linux/gfp.h | 2
include/linux/init_task.h | 1
include/linux/initrd.h | 2
include/linux/kernel.h | 9
include/linux/mm.h | 2
include/linux/mmzone.h | 2
include/linux/pgtable.h | 10
include/linux/proc_fs.h | 1
include/linux/profile.h | 3
include/linux/smp.h | 8
include/linux/swap.h | 1
include/linux/vmalloc.h | 7
include/uapi/linux/if_bonding.h | 11
include/uapi/linux/nfs4.h | 6
include/xen/interface/elfnote.h | 10
include/xen/interface/hvm/hvm_vcpu.h | 10
include/xen/interface/io/xenbus.h | 10
init/Kconfig | 12
init/initramfs.c | 38 +
init/main.c | 1
ipc/sem.c | 12
kernel/async.c | 68 --
kernel/configs/android-base.config | 1
kernel/crash_core.c | 7
kernel/cred.c | 2
kernel/exit.c | 67 ++
kernel/fork.c | 23
kernel/gcov/Kconfig | 1
kernel/gcov/base.c | 49 +
kernel/gcov/clang.c | 282 ----------
kernel/gcov/fs.c | 146 ++++-
kernel/gcov/gcc_4_7.c | 173 ------
kernel/gcov/gcov.h | 14
kernel/kexec_core.c | 4
kernel/kexec_file.c | 4
kernel/kmod.c | 2
kernel/resource.c | 198 ++++---
kernel/sys.c | 14
kernel/umh.c | 8
kernel/up.c | 2
kernel/user_namespace.c | 6
lib/bch.c | 2
lib/crc8.c | 2
lib/decompress_unlzma.c | 2
lib/find_bit.c | 68 --
lib/genalloc.c | 7
lib/list_sort.c | 2
lib/parser.c | 61 +-
lib/percpu_counter.c | 2
lib/stackdepot.c | 6
mm/balloon_compaction.c | 4
mm/compaction.c | 4
mm/filemap.c | 2
mm/gup.c | 2
mm/highmem.c | 2
mm/huge_memory.c | 6
mm/hugetlb.c | 6
mm/internal.h | 2
mm/kasan/kasan.h | 8
mm/kasan/quarantine.c | 4
mm/kasan/shadow.c | 4
mm/kfence/report.c | 2
mm/khugepaged.c | 2
mm/ksm.c | 6
mm/madvise.c | 4
mm/memcontrol.c | 18
mm/memory-failure.c | 2
mm/memory.c | 18
mm/mempolicy.c | 6
mm/migrate.c | 8
mm/mmap.c | 4
mm/mprotect.c | 2
mm/mremap.c | 2
mm/nommu.c | 10
mm/oom_kill.c | 2
mm/page-writeback.c | 4
mm/page_alloc.c | 16
mm/page_owner.c | 2
mm/page_vma_mapped.c | 2
mm/percpu-internal.h | 2
mm/percpu.c | 2
mm/pgalloc-track.h | 6
mm/rmap.c | 2
mm/slab.c | 8
mm/slub.c | 2
mm/swap.c | 4
mm/swap_slots.c | 2
mm/swap_state.c | 2
mm/vmalloc.c | 124 ----
mm/vmstat.c | 2
mm/z3fold.c | 2
mm/zpool.c | 2
mm/zsmalloc.c | 6
samples/configfs/configfs_sample.c | 2
scripts/checkpatch.pl | 15
scripts/gdb/linux/cpus.py | 23
scripts/gdb/linux/symbols.py | 3
scripts/spelling.txt | 3
tools/include/asm-generic/bitops/find.h | 85 ++-
tools/include/asm-generic/bitsperlong.h | 3
tools/include/linux/bitmap.h | 18
tools/lib/bitmap.c | 4
tools/lib/find_bit.c | 56 -
tools/scripts/Makefile.include | 1
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 44 +
tools/testing/selftests/kvm/lib/sparsebit.c | 1
tools/testing/selftests/mincore/mincore_selftest.c | 1
tools/testing/selftests/powerpc/mm/tlbie_test.c | 1
tools/testing/selftests/proc/Makefile | 1
tools/testing/selftests/proc/proc-subset-pid.c | 121 ++++
tools/testing/selftests/proc/read.c | 4
tools/usb/hcd-tests.sh | 2
343 files changed, 1383 insertions(+), 2119 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-05-07 1:01 incoming Andrew Morton
@ 2021-05-07 7:12 ` Linus Torvalds
0 siblings, 0 replies; 419+ messages in thread
From: Linus Torvalds @ 2021-05-07 7:12 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Thu, May 6, 2021 at 6:01 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> I've been wobbly about the secretmem patches due to doubts about
> whether the feature is sufficiently useful to justify inclusion, but
> developers are now weighing in with helpful information and I've asked Mike
> for an extensively updated [0/n] changelog. This will take a few days
> to play out so it is possible that I will prevail upon you for a post-rc1
> merge.
Oh, much too late for this release by now.
> If that's a problem, there's always 5.13-rc1.
5.13-rc1 is two days from now, it would be for 5.14-rc1.. How time -
and version numbers - fly.
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-05-15 0:26 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-05-15 0:26 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
13 patches, based on bd3c9cdb21a2674dd0db70199df884828e37abd4.
Subsystems affected by this patch series:
mm/hugetlb
mm/slub
resource
squashfs
mm/userfaultfd
mm/ksm
mm/pagealloc
mm/kasan
mm/pagemap
hfsplus
modprobe
mm/ioremap
Subsystem: mm/hugetlb
Peter Xu <peterx@redhat.com>:
Patch series "mm/hugetlb: Fix issues on file sealing and fork", v2:
mm/hugetlb: fix F_SEAL_FUTURE_WRITE
mm/hugetlb: fix cow where page writtable in child
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: move slub_debug static key enabling outside slab_mutex
Subsystem: resource
Alistair Popple <apopple@nvidia.com>:
kernel/resource: fix return code check in __request_free_mem_region
Subsystem: squashfs
Phillip Lougher <phillip@squashfs.org.uk>:
squashfs: fix divide error in calculate_skip()
Subsystem: mm/userfaultfd
Axel Rasmussen <axelrasmussen@google.com>:
userfaultfd: release page in error path to avoid BUG_ON
Subsystem: mm/ksm
Hugh Dickins <hughd@google.com>:
ksm: revert "use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()"
Subsystem: mm/pagealloc
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: fix struct page layout on 32-bit systems
Subsystem: mm/kasan
Peter Collingbourne <pcc@google.com>:
kasan: fix unit tests with CONFIG_UBSAN_LOCAL_BOUNDS enabled
Subsystem: mm/pagemap
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap: fix readahead return types
Subsystem: hfsplus
Jouni Roivas <jouni.roivas@tuxera.com>:
hfsplus: prevent corruption in shrinking truncate
Subsystem: modprobe
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
docs: admin-guide: update description for kernel.modprobe sysctl
Subsystem: mm/ioremap
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm/ioremap: fix iomap_max_page_shift
Documentation/admin-guide/sysctl/kernel.rst | 9 ++++---
fs/hfsplus/extents.c | 7 +++--
fs/hugetlbfs/inode.c | 5 ++++
fs/iomap/buffered-io.c | 4 +--
fs/squashfs/file.c | 6 ++--
include/linux/mm.h | 32 ++++++++++++++++++++++++++
include/linux/mm_types.h | 4 +--
include/linux/pagemap.h | 6 ++--
include/net/page_pool.h | 12 +++++++++
kernel/resource.c | 2 -
lib/test_kasan.c | 29 ++++++++++++++++++-----
mm/hugetlb.c | 1
mm/ioremap.c | 6 ++--
mm/ksm.c | 3 +-
mm/shmem.c | 34 ++++++++++++----------------
mm/slab_common.c | 10 ++++++++
mm/slub.c | 9 -------
net/core/page_pool.c | 12 +++++----
18 files changed, 129 insertions(+), 62 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-05-23 0:41 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-05-23 0:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
10 patches, based on 4ff2473bdb4cf2bb7d208ccf4418d3d7e6b1652c.
Subsystems affected by this patch series:
mm/pagealloc
mm/gup
ipc
selftests
mm/kasan
kernel/watchdog
bitmap
procfs
lib
mm/userfaultfd
Subsystem: mm/pagealloc
Arnd Bergmann <arnd@arndb.de>:
mm/shuffle: fix section mismatch warning
Subsystem: mm/gup
Michal Hocko <mhocko@suse.com>:
Revert "mm/gup: check page posion status for coredump."
Subsystem: ipc
Varad Gautam <varad.gautam@suse.com>:
ipc/mqueue, msg, sem: avoid relying on a stack reference past its expiry
Subsystem: selftests
Yang Yingliang <yangyingliang@huawei.com>:
tools/testing/selftests/exec: fix link error
Subsystem: mm/kasan
Alexander Potapenko <glider@google.com>:
kasan: slab: always reset the tag in get_freepointer_safe()
Subsystem: kernel/watchdog
Petr Mladek <pmladek@suse.com>:
watchdog: reliable handling of timestamps
Subsystem: bitmap
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
linux/bits.h: fix compilation error with GENMASK
Subsystem: procfs
Alexey Dobriyan <adobriyan@gmail.com>:
proc: remove Alexey from MAINTAINERS
Subsystem: lib
Zhen Lei <thunder.leizhen@huawei.com>:
lib: kunit: suppress a compilation warning of frame size
Subsystem: mm/userfaultfd
Mike Kravetz <mike.kravetz@oracle.com>:
userfaultfd: hugetlbfs: fix new flag usage in error path
MAINTAINERS | 1 -
fs/hugetlbfs/inode.c | 2 +-
include/linux/bits.h | 2 +-
include/linux/const.h | 8 ++++++++
include/linux/minmax.h | 10 ++--------
ipc/mqueue.c | 6 ++++--
ipc/msg.c | 6 ++++--
ipc/sem.c | 6 ++++--
kernel/watchdog.c | 34 ++++++++++++++++++++--------------
lib/Makefile | 1 +
mm/gup.c | 4 ----
mm/internal.h | 20 --------------------
mm/shuffle.h | 4 ++--
mm/slub.c | 1 +
mm/userfaultfd.c | 28 ++++++++++++++--------------
tools/include/linux/bits.h | 2 +-
tools/include/linux/const.h | 8 ++++++++
tools/testing/selftests/exec/Makefile | 6 +++---
18 files changed, 74 insertions(+), 75 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-06-05 3:00 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-06-05 3:00 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
13 patches, based on 16f0596fc1d78a1f3ae4628cff962bb297dc908c.
Subsystems affected by this patch series:
mips
mm/kfence
init
mm/debug
mm/pagealloc
mm/memory-hotplug
mm/hugetlb
proc
mm/kasan
mm/hugetlb
lib
ocfs2
mailmap
Subsystem: mips
Thomas Bogendoerfer <tsbogend@alpha.franken.de>:
Revert "MIPS: make userspace mapping young by default"
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: use TASK_IDLE when awaiting allocation
Subsystem: init
Mark Rutland <mark.rutland@arm.com>:
pid: take a reference when initializing `cad_pid`
Subsystem: mm/debug
Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
mm/debug_vm_pgtable: fix alignment for pmd/pud_advanced_tests()
Subsystem: mm/pagealloc
Ding Hui <dinghui@sangfor.com.cn>:
mm/page_alloc: fix counting of free pages after take off from buddy
Subsystem: mm/memory-hotplug
David Hildenbrand <david@redhat.com>:
drivers/base/memory: fix trying offlining memory blocks with memory holes on aarch64
Subsystem: mm/hugetlb
Naoya Horiguchi <naoya.horiguchi@nec.com>:
hugetlb: pass head page to remove_hugetlb_page()
Subsystem: proc
David Matlack <dmatlack@google.com>:
proc: add .gitignore for proc-subset-pid selftest
Subsystem: mm/kasan
Yu Kuai <yukuai3@huawei.com>:
mm/kasan/init.c: fix doc warning
Subsystem: mm/hugetlb
Mina Almasry <almasrymina@google.com>:
mm, hugetlb: fix simple resv_huge_pages underflow on UFFDIO_COPY
Subsystem: lib
YueHaibing <yuehaibing@huawei.com>:
lib: crc64: fix kernel-doc warning
Subsystem: ocfs2
Junxiao Bi <junxiao.bi@oracle.com>:
ocfs2: fix data corruption by fallocate
Subsystem: mailmap
Michel Lespinasse <michel@lespinasse.org>:
mailmap: use private address for Michel Lespinasse
.mailmap | 3 +
arch/mips/mm/cache.c | 30 ++++++++---------
drivers/base/memory.c | 6 +--
fs/ocfs2/file.c | 55 +++++++++++++++++++++++++++++---
include/linux/pgtable.h | 8 ++++
init/main.c | 2 -
lib/crc64.c | 2 -
mm/debug_vm_pgtable.c | 4 +-
mm/hugetlb.c | 16 +++++++--
mm/kasan/init.c | 4 +-
mm/kfence/core.c | 6 +--
mm/memory.c | 4 ++
mm/page_alloc.c | 2 +
tools/testing/selftests/proc/.gitignore | 1
14 files changed, 107 insertions(+), 36 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-06-16 1:22 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-06-16 1:22 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
18 patches, based on 94f0b2d4a1d0c52035aef425da5e022bd2cb1c71.
Subsystems affected by this patch series:
mm/memory-failure
mm/swap
mm/slub
mm/hugetlb
mm/memory-failure
coredump
mm/slub
mm/thp
mm/sparsemem
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm,hwpoison: fix race with hugetlb page allocation
Subsystem: mm/swap
Peter Xu <peterx@redhat.com>:
mm/swap: fix pte_same_as_swp() not removing uffd-wp bit when compare
Subsystem: mm/slub
Kees Cook <keescook@chromium.org>:
Patch series "Actually fix freelist pointer vs redzoning", v4:
mm/slub: clarify verification reporting
mm/slub: fix redzoning for small allocations
mm/slub: actually fix freelist pointer vs redzoning
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
mm/hugetlb: expand restore_reserve_on_error functionality
Subsystem: mm/memory-failure
yangerkun <yangerkun@huawei.com>:
mm/memory-failure: make sure wait for page writeback in memory_failure
Subsystem: coredump
Pingfan Liu <kernelfans@gmail.com>:
crash_core, vmcoreinfo: append 'SECTION_SIZE_BITS' to vmcoreinfo
Subsystem: mm/slub
Andrew Morton <akpm@linux-foundation.org>:
mm/slub.c: include swab.h
Subsystem: mm/thp
Xu Yu <xuyu@linux.alibaba.com>:
mm, thp: use head page in __migration_entry_wait()
Hugh Dickins <hughd@google.com>:
Patch series "mm/thp: fix THP splitting unmap BUGs and related", v10:
mm/thp: fix __split_huge_pmd_locked() on shmem migration entry
mm/thp: make is_huge_zero_pmd() safe and quicker
mm/thp: try_to_unmap() use TTU_SYNC for safe splitting
mm/thp: fix vma_address() if virtual address below file offset
Jue Wang <juew@google.com>:
mm/thp: fix page_address_in_vma() on file THP tails
Hugh Dickins <hughd@google.com>:
mm/thp: unmap_mapping_page() to fix THP truncate_cleanup_page()
Yang Shi <shy828301@gmail.com>:
mm: thp: replace DEBUG_VM BUG with VM_WARN when unmap fails for split
Subsystem: mm/sparsemem
Miles Chen <miles.chen@mediatek.com>:
mm/sparse: fix check_usemap_section_nr warnings
Documentation/vm/slub.rst | 10 +--
fs/hugetlbfs/inode.c | 1
include/linux/huge_mm.h | 8 ++
include/linux/hugetlb.h | 8 ++
include/linux/mm.h | 3 +
include/linux/rmap.h | 1
include/linux/swapops.h | 15 +++--
kernel/crash_core.c | 1
mm/huge_memory.c | 58 ++++++++++---------
mm/hugetlb.c | 137 +++++++++++++++++++++++++++++++++++++---------
mm/internal.h | 51 ++++++++++++-----
mm/memory-failure.c | 36 +++++++++++-
mm/memory.c | 41 +++++++++++++
mm/migrate.c | 1
mm/page_vma_mapped.c | 27 +++++----
mm/pgtable-generic.c | 5 -
mm/rmap.c | 41 +++++++++----
mm/slab_common.c | 3 -
mm/slub.c | 37 +++++-------
mm/sparse.c | 13 +++-
mm/swapfile.c | 2
mm/truncate.c | 43 ++++++--------
22 files changed, 388 insertions(+), 154 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-06-25 1:38 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-06-25 1:38 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
24 patches, based on 4a09d388f2ab382f217a764e6a152b3f614246f6.
Subsystems affected by this patch series:
mm/thp
nilfs2
mm/vmalloc
kthread
mm/hugetlb
mm/memory-failure
mm/pagealloc
MAINTAINERS
mailmap
Subsystem: mm/thp
Hugh Dickins <hughd@google.com>:
Patch series "mm: page_vma_mapped_walk() cleanup and THP fixes":
mm: page_vma_mapped_walk(): use page for pvmw->page
mm: page_vma_mapped_walk(): settle PageHuge on entry
mm: page_vma_mapped_walk(): use pmde for *pvmw->pmd
mm: page_vma_mapped_walk(): prettify PVMW_MIGRATION block
mm: page_vma_mapped_walk(): crossing page table boundary
mm: page_vma_mapped_walk(): add a level of indentation
mm: page_vma_mapped_walk(): use goto instead of while (1)
mm: page_vma_mapped_walk(): get vma_address_end() earlier
mm/thp: fix page_vma_mapped_walk() if THP mapped by ptes
mm/thp: another PVMW_SYNC fix in page_vma_mapped_walk()
Subsystem: nilfs2
Pavel Skripkin <paskripkin@gmail.com>:
nilfs2: fix memory leak in nilfs_sysfs_delete_device_group
Subsystem: mm/vmalloc
Claudio Imbrenda <imbrenda@linux.ibm.com>:
Patch series "mm: add vmalloc_no_huge and use it", v4:
mm/vmalloc: add vmalloc_no_huge
KVM: s390: prepare for hugepage vmalloc
Daniel Axtens <dja@axtens.net>:
mm/vmalloc: unbreak kasan vmalloc support
Subsystem: kthread
Petr Mladek <pmladek@suse.com>:
Patch series "kthread_worker: Fix race between kthread_mod_delayed_work():
kthread_worker: split code for canceling the delayed work timer
kthread: prevent deadlock when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync()
Subsystem: mm/hugetlb
Hugh Dickins <hughd@google.com>:
mm, futex: fix shared futex pgoff on shmem huge page
Subsystem: mm/memory-failure
Tony Luck <tony.luck@intel.com>:
Patch series "mm,hwpoison: fix sending SIGBUS for Action Required MCE", v5:
mm/memory-failure: use a mutex to avoid memory_failure() races
Aili Yao <yaoaili@kingsoft.com>:
mm,hwpoison: return -EHWPOISON to denote that the page has already been poisoned
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/hwpoison: do not lock page again when me_huge_page() successfully recovers
Subsystem: mm/pagealloc
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
mm/page_alloc: __alloc_pages_bulk(): do bounds check before accessing array
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: do bulk array bounds check after checking populated elements
Subsystem: MAINTAINERS
Marek Behún <kabel@kernel.org>:
MAINTAINERS: fix Marek's identity again
Subsystem: mailmap
Marek Behún <kabel@kernel.org>:
mailmap: add Marek's other e-mail address and identity without diacritics
.mailmap | 2
MAINTAINERS | 4
arch/s390/kvm/pv.c | 7 +
fs/nilfs2/sysfs.c | 1
include/linux/hugetlb.h | 16 ---
include/linux/pagemap.h | 13 +-
include/linux/vmalloc.h | 1
kernel/futex.c | 3
kernel/kthread.c | 81 ++++++++++------
mm/hugetlb.c | 5 -
mm/memory-failure.c | 83 +++++++++++------
mm/page_alloc.c | 6 +
mm/page_vma_mapped.c | 233 +++++++++++++++++++++++++++---------------------
mm/vmalloc.c | 41 ++++++--
14 files changed, 297 insertions(+), 199 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-06-29 2:32 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-06-29 2:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2.
Subsystems affected by this patch series:
mm/gup
mm/pagealloc
kthread
ia64
scripts
ntfs
squashfs
ocfs2
z
kernel/watchdog
mm/slab
mm/slub
mm/kmemleak
mm/dax
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/mprotect
mm/bootmem
mm/dma
mm/tracing
mm/vmalloc
mm/kasan
mm/initialization
mm/pagealloc
mm/memory-failure
Subsystem: mm/gup
Jann Horn <jannh@google.com>:
mm/gup: fix try_grab_compound_head() race with split_huge_page()
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
mm/page_alloc: fix memory map initialization for descending nodes
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: correct return value of populated elements if bulk array is populated
Subsystem: kthread
Jonathan Neuschäfer <j.neuschaefer@gmx.net>:
kthread: switch to new kerneldoc syntax for named variable macro argument
Petr Mladek <pmladek@suse.com>:
kthread_worker: fix return value when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync()
Subsystem: ia64
Randy Dunlap <rdunlap@infradead.org>:
ia64: headers: drop duplicated words
Arnd Bergmann <arnd@arndb.de>:
ia64: mca_drv: fix incorrect array size calculation
Subsystem: scripts
"Steven Rostedt (VMware)" <rostedt@goodmis.org>:
Patch series "streamline_config.pl: Fix Perl spacing":
streamline_config.pl: make spacing consistent
streamline_config.pl: add softtabstop=4 for vim users
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ntfs
Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>:
ntfs: fix validity check for file name attribute
Subsystem: squashfs
Vincent Whitchurch <vincent.whitchurch@axis.com>:
squashfs: add option to panic on errors
Subsystem: ocfs2
Yang Yingliang <yangyingliang@huawei.com>:
ocfs2: remove unnecessary INIT_LIST_HEAD()
Subsystem: z
Dan Carpenter <dan.carpenter@oracle.com>:
ocfs2: fix snprintf() checking
Colin Ian King <colin.king@canonical.com>:
ocfs2: remove redundant assignment to pointer queue
Wan Jiabing <wanjiabing@vivo.com>:
ocfs2: remove repeated uptodate check for buffer
Chen Huang <chenhuang5@huawei.com>:
ocfs2: replace simple_strtoull() with kstrtoull()
Colin Ian King <colin.king@canonical.com>:
ocfs2: remove redundant initialization of variable ret
Subsystem: kernel/watchdog
Wang Qing <wangqing@vivo.com>:
kernel: watchdog: modify the explanation related to watchdog thread
doc: watchdog: modify the explanation related to watchdog thread
doc: watchdog: modify the doc related to "watchdog/%u"
Subsystem: mm/slab
gumingtao <gumingtao1225@gmail.com>:
slab: use __func__ to trace function name
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
kunit: make test->lock irq safe
Oliver Glitta <glittao@gmail.com>:
mm/slub, kunit: add a KUnit test for SLUB debugging functionality
slub: remove resiliency_test() function
Hyeonggon Yoo <42.hyeyoo@gmail.com>:
mm, slub: change run-time assertion in kmalloc_index() to compile-time
Stephen Boyd <swboyd@chromium.org>:
slub: restore slub_debug=- behavior
slub: actually use 'message' in restore_bytes()
Joe Perches <joe@perches.com>:
slub: indicate slab_fix() uses printf formats
Stephen Boyd <swboyd@chromium.org>:
slub: force on no_hash_pointers when slub_debug is enabled
Faiyaz Mohammed <faiyazm@codeaurora.org>:
mm: slub: move sysfs slab alloc/free interfaces to debugfs
Georgi Djakov <quic_c_gdjako@quicinc.com>:
mm/slub: add taint after the errors are printed
Subsystem: mm/kmemleak
Yanfei Xu <yanfei.xu@windriver.com>:
mm/kmemleak: fix possible wrong memory scanning period
Subsystem: mm/dax
Jan Kara <jack@suse.cz>:
dax: fix ENOMEM handling in grab_mapping_entry()
Subsystem: mm/debug
Tang Bin <tangbin@cmss.chinamobile.com>:
tools/vm/page_owner_sort.c: check malloc() return
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/debug_vm_pgtable: ensure THP availability via has_transparent_hugepage()
Nicolas Saenz Julienne <nsaenzju@redhat.com>:
mm: mmap_lock: use local locks instead of disabling preemption
Gavin Shan <gshan@redhat.com>:
Patch series "mm/page_reporting: Make page reporting work on arm64 with 64KB page size", v4:
mm/page_reporting: fix code style in __page_reporting_request()
mm/page_reporting: export reporting order as module parameter
mm/page_reporting: allow driver to specify reporting order
virtio_balloon: specify page reporting order if needed
Subsystem: mm/pagecache
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: page-writeback: kill get_writeback_state() comments
Chi Wu <wuchi.zero@gmail.com>:
mm/page-writeback: Fix performance when BDI's share of ratio is 0.
mm/page-writeback: update the comment of Dirty position control
mm/page-writeback: use __this_cpu_inc() in account_page_dirtied()
Roman Gushchin <guro@fb.com>:
Patch series "cgroup, blkcg: prevent dirty inodes to pin dying memory cgroups", v9:
writeback, cgroup: do not switch inodes with I_WILL_FREE flag
writeback, cgroup: add smp_mb() to cgroup_writeback_umount()
writeback, cgroup: increment isw_nr_in_flight before grabbing an inode
writeback, cgroup: switch to rcu_work API in inode_switch_wbs()
writeback, cgroup: keep list of inodes attached to bdi_writeback
writeback, cgroup: split out the functional part of inode_switch_wbs_work_fn()
writeback, cgroup: support switching multiple inodes at once
writeback, cgroup: release dying cgwbs by switching attached inodes
Christoph Hellwig <hch@lst.de>:
Patch series "remove the implicit .set_page_dirty default":
fs: unexport __set_page_dirty
fs: move ramfs_aops to libfs
mm: require ->set_page_dirty to be explicitly wired up
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Further set_page_dirty cleanups":
mm/writeback: move __set_page_dirty() to core mm
mm/writeback: use __set_page_dirty in __set_page_dirty_nobuffers
iomap: use __set_page_dirty_nobuffers
fs: remove anon_set_page_dirty()
fs: remove noop_set_page_dirty()
mm: move page dirtying prototypes from mm.h
Subsystem: mm/gup
Peter Xu <peterx@redhat.com>:
Patch series "mm/gup: Fix pin page write cache bouncing on has_pinned", v2:
mm/gup_benchmark: support threading
Andrea Arcangeli <aarcange@redhat.com>:
mm: gup: allow FOLL_PIN to scale in SMP
mm: gup: pack has_pinned in MMF_HAS_PINNED
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm: pagewalk: fix walk for hugepage tables
Subsystem: mm/swap
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "close various race windows for swap", v6:
mm/swapfile: use percpu_ref to serialize against concurrent swapoff
swap: fix do_swap_page() race with swapoff
mm/swap: remove confusing checking for non_swap_entry() in swap_ra_info()
mm/shmem: fix shmem_swapin() race with swapoff
Patch series "Cleanups for swap", v2:
mm/swapfile: move get_swap_page_of_type() under CONFIG_HIBERNATION
mm/swap: remove unused local variable nr_shadows
mm/swap_slots.c: delete meaningless forward declarations
Huang Ying <ying.huang@intel.com>:
mm, swap: remove unnecessary smp_rmb() in swap_type_to_swap_info()
mm: free idle swap cache page after COW
swap: check mapping_empty() for swap cache before being freed
Subsystem: mm/memcg
Waiman Long <longman@redhat.com>:
Patch series "mm/memcg: Reduce kmemcache memory accounting overhead", v6:
mm/memcg: move mod_objcg_state() to memcontrol.c
mm/memcg: cache vmstat data in percpu memcg_stock_pcp
mm/memcg: improve refill_obj_stock() performance
mm/memcg: optimize user context object stock access
Patch series "mm: memcg/slab: Fix objcg pointer array handling problem", v4:
mm: memcg/slab: properly set up gfp flags for objcg pointer array
mm: memcg/slab: create a new set of kmalloc-cg-<n> caches
mm: memcg/slab: disable cache merging for KMALLOC_NORMAL caches
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: fix root_mem_cgroup charging
Patch series "memcontrol code cleanup and simplification", v3:
mm: memcontrol: fix page charging in page replacement
mm: memcontrol: bail out early when !mm in get_mem_cgroup_from_mm
mm: memcontrol: remove the pgdata parameter of mem_cgroup_page_lruvec
mm: memcontrol: simplify lruvec_holds_page_lru_lock
mm: memcontrol: rename lruvec_holds_page_lru_lock to page_matches_lruvec
mm: memcontrol: simplify the logic of objcg pinning memcg
mm: memcontrol: move obj_cgroup_uncharge_pages() out of css_set_lock
mm: vmscan: remove noinline_for_stack
wenhuizhang <wenhui@gwmail.gwu.edu>:
memcontrol: use flexible-array member
Dan Schatzberg <schatzberg.dan@gmail.com>:
Patch series "Charge loop device i/o to issuing cgroup", v14:
loop: use worker per cgroup instead of kworker
mm: charge active memcg when no mm is set
loop: charge i/o to mem and blk cg
Huilong Deng <denghuilong@cdjrlc.com>:
mm: memcontrol: remove trailing semicolon in macros
Subsystem: mm/pagemap
David Hildenbrand <david@redhat.com>:
Patch series "perf/binfmt/mm: remove in-tree usage of MAP_EXECUTABLE":
perf: MAP_EXECUTABLE does not indicate VM_MAYEXEC
binfmt: remove in-tree usage of MAP_EXECUTABLE
mm: ignore MAP_EXECUTABLE in ksys_mmap_pgoff()
Gonzalo Matias Juarez Tello <gmjuareztello@gmail.com>:
mm/mmap.c: logic of find_vma_intersection repeated in __do_munmap
Liam Howlett <liam.howlett@oracle.com>:
mm/mmap: introduce unlock_range() for code cleanup
mm/mmap: use find_vma_intersection() in do_mmap() for overlap
Liu Xiang <liu.xiang@zlingsmart.com>:
mm/memory.c: fix comment of finish_mkwrite_fault()
Liam Howlett <liam.howlett@oracle.com>:
Patch series "mm: Add vma_lookup()", v2:
mm: add vma_lookup(), update find_vma_intersection() comments
drm/i915/selftests: use vma_lookup() in __igt_mmap()
arch/arc/kernel/troubleshoot: use vma_lookup() instead of find_vma()
arch/arm64/kvm: use vma_lookup() instead of find_vma_intersection()
arch/powerpc/kvm/book3s_hv_uvmem: use vma_lookup() instead of find_vma_intersection()
arch/powerpc/kvm/book3s: use vma_lookup() in kvmppc_hv_setup_htab_rma()
arch/mips/kernel/traps: use vma_lookup() instead of find_vma()
arch/m68k/kernel/sys_m68k: use vma_lookup() in sys_cacheflush()
x86/sgx: use vma_lookup() in sgx_encl_find()
virt/kvm: use vma_lookup() instead of find_vma_intersection()
vfio: use vma_lookup() instead of find_vma_intersection()
net/ipv5/tcp: use vma_lookup() in tcp_zerocopy_receive()
drm/amdgpu: use vma_lookup() in amdgpu_ttm_tt_get_user_pages()
media: videobuf2: use vma_lookup() in get_vaddr_frames()
misc/sgi-gru/grufault: use vma_lookup() in gru_find_vma()
kernel/events/uprobes: use vma_lookup() in find_active_uprobe()
lib/test_hmm: use vma_lookup() in dmirror_migrate()
mm/ksm: use vma_lookup() in find_mergeable_vma()
mm/migrate: use vma_lookup() in do_pages_stat_array()
mm/mremap: use vma_lookup() in vma_to_resize()
mm/memory.c: use vma_lookup() in __access_remote_vm()
mm/mempolicy: use vma_lookup() in __access_remote_vm()
Chen Li <chenli@uniontech.com>:
mm: update legacy flush_tlb_* to use vma
Subsystem: mm/mprotect
Peter Collingbourne <pcc@google.com>:
mm: improve mprotect(R|W) efficiency on pages referenced once
Subsystem: mm/bootmem
Souptick Joarder <jrdr.linux@gmail.com>:
h8300: remove unused variable
Subsystem: mm/dma
YueHaibing <yuehaibing@huawei.com>:
mm/dmapool: use DEVICE_ATTR_RO macro
Subsystem: mm/tracing
Vincent Whitchurch <vincent.whitchurch@axis.com>:
mm, tracing: unify PFN format strings
Subsystem: mm/vmalloc
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
Patch series "vmalloc() vs bulk allocator", v2:
mm/page_alloc: add an alloc_pages_bulk_array_node() helper
mm/vmalloc: switch to bulk allocator in __vmalloc_area_node()
mm/vmalloc: print a warning message first on failure
mm/vmalloc: remove quoted strings split across lines
Uladzislau Rezki <urezki@gmail.com>:
mm/vmalloc: fallback to a single page allocator
Rafael Aquini <aquini@redhat.com>:
mm: vmalloc: add cond_resched() in __vunmap()
Subsystem: mm/kasan
Alexander Potapenko <glider@google.com>:
printk: introduce dump_stack_lvl()
kasan: use dump_stack_lvl(KERN_ERR) to print stacks
David Gow <davidgow@google.com>:
kasan: test: improve failure message in KUNIT_EXPECT_KASAN_FAIL()
Daniel Axtens <dja@axtens.net>:
Patch series "KASAN core changes for ppc64 radix KASAN", v16:
kasan: allow an architecture to disable inline instrumentation
kasan: allow architectures to provide an outline readiness check
mm: define default MAX_PTRS_PER_* in include/pgtable.h
kasan: use MAX_PTRS_PER_* for early shadow tables
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
Patch series "kasan: add memory corruption identification support for hw tag-based kasan", v4:
kasan: rename CONFIG_KASAN_SW_TAGS_IDENTIFY to CONFIG_KASAN_TAGS_IDENTIFY
kasan: integrate the common part of two KASAN tag-based modes
kasan: add memory corruption identification support for hardware tag-based mode
Subsystem: mm/initialization
Jungseung Lee <js07.lee@samsung.com>:
mm: report which part of mem is being freed on initmem case
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
mm/mmzone.h: simplify is_highmem_idx()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Constify struct page arguments":
mm: make __dump_page static
Aaron Tomlin <atomlin@redhat.com>:
mm/page_alloc: bail out on fatal signal during reclaim/compaction retry attempt
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/debug: factor PagePoisoned out of __dump_page
mm/page_owner: constify dump_page_owner
mm: make compound_head const-preserving
mm: constify get_pfnblock_flags_mask and get_pfnblock_migratetype
mm: constify page_count and page_ref_count
mm: optimise nth_page for contiguous memmap
Heiner Kallweit <hkallweit1@gmail.com>:
mm/page_alloc: switch to pr_debug
Andrii Nakryiko <andrii@kernel.org>:
kbuild: skip per-CPU BTF generation for pahole v1.18-v1.21
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: split per cpu page lists and zone stats
mm/page_alloc: convert per-cpu list protection to local_lock
mm/vmstat: convert NUMA statistics to basic NUMA counters
mm/vmstat: inline NUMA event counter updates
mm/page_alloc: batch the accounting updates in the bulk allocator
mm/page_alloc: reduce duration that IRQs are disabled for VM counters
mm/page_alloc: explicitly acquire the zone lock in __free_pages_ok
mm/page_alloc: avoid conflating IRQs disabled with zone->lock
mm/page_alloc: update PGFREE outside the zone lock in __free_pages_ok
Minchan Kim <minchan@kernel.org>:
mm: page_alloc: dump migrate-failed pages only at -EBUSY
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Calculate pcp->high based on zone sizes and active CPUs", v2:
mm/page_alloc: delete vm.percpu_pagelist_fraction
mm/page_alloc: disassociate the pcp->high from pcp->batch
mm/page_alloc: adjust pcp->high after CPU hotplug events
mm/page_alloc: scale the number of pages that are batch freed
mm/page_alloc: limit the number of pages on PCP lists when reclaim is active
mm/page_alloc: introduce vm.percpu_pagelist_high_fraction
Dong Aisheng <aisheng.dong@nxp.com>:
mm: drop SECTION_SHIFT in code comments
mm/page_alloc: improve memmap_pages dbg msg
Liu Shixin <liushixin2@huawei.com>:
mm/page_alloc: fix counting of managed_pages
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Allow high order pages to be stored on PCP", v2:
mm/page_alloc: move free_the_page
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "Remove DISCONTIGMEM memory model", v3:
alpha: remove DISCONTIGMEM and NUMA
arc: update comment about HIGHMEM implementation
arc: remove support for DISCONTIGMEM
m68k: remove support for DISCONTIGMEM
mm: remove CONFIG_DISCONTIGMEM
arch, mm: remove stale mentions of DISCONIGMEM
docs: remove description of DISCONTIGMEM
mm: replace CONFIG_NEED_MULTIPLE_NODES with CONFIG_NUMA
mm: replace CONFIG_FLAT_NODE_MEM_MAP with CONFIG_FLATMEM
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: allow high-order pages to be stored on the per-cpu lists
mm/page_alloc: split pcp->high across all online CPUs for cpuless nodes
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm,hwpoison: send SIGBUS with error virutal address
mm,hwpoison: make get_hwpoison_page() call get_any_page()
Documentation/admin-guide/kernel-parameters.txt | 6
Documentation/admin-guide/lockup-watchdogs.rst | 4
Documentation/admin-guide/sysctl/kernel.rst | 10
Documentation/admin-guide/sysctl/vm.rst | 52 -
Documentation/dev-tools/kasan.rst | 9
Documentation/vm/memory-model.rst | 45
arch/alpha/Kconfig | 22
arch/alpha/include/asm/machvec.h | 6
arch/alpha/include/asm/mmzone.h | 100 --
arch/alpha/include/asm/pgtable.h | 4
arch/alpha/include/asm/topology.h | 39
arch/alpha/kernel/core_marvel.c | 53 -
arch/alpha/kernel/core_wildfire.c | 29
arch/alpha/kernel/pci_iommu.c | 29
arch/alpha/kernel/proto.h | 8
arch/alpha/kernel/setup.c | 16
arch/alpha/kernel/sys_marvel.c | 5
arch/alpha/kernel/sys_wildfire.c | 5
arch/alpha/mm/Makefile | 2
arch/alpha/mm/init.c | 3
arch/alpha/mm/numa.c | 223 ----
arch/arc/Kconfig | 13
arch/arc/include/asm/mmzone.h | 40
arch/arc/kernel/troubleshoot.c | 8
arch/arc/mm/init.c | 21
arch/arm/include/asm/tlbflush.h | 13
arch/arm/mm/tlb-v6.S | 2
arch/arm/mm/tlb-v7.S | 2
arch/arm64/Kconfig | 2
arch/arm64/kvm/mmu.c | 2
arch/h8300/kernel/setup.c | 2
arch/ia64/Kconfig | 2
arch/ia64/include/asm/pal.h | 2
arch/ia64/include/asm/spinlock.h | 2
arch/ia64/include/asm/uv/uv_hub.h | 2
arch/ia64/kernel/efi_stub.S | 2
arch/ia64/kernel/mca_drv.c | 2
arch/ia64/kernel/topology.c | 5
arch/ia64/mm/numa.c | 5
arch/m68k/Kconfig.cpu | 10
arch/m68k/include/asm/mmzone.h | 10
arch/m68k/include/asm/page.h | 2
arch/m68k/include/asm/page_mm.h | 35
arch/m68k/include/asm/tlbflush.h | 2
arch/m68k/kernel/sys_m68k.c | 4
arch/m68k/mm/init.c | 20
arch/mips/Kconfig | 2
arch/mips/include/asm/mmzone.h | 8
arch/mips/include/asm/page.h | 2
arch/mips/kernel/traps.c | 4
arch/mips/mm/init.c | 7
arch/nds32/include/asm/memory.h | 6
arch/openrisc/include/asm/tlbflush.h | 2
arch/powerpc/Kconfig | 2
arch/powerpc/include/asm/mmzone.h | 4
arch/powerpc/kernel/setup_64.c | 2
arch/powerpc/kernel/smp.c | 2
arch/powerpc/kexec/core.c | 4
arch/powerpc/kvm/book3s_hv.c | 4
arch/powerpc/kvm/book3s_hv_uvmem.c | 2
arch/powerpc/mm/Makefile | 2
arch/powerpc/mm/mem.c | 4
arch/riscv/Kconfig | 2
arch/s390/Kconfig | 2
arch/s390/include/asm/pgtable.h | 2
arch/sh/include/asm/mmzone.h | 4
arch/sh/kernel/topology.c | 2
arch/sh/mm/Kconfig | 2
arch/sh/mm/init.c | 2
arch/sparc/Kconfig | 2
arch/sparc/include/asm/mmzone.h | 4
arch/sparc/kernel/smp_64.c | 2
arch/sparc/mm/init_64.c | 12
arch/x86/Kconfig | 2
arch/x86/ia32/ia32_aout.c | 4
arch/x86/kernel/cpu/mce/core.c | 13
arch/x86/kernel/cpu/sgx/encl.h | 4
arch/x86/kernel/setup_percpu.c | 6
arch/x86/mm/init_32.c | 4
arch/xtensa/include/asm/page.h | 4
arch/xtensa/include/asm/tlbflush.h | 4
drivers/base/node.c | 18
drivers/block/loop.c | 270 ++++-
drivers/block/loop.h | 15
drivers/dax/device.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c | 4
drivers/gpu/drm/i915/gem/selftests/i915_gem_mman.c | 2
drivers/media/common/videobuf2/frame_vector.c | 2
drivers/misc/sgi-gru/grufault.c | 4
drivers/vfio/vfio_iommu_type1.c | 2
drivers/virtio/virtio_balloon.c | 17
fs/adfs/inode.c | 1
fs/affs/file.c | 2
fs/bfs/file.c | 1
fs/binfmt_aout.c | 4
fs/binfmt_elf.c | 2
fs/binfmt_elf_fdpic.c | 11
fs/binfmt_flat.c | 2
fs/block_dev.c | 1
fs/buffer.c | 25
fs/configfs/inode.c | 8
fs/dax.c | 3
fs/ecryptfs/mmap.c | 13
fs/exfat/inode.c | 1
fs/ext2/inode.c | 4
fs/ext4/inode.c | 2
fs/fat/inode.c | 1
fs/fs-writeback.c | 366 +++++---
fs/fuse/dax.c | 3
fs/gfs2/aops.c | 2
fs/gfs2/meta_io.c | 2
fs/hfs/inode.c | 2
fs/hfsplus/inode.c | 2
fs/hpfs/file.c | 1
fs/iomap/buffered-io.c | 27
fs/jfs/inode.c | 1
fs/kernfs/inode.c | 8
fs/libfs.c | 44
fs/minix/inode.c | 1
fs/nilfs2/mdt.c | 1
fs/ntfs/inode.c | 2
fs/ocfs2/aops.c | 4
fs/ocfs2/cluster/heartbeat.c | 7
fs/ocfs2/cluster/nodemanager.c | 2
fs/ocfs2/dlm/dlmmaster.c | 2
fs/ocfs2/filecheck.c | 6
fs/ocfs2/stackglue.c | 8
fs/omfs/file.c | 1
fs/proc/task_mmu.c | 2
fs/ramfs/inode.c | 9
fs/squashfs/block.c | 5
fs/squashfs/squashfs_fs_sb.h | 1
fs/squashfs/super.c | 86 +
fs/sysv/itree.c | 1
fs/udf/file.c | 1
fs/udf/inode.c | 1
fs/ufs/inode.c | 1
fs/xfs/xfs_aops.c | 4
fs/zonefs/super.c | 4
include/asm-generic/memory_model.h | 37
include/asm-generic/pgtable-nop4d.h | 1
include/asm-generic/topology.h | 2
include/kunit/test.h | 5
include/linux/backing-dev-defs.h | 20
include/linux/cpuhotplug.h | 2
include/linux/fs.h | 6
include/linux/gfp.h | 13
include/linux/iomap.h | 1
include/linux/kasan.h | 7
include/linux/kernel.h | 2
include/linux/kthread.h | 2
include/linux/memblock.h | 6
include/linux/memcontrol.h | 60 -
include/linux/mm.h | 53 -
include/linux/mm_types.h | 10
include/linux/mman.h | 2
include/linux/mmdebug.h | 3
include/linux/mmzone.h | 96 +-
include/linux/page-flags.h | 10
include/linux/page_owner.h | 6
include/linux/page_ref.h | 4
include/linux/page_reporting.h | 3
include/linux/pageblock-flags.h | 2
include/linux/pagemap.h | 4
include/linux/pgtable.h | 22
include/linux/printk.h | 5
include/linux/sched/coredump.h | 8
include/linux/slab.h | 59 +
include/linux/swap.h | 19
include/linux/swapops.h | 5
include/linux/vmstat.h | 69 -
include/linux/writeback.h | 1
include/trace/events/cma.h | 4
include/trace/events/filemap.h | 2
include/trace/events/kmem.h | 12
include/trace/events/page_pool.h | 4
include/trace/events/pagemap.h | 4
include/trace/events/vmscan.h | 2
kernel/cgroup/cgroup.c | 1
kernel/crash_core.c | 4
kernel/events/core.c | 2
kernel/events/uprobes.c | 4
kernel/fork.c | 1
kernel/kthread.c | 19
kernel/sysctl.c | 16
kernel/watchdog.c | 12
lib/Kconfig.debug | 15
lib/Kconfig.kasan | 16
lib/Makefile | 1
lib/dump_stack.c | 20
lib/kunit/test.c | 18
lib/slub_kunit.c | 152 +++
lib/test_hmm.c | 5
lib/test_kasan.c | 11
lib/vsprintf.c | 2
mm/Kconfig | 38
mm/backing-dev.c | 66 +
mm/compaction.c | 2
mm/debug.c | 27
mm/debug_vm_pgtable.c | 63 +
mm/dmapool.c | 5
mm/filemap.c | 2
mm/gup.c | 81 +
mm/hugetlb.c | 2
mm/internal.h | 9
mm/kasan/Makefile | 4
mm/kasan/common.c | 6
mm/kasan/generic.c | 3
mm/kasan/hw_tags.c | 22
mm/kasan/init.c | 6
mm/kasan/kasan.h | 12
mm/kasan/report.c | 6
mm/kasan/report_hw_tags.c | 5
mm/kasan/report_sw_tags.c | 45
mm/kasan/report_tags.c | 51 +
mm/kasan/shadow.c | 6
mm/kasan/sw_tags.c | 45
mm/kasan/tags.c | 59 +
mm/kfence/kfence_test.c | 5
mm/kmemleak.c | 18
mm/ksm.c | 6
mm/memblock.c | 8
mm/memcontrol.c | 385 ++++++--
mm/memory-failure.c | 344 +++++--
mm/memory.c | 22
mm/memory_hotplug.c | 6
mm/mempolicy.c | 4
mm/migrate.c | 4
mm/mmap.c | 54 -
mm/mmap_lock.c | 33
mm/mprotect.c | 52 +
mm/mremap.c | 5
mm/nommu.c | 2
mm/page-writeback.c | 89 +
mm/page_alloc.c | 950 +++++++++++++--------
mm/page_ext.c | 2
mm/page_owner.c | 2
mm/page_reporting.c | 19
mm/page_reporting.h | 5
mm/pagewalk.c | 58 +
mm/shmem.c | 18
mm/slab.h | 24
mm/slab_common.c | 60 -
mm/slub.c | 420 +++++----
mm/sparse.c | 2
mm/swap.c | 4
mm/swap_slots.c | 2
mm/swap_state.c | 20
mm/swapfile.c | 177 +--
mm/vmalloc.c | 181 ++--
mm/vmscan.c | 43
mm/vmstat.c | 282 ++----
mm/workingset.c | 2
net/ipv4/tcp.c | 4
scripts/kconfig/streamline_config.pl | 76 -
scripts/link-vmlinux.sh | 4
scripts/spelling.txt | 16
tools/testing/selftests/vm/gup_test.c | 96 +-
tools/vm/page_owner_sort.c | 4
virt/kvm/kvm_main.c | 2
260 files changed, 3989 insertions(+), 2996 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-07-01 1:46 Andrew Morton
2021-07-03 0:28 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2021-07-01 1:46 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
This is the rest of the -mm tree, less 66 patches which are dependent on
things which are (or were recently) in linux-next. I'll trickle that
material over next week.
192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2 plus the
June 28 sendings.
Subsystems affected by this patch series:
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/kconfig
mm/proc
mm/z3fold
mm/zbud
mm/ras
mm/mempolicy
mm/memblock
mm/migration
mm/thp
mm/nommu
mm/kconfig
mm/madvise
mm/memory-hotplug
mm/zswap
mm/zsmalloc
mm/zram
mm/cleanups
mm/kfence
mm/hmm
procfs
sysctl
misc
core-kernel
lib
lz4
checkpatch
init
kprobes
nilfs2
hfs
signals
exec
kcov
selftests
compress/decompress
ipc
Subsystem: mm/hugetlb
Muchun Song <songmuchun@bytedance.com>:
Patch series "Free some vmemmap pages of HugeTLB page", v23:
mm: memory_hotplug: factor out bootmem core functions to bootmem_info.c
mm: hugetlb: introduce a new config HUGETLB_PAGE_FREE_VMEMMAP
mm: hugetlb: gather discrete indexes of tail page
mm: hugetlb: free the vmemmap pages associated with each HugeTLB page
mm: hugetlb: defer freeing of HugeTLB pages
mm: hugetlb: alloc the vmemmap pages associated with each HugeTLB page
mm: hugetlb: add a kernel parameter hugetlb_free_vmemmap
mm: memory_hotplug: disable memmap_on_memory when hugetlb_free_vmemmap enabled
mm: hugetlb: introduce nr_free_vmemmap_pages in the struct hstate
Shixin Liu <liushixin2@huawei.com>:
mm/debug_vm_pgtable: move {pmd/pud}_huge_tests out of CONFIG_TRANSPARENT_HUGEPAGE
mm/debug_vm_pgtable: remove redundant pfn_{pmd/pte}() and fix one comment mistake
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for huge_memory:, v3:
mm/huge_memory.c: remove dedicated macro HPAGE_CACHE_INDEX_MASK
mm/huge_memory.c: use page->deferred_list
mm/huge_memory.c: add missing read-only THP checking in transparent_hugepage_enabled()
mm/huge_memory.c: remove unnecessary tlb_remove_page_size() for huge zero pmd
mm/huge_memory.c: don't discard hugepage if other processes are mapping it
Christophe Leroy <christophe.leroy@csgroup.eu>:
Patch series "Subject: [PATCH v2 0/5] Implement huge VMAP and VMALLOC on powerpc 8xx", v2:
mm/hugetlb: change parameters of arch_make_huge_pte()
mm/pgtable: add stubs for {pmd/pub}_{set/clear}_huge
mm/vmalloc: enable mapping of huge pages at pte level in vmap
mm/vmalloc: enable mapping of huge pages at pte level in vmalloc
powerpc/8xx: add support for huge pages on VMAP and VMALLOC
Nanyong Sun <sunnanyong@huawei.com>:
khugepaged: selftests: remove debug_cow
Mina Almasry <almasrymina@google.com>:
mm, hugetlb: fix racy resv_huge_pages underflow on UFFDIO_COPY
Muchun Song <songmuchun@bytedance.com>:
Patch series "Split huge PMD mapping of vmemmap pages", v4:
mm: sparsemem: split the huge PMD mapping of vmemmap pages
mm: sparsemem: use huge PMD mapping for vmemmap pages
mm: hugetlb: introduce CONFIG_HUGETLB_PAGE_FREE_VMEMMAP_DEFAULT_ON
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "Fix prep_compound_gigantic_page ref count adjustment":
hugetlb: remove prep_compound_huge_page cleanup
hugetlb: address ref count racing in prep_compound_gigantic_page
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/hwpoison: disable pcp for page_handle_poison()
Subsystem: mm/userfaultfd
Peter Xu <peterx@redhat.com>:
Patch series "userfaultfd/selftests: A few cleanups", v2:
userfaultfd/selftests: use user mode only
userfaultfd/selftests: remove the time() check on delayed uffd
userfaultfd/selftests: dropping VERIFY check in locking_thread
userfaultfd/selftests: only dump counts if mode enabled
userfaultfd/selftests: unify error handling
Patch series "mm/uffd: Misc fix for uffd-wp and one more test":
mm/thp: simplify copying of huge zero page pmd when fork
mm/userfaultfd: fix uffd-wp special cases for fork()
mm/userfaultfd: fail uffd-wp registration if not supported
mm/pagemap: export uffd-wp protection information
userfaultfd/selftests: add pagemap uffd-wp test
Axel Rasmussen <axelrasmussen@google.com>:
Patch series "userfaultfd: add minor fault handling for shmem", v6:
userfaultfd/shmem: combine shmem_{mcopy_atomic,mfill_zeropage}_pte
userfaultfd/shmem: support minor fault registration for shmem
userfaultfd/shmem: support UFFDIO_CONTINUE for shmem
userfaultfd/shmem: advertise shmem minor fault support
userfaultfd/shmem: modify shmem_mfill_atomic_pte to use install_pte()
userfaultfd/selftests: use memfd_create for shmem test type
userfaultfd/selftests: create alias mappings in the shmem test
userfaultfd/selftests: reinitialize test context in each test
userfaultfd/selftests: exercise minor fault handling shmem support
Subsystem: mm/vmscan
Yu Zhao <yuzhao@google.com>:
mm/vmscan.c: fix potential deadlock in reclaim_pages()
include/trace/events/vmscan.h: remove mm_vmscan_inactive_list_is_low
Miaohe Lin <linmiaohe@huawei.com>:
mm: workingset: define macro WORKINGSET_SHIFT
Subsystem: mm/kconfig
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm/kconfig: move HOLES_IN_ZONE into mm
Subsystem: mm/proc
Mike Rapoport <rppt@linux.ibm.com>:
docs: proc.rst: meminfo: briefly describe gaps in memory accounting
David Hildenbrand <david@redhat.com>:
Patch series "fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages", v3:
fs/proc/kcore: drop KCORE_REMAP and KCORE_OTHER
fs/proc/kcore: pfn_is_ram check only applies to KCORE_RAM
fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages
mm: introduce page_offline_(begin|end|freeze|thaw) to synchronize setting PageOffline()
virtio-mem: use page_offline_(start|end) when setting PageOffline()
fs/proc/kcore: use page_offline_(freeze|thaw)
Subsystem: mm/z3fold
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for z3fold":
mm/z3fold: define macro NCHUNKS as TOTAL_CHUNKS - ZHDR_CHUNKS
mm/z3fold: avoid possible underflow in z3fold_alloc()
mm/z3fold: remove magic number in z3fold_create_pool()
mm/z3fold: remove unused function handle_to_z3fold_header()
mm/z3fold: fix potential memory leak in z3fold_destroy_pool()
mm/z3fold: use release_z3fold_page_locked() to release locked z3fold page
Subsystem: mm/zbud
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups for zbud", v2:
mm/zbud: reuse unbuddied[0] as buddied in zbud_pool
mm/zbud: don't export any zbud API
Subsystem: mm/ras
YueHaibing <yuehaibing@huawei.com>:
mm/compaction: use DEVICE_ATTR_WO macro
Liu Xiang <liu.xiang@zlingsmart.com>:
mm: compaction: remove duplicate !list_empty(&sublist) check
Wonhyuk Yang <vvghjk1234@gmail.com>:
mm/compaction: fix 'limit' in fast_isolate_freepages
Subsystem: mm/mempolicy
Feng Tang <feng.tang@intel.com>:
Patch series "mm/mempolicy: some fix and semantics cleanup", v4:
mm/mempolicy: cleanup nodemask intersection check for oom
mm/mempolicy: don't handle MPOL_LOCAL like a fake MPOL_PREFERRED policy
mm/mempolicy: unify the parameter sanity check for mbind and set_mempolicy
Yang Shi <shy828301@gmail.com>:
mm: mempolicy: don't have to split pmd for huge zero page
Ben Widawsky <ben.widawsky@intel.com>:
mm/mempolicy: use unified 'nodes' for bind/interleave/prefer policies
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "arm64: drop pfn_valid_within() and simplify pfn_valid()", v4:
include/linux/mmzone.h: add documentation for pfn_valid()
memblock: update initialization of reserved pages
arm64: decouple check whether pfn is in linear map from pfn_valid()
arm64: drop pfn_valid_within() and simplify pfn_valid()
Anshuman Khandual <anshuman.khandual@arm.com>:
arm64/mm: drop HAVE_ARCH_PFN_VALID
Subsystem: mm/migration
Muchun Song <songmuchun@bytedance.com>:
mm: migrate: fix missing update page_private to hugetlb_page_subpool
Subsystem: mm/thp
Collin Fijalkovich <cfijalkovich@google.com>:
mm, thp: relax the VM_DENYWRITE constraint on file-backed THPs
Yang Shi <shy828301@gmail.com>:
mm: memory: add orig_pmd to struct vm_fault
mm: memory: make numa_migrate_prep() non-static
mm: thp: refactor NUMA fault handling
mm: migrate: account THP NUMA migration counters correctly
mm: migrate: don't split THP for misplaced NUMA page
mm: migrate: check mapcount for THP instead of refcount
mm: thp: skip make PMD PROT_NONE if THP migration is not supported
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/thp: make ARCH_ENABLE_SPLIT_PMD_PTLOCK dependent on PGTABLE_LEVELS > 2
Yang Shi <shy828301@gmail.com>:
mm: rmap: make try_to_unmap() void function
Hugh Dickins <hughd@google.com>:
mm/thp: remap_page() is only needed on anonymous THP
mm: hwpoison_user_mappings() try_to_unmap() with TTU_SYNC
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/thp: fix strncpy warning
Subsystem: mm/nommu
Chen Li <chenli@uniontech.com>:
nommu: remove __GFP_HIGHMEM in vmalloc/vzalloc
Liam Howlett <liam.howlett@oracle.com>:
mm/nommu: unexport do_munmap()
Subsystem: mm/kconfig
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: generalize ZONE_[DMA|DMA32]
Subsystem: mm/madvise
David Hildenbrand <david@redhat.com>:
Patch series "mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables", v2:
mm: make variable names for populate_vma_page_range() consistent
mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables
MAINTAINERS: add tools/testing/selftests/vm/ to MEMORY MANAGEMENT
selftests/vm: add protection_keys_32 / protection_keys_64 to gitignore
selftests/vm: add test for MADV_POPULATE_(READ|WRITE)
Subsystem: mm/memory-hotplug
Liam Mark <lmark@codeaurora.org>:
mm/memory_hotplug: rate limit page migration warnings
Oscar Salvador <osalvador@suse.de>:
mm,memory_hotplug: drop unneeded locking
Subsystem: mm/zswap
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for zswap":
mm/zswap.c: remove unused function zswap_debugfs_exit()
mm/zswap.c: avoid unnecessary copy-in at map time
mm/zswap.c: fix two bugs in zswap_writeback_entry()
Subsystem: mm/zsmalloc
Zhaoyang Huang <zhaoyang.huang@unisoc.com>:
mm: zram: amend SLAB_RECLAIM_ACCOUNT on zspage_cachep
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup for zsmalloc":
mm/zsmalloc.c: remove confusing code in obj_free()
mm/zsmalloc.c: improve readability for async_free_zspage()
Subsystem: mm/zram
Yue Hu <huyue2@yulong.com>:
zram: move backing_dev under macro CONFIG_ZRAM_WRITEBACK
Subsystem: mm/cleanups
Hyeonggon Yoo <42.hyeyoo@gmail.com>:
mm: fix typos and grammar error in comments
Anshuman Khandual <anshuman.khandual@arm.com>:
mm: define default value for FIRST_USER_ADDRESS
Zhen Lei <thunder.leizhen@huawei.com>:
mm: fix spelling mistakes
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Clean W=1 build warnings for mm/":
mm/vmscan: remove kerneldoc-like comment from isolate_lru_pages
mm/vmalloc: include header for prototype of set_iounmap_nonlazy
mm/page_alloc: make should_fail_alloc_page() static
mm/mapping_dirty_helpers: remove double Note in kerneldoc
mm/memcontrol.c: fix kerneldoc comment for mem_cgroup_calculate_protection
mm/memory_hotplug: fix kerneldoc comment for __try_online_node
mm/memory_hotplug: fix kerneldoc comment for __remove_memory
mm/zbud: add kerneldoc fields for zbud_pool
mm/z3fold: add kerneldoc fields for z3fold_pool
mm/swap: make swap_address_space an inline function
mm/mmap_lock: remove dead code for !CONFIG_TRACING configurations
mm/page_alloc: move prototype for find_suitable_fallback
mm/swap: make NODE_DATA an inline function on CONFIG_FLATMEM
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/thp: define default pmd_pgtable()
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: unconditionally use unbound work queue
Subsystem: mm/hmm
Alistair Popple <apopple@nvidia.com>:
Patch series "Add support for SVM atomics in Nouveau", v11:
mm: remove special swap entry functions
mm/swapops: rework swap entry manipulation code
mm/rmap: split try_to_munlock from try_to_unmap
mm/rmap: split migration into its own function
mm: rename migrate_pgmap_owner
mm/memory.c: allow different return codes for copy_nonpresent_pte()
mm: device exclusive memory access
mm: selftests for exclusive device memory
nouveau/svm: refactor nouveau_range_fault
nouveau/svm: implement atomic SVM access
Subsystem: procfs
Marcelo Henrique Cerri <marcelo.cerri@canonical.com>:
proc: Avoid mixing integer types in mem_rw()
ZHOUFENG <zhoufeng.zf@bytedance.com>:
fs/proc/kcore.c: add mmap interface
Kalesh Singh <kaleshsingh@google.com>:
procfs: allow reading fdinfo with PTRACE_MODE_READ
procfs/dmabuf: add inode number to /proc/*/fdinfo
Subsystem: sysctl
Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
sysctl: remove redundant assignment to first
Subsystem: misc
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
drm: include only needed headers in ascii85.h
Subsystem: core-kernel
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: split out panic and oops helpers
Subsystem: lib
Zhen Lei <thunder.leizhen@huawei.com>:
lib: decompress_bunzip2: remove an unneeded semicolon
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
Patch series "lib/string_helpers: get rid of ugly *_escape_mem_ascii()", v3:
lib/string_helpers: switch to use BIT() macro
lib/string_helpers: move ESCAPE_NP check inside 'else' branch in a loop
lib/string_helpers: drop indentation level in string_escape_mem()
lib/string_helpers: introduce ESCAPE_NA for escaping non-ASCII
lib/string_helpers: introduce ESCAPE_NAP to escape non-ASCII and non-printable
lib/string_helpers: allow to append additional characters to be escaped
lib/test-string_helpers: print flags in hexadecimal format
lib/test-string_helpers: get rid of trailing comma in terminators
lib/test-string_helpers: add test cases for new features
MAINTAINERS: add myself as designated reviewer for generic string library
seq_file: introduce seq_escape_mem()
seq_file: add seq_escape_str() as replica of string_escape_str()
seq_file: convert seq_escape() to use seq_escape_str()
nfsd: avoid non-flexible API in seq_quote_mem()
seq_file: drop unused *_escape_mem_ascii()
Trent Piepho <tpiepho@gmail.com>:
lib/math/rational.c: fix divide by zero
lib/math/rational: add Kunit test cases
Zhen Lei <thunder.leizhen@huawei.com>:
lib/decompressors: fix spelling mistakes
lib/mpi: fix spelling mistakes
Alexey Dobriyan <adobriyan@gmail.com>:
lib: memscan() fixlet
lib: uninline simple_strtoull()
Matteo Croce <mcroce@microsoft.com>:
lib/test_string.c: allow module removal
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: split out kstrtox() and simple_strtox() to a separate header
Subsystem: lz4
Rajat Asthana <thisisrast7@gmail.com>:
lz4_decompress: declare LZ4_decompress_safe_withPrefix64k static
Dimitri John Ledkov <dimitri.ledkov@canonical.com>:
lib/decompress_unlz4.c: correctly handle zero-padding around initrds.
Subsystem: checkpatch
Guenter Roeck <linux@roeck-us.net>:
checkpatch: scripts/spdxcheck.py now requires python3
Joe Perches <joe@perches.com>:
checkpatch: improve the indented label test
Guenter Roeck <linux@roeck-us.net>:
checkpatch: do not complain about positive return values starting with EPOLL
Subsystem: init
Andrew Halaney <ahalaney@redhat.com>:
init: print out unknown kernel parameters
Subsystem: kprobes
Barry Song <song.bao.hua@hisilicon.com>:
kprobes: remove duplicated strong free_insn_page in x86 and s390
Subsystem: nilfs2
Colin Ian King <colin.king@canonical.com>:
nilfs2: remove redundant continue statement in a while-loop
Subsystem: hfs
Zhen Lei <thunder.leizhen@huawei.com>:
hfsplus: remove unnecessary oom message
Chung-Chiang Cheng <shepjeng@gmail.com>:
hfsplus: report create_date to kstat.btime
Subsystem: signals
Al Viro <viro@zeniv.linux.org.uk>:
x86: signal: don't do sas_ss_reset() until we are certain that sigframe won't be abandoned
Subsystem: exec
Alexey Dobriyan <adobriyan@gmail.com>:
exec: remove checks in __register_bimfmt()
Subsystem: kcov
Marco Elver <elver@google.com>:
kcov: add __no_sanitize_coverage to fix noinstr for all architectures
Subsystem: selftests
Dave Hansen <dave.hansen@linux.intel.com>:
Patch series "selftests/vm/pkeys: Bug fixes and a new test":
selftests/vm/pkeys: fix alloc_random_pkey() to make it really, really random
selftests/vm/pkeys: handle negative sys_pkey_alloc() return code
selftests/vm/pkeys: refill shadow register after implicit kernel write
selftests/vm/pkeys: exercise x86 XSAVE init state
Subsystem: compress/decompress
Yu Kuai <yukuai3@huawei.com>:
lib/decompressors: remove set but not used variabled 'level'
Subsystem: ipc
Vasily Averin <vvs@virtuozzo.com>:
Patch series "ipc: allocations cleanup", v2:
ipc sem: use kvmalloc for sem_undo allocation
ipc: use kmalloc for msg_queue and shmid_kernel
Manfred Spraul <manfred@colorfullife.com>:
ipc/sem.c: use READ_ONCE()/WRITE_ONCE() for use_global_lock
ipc/util.c: use binary search for max_idx
Documentation/admin-guide/kernel-parameters.txt | 35
Documentation/admin-guide/mm/hugetlbpage.rst | 11
Documentation/admin-guide/mm/memory-hotplug.rst | 13
Documentation/admin-guide/mm/pagemap.rst | 2
Documentation/admin-guide/mm/userfaultfd.rst | 3
Documentation/core-api/kernel-api.rst | 7
Documentation/filesystems/proc.rst | 48
Documentation/vm/hmm.rst | 19
Documentation/vm/unevictable-lru.rst | 33
MAINTAINERS | 10
arch/alpha/Kconfig | 5
arch/alpha/include/asm/pgalloc.h | 1
arch/alpha/include/asm/pgtable.h | 1
arch/alpha/include/uapi/asm/mman.h | 3
arch/alpha/kernel/setup.c | 2
arch/arc/include/asm/pgalloc.h | 2
arch/arc/include/asm/pgtable.h | 8
arch/arm/Kconfig | 3
arch/arm/include/asm/pgalloc.h | 1
arch/arm64/Kconfig | 15
arch/arm64/include/asm/hugetlb.h | 3
arch/arm64/include/asm/memory.h | 2
arch/arm64/include/asm/page.h | 4
arch/arm64/include/asm/pgalloc.h | 1
arch/arm64/include/asm/pgtable.h | 2
arch/arm64/kernel/setup.c | 1
arch/arm64/kvm/mmu.c | 2
arch/arm64/mm/hugetlbpage.c | 5
arch/arm64/mm/init.c | 51
arch/arm64/mm/ioremap.c | 4
arch/arm64/mm/mmu.c | 22
arch/csky/include/asm/pgalloc.h | 2
arch/csky/include/asm/pgtable.h | 1
arch/hexagon/include/asm/pgtable.h | 4
arch/ia64/Kconfig | 7
arch/ia64/include/asm/pal.h | 1
arch/ia64/include/asm/pgalloc.h | 1
arch/ia64/include/asm/pgtable.h | 1
arch/m68k/Kconfig | 5
arch/m68k/include/asm/mcf_pgalloc.h | 2
arch/m68k/include/asm/mcf_pgtable.h | 2
arch/m68k/include/asm/motorola_pgalloc.h | 1
arch/m68k/include/asm/motorola_pgtable.h | 2
arch/m68k/include/asm/pgtable_mm.h | 1
arch/m68k/include/asm/sun3_pgalloc.h | 1
arch/microblaze/Kconfig | 4
arch/microblaze/include/asm/pgalloc.h | 2
arch/microblaze/include/asm/pgtable.h | 2
arch/mips/Kconfig | 10
arch/mips/include/asm/pgalloc.h | 1
arch/mips/include/asm/pgtable-32.h | 1
arch/mips/include/asm/pgtable-64.h | 1
arch/mips/include/uapi/asm/mman.h | 3
arch/mips/kernel/relocate.c | 1
arch/mips/sgi-ip22/ip22-reset.c | 1
arch/mips/sgi-ip32/ip32-reset.c | 1
arch/nds32/include/asm/pgalloc.h | 5
arch/nios2/include/asm/pgalloc.h | 1
arch/nios2/include/asm/pgtable.h | 2
arch/openrisc/include/asm/pgalloc.h | 2
arch/openrisc/include/asm/pgtable.h | 1
arch/parisc/include/asm/pgalloc.h | 1
arch/parisc/include/asm/pgtable.h | 2
arch/parisc/include/uapi/asm/mman.h | 3
arch/parisc/kernel/pdc_chassis.c | 1
arch/powerpc/Kconfig | 6
arch/powerpc/include/asm/book3s/pgtable.h | 1
arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h | 5
arch/powerpc/include/asm/nohash/32/mmu-8xx.h | 43
arch/powerpc/include/asm/nohash/32/pgtable.h | 1
arch/powerpc/include/asm/nohash/64/pgtable.h | 2
arch/powerpc/include/asm/pgalloc.h | 5
arch/powerpc/include/asm/pgtable.h | 6
arch/powerpc/kernel/setup-common.c | 1
arch/powerpc/platforms/Kconfig.cputype | 1
arch/riscv/Kconfig | 5
arch/riscv/include/asm/pgalloc.h | 2
arch/riscv/include/asm/pgtable.h | 2
arch/s390/Kconfig | 6
arch/s390/include/asm/pgalloc.h | 3
arch/s390/include/asm/pgtable.h | 5
arch/s390/kernel/ipl.c | 1
arch/s390/kernel/kprobes.c | 5
arch/s390/mm/pgtable.c | 2
arch/sh/include/asm/pgalloc.h | 1
arch/sh/include/asm/pgtable.h | 2
arch/sparc/Kconfig | 5
arch/sparc/include/asm/pgalloc_32.h | 1
arch/sparc/include/asm/pgalloc_64.h | 1
arch/sparc/include/asm/pgtable_32.h | 3
arch/sparc/include/asm/pgtable_64.h | 8
arch/sparc/kernel/sstate.c | 1
arch/sparc/mm/hugetlbpage.c | 6
arch/sparc/mm/init_64.c | 1
arch/um/drivers/mconsole_kern.c | 1
arch/um/include/asm/pgalloc.h | 1
arch/um/include/asm/pgtable-2level.h | 1
arch/um/include/asm/pgtable-3level.h | 1
arch/um/kernel/um_arch.c | 1
arch/x86/Kconfig | 17
arch/x86/include/asm/desc.h | 1
arch/x86/include/asm/pgalloc.h | 2
arch/x86/include/asm/pgtable_types.h | 2
arch/x86/kernel/cpu/mshyperv.c | 1
arch/x86/kernel/kprobes/core.c | 6
arch/x86/kernel/setup.c | 1
arch/x86/mm/init_64.c | 21
arch/x86/mm/pgtable.c | 34
arch/x86/purgatory/purgatory.c | 2
arch/x86/xen/enlighten.c | 1
arch/xtensa/include/asm/pgalloc.h | 2
arch/xtensa/include/asm/pgtable.h | 1
arch/xtensa/include/uapi/asm/mman.h | 3
arch/xtensa/platforms/iss/setup.c | 1
drivers/block/zram/zram_drv.h | 2
drivers/bus/brcmstb_gisb.c | 1
drivers/char/ipmi/ipmi_msghandler.c | 1
drivers/clk/analogbits/wrpll-cln28hpc.c | 4
drivers/edac/altera_edac.c | 1
drivers/firmware/google/gsmi.c | 1
drivers/gpu/drm/nouveau/include/nvif/if000c.h | 1
drivers/gpu/drm/nouveau/nouveau_svm.c | 162 ++-
drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmm.h | 1
drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmmgp100.c | 6
drivers/hv/vmbus_drv.c | 1
drivers/hwtracing/coresight/coresight-cpu-debug.c | 1
drivers/leds/trigger/ledtrig-activity.c | 1
drivers/leds/trigger/ledtrig-heartbeat.c | 1
drivers/leds/trigger/ledtrig-panic.c | 1
drivers/misc/bcm-vk/bcm_vk_dev.c | 1
drivers/misc/ibmasm/heartbeat.c | 1
drivers/misc/pvpanic/pvpanic.c | 1
drivers/net/ipa/ipa_smp2p.c | 1
drivers/parisc/power.c | 1
drivers/power/reset/ltc2952-poweroff.c | 1
drivers/remoteproc/remoteproc_core.c | 1
drivers/s390/char/con3215.c | 1
drivers/s390/char/con3270.c | 1
drivers/s390/char/sclp.c | 1
drivers/s390/char/sclp_con.c | 1
drivers/s390/char/sclp_vt220.c | 1
drivers/s390/char/zcore.c | 1
drivers/soc/bcm/brcmstb/pm/pm-arm.c | 1
drivers/staging/olpc_dcon/olpc_dcon.c | 1
drivers/video/fbdev/hyperv_fb.c | 1
drivers/virtio/virtio_mem.c | 2
fs/Kconfig | 15
fs/exec.c | 3
fs/hfsplus/inode.c | 5
fs/hfsplus/xattr.c | 1
fs/nfsd/nfs4state.c | 2
fs/nilfs2/btree.c | 1
fs/open.c | 13
fs/proc/base.c | 6
fs/proc/fd.c | 20
fs/proc/kcore.c | 136 ++
fs/proc/task_mmu.c | 34
fs/seq_file.c | 43
fs/userfaultfd.c | 15
include/asm-generic/bug.h | 3
include/linux/ascii85.h | 3
include/linux/bootmem_info.h | 68 +
include/linux/compat.h | 2
include/linux/compiler-clang.h | 17
include/linux/compiler-gcc.h | 6
include/linux/compiler_types.h | 2
include/linux/huge_mm.h | 74 -
include/linux/hugetlb.h | 80 +
include/linux/hugetlb_cgroup.h | 19
include/linux/kcore.h | 3
include/linux/kernel.h | 227 ----
include/linux/kprobes.h | 1
include/linux/kstrtox.h | 155 ++
include/linux/memblock.h | 4
include/linux/memory_hotplug.h | 27
include/linux/mempolicy.h | 9
include/linux/memremap.h | 2
include/linux/migrate.h | 27
include/linux/mm.h | 18
include/linux/mm_types.h | 2
include/linux/mmu_notifier.h | 26
include/linux/mmzone.h | 27
include/linux/mpi.h | 4
include/linux/page-flags.h | 22
include/linux/panic.h | 98 +
include/linux/panic_notifier.h | 12
include/linux/pgtable.h | 44
include/linux/rmap.h | 13
include/linux/seq_file.h | 10
include/linux/shmem_fs.h | 19
include/linux/signal.h | 2
include/linux/string.h | 7
include/linux/string_helpers.h | 31
include/linux/sunrpc/cache.h | 1
include/linux/swap.h | 19
include/linux/swapops.h | 171 +--
include/linux/thread_info.h | 1
include/linux/userfaultfd_k.h | 5
include/linux/vmalloc.h | 15
include/linux/zbud.h | 23
include/trace/events/vmscan.h | 41
include/uapi/asm-generic/mman-common.h | 3
include/uapi/linux/mempolicy.h | 1
include/uapi/linux/userfaultfd.h | 7
init/main.c | 42
ipc/msg.c | 6
ipc/sem.c | 25
ipc/shm.c | 6
ipc/util.c | 44
ipc/util.h | 3
kernel/hung_task.c | 1
kernel/kexec_core.c | 1
kernel/kprobes.c | 2
kernel/panic.c | 1
kernel/rcu/tree.c | 2
kernel/signal.c | 14
kernel/sysctl.c | 4
kernel/trace/trace.c | 1
lib/Kconfig.debug | 12
lib/decompress_bunzip2.c | 6
lib/decompress_unlz4.c | 8
lib/decompress_unlzo.c | 3
lib/decompress_unxz.c | 2
lib/decompress_unzstd.c | 4
lib/kstrtox.c | 5
lib/lz4/lz4_decompress.c | 2
lib/math/Makefile | 1
lib/math/rational-test.c | 56 +
lib/math/rational.c | 16
lib/mpi/longlong.h | 4
lib/mpi/mpicoder.c | 6
lib/mpi/mpiutil.c | 2
lib/parser.c | 1
lib/string.c | 2
lib/string_helpers.c | 142 +-
lib/test-string_helpers.c | 157 ++-
lib/test_hmm.c | 127 ++
lib/test_hmm_uapi.h | 2
lib/test_string.c | 5
lib/vsprintf.c | 1
lib/xz/xz_dec_bcj.c | 2
lib/xz/xz_dec_lzma2.c | 8
lib/zlib_inflate/inffast.c | 2
lib/zstd/huf.h | 2
mm/Kconfig | 16
mm/Makefile | 2
mm/bootmem_info.c | 127 ++
mm/compaction.c | 20
mm/debug_vm_pgtable.c | 109 --
mm/gup.c | 58 +
mm/hmm.c | 12
mm/huge_memory.c | 269 ++---
mm/hugetlb.c | 369 +++++--
mm/hugetlb_vmemmap.c | 332 ++++++
mm/hugetlb_vmemmap.h | 53 -
mm/internal.h | 29
mm/kfence/core.c | 4
mm/khugepaged.c | 20
mm/madvise.c | 66 +
mm/mapping_dirty_helpers.c | 2
mm/memblock.c | 28
mm/memcontrol.c | 4
mm/memory-failure.c | 38
mm/memory.c | 239 +++-
mm/memory_hotplug.c | 161 ---
mm/mempolicy.c | 323 ++----
mm/migrate.c | 268 +----
mm/mlock.c | 12
mm/mmap_lock.c | 59 -
mm/mprotect.c | 18
mm/nommu.c | 5
mm/oom_kill.c | 2
mm/page_alloc.c | 5
mm/page_vma_mapped.c | 15
mm/rmap.c | 644 +++++++++---
mm/shmem.c | 125 --
mm/sparse-vmemmap.c | 432 +++++++-
mm/sparse.c | 1
mm/swap.c | 2
mm/swapfile.c | 2
mm/userfaultfd.c | 249 ++--
mm/util.c | 40
mm/vmalloc.c | 37
mm/vmscan.c | 20
mm/workingset.c | 10
mm/z3fold.c | 39
mm/zbud.c | 235 ++--
mm/zsmalloc.c | 5
mm/zswap.c | 26
scripts/checkpatch.pl | 16
tools/testing/selftests/vm/.gitignore | 3
tools/testing/selftests/vm/Makefile | 5
tools/testing/selftests/vm/hmm-tests.c | 158 +++
tools/testing/selftests/vm/khugepaged.c | 4
tools/testing/selftests/vm/madv_populate.c | 342 ++++++
tools/testing/selftests/vm/pkey-x86.h | 1
tools/testing/selftests/vm/protection_keys.c | 85 +
tools/testing/selftests/vm/run_vmtests.sh | 16
tools/testing/selftests/vm/userfaultfd.c | 1094 ++++++++++-----------
299 files changed, 6277 insertions(+), 3183 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-07-01 1:46 incoming Andrew Morton
@ 2021-07-03 0:28 ` Linus Torvalds
2021-07-03 1:06 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2021-07-03 0:28 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Wed, Jun 30, 2021 at 6:46 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> This is the rest of the -mm tree, less 66 patches which are dependent on
> things which are (or were recently) in linux-next. I'll trickle that
> material over next week.
I haven't bisected this yet, but with the current -git I'm getting
watchdog: BUG: soft lockup - CPU#41 stuck for 49s!
and the common call chain seems to be in flush_tlb_mm_range ->
on_each_cpu_cond_mask.
Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking
at the pulls and merges I've done since, this -mm series looks like
the obvious culprit.
I'll go start bisection, but I thought I'd give a heads-up in case
somebody else has seen TLB-flush-related lockups and already figured
out the guilty party..
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-07-03 0:28 ` incoming Linus Torvalds
@ 2021-07-03 1:06 ` Linus Torvalds
0 siblings, 0 replies; 419+ messages in thread
From: Linus Torvalds @ 2021-07-03 1:06 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Fri, Jul 2, 2021 at 5:28 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking
> at the pulls and merges I've done since, this -mm series looks like
> the obvious culprit.
No, unless my bisection is wrong, the -mm branch is innocent, and was
discarded from the suspects on the very first bisection trial.
So never mind.
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-07-08 0:59 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-07-08 0:59 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
54 patches, based on a931dd33d370896a683236bba67c0d6f3d01144d.
Subsystems affected by this patch series:
lib
mm/slub
mm/secretmem
mm/cleanups
mm/init
debug
mm/pagemap
mm/mremap
Subsystem: lib
Zhen Lei <thunder.leizhen@huawei.com>:
lib/test: fix spelling mistakes
lib: fix spelling mistakes
lib: fix spelling mistakes in header files
Subsystem: mm/slub
Nathan Chancellor <nathan@kernel.org>:
Patch series "hexagon: Fix build error with CONFIG_STACKDEPOT and select CONFIG_ARCH_WANT_LD_ORPHAN_WARN":
hexagon: handle {,SOFT}IRQENTRY_TEXT in linker script
hexagon: use common DISCARDS macro
hexagon: select ARCH_WANT_LD_ORPHAN_WARN
Oliver Glitta <glittao@gmail.com>:
mm/slub: use stackdepot to save stack trace in objects
Subsystem: mm/secretmem
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: introduce memfd_secret system call to create "secret" memory areas", v20:
mmap: make mlock_future_check() global
riscv/Kconfig: make direct map manipulation options depend on MMU
set_memory: allow querying whether set_direct_map_*() is actually enabled
mm: introduce memfd_secret system call to create "secret" memory areas
PM: hibernate: disable when there are active secretmem users
arch, mm: wire up memfd_secret system call where relevant
secretmem: test: add basic selftest for memfd_secret(2)
Subsystem: mm/cleanups
Zhen Lei <thunder.leizhen@huawei.com>:
mm: fix spelling mistakes in header files
Subsystem: mm/init
Kefeng Wang <wangkefeng.wang@huawei.com>:
Patch series "init_mm: cleanup ARCH's text/data/brk setup code", v3:
mm: add setup_initial_init_mm() helper
arc: convert to setup_initial_init_mm()
arm: convert to setup_initial_init_mm()
arm64: convert to setup_initial_init_mm()
csky: convert to setup_initial_init_mm()
h8300: convert to setup_initial_init_mm()
m68k: convert to setup_initial_init_mm()
nds32: convert to setup_initial_init_mm()
nios2: convert to setup_initial_init_mm()
openrisc: convert to setup_initial_init_mm()
powerpc: convert to setup_initial_init_mm()
riscv: convert to setup_initial_init_mm()
s390: convert to setup_initial_init_mm()
sh: convert to setup_initial_init_mm()
x86: convert to setup_initial_init_mm()
Subsystem: debug
Stephen Boyd <swboyd@chromium.org>:
Patch series "Add build ID to stacktraces", v6:
buildid: only consider GNU notes for build ID parsing
buildid: add API to parse build ID out of buffer
buildid: stash away kernels build ID on init
dump_stack: add vmlinux build ID to stack traces
module: add printk formats to add module build ID to stacktraces
arm64: stacktrace: use %pSb for backtrace printing
x86/dumpstack: use %pSb/%pBb for backtrace printing
scripts/decode_stacktrace.sh: support debuginfod
scripts/decode_stacktrace.sh: silence stderr messages from addr2line/nm
scripts/decode_stacktrace.sh: indicate 'auto' can be used for base path
buildid: mark some arguments const
buildid: fix kernel-doc notation
kdump: use vmlinux_build_id to simplify
Subsystem: mm/pagemap
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm: rename pud_page_vaddr to pud_pgtable and make it return pmd_t *
mm: rename p4d_page_vaddr to p4d_pgtable and make it return pud_t *
Subsystem: mm/mremap
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "mrermap fixes", v2:
selftest/mremap_test: update the test to handle pagesize other than 4K
selftest/mremap_test: avoid crash with static build
mm/mremap: convert huge PUD move to separate helper
mm/mremap: don't enable optimized PUD move if page table levels is 2
mm/mremap: use pmd/pud_poplulate to update page table entries
mm/mremap: hold the rmap lock in write mode when moving page table entries.
Patch series "Speedup mremap on ppc64", v8:
mm/mremap: allow arch runtime override
powerpc/book3s64/mm: update flush_tlb_range to flush page walk cache
powerpc/mm: enable HAVE_MOVE_PMD support
Documentation/core-api/printk-formats.rst | 11
arch/alpha/include/asm/pgtable.h | 8
arch/arc/mm/init.c | 5
arch/arm/include/asm/pgtable-3level.h | 2
arch/arm/kernel/setup.c | 5
arch/arm64/include/asm/Kbuild | 1
arch/arm64/include/asm/cacheflush.h | 6
arch/arm64/include/asm/kfence.h | 2
arch/arm64/include/asm/pgtable.h | 8
arch/arm64/include/asm/set_memory.h | 17 +
arch/arm64/include/uapi/asm/unistd.h | 1
arch/arm64/kernel/machine_kexec.c | 1
arch/arm64/kernel/setup.c | 5
arch/arm64/kernel/stacktrace.c | 2
arch/arm64/mm/mmu.c | 7
arch/arm64/mm/pageattr.c | 13
arch/csky/kernel/setup.c | 5
arch/h8300/kernel/setup.c | 5
arch/hexagon/Kconfig | 1
arch/hexagon/kernel/vmlinux.lds.S | 9
arch/ia64/include/asm/pgtable.h | 4
arch/m68k/include/asm/motorola_pgtable.h | 2
arch/m68k/kernel/setup_mm.c | 5
arch/m68k/kernel/setup_no.c | 5
arch/mips/include/asm/pgtable-64.h | 8
arch/nds32/kernel/setup.c | 5
arch/nios2/kernel/setup.c | 5
arch/openrisc/kernel/setup.c | 5
arch/parisc/include/asm/pgtable.h | 4
arch/powerpc/include/asm/book3s/64/pgtable.h | 11
arch/powerpc/include/asm/book3s/64/tlbflush-radix.h | 2
arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 6
arch/powerpc/include/asm/nohash/64/pgtable.h | 6
arch/powerpc/include/asm/tlb.h | 6
arch/powerpc/kernel/setup-common.c | 5
arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 8
arch/powerpc/mm/book3s64/radix_pgtable.c | 6
arch/powerpc/mm/book3s64/radix_tlb.c | 44 +-
arch/powerpc/mm/pgtable_64.c | 4
arch/powerpc/platforms/Kconfig.cputype | 2
arch/riscv/Kconfig | 4
arch/riscv/include/asm/pgtable-64.h | 4
arch/riscv/include/asm/unistd.h | 1
arch/riscv/kernel/setup.c | 5
arch/s390/kernel/setup.c | 5
arch/sh/include/asm/pgtable-3level.h | 4
arch/sh/kernel/setup.c | 5
arch/sparc/include/asm/pgtable_32.h | 6
arch/sparc/include/asm/pgtable_64.h | 10
arch/um/include/asm/pgtable-3level.h | 2
arch/x86/entry/syscalls/syscall_32.tbl | 1
arch/x86/entry/syscalls/syscall_64.tbl | 1
arch/x86/include/asm/pgtable.h | 8
arch/x86/kernel/dumpstack.c | 2
arch/x86/kernel/setup.c | 5
arch/x86/mm/init_64.c | 4
arch/x86/mm/pat/set_memory.c | 4
arch/x86/mm/pgtable.c | 2
include/asm-generic/pgtable-nop4d.h | 2
include/asm-generic/pgtable-nopmd.h | 2
include/asm-generic/pgtable-nopud.h | 4
include/linux/bootconfig.h | 4
include/linux/buildid.h | 10
include/linux/compaction.h | 4
include/linux/cpumask.h | 2
include/linux/crash_core.h | 12
include/linux/debugobjects.h | 2
include/linux/hmm.h | 2
include/linux/hugetlb.h | 6
include/linux/kallsyms.h | 21 +
include/linux/list_lru.h | 4
include/linux/lru_cache.h | 8
include/linux/mm.h | 3
include/linux/mmu_notifier.h | 8
include/linux/module.h | 9
include/linux/nodemask.h | 6
include/linux/percpu-defs.h | 2
include/linux/percpu-refcount.h | 2
include/linux/pgtable.h | 4
include/linux/scatterlist.h | 2
include/linux/secretmem.h | 54 +++
include/linux/set_memory.h | 12
include/linux/shrinker.h | 2
include/linux/syscalls.h | 1
include/linux/vmalloc.h | 4
include/uapi/asm-generic/unistd.h | 7
include/uapi/linux/magic.h | 1
init/Kconfig | 1
init/main.c | 2
kernel/crash_core.c | 50 ---
kernel/kallsyms.c | 104 +++++--
kernel/module.c | 42 ++
kernel/power/hibernate.c | 5
kernel/sys_ni.c | 2
lib/Kconfig.debug | 17 -
lib/asn1_encoder.c | 2
lib/buildid.c | 80 ++++-
lib/devres.c | 2
lib/dump_stack.c | 13
lib/dynamic_debug.c | 2
lib/fonts/font_pearl_8x8.c | 2
lib/kfifo.c | 2
lib/list_sort.c | 2
lib/nlattr.c | 4
lib/oid_registry.c | 2
lib/pldmfw/pldmfw.c | 2
lib/reed_solomon/test_rslib.c | 2
lib/refcount.c | 2
lib/rhashtable.c | 2
lib/sbitmap.c | 2
lib/scatterlist.c | 4
lib/seq_buf.c | 2
lib/sort.c | 2
lib/stackdepot.c | 2
lib/test_bitops.c | 2
lib/test_bpf.c | 2
lib/test_kasan.c | 2
lib/test_kmod.c | 6
lib/test_scanf.c | 2
lib/vsprintf.c | 10
mm/Kconfig | 4
mm/Makefile | 1
mm/gup.c | 12
mm/init-mm.c | 9
mm/internal.h | 3
mm/mlock.c | 3
mm/mmap.c | 5
mm/mremap.c | 108 ++++++-
mm/secretmem.c | 254 +++++++++++++++++
mm/slub.c | 79 +++--
scripts/checksyscalls.sh | 4
scripts/decode_stacktrace.sh | 89 +++++-
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 3
tools/testing/selftests/vm/memfd_secret.c | 296 ++++++++++++++++++++
tools/testing/selftests/vm/mremap_test.c | 116 ++++---
tools/testing/selftests/vm/run_vmtests.sh | 17 +
137 files changed, 1470 insertions(+), 442 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-07-15 4:26 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-07-15 4:26 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
13 patches, based on 40226a3d96ef8ab8980f032681c8bfd46d63874e.
Subsystems affected by this patch series:
mm/kasan
mm/pagealloc
mm/rmap
mm/hmm
hfs
mm/hugetlb
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
mm: move helper to check slub_debug_enabled
Yee Lee <yee.lee@mediatek.com>:
kasan: add memzero init for unaligned size at DEBUG
Marco Elver <elver@google.com>:
kasan: fix build by including kernel.h
Subsystem: mm/pagealloc
Matteo Croce <mcroce@microsoft.com>:
Revert "mm/page_alloc: make should_fail_alloc_page() static"
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: avoid page allocator recursion with pagesets.lock held
Yanfei Xu <yanfei.xu@windriver.com>:
mm/page_alloc: correct return value when failing at preparing
Chuck Lever <chuck.lever@oracle.com>:
mm/page_alloc: further fix __alloc_pages_bulk() return value
Subsystem: mm/rmap
Christoph Hellwig <hch@lst.de>:
mm: fix the try_to_unmap prototype for !CONFIG_MMU
Subsystem: mm/hmm
Alistair Popple <apopple@nvidia.com>:
lib/test_hmm: remove set but unused page variable
Subsystem: hfs
Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>:
Patch series "hfs: fix various errors", v2:
hfs: add missing clean-up in hfs_fill_super
hfs: fix high memory mapping in hfs_bnode_read
hfs: add lock nesting notation to hfs_find_init
Subsystem: mm/hugetlb
Joao Martins <joao.m.martins@oracle.com>:
mm/hugetlb: fix refs calculation from unaligned @vaddr
fs/hfs/bfind.c | 14 +++++++++++++-
fs/hfs/bnode.c | 25 ++++++++++++++++++++-----
fs/hfs/btree.h | 7 +++++++
fs/hfs/super.c | 10 +++++-----
include/linux/kasan.h | 1 +
include/linux/rmap.h | 4 +++-
lib/test_hmm.c | 2 --
mm/hugetlb.c | 5 +++--
mm/kasan/kasan.h | 12 ++++++++++++
mm/page_alloc.c | 30 ++++++++++++++++++++++--------
mm/slab.h | 15 +++++++++++----
mm/slub.c | 14 --------------
12 files changed, 97 insertions(+), 42 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-07-23 22:49 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-07-23 22:49 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
15 patches, based on 704f4cba43d4ed31ef4beb422313f1263d87bc55.
Subsystems affected by this patch series:
mm/userfaultfd
mm/kfence
mm/highmem
mm/pagealloc
mm/memblock
mm/pagecache
mm/secretmem
mm/pagemap
mm/hugetlbfs
Subsystem: mm/userfaultfd
Peter Collingbourne <pcc@google.com>:
Patch series "userfaultfd: do not untag user pointers", v5:
userfaultfd: do not untag user pointers
selftest: use mmap instead of posix_memalign to allocate memory
Subsystem: mm/kfence
Weizhao Ouyang <o451686892@gmail.com>:
kfence: defer kfence_test_init to ensure that kunit debugfs is created
Alexander Potapenko <glider@google.com>:
kfence: move the size check to the beginning of __kfence_alloc()
kfence: skip all GFP_ZONEMASK allocations
Subsystem: mm/highmem
Christoph Hellwig <hch@lst.de>:
mm: call flush_dcache_page() in memcpy_to_page() and memzero_page()
mm: use kmap_local_page in memzero_page
Subsystem: mm/pagealloc
Sergei Trofimovich <slyfox@gentoo.org>:
mm: page_alloc: fix page_poison=1 / INIT_ON_ALLOC_DEFAULT_ON interaction
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
memblock: make for_each_mem_range() traverse MEMBLOCK_HOTPLUG regions
Subsystem: mm/pagecache
Roman Gushchin <guro@fb.com>:
writeback, cgroup: remove wb from offline list before releasing refcnt
writeback, cgroup: do not reparent dax inodes
Subsystem: mm/secretmem
Mike Rapoport <rppt@linux.ibm.com>:
mm/secretmem: wire up ->set_page_dirty
Subsystem: mm/pagemap
Muchun Song <songmuchun@bytedance.com>:
mm: mmap_lock: fix disabling preemption directly
Qi Zheng <zhengqi.arch@bytedance.com>:
mm: fix the deadlock in finish_fault()
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlbfs: fix mount mode command line processing
Documentation/arm64/tagged-address-abi.rst | 26 ++++++++++++++++++--------
fs/fs-writeback.c | 3 +++
fs/hugetlbfs/inode.c | 2 +-
fs/userfaultfd.c | 26 ++++++++++++--------------
include/linux/highmem.h | 6 ++++--
include/linux/memblock.h | 4 ++--
mm/backing-dev.c | 2 +-
mm/kfence/core.c | 19 ++++++++++++++++---
mm/kfence/kfence_test.c | 2 +-
mm/memblock.c | 3 ++-
mm/memory.c | 11 ++++++++++-
mm/mmap_lock.c | 4 ++--
mm/page_alloc.c | 29 ++++++++++++++++-------------
mm/secretmem.c | 1 +
tools/testing/selftests/vm/userfaultfd.c | 6 ++++--
15 files changed, 93 insertions(+), 51 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-07-29 21:52 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-07-29 21:52 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
7 patches, based on 7e96bf476270aecea66740a083e51b38c1371cd2.
Subsystems affected by this patch series:
lib
ocfs2
mm/memcg
mm/migration
mm/slub
mm/memcg
Subsystem: lib
Matteo Croce <mcroce@microsoft.com>:
lib/test_string.c: move string selftest in the Runtime Testing menu
Subsystem: ocfs2
Junxiao Bi <junxiao.bi@oracle.com>:
ocfs2: fix zero out valid data
ocfs2: issue zeroout to EOF blocks
Subsystem: mm/memcg
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: fix blocking rstat function called from atomic cgroup1 thresholding code
Subsystem: mm/migration
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/migrate: fix NR_ISOLATED corruption on 64-bit
Subsystem: mm/slub
Shakeel Butt <shakeelb@google.com>:
slub: fix unreclaimable slab stat for bulk free
Subsystem: mm/memcg
Wang Hai <wanghai38@huawei.com>:
mm/memcg: fix NULL pointer dereference in memcg_slab_free_hook()
fs/ocfs2/file.c | 103 ++++++++++++++++++++++++++++++++----------------------
lib/Kconfig | 3 -
lib/Kconfig.debug | 3 +
mm/memcontrol.c | 3 +
mm/migrate.c | 2 -
mm/slab.h | 2 -
mm/slub.c | 22 ++++++-----
7 files changed, 81 insertions(+), 57 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-08-13 23:53 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-08-13 23:53 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
7 patches, based on f8e6dfc64f6135d1b6c5215c14cd30b9b60a0008.
Subsystems affected by this patch series:
mm/kasan
mm/slub
mm/madvise
mm/memcg
lib
Subsystem: mm/kasan
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
Patch series "kasan, slub: reset tag when printing address", v3:
kasan, kmemleak: reset tags when scanning block
kasan, slub: reset tag when printing address
Subsystem: mm/slub
Shakeel Butt <shakeelb@google.com>:
slub: fix kmalloc_pagealloc_invalid_free unit test
Vlastimil Babka <vbabka@suse.cz>:
mm: slub: fix slub_debug disabling for list of slabs
Subsystem: mm/madvise
David Hildenbrand <david@redhat.com>:
mm/madvise: report SIGBUS as -EFAULT for MADV_POPULATE_(READ|WRITE)
Subsystem: mm/memcg
Waiman Long <longman@redhat.com>:
mm/memcg: fix incorrect flushing of lruvec data in obj_stock
Subsystem: lib
Liang Wang <wangliang101@huawei.com>:
lib: use PFN_PHYS() in devmem_is_allowed()
lib/devmem_is_allowed.c | 2 +-
mm/gup.c | 7 +++++--
mm/kmemleak.c | 6 +++---
mm/madvise.c | 4 +++-
mm/memcontrol.c | 6 ++++--
mm/slub.c | 25 ++++++++++++++-----------
6 files changed, 30 insertions(+), 20 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-08-20 2:03 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-08-20 2:03 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
10 patches, based on 614cb2751d3150850d459bee596c397f344a7936.
Subsystems affected by this patch series:
mm/shmem
mm/pagealloc
mm/tracing
MAINTAINERS
mm/memcg
mm/memory-failure
mm/vmscan
mm/kfence
mm/hugetlb
Subsystem: mm/shmem
Yang Shi <shy828301@gmail.com>:
Revert "mm/shmem: fix shmem_swapin() race with swapoff"
Revert "mm: swap: check if swap backing device is congested or not"
Subsystem: mm/pagealloc
Doug Berger <opendmb@gmail.com>:
mm/page_alloc: don't corrupt pcppage_migratetype
Subsystem: mm/tracing
Mike Rapoport <rppt@linux.ibm.com>:
mmflags.h: add missing __GFP_ZEROTAGS and __GFP_SKIP_KASAN_POISON names
Subsystem: MAINTAINERS
Nathan Chancellor <nathan@kernel.org>:
MAINTAINERS: update ClangBuiltLinux IRC chat
Subsystem: mm/memcg
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: fix occasional OOMs due to proportional memory.low reclaim
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/hwpoison: retry with shake_page() for unhandlable pages
Subsystem: mm/vmscan
Johannes Weiner <hannes@cmpxchg.org>:
mm: vmscan: fix missing psi annotation for node_reclaim()
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: fix is_kfence_address() for addresses below KFENCE_POOL_SIZE
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: don't pass page cache pages to restore_reserve_on_error
MAINTAINERS | 2 +-
include/linux/kfence.h | 7 ++++---
include/linux/memcontrol.h | 29 +++++++++++++++--------------
include/trace/events/mmflags.h | 4 +++-
mm/hugetlb.c | 19 ++++++++++++++-----
mm/memory-failure.c | 12 +++++++++---
mm/page_alloc.c | 25 ++++++++++++-------------
mm/shmem.c | 14 +-------------
mm/swap_state.c | 7 -------
mm/vmscan.c | 30 ++++++++++++++++++++++--------
10 files changed, 81 insertions(+), 68 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-08-25 19:17 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-08-25 19:17 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
2 patches, based on 6e764bcd1cf72a2846c0e53d3975a09b242c04c9.
Subsystems affected by this patch series:
mm/memory-hotplug
MAINTAINERS
Subsystem: mm/memory-hotplug
Miaohe Lin <linmiaohe@huawei.com>:
mm/memory_hotplug: fix potential permanent lru cache disable
Subsystem: MAINTAINERS
Namjae Jeon <namjae.jeon@samsung.com>:
MAINTAINERS: exfat: update my email address
MAINTAINERS | 2 +-
mm/memory_hotplug.c | 1 +
2 files changed, 2 insertions(+), 1 deletion(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-09-02 21:48 Andrew Morton
2021-09-02 21:49 ` incoming Andrew Morton
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2021-09-02 21:48 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b.
Subsystems affected by this patch series:
ia64
ocfs2
block
mm/slub
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/shmem
mm/memcg
mm/selftests
mm/pagemap
mm/mremap
mm/bootmem
mm/sparsemem
mm/vmalloc
mm/kasan
mm/pagealloc
mm/memory-failure
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/compaction
mm/mempolicy
mm/memblock
mm/oom-kill
mm/migration
mm/ksm
mm/percpu
mm/vmstat
mm/madvise
Subsystem: ia64
Jason Wang <wangborong@cdjrlc.com>:
ia64: fix typo in a comment
Geert Uytterhoeven <geert+renesas@glider.be>:
Patch series "ia64: Miscellaneous fixes and cleanups":
ia64: fix #endif comment for reserve_elfcorehdr()
ia64: make reserve_elfcorehdr() static
ia64: make num_rsvd_regions static
Subsystem: ocfs2
Dan Carpenter <dan.carpenter@oracle.com>:
ocfs2: remove an unnecessary condition
Tuo Li <islituo@gmail.com>:
ocfs2: quota_local: fix possible uninitialized-variable access in ocfs2_local_read_info()
Gang He <ghe@suse.com>:
ocfs2: ocfs2_downconvert_lock failure results in deadlock
Subsystem: block
kernel test robot <lkp@intel.com>:
arch/csky/kernel/probes/kprobes.c: fix bugon.cocci warnings
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v4:
mm, slub: don't call flush_all() from slab_debug_trace_open()
mm, slub: allocate private object map for debugfs listings
mm, slub: allocate private object map for validate_slab_cache()
mm, slub: don't disable irq for debug_check_no_locks_freed()
mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
mm, slub: unify cmpxchg_double_slab() and __cmpxchg_double_slab()
mm, slub: extract get_partial() from new_slab_objects()
mm, slub: dissolve new_slab_objects() into ___slab_alloc()
mm, slub: return slab page from get_partial() and set c->page afterwards
mm, slub: restructure new page checks in ___slab_alloc()
mm, slub: simplify kmem_cache_cpu and tid setup
mm, slub: move disabling/enabling irqs to ___slab_alloc()
mm, slub: do initial checks in ___slab_alloc() with irqs enabled
mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
mm, slub: restore irqs around calling new_slab()
mm, slub: validate slab from partial list or page allocator before making it cpu slab
mm, slub: check new pages with restored irqs
mm, slub: stop disabling irqs around get_partial()
mm, slub: move reset of c->page and freelist out of deactivate_slab()
mm, slub: make locking in deactivate_slab() irq-safe
mm, slub: call deactivate_slab() without disabling irqs
mm, slub: move irq control into unfreeze_partials()
mm, slub: discard slabs in unfreeze_partials() without irqs disabled
mm, slub: detach whole partial list at once in unfreeze_partials()
mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
mm, slub: only disable irq with spin_lock in __unfreeze_partials()
mm, slub: don't disable irqs in slub_cpu_dead()
mm, slab: make flush_slab() possible to call with irqs enabled
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
mm: slub: make object_map_lock a raw_spinlock_t
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: optionally save/restore irqs in slab_[un]lock()/
mm, slub: make slab_lock() disable irqs with PREEMPT_RT
mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
mm, slub: use migrate_disable() on PREEMPT_RT
mm, slub: convert kmem_cpu_slab protection to local_lock
Subsystem: mm/debug
Gavin Shan <gshan@redhat.com>:
Patch series "mm/debug_vm_pgtable: Enhancements", v6:
mm/debug_vm_pgtable: introduce struct pgtable_debug_args
mm/debug_vm_pgtable: use struct pgtable_debug_args in basic tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in leaf and savewrite tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in protnone and devmap tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in soft_dirty and swap tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in migration and thp tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in PTE modifying tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in PMD modifying tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in PUD modifying tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in PGD and P4D modifying tests
mm/debug_vm_pgtable: remove unused code
mm/debug_vm_pgtable: fix corrupted page flag
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: report a more useful address for reclaim acquisition
liuhailong <liuhailong@oppo.com>:
mm: add kernel_misc_reclaimable in show_free_areas
Subsystem: mm/pagecache
Jan Kara <jack@suse.cz>:
Patch series "writeback: Fix bandwidth estimates", v4:
writeback: track number of inodes under writeback
writeback: reliably update bandwidth estimation
writeback: fix bandwidth estimate for spiky workload
writeback: rename domain_update_bandwidth()
writeback: use READ_ONCE for unlocked reads of writeback stats
Johannes Weiner <hannes@cmpxchg.org>:
mm: remove irqsave/restore locking from contexts with irqs enabled
fs: drop_caches: fix skipping over shadow cache inodes
fs: inode: count invalidated shadow pages in pginodesteal
Shakeel Butt <shakeelb@google.com>:
writeback: memcg: simplify cgroup_writeback_by_id
Jing Yangyang <jing.yangyang@zte.com.cn>:
include/linux/buffer_head.h: fix boolreturn.cocci warnings
Subsystem: mm/gup
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups and fixup for gup":
mm: gup: remove set but unused local variable major
mm: gup: remove unneed local variable orig_refs
mm: gup: remove useless BUG_ON in __get_user_pages()
mm: gup: fix potential pgmap refcnt leak in __gup_device_huge()
mm: gup: use helper PAGE_ALIGNED in populate_vma_page_range()
John Hubbard <jhubbard@nvidia.com>:
Patch series "A few gup refactorings and documentation updates", v3:
mm/gup: documentation corrections for gup/pup
mm/gup: small refactoring: simplify try_grab_page()
mm/gup: remove try_get_page(), call try_get_compound_head() directly
Subsystem: mm/swap
Hugh Dickins <hughd@google.com>:
fs, mm: fix race in unlinking swapfile
John Hubbard <jhubbard@nvidia.com>:
mm: delete unused get_kernel_page()
Subsystem: mm/shmem
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
shmem: use raw_spinlock_t for ->stat_lock
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups for shmem":
shmem: remove unneeded variable ret
shmem: remove unneeded header file
shmem: remove unneeded function forward declaration
shmem: include header file to declare swap_info
Hugh Dickins <hughd@google.com>:
Patch series "huge tmpfs: shmem_is_huge() fixes and cleanups":
huge tmpfs: fix fallocate(vanilla) advance over huge pages
huge tmpfs: fix split_huge_page() after FALLOC_FL_KEEP_SIZE
huge tmpfs: remove shrinklist addition from shmem_setattr()
huge tmpfs: revert shmem's use of transhuge_vma_enabled()
huge tmpfs: move shmem_huge_enabled() upwards
huge tmpfs: SGP_NOALLOC to stop collapse_file() on race
huge tmpfs: shmem_is_huge(vma, inode, index)
huge tmpfs: decide stat.st_blksize by shmem_is_huge()
shmem: shmem_writepage() split unlikely i915 THP
Subsystem: mm/memcg
Suren Baghdasaryan <surenb@google.com>:
mm, memcg: add mem_cgroup_disabled checks in vmpressure and swap-related functions
mm, memcg: inline mem_cgroup_{charge/uncharge} to improve disabled memcg config
mm, memcg: inline swap-related functions to improve disabled memcg config
Vasily Averin <vvs@virtuozzo.com>:
memcg: enable accounting for pids in nested pid namespaces
Shakeel Butt <shakeelb@google.com>:
memcg: switch lruvec stats to rstat
memcg: infrastructure to flush memcg stats
Yutian Yang <nglaive@gmail.com>:
memcg: charge fs_context and legacy_fs_context
Vasily Averin <vvs@virtuozzo.com>:
Patch series "memcg accounting from OpenVZ", v7:
memcg: enable accounting for mnt_cache entries
memcg: enable accounting for pollfd and select bits arrays
memcg: enable accounting for file lock caches
memcg: enable accounting for fasync_cache
memcg: enable accounting for new namesapces and struct nsproxy
memcg: enable accounting of ipc resources
memcg: enable accounting for signals
memcg: enable accounting for posix_timers_cache slab
memcg: enable accounting for ldt_struct objects
Shakeel Butt <shakeelb@google.com>:
memcg: cleanup racy sum avoidance code
Vasily Averin <vvs@virtuozzo.com>:
memcg: replace in_interrupt() by !in_task() in active_memcg()
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: memcontrol: set the correct memcg swappiness restriction
Miaohe Lin <linmiaohe@huawei.com>:
mm, memcg: remove unused functions
mm, memcg: save some atomic ops when flush is already true
Michal Hocko <mhocko@suse.com>:
memcg: fix up drain_local_stock comment
Shakeel Butt <shakeelb@google.com>:
memcg: make memcg->event_list_lock irqsafe
Subsystem: mm/selftests
Po-Hsu Lin <po-hsu.lin@canonical.com>:
selftests/vm: use kselftest skip code for skipped tests
Colin Ian King <colin.king@canonical.com>:
selftests: Fix spelling mistake "cann't" -> "cannot"
Subsystem: mm/pagemap
Nicholas Piggin <npiggin@gmail.com>:
Patch series "shoot lazy tlbs", v4:
lazy tlb: introduce lazy mm refcount helper functions
lazy tlb: allow lazy tlb mm refcounting to be configurable
lazy tlb: shoot lazies, a non-refcounting lazy tlb option
powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN
Christoph Hellwig <hch@lst.de>:
Patch series "_kernel_dcache_page fixes and removal":
mmc: JZ4740: remove the flush_kernel_dcache_page call in jz4740_mmc_read_data
mmc: mmc_spi: replace flush_kernel_dcache_page with flush_dcache_page
scatterlist: replace flush_kernel_dcache_page with flush_dcache_page
mm: remove flush_kernel_dcache_page
Huang Ying <ying.huang@intel.com>:
mm,do_huge_pmd_numa_page: remove unnecessary TLB flushing code
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
mm: change fault_in_pages_* to have an unsigned size parameter
Luigi Rizzo <lrizzo@google.com>:
mm/pagemap: add mmap_assert_locked() annotations to find_vma*()
"Liam R. Howlett" <Liam.Howlett@Oracle.com>:
remap_file_pages: Use vma_lookup() instead of find_vma()
Subsystem: mm/mremap
Chen Wandun <chenwandun@huawei.com>:
mm/mremap: fix memory account on do_munmap() failure
Subsystem: mm/bootmem
Muchun Song <songmuchun@bytedance.com>:
mm/bootmem_info.c: mark __init on register_page_bootmem_info_section
Subsystem: mm/sparsemem
Ohhoon Kwon <ohoono.kwon@samsung.com>:
Patch series "mm: sparse: remove __section_nr() function", v4:
mm: sparse: pass section_nr to section_mark_present
mm: sparse: pass section_nr to find_memory_block
mm: sparse: remove __section_nr() function
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/sparse: set SECTION_NID_SHIFT to 6
Matthew Wilcox <willy@infradead.org>:
include/linux/mmzone.h: avoid a warning in sparse memory support
Miles Chen <miles.chen@mediatek.com>:
mm/sparse: clarify pgdat_to_phys
Subsystem: mm/vmalloc
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: use batched page requests in bulk-allocator
mm/vmalloc: remove gfpflags_allow_blocking() check
lib/test_vmalloc.c: add a new 'nr_pages' parameter
Chen Wandun <chenwandun@huawei.com>:
mm/vmalloc: fix wrong behavior in vread
Subsystem: mm/kasan
Woody Lin <woodylin@google.com>:
mm/kasan: move kasan.fault to mm/kasan/report.c
Andrey Konovalov <andreyknvl@gmail.com>:
Patch series "kasan: test: avoid crashing the kernel with HW_TAGS", v2:
kasan: test: rework kmalloc_oob_right
kasan: test: avoid writing invalid memory
kasan: test: avoid corrupting memory via memset
kasan: test: disable kmalloc_memmove_invalid_size for HW_TAGS
kasan: test: only do kmalloc_uaf_memset for generic mode
kasan: test: clean up ksize_uaf
kasan: test: avoid corrupting memory in copy_user_test
kasan: test: avoid corrupting memory in kasan_rcu_uaf
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: ensure consistency of memory map poisoning":
mm/page_alloc: always initialize memory map for the holes
microblaze: simplify pte_alloc_one_kernel()
mm: introduce memmap_alloc() to unify memory map allocation
memblock: stop poisoning raw allocations
Nico Pache <npache@redhat.com>:
mm/page_alloc.c: fix 'zone_id' may be used uninitialized in this function warning
Mike Rapoport <rppt@linux.ibm.com>:
mm/page_alloc: make alloc_node_mem_map() __init rather than __ref
Vasily Averin <vvs@virtuozzo.com>:
mm/page_alloc.c: use in_task()
"George G. Davis" <davis.george@siemens.com>:
mm/page_isolation: tracing: trace all test_pages_isolated failures
Subsystem: mm/memory-failure
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups and fixup for hwpoison":
mm/hwpoison: remove unneeded variable unmap_success
mm/hwpoison: fix potential pte_unmap_unlock pte error
mm/hwpoison: change argument struct page **hpagep to *hpage
mm/hwpoison: fix some obsolete comments
Yang Shi <shy828301@gmail.com>:
mm: hwpoison: don't drop slab caches for offlining non-LRU page
doc: hwpoison: correct the support for hugepage
mm: hwpoison: dump page for unhandlable page
Michael Wang <yun.wang@linux.alibaba.com>:
mm: fix panic caused by __page_handle_poison()
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: simplify prep_compound_gigantic_page ref count racing code
hugetlb: drop ref count earlier after page allocation
hugetlb: before freeing hugetlb page set dtor to appropriate value
hugetlb: fix hugetlb cgroup refcounting during vma split
Subsystem: mm/userfaultfd
Nadav Amit <namit@vmware.com>:
Patch series "userfaultfd: minor bug fixes":
userfaultfd: change mmap_changing to atomic
userfaultfd: prevent concurrent API initialization
selftests/vm/userfaultfd: wake after copy failure
Subsystem: mm/vmscan
Dave Hansen <dave.hansen@linux.intel.com>:
Patch series "Migrate Pages in lieu of discard", v11:
mm/numa: automatically generate node migration order
mm/migrate: update node demotion order on hotplug events
Yang Shi <yang.shi@linux.alibaba.com>:
mm/migrate: enable returning precise migrate_pages() success count
Dave Hansen <dave.hansen@linux.intel.com>:
mm/migrate: demote pages during reclaim
Yang Shi <yang.shi@linux.alibaba.com>:
mm/vmscan: add page demotion counter
Dave Hansen <dave.hansen@linux.intel.com>:
mm/vmscan: add helper for querying ability to age anonymous pages
Keith Busch <kbusch@kernel.org>:
mm/vmscan: Consider anonymous pages without swap
Dave Hansen <dave.hansen@linux.intel.com>:
mm/vmscan: never demote for memcg reclaim
Huang Ying <ying.huang@intel.com>:
mm/migrate: add sysfs interface to enable reclaim migration
Hui Su <suhui@zeku.com>:
mm/vmpressure: replace vmpressure_to_css() with vmpressure_to_memcg()
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups for vmscan", v2:
mm/vmscan: remove the PageDirty check after MADV_FREE pages are page_ref_freezed
mm/vmscan: remove misleading setting to sc->priority
mm/vmscan: remove unneeded return value of kswapd_run()
mm/vmscan: add 'else' to remove check_pending label
Vlastimil Babka <vbabka@suse.cz>:
mm, vmscan: guarantee drop_slab_node() termination
Subsystem: mm/compaction
Charan Teja Reddy <charante@codeaurora.org>:
mm: compaction: optimize proactive compaction deferrals
mm: compaction: support triggering of proactive compaction by user
Subsystem: mm/mempolicy
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm/mempolicy: use readable NUMA_NO_NODE macro instead of magic number
Dave Hansen <dave.hansen@linux.intel.com>:
Patch series "Introduce multi-preference mempolicy", v7:
mm/mempolicy: add MPOL_PREFERRED_MANY for multiple preferred nodes
Feng Tang <feng.tang@intel.com>:
mm/memplicy: add page allocation function for MPOL_PREFERRED_MANY policy
Ben Widawsky <ben.widawsky@intel.com>:
mm/hugetlb: add support for mempolicy MPOL_PREFERRED_MANY
mm/mempolicy: advertise new MPOL_PREFERRED_MANY
Feng Tang <feng.tang@intel.com>:
mm/mempolicy: unify the create() func for bind/interleave/prefer-many policies
Vasily Averin <vvs@virtuozzo.com>:
mm/mempolicy.c: use in_task() in mempolicy_slab_node()
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
memblock: make memblock_find_in_range method private
Subsystem: mm/oom-kill
Suren Baghdasaryan <surenb@google.com>:
mm: introduce process_mrelease system call
mm: wire up syscall process_mrelease
Subsystem: mm/migration
Randy Dunlap <rdunlap@infradead.org>:
mm/migrate: correct kernel-doc notation
Subsystem: mm/ksm
Zhansaya Bagdauletkyzy <zhansayabagdaulet@gmail.com>:
Patch series "add KSM selftests":
selftests: vm: add KSM merge test
selftests: vm: add KSM unmerge test
selftests: vm: add KSM zero page merging test
selftests: vm: add KSM merging across nodes test
mm: KSM: fix data type
Patch series "add KSM performance tests", v3:
selftests: vm: add KSM merging time test
selftests: vm: add COW time test for KSM pages
Subsystem: mm/percpu
Jing Xiangfeng <jingxiangfeng@huawei.com>:
mm/percpu,c: remove obsolete comments of pcpu_chunk_populated()
Subsystem: mm/vmstat
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup for vmstat":
mm/vmstat: correct some wrong comments
mm/vmstat: simplify the array size calculation
mm/vmstat: remove unneeded return value
Subsystem: mm/madvise
zhangkui <zhangkui@oppo.com>:
mm/madvise: add MADV_WILLNEED to process_madvise()
Documentation/ABI/testing/sysfs-kernel-mm-numa | 24
Documentation/admin-guide/mm/numa_memory_policy.rst | 15
Documentation/admin-guide/sysctl/vm.rst | 3
Documentation/core-api/cachetlb.rst | 86 -
Documentation/dev-tools/kasan.rst | 13
Documentation/translations/zh_CN/core-api/cachetlb.rst | 9
Documentation/vm/hwpoison.rst | 1
arch/Kconfig | 28
arch/alpha/kernel/syscalls/syscall.tbl | 2
arch/arm/include/asm/cacheflush.h | 4
arch/arm/kernel/setup.c | 20
arch/arm/mach-rpc/ecard.c | 2
arch/arm/mm/flush.c | 33
arch/arm/mm/nommu.c | 6
arch/arm/tools/syscall.tbl | 2
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 2
arch/arm64/kvm/hyp/reserved_mem.c | 9
arch/arm64/mm/init.c | 38
arch/csky/abiv1/cacheflush.c | 11
arch/csky/abiv1/inc/abi/cacheflush.h | 4
arch/csky/kernel/probes/kprobes.c | 3
arch/ia64/include/asm/meminit.h | 2
arch/ia64/kernel/acpi.c | 2
arch/ia64/kernel/setup.c | 55
arch/ia64/kernel/syscalls/syscall.tbl | 2
arch/m68k/kernel/syscalls/syscall.tbl | 2
arch/microblaze/include/asm/page.h | 3
arch/microblaze/include/asm/pgtable.h | 2
arch/microblaze/kernel/syscalls/syscall.tbl | 2
arch/microblaze/mm/init.c | 12
arch/microblaze/mm/pgtable.c | 17
arch/mips/include/asm/cacheflush.h | 8
arch/mips/kernel/setup.c | 14
arch/mips/kernel/syscalls/syscall_n32.tbl | 2
arch/mips/kernel/syscalls/syscall_n64.tbl | 2
arch/mips/kernel/syscalls/syscall_o32.tbl | 2
arch/nds32/include/asm/cacheflush.h | 3
arch/nds32/mm/cacheflush.c | 9
arch/parisc/include/asm/cacheflush.h | 8
arch/parisc/kernel/cache.c | 3
arch/parisc/kernel/syscalls/syscall.tbl | 2
arch/powerpc/Kconfig | 1
arch/powerpc/kernel/smp.c | 2
arch/powerpc/kernel/syscalls/syscall.tbl | 2
arch/powerpc/mm/book3s64/radix_tlb.c | 4
arch/powerpc/platforms/pseries/hotplug-memory.c | 4
arch/riscv/mm/init.c | 44
arch/s390/kernel/setup.c | 9
arch/s390/kernel/syscalls/syscall.tbl | 2
arch/s390/mm/fault.c | 2
arch/sh/include/asm/cacheflush.h | 8
arch/sh/kernel/syscalls/syscall.tbl | 2
arch/sparc/kernel/syscalls/syscall.tbl | 2
arch/x86/entry/syscalls/syscall_32.tbl | 1
arch/x86/entry/syscalls/syscall_64.tbl | 1
arch/x86/kernel/aperture_64.c | 5
arch/x86/kernel/ldt.c | 6
arch/x86/mm/init.c | 23
arch/x86/mm/numa.c | 5
arch/x86/mm/numa_emulation.c | 5
arch/x86/realmode/init.c | 2
arch/xtensa/kernel/syscalls/syscall.tbl | 2
block/blk-map.c | 2
drivers/acpi/tables.c | 5
drivers/base/arch_numa.c | 5
drivers/base/memory.c | 4
drivers/mmc/host/jz4740_mmc.c | 4
drivers/mmc/host/mmc_spi.c | 2
drivers/of/of_reserved_mem.c | 12
fs/drop_caches.c | 3
fs/exec.c | 12
fs/fcntl.c | 3
fs/fs-writeback.c | 28
fs/fs_context.c | 4
fs/inode.c | 2
fs/locks.c | 6
fs/namei.c | 8
fs/namespace.c | 7
fs/ocfs2/dlmglue.c | 14
fs/ocfs2/quota_global.c | 1
fs/ocfs2/quota_local.c | 2
fs/pipe.c | 2
fs/select.c | 4
fs/userfaultfd.c | 116 -
include/linux/backing-dev-defs.h | 2
include/linux/backing-dev.h | 19
include/linux/buffer_head.h | 2
include/linux/compaction.h | 2
include/linux/highmem.h | 5
include/linux/hugetlb_cgroup.h | 12
include/linux/memblock.h | 2
include/linux/memcontrol.h | 118 +
include/linux/memory.h | 2
include/linux/mempolicy.h | 16
include/linux/migrate.h | 14
include/linux/mm.h | 17
include/linux/mmzone.h | 4
include/linux/page-flags.h | 9
include/linux/pagemap.h | 4
include/linux/sched/mm.h | 35
include/linux/shmem_fs.h | 25
include/linux/slub_def.h | 6
include/linux/swap.h | 28
include/linux/syscalls.h | 1
include/linux/userfaultfd_k.h | 8
include/linux/vm_event_item.h | 2
include/linux/vmpressure.h | 2
include/linux/writeback.h | 4
include/trace/events/migrate.h | 3
include/uapi/asm-generic/unistd.h | 4
include/uapi/linux/mempolicy.h | 1
ipc/msg.c | 2
ipc/namespace.c | 2
ipc/sem.c | 9
ipc/shm.c | 2
kernel/cgroup/namespace.c | 2
kernel/cpu.c | 2
kernel/exit.c | 2
kernel/fork.c | 51
kernel/kthread.c | 21
kernel/nsproxy.c | 2
kernel/pid_namespace.c | 5
kernel/sched/core.c | 37
kernel/sched/sched.h | 4
kernel/signal.c | 2
kernel/sys_ni.c | 1
kernel/sysctl.c | 2
kernel/time/namespace.c | 4
kernel/time/posix-timers.c | 4
kernel/user_namespace.c | 2
lib/scatterlist.c | 5
lib/test_kasan.c | 80 -
lib/test_kasan_module.c | 20
lib/test_vmalloc.c | 5
mm/backing-dev.c | 11
mm/bootmem_info.c | 4
mm/compaction.c | 69 -
mm/debug_vm_pgtable.c | 982 +++++++++------
mm/filemap.c | 15
mm/gup.c | 109 -
mm/huge_memory.c | 32
mm/hugetlb.c | 173 ++
mm/hwpoison-inject.c | 2
mm/internal.h | 9
mm/kasan/hw_tags.c | 43
mm/kasan/kasan.h | 1
mm/kasan/report.c | 29
mm/khugepaged.c | 2
mm/ksm.c | 8
mm/madvise.c | 1
mm/memblock.c | 22
mm/memcontrol.c | 234 +--
mm/memory-failure.c | 53
mm/memory_hotplug.c | 2
mm/mempolicy.c | 207 ++-
mm/migrate.c | 319 ++++
mm/mmap.c | 7
mm/mremap.c | 2
mm/oom_kill.c | 70 +
mm/page-writeback.c | 133 +-
mm/page_alloc.c | 62
mm/page_isolation.c | 13
mm/percpu.c | 3
mm/shmem.c | 309 ++--
mm/slab_common.c | 2
mm/slub.c | 1085 ++++++++++-------
mm/sparse.c | 46
mm/swap.c | 22
mm/swapfile.c | 14
mm/truncate.c | 28
mm/userfaultfd.c | 15
mm/vmalloc.c | 79 -
mm/vmpressure.c | 10
mm/vmscan.c | 220 ++-
mm/vmstat.c | 25
security/tomoyo/domain.c | 13
tools/testing/scatterlist/linux/mm.h | 1
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 3
tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 5
tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 5
tools/testing/selftests/vm/ksm_tests.c | 696 ++++++++++
tools/testing/selftests/vm/mlock-random-test.c | 2
tools/testing/selftests/vm/run_vmtests.sh | 98 +
tools/testing/selftests/vm/userfaultfd.c | 13
186 files changed, 4488 insertions(+), 2281 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-09-02 21:48 incoming Andrew Morton
@ 2021-09-02 21:49 ` Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-09-02 21:49 UTC (permalink / raw)
To: Linus Torvalds, linux-mm, mm-commits
On Thu, 2 Sep 2021 14:48:20 -0700 Andrew Morton <akpm@linux-foundation.org> wrote:
> 212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b.
Make that "based on 7d2a07b769330c34b4deabeed939325c77a7ec2f".
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-09-08 2:52 Andrew Morton
2021-09-08 8:57 ` incoming Vlastimil Babka
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2021-09-08 2:52 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
147 patches, based on 7d2a07b769330c34b4deabeed939325c77a7ec2f.
Subsystems affected by this patch series:
mm/slub
mm/memory-hotplug
mm/rmap
mm/ioremap
mm/highmem
mm/cleanups
mm/secretmem
mm/kfence
mm/damon
alpha
percpu
procfs
misc
core-kernel
MAINTAINERS
lib
bitops
checkpatch
epoll
init
nilfs2
coredump
fork
pids
criu
kconfig
selftests
ipc
mm/vmscan
scripts
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6:
mm, slub: don't call flush_all() from slab_debug_trace_open()
mm, slub: allocate private object map for debugfs listings
mm, slub: allocate private object map for validate_slab_cache()
mm, slub: don't disable irq for debug_check_no_locks_freed()
mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
mm, slub: extract get_partial() from new_slab_objects()
mm, slub: dissolve new_slab_objects() into ___slab_alloc()
mm, slub: return slab page from get_partial() and set c->page afterwards
mm, slub: restructure new page checks in ___slab_alloc()
mm, slub: simplify kmem_cache_cpu and tid setup
mm, slub: move disabling/enabling irqs to ___slab_alloc()
mm, slub: do initial checks in ___slab_alloc() with irqs enabled
mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
mm, slub: restore irqs around calling new_slab()
mm, slub: validate slab from partial list or page allocator before making it cpu slab
mm, slub: check new pages with restored irqs
mm, slub: stop disabling irqs around get_partial()
mm, slub: move reset of c->page and freelist out of deactivate_slab()
mm, slub: make locking in deactivate_slab() irq-safe
mm, slub: call deactivate_slab() without disabling irqs
mm, slub: move irq control into unfreeze_partials()
mm, slub: discard slabs in unfreeze_partials() without irqs disabled
mm, slub: detach whole partial list at once in unfreeze_partials()
mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
mm, slub: only disable irq with spin_lock in __unfreeze_partials()
mm, slub: don't disable irqs in slub_cpu_dead()
mm, slab: split out the cpu offline variant of flush_slab()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
mm: slub: make object_map_lock a raw_spinlock_t
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: make slab_lock() disable irqs with PREEMPT_RT
mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
mm, slub: use migrate_disable() on PREEMPT_RT
mm, slub: convert kmem_cpu_slab protection to local_lock
Subsystem: mm/memory-hotplug
David Hildenbrand <david@redhat.com>:
Patch series "memory-hotplug.rst: complete admin-guide overhaul", v3:
memory-hotplug.rst: remove locking details from admin-guide
memory-hotplug.rst: complete admin-guide overhaul
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE":
mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE
mm: memory_hotplug: cleanup after removal of pfn_valid_within()
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: preparatory patches for new online policy and memory":
mm/memory_hotplug: use "unsigned long" for PFN in zone_for_pfn_range()
mm/memory_hotplug: remove nid parameter from arch_remove_memory()
mm/memory_hotplug: remove nid parameter from remove_memory() and friends
ACPI: memhotplug: memory resources cannot be enabled yet
Patch series "mm/memory_hotplug: "auto-movable" online policy and memory groups", v3:
mm: track present early pages per zone
mm/memory_hotplug: introduce "auto-movable" online policy
drivers/base/memory: introduce "memory groups" to logically group memory blocks
mm/memory_hotplug: track present pages in memory groups
ACPI: memhotplug: use a single static memory group for a single memory device
dax/kmem: use a single static memory group for a single probed unit
virtio-mem: use a single dynamic memory group for a single virtio-mem device
mm/memory_hotplug: memory group aware "auto-movable" online policy
mm/memory_hotplug: improved dynamic memory group aware "auto-movable" online policy
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixups for memory hotplug":
mm/memory_hotplug: use helper zone_is_zone_device() to simplify the code
Subsystem: mm/rmap
Muchun Song <songmuchun@bytedance.com>:
mm: remove redundant compound_head() calling
Subsystem: mm/ioremap
Christoph Hellwig <hch@lst.de>:
riscv: only select GENERIC_IOREMAP if MMU support is enabled
Patch series "small ioremap cleanups":
mm: move ioremap_page_range to vmalloc.c
mm: don't allow executable ioremap mappings
Weizhao Ouyang <o451686892@gmail.com>:
mm/early_ioremap.c: remove redundant early_ioremap_shutdown()
Subsystem: mm/highmem
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
highmem: don't disable preemption on RT in kmap_atomic()
Subsystem: mm/cleanups
Changbin Du <changbin.du@gmail.com>:
mm: in_irq() cleanup
Muchun Song <songmuchun@bytedance.com>:
mm: introduce PAGEFLAGS_MASK to replace ((1UL << NR_PAGEFLAGS) - 1)
Subsystem: mm/secretmem
Jordy Zomer <jordy@jordyzomer.github.io>:
mm/secretmem: use refcount_t instead of atomic_t
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: show cpu and timestamp in alloc/free info
kfence: test: fail fast if disabled at boot
Subsystem: mm/damon
SeongJae Park <sjpark@amazon.de>:
Patch series "Introduce Data Access MONitor (DAMON)", v34:
mm: introduce Data Access MONitor (DAMON)
mm/damon/core: implement region-based sampling
mm/damon: adaptively adjust regions
mm/idle_page_tracking: make PG_idle reusable
mm/damon: implement primitives for the virtual memory address spaces
mm/damon: add a tracepoint
mm/damon: implement a debugfs-based user space interface
mm/damon/dbgfs: export kdamond pid to the user space
mm/damon/dbgfs: support multiple contexts
Documentation: add documents for DAMON
mm/damon: add kunit tests
mm/damon: add user space selftests
MAINTAINERS: update for DAMON
Subsystem: alpha
Randy Dunlap <rdunlap@infradead.org>:
alpha: agp: make empty macros use do-while-0 style
alpha: pci-sysfs: fix all kernel-doc warnings
Subsystem: percpu
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
percpu: remove export of pcpu_base_addr
Subsystem: procfs
Feng Zhou <zhoufeng.zf@bytedance.com>:
fs/proc/kcore.c: add mmap interface
Christoph Hellwig <hch@lst.de>:
proc: stop using seq_get_buf in proc_task_name
Ohhoon Kwon <ohoono.kwon@samsung.com>:
connector: send event on write to /proc/[pid]/comm
Subsystem: misc
Colin Ian King <colin.king@canonical.com>:
arch: Kconfig: fix spelling mistake "seperate" -> "separate"
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
include/linux/once.h: fix trivia typo Not -> Note
Daniel Lezcano <daniel.lezcano@linaro.org>:
Patch series "Add Hz macros", v3:
units: change from 'L' to 'UL'
units: add the HZ macros
thermal/drivers/devfreq_cooling: use HZ macros
devfreq: use HZ macros
iio/drivers/as73211: use HZ macros
hwmon/drivers/mr75203: use HZ macros
iio/drivers/hid-sensor: use HZ macros
i2c/drivers/ov02q10: use HZ macros
mtd/drivers/nand: use HZ macros
phy/drivers/stm32: use HZ macros
Subsystem: core-kernel
Yang Yang <yang.yang29@zte.com.cn>:
kernel/acct.c: use dedicated helper to access rlimit values
Pavel Skripkin <paskripkin@gmail.com>:
profiling: fix shift-out-of-bounds bugs
Subsystem: MAINTAINERS
Nathan Chancellor <nathan@kernel.org>:
MAINTAINERS: update ClangBuiltLinux mailing list
Documentation/llvm: update mailing list
Documentation/llvm: update IRC location
Subsystem: lib
Geert Uytterhoeven <geert@linux-m68k.org>:
Patch series "math: RATIONAL and RATIONAL_KUNIT_TEST improvements":
math: make RATIONAL tristate
math: RATIONAL_KUNIT_TEST should depend on RATIONAL instead of selecting it
Matteo Croce <mcroce@microsoft.com>:
Patch series "lib/string: optimized mem* functions", v2:
lib/string: optimized memcpy
lib/string: optimized memmove
lib/string: optimized memset
Daniel Latypov <dlatypov@google.com>:
lib/test: convert test_sort.c to use KUnit
Randy Dunlap <rdunlap@infradead.org>:
lib/dump_stack: correct kernel-doc notation
lib/iov_iter.c: fix kernel-doc warnings
Subsystem: bitops
Yury Norov <yury.norov@gmail.com>:
Patch series "Resend bitmap patches":
bitops: protect find_first_{,zero}_bit properly
bitops: move find_bit_*_le functions from le.h to find.h
include: move find.h from asm_generic to linux
arch: remove GENERIC_FIND_FIRST_BIT entirely
lib: add find_first_and_bit()
cpumask: use find_first_and_bit()
all: replace find_next{,_zero}_bit with find_first{,_zero}_bit where appropriate
tools: sync tools/bitmap with mother linux
cpumask: replace cpumask_next_* with cpumask_first_* where appropriate
include/linux: move for_each_bit() macros from bitops.h to find.h
find: micro-optimize for_each_{set,clear}_bit()
bitops: replace for_each_*_bit_from() with for_each_*_bit() where appropriate
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
tools: rename bitmap_alloc() to bitmap_zalloc()
Yury Norov <yury.norov@gmail.com>:
mm/percpu: micro-optimize pcpu_is_populated()
bitmap: unify find_bit operations
lib: bitmap: add performance test for bitmap_print_to_pagebuf
vsprintf: rework bitmap_list_string
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: support wide strings
Mimi Zohar <zohar@linux.ibm.com>:
checkpatch: make email address check case insensitive
Joe Perches <joe@perches.com>:
checkpatch: improve GIT_COMMIT_ID test
Subsystem: epoll
Nicholas Piggin <npiggin@gmail.com>:
fs/epoll: use a per-cpu counter for user's watches count
Subsystem: init
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
init: move usermodehelper_enable() to populate_rootfs()
Kefeng Wang <wangkefeng.wang@huawei.com>:
trap: cleanup trap_init()
Subsystem: nilfs2
Nanyong Sun <sunnanyong@huawei.com>:
Patch series "nilfs2: fix incorrect usage of kobject":
nilfs2: fix memory leak in nilfs_sysfs_create_device_group
nilfs2: fix NULL pointer in nilfs_##name##_attr_release
nilfs2: fix memory leak in nilfs_sysfs_create_##name##_group
nilfs2: fix memory leak in nilfs_sysfs_delete_##name##_group
nilfs2: fix memory leak in nilfs_sysfs_create_snapshot_group
nilfs2: fix memory leak in nilfs_sysfs_delete_snapshot_group
Zhen Lei <thunder.leizhen@huawei.com>:
nilfs2: use refcount_dec_and_lock() to fix potential UAF
Subsystem: coredump
David Oberhollenzer <david.oberhollenzer@sigma-star.at>:
fs/coredump.c: log if a core dump is aborted due to changed file permissions
QiuXi <qiuxi1@huawei.com>:
coredump: fix memleak in dump_vma_snapshot()
Subsystem: fork
Christoph Hellwig <hch@lst.de>:
kernel/fork.c: unexport get_{mm,task}_exe_file
Subsystem: pids
Takahiro Itazuri <itazur@amazon.com>:
pid: cleanup the stale comment mentioning pidmap_init().
Subsystem: criu
Cyrill Gorcunov <gorcunov@gmail.com>:
prctl: allow to setup brk for et_dyn executables
Subsystem: kconfig
Zenghui Yu <yuzenghui@huawei.com>:
configs: remove the obsolete CONFIG_INPUT_POLLDEV
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
Kconfig.debug: drop selecting non-existing HARDLOCKUP_DETECTOR_ARCH
Subsystem: selftests
Greg Thelen <gthelen@google.com>:
selftests/memfd: remove unused variable
Subsystem: ipc
Rafael Aquini <aquini@redhat.com>:
ipc: replace costly bailout check in sysvipc_find_ipc()
Subsystem: mm/vmscan
Randy Dunlap <rdunlap@infradead.org>:
mm/workingset: correct kernel-doc notations
Subsystem: scripts
Randy Dunlap <rdunlap@infradead.org>:
scripts: check_extable: fix typo in user error message
a/Documentation/admin-guide/mm/damon/index.rst | 15
a/Documentation/admin-guide/mm/damon/start.rst | 114 +
a/Documentation/admin-guide/mm/damon/usage.rst | 112 +
a/Documentation/admin-guide/mm/index.rst | 1
a/Documentation/admin-guide/mm/memory-hotplug.rst | 842 ++++++-----
a/Documentation/dev-tools/kfence.rst | 98 -
a/Documentation/kbuild/llvm.rst | 5
a/Documentation/vm/damon/api.rst | 20
a/Documentation/vm/damon/design.rst | 166 ++
a/Documentation/vm/damon/faq.rst | 51
a/Documentation/vm/damon/index.rst | 30
a/Documentation/vm/index.rst | 1
a/MAINTAINERS | 17
a/arch/Kconfig | 2
a/arch/alpha/include/asm/agp.h | 4
a/arch/alpha/include/asm/bitops.h | 2
a/arch/alpha/kernel/pci-sysfs.c | 12
a/arch/arc/Kconfig | 1
a/arch/arc/include/asm/bitops.h | 1
a/arch/arc/kernel/traps.c | 5
a/arch/arm/configs/dove_defconfig | 1
a/arch/arm/configs/pxa_defconfig | 1
a/arch/arm/include/asm/bitops.h | 1
a/arch/arm/kernel/traps.c | 5
a/arch/arm64/Kconfig | 1
a/arch/arm64/include/asm/bitops.h | 1
a/arch/arm64/mm/mmu.c | 3
a/arch/csky/include/asm/bitops.h | 1
a/arch/h8300/include/asm/bitops.h | 1
a/arch/h8300/kernel/traps.c | 4
a/arch/hexagon/include/asm/bitops.h | 1
a/arch/hexagon/kernel/traps.c | 4
a/arch/ia64/include/asm/bitops.h | 2
a/arch/ia64/mm/init.c | 3
a/arch/m68k/include/asm/bitops.h | 2
a/arch/mips/Kconfig | 1
a/arch/mips/configs/lemote2f_defconfig | 1
a/arch/mips/configs/pic32mzda_defconfig | 1
a/arch/mips/configs/rt305x_defconfig | 1
a/arch/mips/configs/xway_defconfig | 1
a/arch/mips/include/asm/bitops.h | 1
a/arch/nds32/kernel/traps.c | 5
a/arch/nios2/kernel/traps.c | 5
a/arch/openrisc/include/asm/bitops.h | 1
a/arch/openrisc/kernel/traps.c | 5
a/arch/parisc/configs/generic-32bit_defconfig | 1
a/arch/parisc/include/asm/bitops.h | 2
a/arch/parisc/kernel/traps.c | 4
a/arch/powerpc/include/asm/bitops.h | 2
a/arch/powerpc/include/asm/cputhreads.h | 2
a/arch/powerpc/kernel/traps.c | 5
a/arch/powerpc/mm/mem.c | 3
a/arch/powerpc/platforms/pasemi/dma_lib.c | 4
a/arch/powerpc/platforms/pseries/hotplug-memory.c | 9
a/arch/riscv/Kconfig | 2
a/arch/riscv/include/asm/bitops.h | 1
a/arch/riscv/kernel/traps.c | 5
a/arch/s390/Kconfig | 1
a/arch/s390/include/asm/bitops.h | 1
a/arch/s390/kvm/kvm-s390.c | 2
a/arch/s390/mm/init.c | 3
a/arch/sh/include/asm/bitops.h | 1
a/arch/sh/mm/init.c | 3
a/arch/sparc/include/asm/bitops_32.h | 1
a/arch/sparc/include/asm/bitops_64.h | 2
a/arch/um/kernel/trap.c | 4
a/arch/x86/Kconfig | 1
a/arch/x86/configs/i386_defconfig | 1
a/arch/x86/configs/x86_64_defconfig | 1
a/arch/x86/include/asm/bitops.h | 2
a/arch/x86/kernel/apic/vector.c | 4
a/arch/x86/mm/init_32.c | 3
a/arch/x86/mm/init_64.c | 3
a/arch/x86/um/Kconfig | 1
a/arch/xtensa/include/asm/bitops.h | 1
a/block/blk-mq.c | 2
a/drivers/acpi/acpi_memhotplug.c | 46
a/drivers/base/memory.c | 231 ++-
a/drivers/base/node.c | 2
a/drivers/block/rnbd/rnbd-clt.c | 2
a/drivers/dax/kmem.c | 43
a/drivers/devfreq/devfreq.c | 2
a/drivers/dma/ti/edma.c | 2
a/drivers/gpu/drm/etnaviv/etnaviv_gpu.c | 4
a/drivers/hwmon/ltc2992.c | 3
a/drivers/hwmon/mr75203.c | 2
a/drivers/iio/adc/ad7124.c | 2
a/drivers/iio/common/hid-sensors/hid-sensor-attributes.c | 3
a/drivers/iio/light/as73211.c | 3
a/drivers/infiniband/hw/irdma/hw.c | 16
a/drivers/media/cec/core/cec-core.c | 2
a/drivers/media/i2c/ov02a10.c | 2
a/drivers/media/mc/mc-devnode.c | 2
a/drivers/mmc/host/renesas_sdhi_core.c | 2
a/drivers/mtd/nand/raw/intel-nand-controller.c | 2
a/drivers/net/virtio_net.c | 2
a/drivers/pci/controller/dwc/pci-dra7xx.c | 2
a/drivers/phy/st/phy-stm32-usbphyc.c | 2
a/drivers/scsi/lpfc/lpfc_sli.c | 10
a/drivers/soc/fsl/qbman/bman_portal.c | 2
a/drivers/soc/fsl/qbman/qman_portal.c | 2
a/drivers/soc/ti/k3-ringacc.c | 4
a/drivers/thermal/devfreq_cooling.c | 2
a/drivers/tty/n_tty.c | 2
a/drivers/virt/acrn/ioreq.c | 3
a/drivers/virtio/virtio_mem.c | 26
a/fs/coredump.c | 15
a/fs/eventpoll.c | 18
a/fs/f2fs/segment.c | 8
a/fs/nilfs2/sysfs.c | 26
a/fs/nilfs2/the_nilfs.c | 9
a/fs/ocfs2/cluster/heartbeat.c | 2
a/fs/ocfs2/dlm/dlmdomain.c | 4
a/fs/ocfs2/dlm/dlmmaster.c | 18
a/fs/ocfs2/dlm/dlmrecovery.c | 2
a/fs/ocfs2/dlm/dlmthread.c | 2
a/fs/proc/array.c | 18
a/fs/proc/base.c | 5
a/fs/proc/kcore.c | 73
a/include/asm-generic/bitops.h | 1
a/include/asm-generic/bitops/find.h | 198 --
a/include/asm-generic/bitops/le.h | 64
a/include/asm-generic/early_ioremap.h | 6
a/include/linux/bitmap.h | 34
a/include/linux/bitops.h | 34
a/include/linux/cpumask.h | 46
a/include/linux/damon.h | 290 +++
a/include/linux/find.h | 134 +
a/include/linux/highmem-internal.h | 27
a/include/linux/memory.h | 55
a/include/linux/memory_hotplug.h | 40
a/include/linux/mmzone.h | 19
a/include/linux/once.h | 2
a/include/linux/page-flags.h | 17
a/include/linux/page_ext.h | 2
a/include/linux/page_idle.h | 6
a/include/linux/pagemap.h | 7
a/include/linux/sched/user.h | 3
a/include/linux/slub_def.h | 6
a/include/linux/threads.h | 2
a/include/linux/units.h | 10
a/include/linux/vmalloc.h | 3
a/include/trace/events/damon.h | 43
a/include/trace/events/mmflags.h | 2
a/include/trace/events/page_ref.h | 4
a/init/initramfs.c | 2
a/init/main.c | 3
a/init/noinitramfs.c | 2
a/ipc/util.c | 16
a/kernel/acct.c | 2
a/kernel/fork.c | 2
a/kernel/profile.c | 21
a/kernel/sys.c | 7
a/kernel/time/clocksource.c | 4
a/kernel/user.c | 25
a/lib/Kconfig | 3
a/lib/Kconfig.debug | 9
a/lib/dump_stack.c | 3
a/lib/find_bit.c | 21
a/lib/find_bit_benchmark.c | 21
a/lib/genalloc.c | 2
a/lib/iov_iter.c | 8
a/lib/math/Kconfig | 2
a/lib/math/rational.c | 3
a/lib/string.c | 130 +
a/lib/test_bitmap.c | 37
a/lib/test_printf.c | 2
a/lib/test_sort.c | 40
a/lib/vsprintf.c | 26
a/mm/Kconfig | 15
a/mm/Makefile | 4
a/mm/compaction.c | 20
a/mm/damon/Kconfig | 68
a/mm/damon/Makefile | 5
a/mm/damon/core-test.h | 253 +++
a/mm/damon/core.c | 748 ++++++++++
a/mm/damon/dbgfs-test.h | 126 +
a/mm/damon/dbgfs.c | 631 ++++++++
a/mm/damon/vaddr-test.h | 329 ++++
a/mm/damon/vaddr.c | 672 +++++++++
a/mm/early_ioremap.c | 5
a/mm/highmem.c | 2
a/mm/ioremap.c | 25
a/mm/kfence/core.c | 3
a/mm/kfence/kfence.h | 2
a/mm/kfence/kfence_test.c | 3
a/mm/kfence/report.c | 19
a/mm/kmemleak.c | 2
a/mm/memory_hotplug.c | 396 ++++-
a/mm/memremap.c | 5
a/mm/page_alloc.c | 27
a/mm/page_ext.c | 12
a/mm/page_idle.c | 10
a/mm/page_isolation.c | 7
a/mm/page_owner.c | 14
a/mm/percpu.c | 36
a/mm/rmap.c | 6
a/mm/secretmem.c | 9
a/mm/slab_common.c | 2
a/mm/slub.c | 1023 +++++++++-----
a/mm/vmalloc.c | 24
a/mm/workingset.c | 2
a/net/ncsi/ncsi-manage.c | 4
a/scripts/check_extable.sh | 2
a/scripts/checkpatch.pl | 93 -
a/tools/include/linux/bitmap.h | 4
a/tools/perf/bench/find-bit-bench.c | 2
a/tools/perf/builtin-c2c.c | 6
a/tools/perf/builtin-record.c | 2
a/tools/perf/tests/bitmap.c | 2
a/tools/perf/tests/mem2node.c | 2
a/tools/perf/util/affinity.c | 4
a/tools/perf/util/header.c | 4
a/tools/perf/util/metricgroup.c | 2
a/tools/perf/util/mmap.c | 4
a/tools/testing/selftests/damon/Makefile | 7
a/tools/testing/selftests/damon/_chk_dependency.sh | 28
a/tools/testing/selftests/damon/debugfs_attrs.sh | 75 +
a/tools/testing/selftests/kvm/dirty_log_perf_test.c | 2
a/tools/testing/selftests/kvm/dirty_log_test.c | 4
a/tools/testing/selftests/kvm/x86_64/vmx_dirty_log_test.c | 2
a/tools/testing/selftests/memfd/memfd_test.c | 2
b/MAINTAINERS | 2
b/tools/include/asm-generic/bitops.h | 1
b/tools/include/linux/bitmap.h | 7
b/tools/include/linux/find.h | 81 +
b/tools/lib/find_bit.c | 20
227 files changed, 6695 insertions(+), 1875 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-09-08 2:52 incoming Andrew Morton
@ 2021-09-08 8:57 ` Vlastimil Babka
0 siblings, 0 replies; 419+ messages in thread
From: Vlastimil Babka @ 2021-09-08 8:57 UTC (permalink / raw)
To: Andrew Morton, Linus Torvalds
Cc: linux-mm, mm-commits, Mike Galbraith, Mel Gorman
On 9/8/21 04:52, Andrew Morton wrote:
> Subsystem: mm/slub
>
> Vlastimil Babka <vbabka@suse.cz>:
> Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6:
> mm, slub: don't call flush_all() from slab_debug_trace_open()
> mm, slub: allocate private object map for debugfs listings
> mm, slub: allocate private object map for validate_slab_cache()
> mm, slub: don't disable irq for debug_check_no_locks_freed()
> mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
> mm, slub: extract get_partial() from new_slab_objects()
> mm, slub: dissolve new_slab_objects() into ___slab_alloc()
> mm, slub: return slab page from get_partial() and set c->page afterwards
> mm, slub: restructure new page checks in ___slab_alloc()
> mm, slub: simplify kmem_cache_cpu and tid setup
> mm, slub: move disabling/enabling irqs to ___slab_alloc()
> mm, slub: do initial checks in ___slab_alloc() with irqs enabled
> mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
> mm, slub: restore irqs around calling new_slab()
> mm, slub: validate slab from partial list or page allocator before making it cpu slab
> mm, slub: check new pages with restored irqs
> mm, slub: stop disabling irqs around get_partial()
> mm, slub: move reset of c->page and freelist out of deactivate_slab()
> mm, slub: make locking in deactivate_slab() irq-safe
> mm, slub: call deactivate_slab() without disabling irqs
> mm, slub: move irq control into unfreeze_partials()
> mm, slub: discard slabs in unfreeze_partials() without irqs disabled
> mm, slub: detach whole partial list at once in unfreeze_partials()
> mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
> mm, slub: only disable irq with spin_lock in __unfreeze_partials()
> mm, slub: don't disable irqs in slub_cpu_dead()
> mm, slab: split out the cpu offline variant of flush_slab()
>
> Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
> mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
> mm: slub: make object_map_lock a raw_spinlock_t
>
> Vlastimil Babka <vbabka@suse.cz>:
> mm, slub: make slab_lock() disable irqs with PREEMPT_RT
> mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
> mm, slub: use migrate_disable() on PREEMPT_RT
> mm, slub: convert kmem_cpu_slab protection to local_lock
For my own piece of mind, I've checked that this part (patches 1 to 33)
are identical to the v6 posting [1] and git version [2] that Mel and
Mike tested (replies to [1]).
[1] https://lore.kernel.org/all/20210904105003.11688-1-vbabka@suse.cz/
[2] git://git.kernel.org/pub/scm/linux/kernel/git/vbabka/linux.git
tags/mm-slub-5.15-rc1
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-09-08 22:17 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-09-08 22:17 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
This is the post-linux-next material, so it is based upon latest
upstream to catch the now-merged dependencies.
10 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c.
Subsystems affected by this patch series:
mm/vmstat
mm/migration
compat
Subsystem: mm/vmstat
Ingo Molnar <mingo@elte.hu>:
mm/vmstat: protect per cpu variables with preempt disable on RT
Subsystem: mm/migration
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: migrate: introduce a local variable to get the number of pages
mm: migrate: fix the incorrect function name in comments
mm: migrate: change to use bool type for 'page_was_mapped'
Subsystem: compat
Arnd Bergmann <arnd@arndb.de>:
Patch series "compat: remove compat_alloc_user_space", v5:
kexec: move locking into do_kexec_load
kexec: avoid compat_alloc_user_space
mm: simplify compat_sys_move_pages
mm: simplify compat numa syscalls
compat: remove some compat entry points
arch: remove compat_alloc_user_space
arch/arm64/include/asm/compat.h | 5
arch/arm64/include/asm/uaccess.h | 11 -
arch/arm64/include/asm/unistd32.h | 10 -
arch/arm64/lib/Makefile | 2
arch/arm64/lib/copy_in_user.S | 77 ----------
arch/mips/cavium-octeon/octeon-memcpy.S | 2
arch/mips/include/asm/compat.h | 8 -
arch/mips/include/asm/uaccess.h | 26 ---
arch/mips/kernel/syscalls/syscall_n32.tbl | 10 -
arch/mips/kernel/syscalls/syscall_o32.tbl | 10 -
arch/mips/lib/memcpy.S | 11 -
arch/parisc/include/asm/compat.h | 6
arch/parisc/include/asm/uaccess.h | 2
arch/parisc/kernel/syscalls/syscall.tbl | 8 -
arch/parisc/lib/memcpy.c | 9 -
arch/powerpc/include/asm/compat.h | 16 --
arch/powerpc/kernel/syscalls/syscall.tbl | 10 -
arch/s390/include/asm/compat.h | 10 -
arch/s390/include/asm/uaccess.h | 3
arch/s390/kernel/syscalls/syscall.tbl | 10 -
arch/s390/lib/uaccess.c | 63 --------
arch/sparc/include/asm/compat.h | 19 --
arch/sparc/kernel/process_64.c | 2
arch/sparc/kernel/signal32.c | 12 -
arch/sparc/kernel/signal_64.c | 8 -
arch/sparc/kernel/syscalls/syscall.tbl | 10 -
arch/x86/entry/syscalls/syscall_32.tbl | 4
arch/x86/entry/syscalls/syscall_64.tbl | 2
arch/x86/include/asm/compat.h | 13 -
arch/x86/include/asm/uaccess_64.h | 7
include/linux/compat.h | 39 +----
include/linux/uaccess.h | 10 -
include/uapi/asm-generic/unistd.h | 10 -
kernel/compat.c | 21 --
kernel/kexec.c | 105 +++++---------
kernel/sys_ni.c | 5
mm/mempolicy.c | 213 +++++++-----------------------
mm/migrate.c | 69 +++++----
mm/vmstat.c | 48 ++++++
39 files changed, 243 insertions(+), 663 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-09-09 1:08 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-09-09 1:08 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
A bunch of hotfixes, mostly cc:stable.
8 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c.
Subsystems affected by this patch series:
mm/hmm
mm/hugetlb
mm/vmscan
mm/pagealloc
mm/pagemap
mm/kmemleak
mm/mempolicy
mm/memblock
Subsystem: mm/hmm
Li Zhijian <lizhijian@cn.fujitsu.com>:
mm/hmm: bypass devmap pte when all pfn requested flags are fulfilled
Subsystem: mm/hugetlb
Liu Zixian <liuzixian4@huawei.com>:
mm/hugetlb: initialize hugetlb_usage in mm_init
Subsystem: mm/vmscan
Rik van Riel <riel@surriel.com>:
mm,vmscan: fix divide by zero in get_scan_count
Subsystem: mm/pagealloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/page_alloc.c: avoid accessing uninitialized pcp page migratetype
Subsystem: mm/pagemap
Liam Howlett <liam.howlett@oracle.com>:
mmap_lock: change trace and locking order
Subsystem: mm/kmemleak
Naohiro Aota <naohiro.aota@wdc.com>:
mm/kmemleak: allow __GFP_NOLOCKDEP passed to kmemleak's gfp
Subsystem: mm/mempolicy
yanghui <yanghui.def@bytedance.com>:
mm/mempolicy: fix a race between offset_il_node and mpol_rebind_task
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
nds32/setup: remove unused memblock_region variable in setup_memory()
arch/nds32/kernel/setup.c | 1 -
include/linux/hugetlb.h | 9 +++++++++
include/linux/mmap_lock.h | 8 ++++----
kernel/fork.c | 1 +
mm/hmm.c | 5 ++++-
mm/kmemleak.c | 3 ++-
mm/mempolicy.c | 17 +++++++++++++----
mm/page_alloc.c | 4 +++-
mm/vmscan.c | 2 +-
9 files changed, 37 insertions(+), 13 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-09-10 3:09 Andrew Morton
2021-09-10 17:11 ` incoming Kees Cook
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2021-09-10 3:09 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
More post linux-next material.
9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
Subsystems affected by this patch series:
mm/slab-generic
rapidio
mm/debug
Subsystem: mm/slab-generic
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: move kvmalloc-related functions to slab.h
Subsystem: rapidio
Kees Cook <keescook@chromium.org>:
rapidio: avoid bogus __alloc_size warning
Subsystem: mm/debug
Kees Cook <keescook@chromium.org>:
Patch series "Add __alloc_size() for better bounds checking", v2:
Compiler Attributes: add __alloc_size() for better bounds checking
checkpatch: add __alloc_size() to known $Attribute
slab: clean up function declarations
slab: add __alloc_size attributes for better bounds checking
mm/page_alloc: add __alloc_size attributes for better bounds checking
percpu: add __alloc_size attributes for better bounds checking
mm/vmalloc: add __alloc_size attributes for better bounds checking
Makefile | 15 +++
drivers/of/kexec.c | 1
drivers/rapidio/devices/rio_mport_cdev.c | 9 +-
include/linux/compiler_attributes.h | 6 +
include/linux/gfp.h | 2
include/linux/mm.h | 34 --------
include/linux/percpu.h | 3
include/linux/slab.h | 122 ++++++++++++++++++++++---------
include/linux/vmalloc.h | 11 ++
scripts/checkpatch.pl | 3
10 files changed, 132 insertions(+), 74 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-09-10 3:09 incoming Andrew Morton
@ 2021-09-10 17:11 ` Kees Cook
2021-09-10 20:13 ` incoming Kees Cook
0 siblings, 1 reply; 419+ messages in thread
From: Kees Cook @ 2021-09-10 17:11 UTC (permalink / raw)
To: Linus Torvalds, Andrew Morton; +Cc: linux-mm, mm-commits
On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote:
>
> More post linux-next material.
>
> 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
>
> Subsystems affected by this patch series:
>
> mm/slab-generic
> rapidio
> mm/debug
>
> Subsystem: mm/slab-generic
>
> "Matthew Wilcox (Oracle)" <willy@infradead.org>:
> mm: move kvmalloc-related functions to slab.h
>
> Subsystem: rapidio
>
> Kees Cook <keescook@chromium.org>:
> rapidio: avoid bogus __alloc_size warning
>
> Subsystem: mm/debug
>
> Kees Cook <keescook@chromium.org>:
> Patch series "Add __alloc_size() for better bounds checking", v2:
> Compiler Attributes: add __alloc_size() for better bounds checking
> checkpatch: add __alloc_size() to known $Attribute
> slab: clean up function declarations
> slab: add __alloc_size attributes for better bounds checking
> mm/page_alloc: add __alloc_size attributes for better bounds checking
> percpu: add __alloc_size attributes for better bounds checking
> mm/vmalloc: add __alloc_size attributes for better bounds checking
Hi,
FYI, in overnight build testing I found yet another corner case in
GCC's handling of the __alloc_size attribute. It's the gift that keeps
on giving. The fix is here:
https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/
>
> Makefile | 15 +++
> drivers/of/kexec.c | 1
> drivers/rapidio/devices/rio_mport_cdev.c | 9 +-
> include/linux/compiler_attributes.h | 6 +
> include/linux/gfp.h | 2
> include/linux/mm.h | 34 --------
> include/linux/percpu.h | 3
> include/linux/slab.h | 122 ++++++++++++++++++++++---------
> include/linux/vmalloc.h | 11 ++
> scripts/checkpatch.pl | 3
> 10 files changed, 132 insertions(+), 74 deletions(-)
>
--
Kees Cook
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2021-09-10 17:11 ` incoming Kees Cook
@ 2021-09-10 20:13 ` Kees Cook
0 siblings, 0 replies; 419+ messages in thread
From: Kees Cook @ 2021-09-10 20:13 UTC (permalink / raw)
To: linux-kernel; +Cc: Linus Torvalds, Andrew Morton, linux-mm, mm-commits
On Fri, Sep 10, 2021 at 10:11:53AM -0700, Kees Cook wrote:
> On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote:
> >
> > More post linux-next material.
> >
> > 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
> >
> > Subsystems affected by this patch series:
> >
> > mm/slab-generic
> > rapidio
> > mm/debug
> >
> > Subsystem: mm/slab-generic
> >
> > "Matthew Wilcox (Oracle)" <willy@infradead.org>:
> > mm: move kvmalloc-related functions to slab.h
> >
> > Subsystem: rapidio
> >
> > Kees Cook <keescook@chromium.org>:
> > rapidio: avoid bogus __alloc_size warning
> >
> > Subsystem: mm/debug
> >
> > Kees Cook <keescook@chromium.org>:
> > Patch series "Add __alloc_size() for better bounds checking", v2:
> > Compiler Attributes: add __alloc_size() for better bounds checking
> > checkpatch: add __alloc_size() to known $Attribute
> > slab: clean up function declarations
> > slab: add __alloc_size attributes for better bounds checking
> > mm/page_alloc: add __alloc_size attributes for better bounds checking
> > percpu: add __alloc_size attributes for better bounds checking
> > mm/vmalloc: add __alloc_size attributes for better bounds checking
>
> Hi,
>
> FYI, in overnight build testing I found yet another corner case in
> GCC's handling of the __alloc_size attribute. It's the gift that keeps
> on giving. The fix is here:
>
> https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/
I'm so glad it's Friday. Here's the v2 fix... *sigh*
https://lore.kernel.org/lkml/20210910201132.3809437-1-keescook@chromium.org/
-Kees
>
> >
> > Makefile | 15 +++
> > drivers/of/kexec.c | 1
> > drivers/rapidio/devices/rio_mport_cdev.c | 9 +-
> > include/linux/compiler_attributes.h | 6 +
> > include/linux/gfp.h | 2
> > include/linux/mm.h | 34 --------
> > include/linux/percpu.h | 3
> > include/linux/slab.h | 122 ++++++++++++++++++++++---------
> > include/linux/vmalloc.h | 11 ++
> > scripts/checkpatch.pl | 3
> > 10 files changed, 132 insertions(+), 74 deletions(-)
> >
>
> --
> Kees Cook
--
Kees Cook
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-09-24 22:42 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-09-24 22:42 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
16 patches, based on 7d42e98182586f57f376406d033f05fe135edb75.
Subsystems affected by this patch series:
mm/memory-failure
mm/kasan
mm/damon
xtensa
mm/shmem
ocfs2
scripts
mm/tools
lib
mm/pagecache
mm/debug
sh
mm/kasan
mm/memory-failure
mm/pagemap
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm, hwpoison: add is_free_buddy_page() in HWPoisonHandlable()
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
kasan: fix Kconfig check of CC_HAS_WORKING_NOSANITIZE_ADDRESS
Subsystem: mm/damon
Adam Borowski <kilobyte@angband.pl>:
mm/damon: don't use strnlen() with known-bogus source length
Subsystem: xtensa
Guenter Roeck <linux@roeck-us.net>:
xtensa: increase size of gcc stack frame check
Subsystem: mm/shmem
Liu Yuntao <liuyuntao10@huawei.com>:
mm/shmem.c: fix judgment error in shmem_is_huge()
Subsystem: ocfs2
Wengang Wang <wen.gang.wang@oracle.com>:
ocfs2: drop acl cache for directories too
Subsystem: scripts
Miles Chen <miles.chen@mediatek.com>:
scripts/sorttable: riscv: fix undeclared identifier 'EM_RISCV' error
Subsystem: mm/tools
Changbin Du <changbin.du@gmail.com>:
tools/vm/page-types: remove dependency on opt_file for idle page tracking
Subsystem: lib
Paul Menzel <pmenzel@molgen.mpg.de>:
lib/zlib_inflate/inffast: check config in C to avoid unused function warning
Subsystem: mm/pagecache
Minchan Kim <minchan@kernel.org>:
mm: fs: invalidate bh_lrus for only cold path
Subsystem: mm/debug
Weizhao Ouyang <o451686892@gmail.com>:
mm/debug: sync up MR_CONTIG_RANGE and MR_LONGTERM_PIN
mm/debug: sync up latest migrate_reason to migrate_reason_names
Subsystem: sh
Geert Uytterhoeven <geert+renesas@glider.be>:
sh: pgtable-3level: fix cast to pointer from integer of different size
Subsystem: mm/kasan
Nathan Chancellor <nathan@kernel.org>:
kasan: always respect CONFIG_KASAN_STACK
Subsystem: mm/memory-failure
Qi Zheng <zhengqi.arch@bytedance.com>:
mm/memory_failure: fix the missing pte_unmap() call
Subsystem: mm/pagemap
Chen Jun <chenjun102@huawei.com>:
mm: fix uninitialized use in overcommit_policy_handler
arch/sh/include/asm/pgtable-3level.h | 2 +-
fs/buffer.c | 8 ++++++--
fs/ocfs2/dlmglue.c | 3 ++-
include/linux/buffer_head.h | 4 ++--
include/linux/migrate.h | 6 +++++-
lib/Kconfig.debug | 2 +-
lib/Kconfig.kasan | 2 ++
lib/zlib_inflate/inffast.c | 13 ++++++-------
mm/damon/dbgfs-test.h | 16 ++++++++--------
mm/debug.c | 4 +++-
mm/memory-failure.c | 12 ++++++------
mm/shmem.c | 4 ++--
mm/swap.c | 19 ++++++++++++++++---
mm/util.c | 4 ++--
scripts/Makefile.kasan | 3 ++-
scripts/sorttable.c | 4 ++++
tools/vm/page-types.c | 2 +-
17 files changed, 69 insertions(+), 39 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-10-18 22:14 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-10-18 22:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
19 patches, based on 519d81956ee277b4419c723adfb154603c2565ba.
Subsystems affected by this patch series:
mm/userfaultfd
mm/migration
ocfs2
mm/memblock
mm/mempolicy
mm/slub
binfmt
vfs
mm/secretmem
mm/thp
misc
Subsystem: mm/userfaultfd
Peter Xu <peterx@redhat.com>:
mm/userfaultfd: selftests: fix memory corruption with thp enabled
Nadav Amit <namit@vmware.com>:
userfaultfd: fix a race between writeprotect and exit_mmap()
Subsystem: mm/migration
Dave Hansen <dave.hansen@linux.intel.com>:
Patch series "mm/migrate: 5.15 fixes for automatic demotion", v2:
mm/migrate: optimize hotplug-time demotion order updates
mm/migrate: add CPU hotplug to demotion #ifdef
Huang Ying <ying.huang@intel.com>:
mm/migrate: fix CPUHP state to update node demotion order
Subsystem: ocfs2
Jan Kara <jack@suse.cz>:
ocfs2: fix data corruption after conversion from inline format
Valentin Vidic <vvidic@valentin-vidic.from.hr>:
ocfs2: mount fails with buffer overflow in strlen
Subsystem: mm/memblock
Peng Fan <peng.fan@nxp.com>:
memblock: check memory total_size
Subsystem: mm/mempolicy
Eric Dumazet <edumazet@google.com>:
mm/mempolicy: do not allow illegal MPOL_F_NUMA_BALANCING | MPOL_LOCAL in mbind()
Subsystem: mm/slub
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Fixups for slub":
mm, slub: fix two bugs in slab_debug_trace_open()
mm, slub: fix mismatch between reconstructed freelist depth and cnt
mm, slub: fix potential memoryleak in kmem_cache_open()
mm, slub: fix potential use-after-free in slab_debugfs_fops
mm, slub: fix incorrect memcg slab count for bulk free
Subsystem: binfmt
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
elfcore: correct reference to CONFIG_UML
Subsystem: vfs
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
vfs: check fd has read access in kernel_read_file_from_fd()
Subsystem: mm/secretmem
Sean Christopherson <seanjc@google.com>:
mm/secretmem: fix NULL page->mapping dereference in page_is_secretmem()
Subsystem: mm/thp
Marek Szyprowski <m.szyprowski@samsung.com>:
mm/thp: decrease nr_thps in file's mapping on THP split
Subsystem: misc
Andrej Shadura <andrew.shadura@collabora.co.uk>:
mailmap: add Andrej Shadura
.mailmap | 2 +
fs/kernel_read_file.c | 2 -
fs/ocfs2/alloc.c | 46 ++++++-----------------
fs/ocfs2/super.c | 14 +++++--
fs/userfaultfd.c | 12 ++++--
include/linux/cpuhotplug.h | 4 ++
include/linux/elfcore.h | 2 -
include/linux/memory.h | 5 ++
include/linux/secretmem.h | 2 -
mm/huge_memory.c | 6 ++-
mm/memblock.c | 2 -
mm/mempolicy.c | 16 ++------
mm/migrate.c | 62 ++++++++++++++++++-------------
mm/page_ext.c | 4 --
mm/slab.c | 4 +-
mm/slub.c | 31 ++++++++++++---
tools/testing/selftests/vm/userfaultfd.c | 23 ++++++++++-
17 files changed, 138 insertions(+), 99 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-10-28 21:35 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-10-28 21:35 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
11 patches, based on 411a44c24a561e449b592ff631b7ae321f1eb559.
Subsystems affected by this patch series:
mm/memcg
mm/memory-failure
mm/oom-kill
ocfs2
mm/secretmem
mm/vmalloc
mm/hugetlb
mm/damon
mm/tools
Subsystem: mm/memcg
Shakeel Butt <shakeelb@google.com>:
memcg: page_alloc: skip bulk allocator for __GFP_ACCOUNT
Subsystem: mm/memory-failure
Yang Shi <shy828301@gmail.com>:
mm: hwpoison: remove the unnecessary THP check
mm: filemap: check if THP has hwpoisoned subpage for PMD page fault
Subsystem: mm/oom-kill
Suren Baghdasaryan <surenb@google.com>:
mm/oom_kill.c: prevent a race between process_mrelease and exit_mmap
Subsystem: ocfs2
Gautham Ananthakrishna <gautham.ananthakrishna@oracle.com>:
ocfs2: fix race between searching chunks and release journal_head from buffer_head
Subsystem: mm/secretmem
Kees Cook <keescook@chromium.org>:
mm/secretmem: avoid letting secretmem_users drop to zero
Subsystem: mm/vmalloc
Chen Wandun <chenwandun@huawei.com>:
mm/vmalloc: fix numa spreading for large hash tables
Subsystem: mm/hugetlb
Rongwei Wang <rongwei.wang@linux.alibaba.com>:
mm, thp: bail out early in collapse_file for writeback page
Yang Shi <shy828301@gmail.com>:
mm: khugepaged: skip huge page collapse for special files
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
mm/damon/core-test: fix wrong expectations for 'damon_split_regions_of()'
Subsystem: mm/tools
David Yang <davidcomponentone@gmail.com>:
tools/testing/selftests/vm/split_huge_page_test.c: fix application of sizeof to pointer
fs/ocfs2/suballoc.c | 22 ++++++++++-------
include/linux/page-flags.h | 23 ++++++++++++++++++
mm/damon/core-test.h | 4 +--
mm/huge_memory.c | 2 +
mm/khugepaged.c | 26 +++++++++++++-------
mm/memory-failure.c | 28 +++++++++++-----------
mm/memory.c | 9 +++++++
mm/oom_kill.c | 23 +++++++++---------
mm/page_alloc.c | 8 +++++-
mm/secretmem.c | 2 -
mm/vmalloc.c | 15 +++++++----
tools/testing/selftests/vm/split_huge_page_test.c | 2 -
12 files changed, 110 insertions(+), 54 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-11-05 20:34 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-11-05 20:34 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
262 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813
Subsystems affected by this patch series:
scripts
ocfs2
vfs
mm/slab-generic
mm/slab
mm/slub
mm/kconfig
mm/dax
mm/kasan
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/mprotect
mm/mremap
mm/iomap
mm/tracing
mm/vmalloc
mm/pagealloc
mm/memory-failure
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/tools
mm/memblock
mm/oom-kill
mm/hugetlbfs
mm/migration
mm/thp
mm/readahead
mm/nommu
mm/ksm
mm/vmstat
mm/madvise
mm/memory-hotplug
mm/rmap
mm/zsmalloc
mm/highmem
mm/zram
mm/cleanups
mm/kfence
mm/damon
Subsystem: scripts
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Sven Eckelmann <sven@narfation.org>:
scripts/spelling.txt: fix "mistake" version of "synchronization"
weidonghui <weidonghui@allwinnertech.com>:
scripts/decodecode: fix faulting instruction no print when opps.file is DOS format
Subsystem: ocfs2
Chenyuan Mi <cymi20@fudan.edu.cn>:
ocfs2: fix handle refcount leak in two exception handling paths
Valentin Vidic <vvidic@valentin-vidic.from.hr>:
ocfs2: cleanup journal init and shutdown
Colin Ian King <colin.king@canonical.com>:
ocfs2/dlm: remove redundant assignment of variable ret
Jan Kara <jack@suse.cz>:
Patch series "ocfs2: Truncate data corruption fix":
ocfs2: fix data corruption on truncate
ocfs2: do not zero pages beyond i_size
Subsystem: vfs
Arnd Bergmann <arnd@arndb.de>:
fs/posix_acl.c: avoid -Wempty-body warning
Jia He <justin.he@arm.com>:
d_path: fix Kernel doc validator complaining
Subsystem: mm/slab-generic
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: move kvmalloc-related functions to slab.h
Subsystem: mm/slab
Shi Lei <shi_lei@massclouds.com>:
mm/slab.c: remove useless lines in enable_cpucache()
Subsystem: mm/slub
Kefeng Wang <wangkefeng.wang@huawei.com>:
slub: add back check for free nonslab objects
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: change percpu partial accounting from objects to pages
mm/slub: increase default cpu partial list sizes
Hyeonggon Yoo <42.hyeyoo@gmail.com>:
mm, slub: use prefetchw instead of prefetch
Subsystem: mm/kconfig
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm: disable NUMA_BALANCING_DEFAULT_ENABLED and TRANSPARENT_HUGEPAGE on PREEMPT_RT
Subsystem: mm/dax
Christoph Hellwig <hch@lst.de>:
mm: don't include <linux/dax.h> in <linux/mempolicy.h>
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
Patch series "stackdepot, kasan, workqueue: Avoid expanding stackdepot slabs when holding raw_spin_lock", v2:
lib/stackdepot: include gfp.h
lib/stackdepot: remove unused function argument
lib/stackdepot: introduce __stack_depot_save()
kasan: common: provide can_alloc in kasan_save_stack()
kasan: generic: introduce kasan_record_aux_stack_noalloc()
workqueue, kasan: avoid alloc_pages() when recording stack
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
kasan: fix tag for large allocations when using CONFIG_SLAB
Peter Collingbourne <pcc@google.com>:
kasan: test: add memcpy test that avoids out-of-bounds write
Subsystem: mm/debug
Peter Xu <peterx@redhat.com>:
Patch series "mm/smaps: Fixes and optimizations on shmem swap handling":
mm/smaps: fix shmem pte hole swap calculation
mm/smaps: use vma->vm_pgoff directly when counting partial swap
mm/smaps: simplify shmem handling of pte holes
Guo Ren <guoren@linux.alibaba.com>:
mm: debug_vm_pgtable: don't use __P000 directly
Kees Cook <keescook@chromium.org>:
kasan: test: bypass __alloc_size checks
Patch series "Add __alloc_size()", v3:
rapidio: avoid bogus __alloc_size warning
Compiler Attributes: add __alloc_size() for better bounds checking
slab: clean up function prototypes
slab: add __alloc_size attributes for better bounds checking
mm/kvmalloc: add __alloc_size attributes for better bounds checking
mm/vmalloc: add __alloc_size attributes for better bounds checking
mm/page_alloc: add __alloc_size attributes for better bounds checking
percpu: add __alloc_size attributes for better bounds checking
Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
mm/page_ext.c: fix a comment
Subsystem: mm/pagecache
David Howells <dhowells@redhat.com>:
mm: stop filemap_read() from grabbing a superfluous page
Christoph Hellwig <hch@lst.de>:
Patch series "simplify bdi unregistation":
mm: export bdi_unregister
mtd: call bdi_unregister explicitly
fs: explicitly unregister per-superblock BDIs
mm: don't automatically unregister bdis
mm: simplify bdi refcounting
Jens Axboe <axboe@kernel.dk>:
mm: don't read i_size of inode unless we need it
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap.c: remove bogus VM_BUG_ON
Jens Axboe <axboe@kernel.dk>:
mm: move more expensive part of XA setup out of mapping check
Subsystem: mm/gup
John Hubbard <jhubbard@nvidia.com>:
mm/gup: further simplify __gup_device_huge()
Subsystem: mm/swap
Xu Wang <vulab@iscas.ac.cn>:
mm/swapfile: remove needless request_queue NULL pointer check
Rafael Aquini <aquini@redhat.com>:
mm/swapfile: fix an integer overflow in swap_show()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: optimise put_pages_list()
Subsystem: mm/memcg
Peter Xu <peterx@redhat.com>:
mm/memcg: drop swp_entry_t* in mc_handle_file_pte()
Shakeel Butt <shakeelb@google.com>:
memcg: flush stats only if updated
memcg: unify memcg stat flushing
Waiman Long <longman@redhat.com>:
mm/memcg: remove obsolete memcg_free_kmem()
Len Baker <len.baker@gmx.com>:
mm/list_lru.c: prefer struct_size over open coded arithmetic
Shakeel Butt <shakeelb@google.com>:
memcg, kmem: further deprecate kmem.limit_in_bytes
Muchun Song <songmuchun@bytedance.com>:
mm: list_lru: remove holding lru lock
mm: list_lru: fix the return value of list_lru_count_one()
mm: memcontrol: remove kmemcg_id reparenting
mm: memcontrol: remove the kmem states
mm: list_lru: only add memcg-aware lrus to the global lru list
Vasily Averin <vvs@virtuozzo.com>:
Patch series "memcg: prohibit unconditional exceeding the limit of dying tasks", v3:
mm, oom: pagefault_out_of_memory: don't force global OOM for dying tasks
Michal Hocko <mhocko@suse.com>:
mm, oom: do not trigger out_of_memory from the #PF
Vasily Averin <vvs@virtuozzo.com>:
memcg: prohibit unconditional exceeding the limit of dying tasks
Subsystem: mm/pagemap
Peng Liu <liupeng256@huawei.com>:
mm/mmap.c: fix a data race of mm->total_vm
Rolf Eike Beer <eb@emlix.com>:
mm: use __pfn_to_section() instead of open coding it
Amit Daniel Kachhap <amit.kachhap@arm.com>:
mm/memory.c: avoid unnecessary kernel/user pointer conversion
Nadav Amit <namit@vmware.com>:
mm/memory.c: use correct VMA flags when freeing page-tables
Peter Xu <peterx@redhat.com>:
Patch series "mm: A few cleanup patches around zap, shmem and uffd", v4:
mm/shmem: unconditionally set pte dirty in mfill_atomic_install_pte
mm: clear vmf->pte after pte_unmap_same() returns
mm: drop first_index/last_index in zap_details
mm: add zap_skip_check_mapping() helper
Qi Zheng <zhengqi.arch@bytedance.com>:
Patch series "Do some code cleanups related to mm", v3:
mm: introduce pmd_install() helper
mm: remove redundant smp_wmb()
Tiberiu A Georgescu <tiberiu.georgescu@nutanix.com>:
Documentation: update pagemap with shmem exceptions
Nicholas Piggin <npiggin@gmail.com>:
Patch series "shoot lazy tlbs", v4:
lazy tlb: introduce lazy mm refcount helper functions
lazy tlb: allow lazy tlb mm refcounting to be configurable
lazy tlb: shoot lazies, a non-refcounting lazy tlb option
powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
memory: remove unused CONFIG_MEM_BLOCK_SIZE
Subsystem: mm/mprotect
Liu Song <liu.song11@zte.com.cn>:
mm/mprotect.c: avoid repeated assignment in do_mprotect_pkey()
Subsystem: mm/mremap
Dmitry Safonov <dima@arista.com>:
mm/mremap: don't account pages in vma_to_resize()
Subsystem: mm/iomap
Lucas De Marchi <lucas.demarchi@intel.com>:
include/linux/io-mapping.h: remove fallback for writecombine
Subsystem: mm/tracing
Gang Li <ligang.bdlg@bytedance.com>:
mm: mmap_lock: remove redundant newline in TP_printk
mm: mmap_lock: use DECLARE_EVENT_CLASS and DEFINE_EVENT_FN
Subsystem: mm/vmalloc
Vasily Averin <vvs@virtuozzo.com>:
mm/vmalloc: repair warn_alloc()s in __vmalloc_area_node()
Peter Zijlstra <peterz@infradead.org>:
mm/vmalloc: don't allow VM_NO_GUARD on vmap()
Eric Dumazet <edumazet@google.com>:
mm/vmalloc: make show_numa_info() aware of hugepage mappings
mm/vmalloc: make sure to dump unpurged areas in /proc/vmallocinfo
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: do not adjust the search size for alignment overhead
mm/vmalloc: check various alignments when debugging
Vasily Averin <vvs@virtuozzo.com>:
vmalloc: back off when the current task is OOM-killed
Kefeng Wang <wangkefeng.wang@huawei.com>:
vmalloc: choose a better start address in vm_area_register_early()
arm64: support page mapping percpu first chunk allocator
kasan: arm64: fix pcpu_page_first_chunk crash with KASAN_VMALLOC
Michal Hocko <mhocko@suse.com>:
mm/vmalloc: be more explicit about supported gfp flags
Chen Wandun <chenwandun@huawei.com>:
mm/vmalloc: introduce alloc_pages_bulk_array_mempolicy to accelerate memory allocation
Changcheng Deng <deng.changcheng@zte.com.cn>:
lib/test_vmalloc.c: use swap() to make code cleaner
Subsystem: mm/pagealloc
Eric Dumazet <edumazet@google.com>:
mm/large system hash: avoid possible NULL deref in alloc_large_system_hash
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups and fixup for page_alloc", v2:
mm/page_alloc.c: remove meaningless VM_BUG_ON() in pindex_to_order()
mm/page_alloc.c: simplify the code by using macro K()
mm/page_alloc.c: fix obsolete comment in free_pcppages_bulk()
mm/page_alloc.c: use helper function zone_spans_pfn()
mm/page_alloc.c: avoid allocating highmem pages via alloc_pages_exact[_nid]
Bharata B Rao <bharata@amd.com>:
Patch series "Fix NUMA nodes fallback list ordering":
mm/page_alloc: print node fallback order
Krupa Ramakrishnan <krupa.ramakrishnan@amd.com>:
mm/page_alloc: use accumulated load when building node fallback list
Geert Uytterhoeven <geert+renesas@glider.be>:
Patch series "Fix NUMA without SMP":
mm: move node_reclaim_distance to fix NUMA without SMP
mm: move fold_vm_numa_events() to fix NUMA without SMP
Eric Dumazet <edumazet@google.com>:
mm/page_alloc.c: do not acquire zone lock in is_free_buddy_page()
Feng Tang <feng.tang@intel.com>:
mm/page_alloc: detect allocation forbidden by cpuset and bail out early
Liangcai Fan <liangcaifan19@gmail.com>:
mm/page_alloc.c: show watermark_boost of zone in zoneinfo
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm: create a new system state and fix core_kernel_text()
mm: make generic arch_is_kernel_initmem_freed() do what it says
powerpc: use generic version of arch_is_kernel_initmem_freed()
s390: use generic version of arch_is_kernel_initmem_freed()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm: page_alloc: use migrate_disable() in drain_local_pages_wq()
Wang ShaoBo <bobo.shaobowang@huawei.com>:
mm/page_alloc: use clamp() to simplify code
Subsystem: mm/memory-failure
Marco Elver <elver@google.com>:
mm: fix data race in PagePoisoned()
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
mm/memory_failure: constify static mm_walk_ops
Yang Shi <shy828301@gmail.com>:
Patch series "Solve silent data loss caused by poisoned page cache (shmem/tmpfs)", v5:
mm: filemap: coding style cleanup for filemap_map_pmd()
mm: hwpoison: refactor refcount check handling
mm: shmem: don't truncate page if memory failure happens
mm: hwpoison: handle non-anonymous THP correctly
Subsystem: mm/hugetlb
Peter Xu <peterx@redhat.com>:
mm/hugetlb: drop __unmap_hugepage_range definition from hugetlb.h
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "hugetlb: add demote/split page functionality", v4:
hugetlb: add demote hugetlb page sysfs interfaces
mm/cma: add cma_pages_valid to determine if pages are in CMA
hugetlb: be sure to free demoted CMA pages to CMA
hugetlb: add demote bool to gigantic page routines
hugetlb: add hugetlb demote page support
Liangcai Fan <liangcaifan19@gmail.com>:
mm: khugepaged: recalculate min_free_kbytes after stopping khugepaged
Mina Almasry <almasrymina@google.com>:
mm, hugepages: add mremap() support for hugepage backed vma
mm, hugepages: add hugetlb vma mremap() test
Baolin Wang <baolin.wang@linux.alibaba.com>:
hugetlb: support node specified when using cma for gigantic hugepages
Ran Jianping <ran.jianping@zte.com.cn>:
mm: remove duplicate include in hugepage-mremap.c
Baolin Wang <baolin.wang@linux.alibaba.com>:
Patch series "Some cleanups and improvements for hugetlb":
hugetlb_cgroup: remove unused hugetlb_cgroup_from_counter macro
hugetlb: replace the obsolete hugetlb_instantiation_mutex in the comments
hugetlb: remove redundant validation in has_same_uncharge_info()
hugetlb: remove redundant VM_BUG_ON() in add_reservation_in_range()
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: remove unnecessary set_page_count in prep_compound_gigantic_page
Subsystem: mm/userfaultfd
Axel Rasmussen <axelrasmussen@google.com>:
Patch series "Small userfaultfd selftest fixups", v2:
userfaultfd/selftests: don't rely on GNU extensions for random numbers
userfaultfd/selftests: fix feature support detection
userfaultfd/selftests: fix calculation of expected ioctls
Subsystem: mm/vmscan
Miaohe Lin <linmiaohe@huawei.com>:
mm/page_isolation: fix potential missing call to unset_migratetype_isolate()
mm/page_isolation: guard against possible putback unisolated page
Kai Song <songkai01@inspur.com>:
mm/vmscan.c: fix -Wunused-but-set-variable warning
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Remove dependency on congestion_wait in mm/", v5. Patch series:
mm/vmscan: throttle reclaim until some writeback completes if congested
mm/vmscan: throttle reclaim and compaction when too may pages are isolated
mm/vmscan: throttle reclaim when no progress is being made
mm/writeback: throttle based on page writeback instead of congestion
mm/page_alloc: remove the throttling logic from the page allocator
mm/vmscan: centralise timeout values for reclaim_throttle
mm/vmscan: increase the timeout if page reclaim is not making progress
mm/vmscan: delay waking of tasks throttled on NOPROGRESS
Yuanzheng Song <songyuanzheng@huawei.com>:
mm/vmpressure: fix data-race with memcg->socket_pressure
Subsystem: mm/tools
Zhenliang Wei <weizhenliang@huawei.com>:
tools/vm/page_owner_sort.c: count and sort by mem
Naoya Horiguchi <naoya.horiguchi@nec.com>:
Patch series "tools/vm/page-types.c: a few improvements":
tools/vm/page-types.c: make walk_file() aware of address range option
tools/vm/page-types.c: move show_file() to summary output
tools/vm/page-types.c: print file offset in hexadecimal
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "memblock: cleanup memblock_free interface", v2:
arch_numa: simplify numa_distance allocation
xen/x86: free_p2m_page: use memblock_free_ptr() to free a virtual pointer
memblock: drop memblock_free_early_nid() and memblock_free_early()
memblock: stop aliasing __memblock_free_late with memblock_free_late
memblock: rename memblock_free to memblock_phys_free
memblock: use memblock_free for freeing virtual pointers
Subsystem: mm/oom-kill
Sultan Alsawaf <sultan@kerneltoast.com>:
mm: mark the OOM reaper thread as freezable
Subsystem: mm/hugetlbfs
Zhenguo Yao <yaozhenguo1@gmail.com>:
hugetlbfs: extend the definition of hugepages parameter to support node allocation
Subsystem: mm/migration
John Hubbard <jhubbard@nvidia.com>:
mm/migrate: de-duplicate migrate_reason strings
Yang Shi <shy828301@gmail.com>:
mm: migrate: make demotion knob depend on migration
Subsystem: mm/thp
"George G. Davis" <davis.george@siemens.com>:
selftests/vm/transhuge-stress: fix ram size thinko
Rongwei Wang <rongwei.wang@linux.alibaba.com>:
Patch series "fix two bugs for file THP":
mm, thp: lock filemap when truncating page cache
mm, thp: fix incorrect unmap behavior for private pages
Subsystem: mm/readahead
Lin Feng <linf@wangsu.com>:
mm/readahead.c: fix incorrect comments for get_init_ra_size
Subsystem: mm/nommu
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: nommu: kill arch_get_unmapped_area()
Subsystem: mm/ksm
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
selftest/vm: fix ksm selftest to run with different NUMA topologies
Pedro Demarchi Gomes <pedrodemargomes@gmail.com>:
selftests: vm: add KSM huge pages merging time test
Subsystem: mm/vmstat
Liu Shixin <liushixin2@huawei.com>:
mm/vmstat: annotate data race for zone->free_area[order].nr_free
Lin Feng <linf@wangsu.com>:
mm: vmstat.c: make extfrag_index show more pretty
Subsystem: mm/madvise
David Hildenbrand <david@redhat.com>:
selftests/vm: make MADV_POPULATE_(READ|WRITE) use in-tree headers
Subsystem: mm/memory-hotplug
Tang Yizhou <tangyizhou@huawei.com>:
mm/memory_hotplug: add static qualifier for online_policy_to_str()
David Hildenbrand <david@redhat.com>:
Patch series "memory-hotplug.rst: document the "auto-movable" online policy":
memory-hotplug.rst: fix two instances of "movablecore" that should be "movable_node"
memory-hotplug.rst: fix wrong /sys/module/memory_hotplug/parameters/ path
memory-hotplug.rst: document the "auto-movable" online policy
Patch series "mm/memory_hotplug: Kconfig and 32 bit cleanups":
mm/memory_hotplug: remove CONFIG_X86_64_ACPI_NUMA dependency from CONFIG_MEMORY_HOTPLUG
mm/memory_hotplug: remove CONFIG_MEMORY_HOTPLUG_SPARSE
mm/memory_hotplug: restrict CONFIG_MEMORY_HOTPLUG to 64 bit
mm/memory_hotplug: remove HIGHMEM leftovers
mm/memory_hotplug: remove stale function declarations
x86: remove memory hotplug support on X86_32
Patch series "mm/memory_hotplug: full support for add_memory_driver_managed() with CONFIG_ARCH_KEEP_MEMBLOCK", v2:
mm/memory_hotplug: handle memblock_add_node() failures in add_memory_resource()
memblock: improve MEMBLOCK_HOTPLUG documentation
memblock: allow to specify flags with memblock_add_node()
memblock: add MEMBLOCK_DRIVER_MANAGED to mimic IORESOURCE_SYSRAM_DRIVER_MANAGED
mm/memory_hotplug: indicate MEMBLOCK_DRIVER_MANAGED with IORESOURCE_SYSRAM_DRIVER_MANAGED
Subsystem: mm/rmap
Alistair Popple <apopple@nvidia.com>:
mm/rmap.c: avoid double faults migrating device private pages
Subsystem: mm/zsmalloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/zsmalloc.c: close race window between zs_pool_dec_isolated() and zs_unregister_migration()
Subsystem: mm/highmem
Ira Weiny <ira.weiny@intel.com>:
mm/highmem: remove deprecated kmap_atomic
Subsystem: mm/zram
Jaewon Kim <jaewon31.kim@samsung.com>:
zram_drv: allow reclaim on bio_alloc
Dan Carpenter <dan.carpenter@oracle.com>:
zram: off by one in read_block_state()
Brian Geffon <bgeffon@google.com>:
zram: introduce an aged idle interface
Subsystem: mm/cleanups
Stephen Kitt <steve@sk2.org>:
mm: remove HARDENED_USERCOPY_FALLBACK
Mianhan Liu <liumh1@shanghaitech.edu.cn>:
include/linux/mm.h: move nr_free_buffer_pages from swap.h to mm.h
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
stacktrace: move filter_irq_stacks() to kernel/stacktrace.c
kfence: count unexpectedly skipped allocations
kfence: move saving stack trace of allocations into __kfence_alloc()
kfence: limit currently covered allocations when pool nearly full
kfence: add note to documentation about skipping covered allocations
kfence: test: use kunit_skip() to skip tests
kfence: shorten critical sections of alloc/free
kfence: always use static branches to guard kfence_alloc()
kfence: default to dynamic branch instead of static keys mode
Subsystem: mm/damon
Geert Uytterhoeven <geert@linux-m68k.org>:
mm/damon: grammar s/works/work/
SeongJae Park <sjpark@amazon.de>:
Documentation/vm: move user guides to admin-guide/mm/
SeongJae Park <sj@kernel.org>:
MAINTAINERS: update SeongJae's email address
SeongJae Park <sjpark@amazon.de>:
docs/vm/damon: remove broken reference
include/linux/damon.h: fix kernel-doc comments for 'damon_callback'
SeongJae Park <sj@kernel.org>:
mm/damon/core: print kdamond start log in debug mode only
Changbin Du <changbin.du@gmail.com>:
mm/damon: remove unnecessary do_exit() from kdamond
mm/damon: needn't hold kdamond_lock to print pid of kdamond
Colin Ian King <colin.king@canonical.com>:
mm/damon/core: nullify pointer ctx->kdamond with a NULL
SeongJae Park <sj@kernel.org>:
Patch series "Implement Data Access Monitoring-based Memory Operation Schemes":
mm/damon/core: account age of target regions
mm/damon/core: implement DAMON-based Operation Schemes (DAMOS)
mm/damon/vaddr: support DAMON-based Operation Schemes
mm/damon/dbgfs: support DAMON-based Operation Schemes
mm/damon/schemes: implement statistics feature
selftests/damon: add 'schemes' debugfs tests
Docs/admin-guide/mm/damon: document DAMON-based Operation Schemes
Patch series "DAMON: Support Physical Memory Address Space Monitoring::
mm/damon/dbgfs: allow users to set initial monitoring target regions
mm/damon/dbgfs-test: add a unit test case for 'init_regions'
Docs/admin-guide/mm/damon: document 'init_regions' feature
mm/damon/vaddr: separate commonly usable functions
mm/damon: implement primitives for physical address space monitoring
mm/damon/dbgfs: support physical memory monitoring
Docs/DAMON: document physical memory monitoring support
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
mm/damon/vaddr: constify static mm_walk_ops
Rongwei Wang <rongwei.wang@linux.alibaba.com>:
mm/damon/dbgfs: remove unnecessary variables
SeongJae Park <sj@kernel.org>:
mm/damon/paddr: support the pageout scheme
mm/damon/schemes: implement size quota for schemes application speed control
mm/damon/schemes: skip already charged targets and regions
mm/damon/schemes: implement time quota
mm/damon/dbgfs: support quotas of schemes
mm/damon/selftests: support schemes quotas
mm/damon/schemes: prioritize regions within the quotas
mm/damon/vaddr,paddr: support pageout prioritization
mm/damon/dbgfs: support prioritization weights
tools/selftests/damon: update for regions prioritization of schemes
mm/damon/schemes: activate schemes based on a watermarks mechanism
mm/damon/dbgfs: support watermarks
selftests/damon: support watermarks
mm/damon: introduce DAMON-based Reclamation (DAMON_RECLAIM)
Documentation/admin-guide/mm/damon: add a document for DAMON_RECLAIM
Xin Hao <xhao@linux.alibaba.com>:
Patch series "mm/damon: Fix some small bugs", v4:
mm/damon: remove unnecessary variable initialization
mm/damon/dbgfs: add adaptive_targets list check before enable monitor_on
SeongJae Park <sj@kernel.org>:
Patch series "Fix trivial nits in Documentation/admin-guide/mm":
Docs/admin-guide/mm/damon/start: fix wrong example commands
Docs/admin-guide/mm/damon/start: fix a wrong link
Docs/admin-guide/mm/damon/start: simplify the content
Docs/admin-guide/mm/pagemap: wordsmith page flags descriptions
Changbin Du <changbin.du@gmail.com>:
mm/damon: simplify stop mechanism
Colin Ian King <colin.i.king@googlemail.com>:
mm/damon: fix a few spelling mistakes in comments and a pr_debug message
Changbin Du <changbin.du@gmail.com>:
mm/damon: remove return value from before_terminate callback
a/Documentation/admin-guide/blockdev/zram.rst | 8
a/Documentation/admin-guide/cgroup-v1/memory.rst | 11
a/Documentation/admin-guide/kernel-parameters.txt | 14
a/Documentation/admin-guide/mm/damon/index.rst | 1
a/Documentation/admin-guide/mm/damon/reclaim.rst | 235 +++
a/Documentation/admin-guide/mm/damon/start.rst | 140 +
a/Documentation/admin-guide/mm/damon/usage.rst | 117 +
a/Documentation/admin-guide/mm/hugetlbpage.rst | 42
a/Documentation/admin-guide/mm/memory-hotplug.rst | 147 +-
a/Documentation/admin-guide/mm/pagemap.rst | 75 -
a/Documentation/core-api/memory-hotplug.rst | 3
a/Documentation/dev-tools/kfence.rst | 23
a/Documentation/translations/zh_CN/core-api/memory-hotplug.rst | 4
a/Documentation/vm/damon/design.rst | 29
a/Documentation/vm/damon/faq.rst | 5
a/Documentation/vm/damon/index.rst | 1
a/Documentation/vm/page_owner.rst | 23
a/MAINTAINERS | 2
a/Makefile | 15
a/arch/Kconfig | 28
a/arch/alpha/kernel/core_irongate.c | 6
a/arch/arc/mm/init.c | 6
a/arch/arm/mach-hisi/platmcpm.c | 2
a/arch/arm/mach-rpc/ecard.c | 2
a/arch/arm/mm/init.c | 2
a/arch/arm64/Kconfig | 4
a/arch/arm64/mm/kasan_init.c | 16
a/arch/arm64/mm/mmu.c | 4
a/arch/ia64/mm/contig.c | 2
a/arch/ia64/mm/init.c | 2
a/arch/m68k/mm/mcfmmu.c | 3
a/arch/m68k/mm/motorola.c | 6
a/arch/mips/loongson64/init.c | 4
a/arch/mips/mm/init.c | 6
a/arch/mips/sgi-ip27/ip27-memory.c | 3
a/arch/mips/sgi-ip30/ip30-setup.c | 6
a/arch/powerpc/Kconfig | 1
a/arch/powerpc/configs/skiroot_defconfig | 1
a/arch/powerpc/include/asm/machdep.h | 2
a/arch/powerpc/include/asm/sections.h | 13
a/arch/powerpc/kernel/dt_cpu_ftrs.c | 8
a/arch/powerpc/kernel/paca.c | 8
a/arch/powerpc/kernel/setup-common.c | 4
a/arch/powerpc/kernel/setup_64.c | 6
a/arch/powerpc/kernel/smp.c | 2
a/arch/powerpc/mm/book3s64/radix_tlb.c | 4
a/arch/powerpc/mm/hugetlbpage.c | 9
a/arch/powerpc/platforms/powernv/pci-ioda.c | 4
a/arch/powerpc/platforms/powernv/setup.c | 4
a/arch/powerpc/platforms/pseries/setup.c | 2
a/arch/powerpc/platforms/pseries/svm.c | 9
a/arch/riscv/kernel/setup.c | 10
a/arch/s390/include/asm/sections.h | 12
a/arch/s390/kernel/setup.c | 11
a/arch/s390/kernel/smp.c | 6
a/arch/s390/kernel/uv.c | 2
a/arch/s390/mm/init.c | 3
a/arch/s390/mm/kasan_init.c | 2
a/arch/sh/boards/mach-ap325rxa/setup.c | 2
a/arch/sh/boards/mach-ecovec24/setup.c | 4
a/arch/sh/boards/mach-kfr2r09/setup.c | 2
a/arch/sh/boards/mach-migor/setup.c | 2
a/arch/sh/boards/mach-se/7724/setup.c | 4
a/arch/sparc/kernel/smp_64.c | 4
a/arch/um/kernel/mem.c | 4
a/arch/x86/Kconfig | 6
a/arch/x86/kernel/setup.c | 4
a/arch/x86/kernel/setup_percpu.c | 2
a/arch/x86/mm/init.c | 2
a/arch/x86/mm/init_32.c | 31
a/arch/x86/mm/kasan_init_64.c | 4
a/arch/x86/mm/numa.c | 2
a/arch/x86/mm/numa_emulation.c | 2
a/arch/x86/xen/mmu_pv.c | 8
a/arch/x86/xen/p2m.c | 4
a/arch/x86/xen/setup.c | 6
a/drivers/base/Makefile | 2
a/drivers/base/arch_numa.c | 96 +
a/drivers/base/node.c | 9
a/drivers/block/zram/zram_drv.c | 66
a/drivers/firmware/efi/memmap.c | 2
a/drivers/hwmon/occ/p9_sbe.c | 1
a/drivers/macintosh/smu.c | 2
a/drivers/mmc/core/mmc_test.c | 1
a/drivers/mtd/mtdcore.c | 1
a/drivers/of/kexec.c | 4
a/drivers/of/of_reserved_mem.c | 5
a/drivers/rapidio/devices/rio_mport_cdev.c | 9
a/drivers/s390/char/sclp_early.c | 4
a/drivers/usb/early/xhci-dbc.c | 10
a/drivers/virtio/Kconfig | 2
a/drivers/xen/swiotlb-xen.c | 4
a/fs/d_path.c | 8
a/fs/exec.c | 4
a/fs/ocfs2/alloc.c | 21
a/fs/ocfs2/dlm/dlmrecovery.c | 1
a/fs/ocfs2/file.c | 8
a/fs/ocfs2/inode.c | 4
a/fs/ocfs2/journal.c | 28
a/fs/ocfs2/journal.h | 3
a/fs/ocfs2/super.c | 40
a/fs/open.c | 16
a/fs/posix_acl.c | 3
a/fs/proc/task_mmu.c | 28
a/fs/super.c | 3
a/include/asm-generic/sections.h | 14
a/include/linux/backing-dev-defs.h | 3
a/include/linux/backing-dev.h | 1
a/include/linux/cma.h | 1
a/include/linux/compiler-gcc.h | 8
a/include/linux/compiler_attributes.h | 10
a/include/linux/compiler_types.h | 12
a/include/linux/cpuset.h | 17
a/include/linux/damon.h | 258 +++
a/include/linux/fs.h | 1
a/include/linux/gfp.h | 8
a/include/linux/highmem.h | 28
a/include/linux/hugetlb.h | 36
a/include/linux/io-mapping.h | 6
a/include/linux/kasan.h | 8
a/include/linux/kernel.h | 1
a/include/linux/kfence.h | 21
a/include/linux/memblock.h | 48
a/include/linux/memcontrol.h | 9
a/include/linux/memory.h | 26
a/include/linux/memory_hotplug.h | 3
a/include/linux/mempolicy.h | 5
a/include/linux/migrate.h | 23
a/include/linux/migrate_mode.h | 13
a/include/linux/mm.h | 57
a/include/linux/mm_types.h | 2
a/include/linux/mmzone.h | 41
a/include/linux/node.h | 4
a/include/linux/page-flags.h | 2
a/include/linux/percpu.h | 6
a/include/linux/sched/mm.h | 25
a/include/linux/slab.h | 181 +-
a/include/linux/slub_def.h | 13
a/include/linux/stackdepot.h | 8
a/include/linux/stacktrace.h | 1
a/include/linux/swap.h | 1
a/include/linux/vmalloc.h | 24
a/include/trace/events/mmap_lock.h | 50
a/include/trace/events/vmscan.h | 42
a/include/trace/events/writeback.h | 7
a/init/Kconfig | 2
a/init/initramfs.c | 4
a/init/main.c | 6
a/kernel/cgroup/cpuset.c | 23
a/kernel/cpu.c | 2
a/kernel/dma/swiotlb.c | 6
a/kernel/exit.c | 2
a/kernel/extable.c | 2
a/kernel/fork.c | 51
a/kernel/kexec_file.c | 5
a/kernel/kthread.c | 21
a/kernel/locking/lockdep.c | 15
a/kernel/printk/printk.c | 4
a/kernel/sched/core.c | 37
a/kernel/sched/sched.h | 4
a/kernel/sched/topology.c | 1
a/kernel/stacktrace.c | 30
a/kernel/tsacct.c | 2
a/kernel/workqueue.c | 2
a/lib/Kconfig.debug | 2
a/lib/Kconfig.kfence | 26
a/lib/bootconfig.c | 2
a/lib/cpumask.c | 6
a/lib/stackdepot.c | 76 -
a/lib/test_kasan.c | 26
a/lib/test_kasan_module.c | 2
a/lib/test_vmalloc.c | 6
a/mm/Kconfig | 10
a/mm/backing-dev.c | 65
a/mm/cma.c | 26
a/mm/compaction.c | 12
a/mm/damon/Kconfig | 24
a/mm/damon/Makefile | 4
a/mm/damon/core.c | 500 ++++++-
a/mm/damon/dbgfs-test.h | 56
a/mm/damon/dbgfs.c | 486 +++++-
a/mm/damon/paddr.c | 275 +++
a/mm/damon/prmtv-common.c | 133 +
a/mm/damon/prmtv-common.h | 20
a/mm/damon/reclaim.c | 356 ++++
a/mm/damon/vaddr-test.h | 2
a/mm/damon/vaddr.c | 167 +-
a/mm/debug.c | 20
a/mm/debug_vm_pgtable.c | 7
a/mm/filemap.c | 78 -
a/mm/gup.c | 5
a/mm/highmem.c | 6
a/mm/hugetlb.c | 713 +++++++++-
a/mm/hugetlb_cgroup.c | 3
a/mm/internal.h | 26
a/mm/kasan/common.c | 8
a/mm/kasan/generic.c | 16
a/mm/kasan/kasan.h | 2
a/mm/kasan/shadow.c | 5
a/mm/kfence/core.c | 214 ++-
a/mm/kfence/kfence.h | 2
a/mm/kfence/kfence_test.c | 14
a/mm/khugepaged.c | 10
a/mm/list_lru.c | 58
a/mm/memblock.c | 35
a/mm/memcontrol.c | 217 +--
a/mm/memory-failure.c | 117 +
a/mm/memory.c | 166 +-
a/mm/memory_hotplug.c | 57
a/mm/mempolicy.c | 143 +-
a/mm/migrate.c | 61
a/mm/mmap.c | 2
a/mm/mprotect.c | 5
a/mm/mremap.c | 86 -
a/mm/nommu.c | 6
a/mm/oom_kill.c | 27
a/mm/page-writeback.c | 13
a/mm/page_alloc.c | 119 -
a/mm/page_ext.c | 2
a/mm/page_isolation.c | 29
a/mm/percpu.c | 24
a/mm/readahead.c | 2
a/mm/rmap.c | 8
a/mm/shmem.c | 44
a/mm/slab.c | 16
a/mm/slab_common.c | 8
a/mm/slub.c | 117 -
a/mm/sparse-vmemmap.c | 2
a/mm/sparse.c | 6
a/mm/swap.c | 23
a/mm/swapfile.c | 6
a/mm/userfaultfd.c | 8
a/mm/vmalloc.c | 107 +
a/mm/vmpressure.c | 2
a/mm/vmscan.c | 194 ++
a/mm/vmstat.c | 76 -
a/mm/zsmalloc.c | 7
a/net/ipv4/tcp.c | 1
a/net/ipv4/udp.c | 1
a/net/netfilter/ipvs/ip_vs_ctl.c | 1
a/net/openvswitch/meter.c | 1
a/net/sctp/protocol.c | 1
a/scripts/checkpatch.pl | 3
a/scripts/decodecode | 2
a/scripts/spelling.txt | 18
a/security/Kconfig | 14
a/tools/testing/selftests/damon/debugfs_attrs.sh | 25
a/tools/testing/selftests/memory-hotplug/config | 1
a/tools/testing/selftests/vm/.gitignore | 1
a/tools/testing/selftests/vm/Makefile | 1
a/tools/testing/selftests/vm/hugepage-mremap.c | 161 ++
a/tools/testing/selftests/vm/ksm_tests.c | 154 ++
a/tools/testing/selftests/vm/madv_populate.c | 15
a/tools/testing/selftests/vm/run_vmtests.sh | 11
a/tools/testing/selftests/vm/transhuge-stress.c | 2
a/tools/testing/selftests/vm/userfaultfd.c | 157 +-
a/tools/vm/page-types.c | 38
a/tools/vm/page_owner_sort.c | 94 +
b/Documentation/admin-guide/mm/index.rst | 2
b/Documentation/vm/index.rst | 26
260 files changed, 6448 insertions(+), 2327 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-11-09 2:30 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-11-09 2:30 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
87 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813, plus
previously sent material.
Subsystems affected by this patch series:
mm/pagecache
mm/hugetlb
procfs
misc
MAINTAINERS
lib
checkpatch
binfmt
kallsyms
ramfs
init
codafs
nilfs2
hfs
crash_dump
signals
seq_file
fork
sysvfs
kcov
gdb
resource
selftests
ipc
Subsystem: mm/pagecache
Johannes Weiner <hannes@cmpxchg.org>:
vfs: keep inodes with page cache off the inode shrinker LRU
Subsystem: mm/hugetlb
zhangyiru <zhangyiru3@huawei.com>:
mm,hugetlb: remove mlock ulimit for SHM_HUGETLB
Subsystem: procfs
Florian Weimer <fweimer@redhat.com>:
procfs: do not list TID 0 in /proc/<pid>/task
David Hildenbrand <david@redhat.com>:
x86/xen: update xen_oldmem_pfn_is_ram() documentation
x86/xen: simplify xen_oldmem_pfn_is_ram()
x86/xen: print a warning when HVMOP_get_mem_type fails
proc/vmcore: let pfn_is_ram() return a bool
proc/vmcore: convert oldmem_pfn_is_ram callback to more generic vmcore callbacks
virtio-mem: factor out hotplug specifics from virtio_mem_init() into virtio_mem_init_hotplug()
virtio-mem: factor out hotplug specifics from virtio_mem_probe() into virtio_mem_init_hotplug()
virtio-mem: factor out hotplug specifics from virtio_mem_remove() into virtio_mem_deinit_hotplug()
virtio-mem: kdump mode to sanitize /proc/vmcore access
Stephen Brennan <stephen.s.brennan@oracle.com>:
proc: allow pid_revalidate() during LOOKUP_RCU
Subsystem: misc
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
Patch series "kernel.h further split", v5:
kernel.h: drop unneeded <linux/kernel.h> inclusion from other headers
kernel.h: split out container_of() and typeof_member() macros
include/kunit/test.h: replace kernel.h with the necessary inclusions
include/linux/list.h: replace kernel.h with the necessary inclusions
include/linux/llist.h: replace kernel.h with the necessary inclusions
include/linux/plist.h: replace kernel.h with the necessary inclusions
include/media/media-entity.h: replace kernel.h with the necessary inclusions
include/linux/delay.h: replace kernel.h with the necessary inclusions
include/linux/sbitmap.h: replace kernel.h with the necessary inclusions
include/linux/radix-tree.h: replace kernel.h with the necessary inclusions
include/linux/generic-radix-tree.h: replace kernel.h with the necessary inclusions
Stephen Rothwell <sfr@canb.auug.org.au>:
kernel.h: split out instruction pointer accessors
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
linux/container_of.h: switch to static_assert
Colin Ian King <colin.i.king@googlemail.com>:
mailmap: update email address for Colin King
Subsystem: MAINTAINERS
Kees Cook <keescook@chromium.org>:
MAINTAINERS: add "exec & binfmt" section with myself and Eric
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
Patch series "Rectify file references for dt-bindings in MAINTAINERS", v5:
MAINTAINERS: rectify entry for ARM/TOSHIBA VISCONTI ARCHITECTURE
MAINTAINERS: rectify entry for HIKEY960 ONBOARD USB GPIO HUB DRIVER
MAINTAINERS: rectify entry for INTEL KEEM BAY DRM DRIVER
MAINTAINERS: rectify entry for ALLWINNER HARDWARE SPINLOCK SUPPORT
Subsystem: lib
Imran Khan <imran.f.khan@oracle.com>:
Patch series "lib, stackdepot: check stackdepot handle before accessing slabs", v2:
lib, stackdepot: check stackdepot handle before accessing slabs
lib, stackdepot: add helper to print stack entries
lib, stackdepot: add helper to print stack entries into buffer
Lucas De Marchi <lucas.demarchi@intel.com>:
include/linux/string_helpers.h: add linux/string.h for strlen()
Alexey Dobriyan <adobriyan@gmail.com>:
lib: uninline simple_strntoull() as well
Thomas Gleixner <tglx@linutronix.de>:
mm/scatterlist: replace the !preemptible warning in sg_miter_stop()
Subsystem: checkpatch
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
const_structs.checkpatch: add a few sound ops structs
Joe Perches <joe@perches.com>:
checkpatch: improve EXPORT_SYMBOL test for EXPORT_SYMBOL_NS uses
Peter Ujfalusi <peter.ujfalusi@linux.intel.com>:
checkpatch: get default codespell dictionary path from package location
Subsystem: binfmt
Kees Cook <keescook@chromium.org>:
binfmt_elf: reintroduce using MAP_FIXED_NOREPLACE
Alexey Dobriyan <adobriyan@gmail.com>:
ELF: simplify STACK_ALLOC macro
Subsystem: kallsyms
Kefeng Wang <wangkefeng.wang@huawei.com>:
Patch series "sections: Unify kernel sections range check and use", v4:
kallsyms: remove arch specific text and data check
kallsyms: fix address-checks for kernel related range
sections: move and rename core_kernel_data() to is_kernel_core_data()
sections: move is_kernel_inittext() into sections.h
x86: mm: rename __is_kernel_text() to is_x86_32_kernel_text()
sections: provide internal __is_kernel() and __is_kernel_text() helper
mm: kasan: use is_kernel() helper
extable: use is_kernel_text() helper
powerpc/mm: use core_kernel_text() helper
microblaze: use is_kernel_text() helper
alpha: use is_kernel_text() helper
Subsystem: ramfs
yangerkun <yangerkun@huawei.com>:
ramfs: fix mount source show for ramfs
Subsystem: init
Andrew Halaney <ahalaney@redhat.com>:
init: make unknown command line param message clearer
Subsystem: codafs
Jan Harkes <jaharkes@cs.cmu.edu>:
Patch series "Coda updates for -next":
coda: avoid NULL pointer dereference from a bad inode
coda: check for async upcall request using local state
Alex Shi <alex.shi@linux.alibaba.com>:
coda: remove err which no one care
Jan Harkes <jaharkes@cs.cmu.edu>:
coda: avoid flagging NULL inodes
coda: avoid hidden code duplication in rename
coda: avoid doing bad things on inode type changes during revalidation
Xiyu Yang <xiyuyang19@fudan.edu.cn>:
coda: convert from atomic_t to refcount_t on coda_vm_ops->refcnt
Jing Yangyang <jing.yangyang@zte.com.cn>:
coda: use vmemdup_user to replace the open code
Jan Harkes <jaharkes@cs.cmu.edu>:
coda: bump module version to 7.2
Subsystem: nilfs2
Qing Wang <wangqing@vivo.com>:
Patch series "nilfs2 updates":
nilfs2: replace snprintf in show functions with sysfs_emit
Ryusuke Konishi <konishi.ryusuke@gmail.com>:
nilfs2: remove filenames from file comments
Subsystem: hfs
Arnd Bergmann <arnd@arndb.de>:
hfs/hfsplus: use WARN_ON for sanity check
Subsystem: crash_dump
Changcheng Deng <deng.changcheng@zte.com.cn>:
crash_dump: fix boolreturn.cocci warning
Ye Guojin <ye.guojin@zte.com.cn>:
crash_dump: remove duplicate include in crash_dump.h
Subsystem: signals
Ye Guojin <ye.guojin@zte.com.cn>:
signal: remove duplicate include in signal.h
Subsystem: seq_file
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
seq_file: move seq_escape() to a header
Muchun Song <songmuchun@bytedance.com>:
seq_file: fix passing wrong private data
Subsystem: fork
Ran Xiaokai <ran.xiaokai@zte.com.cn>:
kernel/fork.c: unshare(): use swap() to make code cleaner
Subsystem: sysvfs
Pavel Skripkin <paskripkin@gmail.com>:
sysv: use BUILD_BUG_ON instead of runtime check
Subsystem: kcov
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
Patch series "kcov: PREEMPT_RT fixup + misc", v2:
Documentation/kcov: include types.h in the example
Documentation/kcov: define `ip' in the example
kcov: allocate per-CPU memory on the relevant node
kcov: avoid enable+disable interrupts if !in_task()
kcov: replace local_irq_save() with a local_lock_t
Subsystem: gdb
Douglas Anderson <dianders@chromium.org>:
scripts/gdb: handle split debug for vmlinux
Subsystem: resource
David Hildenbrand <david@redhat.com>:
Patch series "virtio-mem: disallow mapping virtio-mem memory via /dev/mem", v5:
kernel/resource: clean up and optimize iomem_is_exclusive()
kernel/resource: disallow access to exclusive system RAM regions
virtio-mem: disallow mapping virtio-mem memory via /dev/mem
Subsystem: selftests
SeongJae Park <sjpark@amazon.de>:
selftests/kselftest/runner/run_one(): allow running non-executable files
Subsystem: ipc
Michal Clapinski <mclapinski@google.com>:
ipc: check checkpoint_restore_ns_capable() to modify C/R proc files
Manfred Spraul <manfred@colorfullife.com>:
ipc/ipc_sysctl.c: remove fallback for !CONFIG_PROC_SYSCTL
.mailmap | 2
Documentation/dev-tools/kcov.rst | 5
MAINTAINERS | 21 +
arch/alpha/kernel/traps.c | 4
arch/microblaze/mm/pgtable.c | 3
arch/powerpc/mm/pgtable_32.c | 7
arch/riscv/lib/delay.c | 4
arch/s390/include/asm/facility.h | 4
arch/x86/kernel/aperture_64.c | 13
arch/x86/kernel/unwind_orc.c | 2
arch/x86/mm/init_32.c | 14
arch/x86/xen/mmu_hvm.c | 39 --
drivers/gpu/drm/drm_dp_mst_topology.c | 5
drivers/gpu/drm/drm_mm.c | 5
drivers/gpu/drm/i915/i915_vma.c | 5
drivers/gpu/drm/i915/intel_runtime_pm.c | 20 -
drivers/media/dvb-frontends/cxd2880/cxd2880_common.h | 1
drivers/virtio/Kconfig | 1
drivers/virtio/virtio_mem.c | 321 +++++++++++++------
fs/binfmt_elf.c | 33 +
fs/coda/cnode.c | 13
fs/coda/coda_linux.c | 39 +-
fs/coda/coda_linux.h | 6
fs/coda/dir.c | 20 -
fs/coda/file.c | 12
fs/coda/psdev.c | 14
fs/coda/upcall.c | 3
fs/hfs/inode.c | 6
fs/hfsplus/inode.c | 12
fs/hugetlbfs/inode.c | 23 -
fs/inode.c | 46 +-
fs/internal.h | 1
fs/nilfs2/alloc.c | 2
fs/nilfs2/alloc.h | 2
fs/nilfs2/bmap.c | 2
fs/nilfs2/bmap.h | 2
fs/nilfs2/btnode.c | 2
fs/nilfs2/btnode.h | 2
fs/nilfs2/btree.c | 2
fs/nilfs2/btree.h | 2
fs/nilfs2/cpfile.c | 2
fs/nilfs2/cpfile.h | 2
fs/nilfs2/dat.c | 2
fs/nilfs2/dat.h | 2
fs/nilfs2/dir.c | 2
fs/nilfs2/direct.c | 2
fs/nilfs2/direct.h | 2
fs/nilfs2/file.c | 2
fs/nilfs2/gcinode.c | 2
fs/nilfs2/ifile.c | 2
fs/nilfs2/ifile.h | 2
fs/nilfs2/inode.c | 2
fs/nilfs2/ioctl.c | 2
fs/nilfs2/mdt.c | 2
fs/nilfs2/mdt.h | 2
fs/nilfs2/namei.c | 2
fs/nilfs2/nilfs.h | 2
fs/nilfs2/page.c | 2
fs/nilfs2/page.h | 2
fs/nilfs2/recovery.c | 2
fs/nilfs2/segbuf.c | 2
fs/nilfs2/segbuf.h | 2
fs/nilfs2/segment.c | 2
fs/nilfs2/segment.h | 2
fs/nilfs2/sufile.c | 2
fs/nilfs2/sufile.h | 2
fs/nilfs2/super.c | 2
fs/nilfs2/sysfs.c | 78 ++--
fs/nilfs2/sysfs.h | 2
fs/nilfs2/the_nilfs.c | 2
fs/nilfs2/the_nilfs.h | 2
fs/proc/base.c | 21 -
fs/proc/vmcore.c | 109 ++++--
fs/ramfs/inode.c | 11
fs/seq_file.c | 16
fs/sysv/super.c | 6
include/asm-generic/sections.h | 75 +++-
include/kunit/test.h | 13
include/linux/bottom_half.h | 3
include/linux/container_of.h | 52 ++-
include/linux/crash_dump.h | 30 +
include/linux/delay.h | 2
include/linux/fs.h | 1
include/linux/fwnode.h | 1
include/linux/generic-radix-tree.h | 3
include/linux/hugetlb.h | 6
include/linux/instruction_pointer.h | 8
include/linux/kallsyms.h | 21 -
include/linux/kernel.h | 39 --
include/linux/list.h | 4
include/linux/llist.h | 4
include/linux/pagemap.h | 50 ++
include/linux/plist.h | 5
include/linux/radix-tree.h | 4
include/linux/rwsem.h | 1
include/linux/sbitmap.h | 11
include/linux/seq_file.h | 19 +
include/linux/signal.h | 1
include/linux/smp.h | 1
include/linux/spinlock.h | 1
include/linux/stackdepot.h | 5
include/linux/string_helpers.h | 1
include/media/media-entity.h | 3
init/main.c | 4
ipc/ipc_sysctl.c | 42 +-
ipc/shm.c | 8
kernel/extable.c | 33 -
kernel/fork.c | 9
kernel/kcov.c | 40 +-
kernel/locking/lockdep.c | 3
kernel/resource.c | 54 ++-
kernel/trace/ftrace.c | 2
lib/scatterlist.c | 11
lib/stackdepot.c | 46 ++
lib/vsprintf.c | 3
mm/Kconfig | 7
mm/filemap.c | 8
mm/kasan/report.c | 17 -
mm/memfd.c | 4
mm/mmap.c | 3
mm/page_owner.c | 18 -
mm/truncate.c | 19 +
mm/vmscan.c | 7
mm/workingset.c | 10
net/sysctl_net.c | 2
scripts/checkpatch.pl | 33 +
scripts/const_structs.checkpatch | 4
scripts/gdb/linux/symbols.py | 3
tools/testing/selftests/kselftest/runner.sh | 28 +
tools/testing/selftests/proc/.gitignore | 1
tools/testing/selftests/proc/Makefile | 2
tools/testing/selftests/proc/proc-tid0.c | 81 ++++
132 files changed, 1206 insertions(+), 681 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-11-11 4:32 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-11-11 4:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
The post-linux-next material.
7 patches, based on debe436e77c72fcee804fb867f275e6d31aa999c.
Subsystems affected by this patch series:
mm/debug
mm/slab-generic
mm/migration
mm/memcg
mm/kasan
Subsystem: mm/debug
Yixuan Cao <caoyixuan2019@email.szu.edu.cn>:
mm/page_owner.c: modify the type of argument "order" in some functions
Subsystem: mm/slab-generic
Ingo Molnar <mingo@kernel.org>:
mm: allow only SLUB on PREEMPT_RT
Subsystem: mm/migration
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: migrate: simplify the file-backed pages validation when migrating its mapping
Alistair Popple <apopple@nvidia.com>:
mm/migrate.c: remove MIGRATE_PFN_LOCKED
Subsystem: mm/memcg
Christoph Hellwig <hch@lst.de>:
Patch series "unexport memcg locking helpers":
mm: unexport folio_memcg_{,un}lock
mm: unexport {,un}lock_page_memcg
Subsystem: mm/kasan
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
kasan: add kasan mode messages when kasan init
Documentation/vm/hmm.rst | 2
arch/arm64/mm/kasan_init.c | 2
arch/powerpc/kvm/book3s_hv_uvmem.c | 4
drivers/gpu/drm/amd/amdkfd/kfd_migrate.c | 2
drivers/gpu/drm/nouveau/nouveau_dmem.c | 4
include/linux/migrate.h | 1
include/linux/page_owner.h | 12 +-
init/Kconfig | 2
lib/test_hmm.c | 5 -
mm/kasan/hw_tags.c | 14 ++
mm/kasan/sw_tags.c | 2
mm/memcontrol.c | 4
mm/migrate.c | 151 +++++--------------------------
mm/page_owner.c | 6 -
14 files changed, 61 insertions(+), 150 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-11-20 0:42 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-11-20 0:42 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
15 patches, based on a90af8f15bdc9449ee2d24e1d73fa3f7e8633f81.
Subsystems affected by this patch series:
mm/swap
ipc
mm/slab-generic
hexagon
mm/kmemleak
mm/hugetlb
mm/kasan
mm/damon
mm/highmem
proc
Subsystem: mm/swap
Matthew Wilcox <willy@infradead.org>:
mm/swap.c:put_pages_list(): reinitialise the page list
Subsystem: ipc
Alexander Mikhalitsyn <alexander.mikhalitsyn@virtuozzo.com>:
Patch series "shm: shm_rmid_forced feature fixes":
ipc: WARN if trying to remove ipc object which is absent
shm: extend forced shm destroy to support objects from several IPC nses
Subsystem: mm/slab-generic
Yunfeng Ye <yeyunfeng@huawei.com>:
mm: emit the "free" trace report before freeing memory in kmem_cache_free()
Subsystem: hexagon
Nathan Chancellor <nathan@kernel.org>:
Patch series "Fixes for ARCH=hexagon allmodconfig", v2:
hexagon: export raw I/O routines for modules
hexagon: clean up timer-regs.h
hexagon: ignore vmlinux.lds
Subsystem: mm/kmemleak
Rustam Kovhaev <rkovhaev@gmail.com>:
mm: kmemleak: slob: respect SLAB_NOLEAKTRACE flag
Subsystem: mm/hugetlb
Bui Quang Minh <minhquangbui99@gmail.com>:
hugetlb: fix hugetlb cgroup refcounting during mremap
Mina Almasry <almasrymina@google.com>:
hugetlb, userfaultfd: fix reservation restore on userfaultfd error
Subsystem: mm/kasan
Kees Cook <keescook@chromium.org>:
kasan: test: silence intentional read overflow warnings
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
Patch series "DAMON fixes":
mm/damon/dbgfs: use '__GFP_NOWARN' for user-specified size buffer allocation
mm/damon/dbgfs: fix missed use of damon_dbgfs_lock
Subsystem: mm/highmem
Ard Biesheuvel <ardb@kernel.org>:
kmap_local: don't assume kmap PTEs are linear arrays in memory
Subsystem: proc
David Hildenbrand <david@redhat.com>:
proc/vmcore: fix clearing user buffer by properly using clear_user()
arch/arm/Kconfig | 1
arch/hexagon/include/asm/timer-regs.h | 26 ----
arch/hexagon/include/asm/timex.h | 3
arch/hexagon/kernel/.gitignore | 1
arch/hexagon/kernel/time.c | 12 +-
arch/hexagon/lib/io.c | 4
fs/proc/vmcore.c | 20 ++-
include/linux/hugetlb_cgroup.h | 12 ++
include/linux/ipc_namespace.h | 15 ++
include/linux/sched/task.h | 2
ipc/shm.c | 189 +++++++++++++++++++++++++---------
ipc/util.c | 6 -
lib/test_kasan.c | 2
mm/Kconfig | 3
mm/damon/dbgfs.c | 20 ++-
mm/highmem.c | 32 +++--
mm/hugetlb.c | 11 +
mm/slab.c | 3
mm/slab.h | 2
mm/slob.c | 3
mm/slub.c | 2
mm/swap.c | 1
22 files changed, 254 insertions(+), 116 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-12-10 22:45 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-12-10 22:45 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
21 patches, based on c741e49150dbb0c0aebe234389f4aa8b47958fa8.
Subsystems affected by this patch series:
mm/mlock
MAINTAINERS
mailmap
mm/pagecache
mm/damon
mm/slub
mm/memcg
mm/hugetlb
mm/pagecache
Subsystem: mm/mlock
Drew DeVault <sir@cmpwn.com>:
Increase default MLOCK_LIMIT to 8 MiB
Subsystem: MAINTAINERS
Dave Young <dyoung@redhat.com>:
MAINTAINERS: update kdump maintainers
Subsystem: mailmap
Guo Ren <guoren@linux.alibaba.com>:
mailmap: update email address for Guo Ren
Subsystem: mm/pagecache
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
filemap: remove PageHWPoison check from next_uptodate_page()
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
Patch series "mm/damon: Fix fake /proc/loadavg reports", v3:
timers: implement usleep_idle_range()
mm/damon/core: fix fake load reports due to uninterruptible sleeps
Patch series "mm/damon: Trivial fixups and improvements":
mm/damon/core: use better timer mechanisms selection threshold
mm/damon/dbgfs: remove an unnecessary error message
mm/damon/core: remove unnecessary error messages
mm/damon/vaddr: remove an unnecessary warning message
mm/damon/vaddr-test: split a test function having >1024 bytes frame size
mm/damon/vaddr-test: remove unnecessary variables
selftests/damon: skip test if DAMON is running
selftests/damon: test DAMON enabling with empty target_ids case
selftests/damon: test wrong DAMOS condition ranges input
selftests/damon: test debugfs file reads/writes with huge count
selftests/damon: split test cases
Subsystem: mm/slub
Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
mm/slub: fix endianness bug for alloc/free_traces attributes
Subsystem: mm/memcg
Waiman Long <longman@redhat.com>:
mm/memcg: relocate mod_objcg_mlstate(), get_obj_stock() and put_obj_stock()
Subsystem: mm/hugetlb
Zhenguo Yao <yaozhenguo1@gmail.com>:
hugetlbfs: fix issue of preallocation of gigantic pages can't work
Subsystem: mm/pagecache
Manjong Lee <mj0123.lee@samsung.com>:
mm: bdi: initialize bdi_min_ratio when bdi is unregistered
.mailmap | 2
MAINTAINERS | 2
include/linux/delay.h | 14
include/uapi/linux/resource.h | 13
kernel/time/timer.c | 16 -
mm/backing-dev.c | 7
mm/damon/core.c | 20 -
mm/damon/dbgfs.c | 4
mm/damon/vaddr-test.h | 85 ++---
mm/damon/vaddr.c | 1
mm/filemap.c | 2
mm/hugetlb.c | 2
mm/memcontrol.c | 106 +++----
mm/slub.c | 15 -
tools/testing/selftests/damon/.gitignore | 2
tools/testing/selftests/damon/Makefile | 7
tools/testing/selftests/damon/_debugfs_common.sh | 52 +++
tools/testing/selftests/damon/debugfs_attrs.sh | 149 ++--------
tools/testing/selftests/damon/debugfs_empty_targets.sh | 13
tools/testing/selftests/damon/debugfs_huge_count_read_write.sh | 22 +
tools/testing/selftests/damon/debugfs_schemes.sh | 19 +
tools/testing/selftests/damon/debugfs_target_ids.sh | 19 +
tools/testing/selftests/damon/huge_count_read_write.c | 39 ++
23 files changed, 363 insertions(+), 248 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-12-25 5:11 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-12-25 5:11 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
9 patches, based on bc491fb12513e79702c6f936c838f792b5389129.
Subsystems affected by this patch series:
mm/kfence
mm/mempolicy
core-kernel
MAINTAINERS
mm/memory-failure
mm/pagemap
mm/pagealloc
mm/damon
mm/memory-failure
Subsystem: mm/kfence
Baokun Li <libaokun1@huawei.com>:
kfence: fix memory leak when cat kfence objects
Subsystem: mm/mempolicy
Andrey Ryabinin <arbn@yandex-team.com>:
mm: mempolicy: fix THP allocations escaping mempolicy restrictions
Subsystem: core-kernel
Philipp Rudo <prudo@redhat.com>:
kernel/crash_core: suppress unknown crashkernel parameter warning
Subsystem: MAINTAINERS
Randy Dunlap <rdunlap@infradead.org>:
MAINTAINERS: mark more list instances as moderated
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm, hwpoison: fix condition in free hugetlb page path
Subsystem: mm/pagemap
Hugh Dickins <hughd@google.com>:
mm: delete unsafe BUG from page_cache_add_speculative()
Subsystem: mm/pagealloc
Thibaut Sautereau <thibaut.sautereau@ssi.gouv.fr>:
mm/page_alloc: fix __alloc_size attribute for alloc_pages_exact_nid
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
mm/damon/dbgfs: protect targets destructions with kdamond_lock
Subsystem: mm/memory-failure
Liu Shixin <liushixin2@huawei.com>:
mm/hwpoison: clear MF_COUNT_INCREASED before retrying get_any_page()
MAINTAINERS | 4 ++--
include/linux/gfp.h | 2 +-
include/linux/pagemap.h | 1 -
kernel/crash_core.c | 11 +++++++++++
mm/damon/dbgfs.c | 2 ++
mm/kfence/core.c | 1 +
mm/memory-failure.c | 14 +++++---------
mm/mempolicy.c | 3 +--
8 files changed, 23 insertions(+), 15 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2021-12-31 4:12 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2021-12-31 4:12 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
2 patches, based on 4f3d93c6eaff6b84e43b63e0d7a119c5920e1020.
Subsystems affected by this patch series:
mm/userfaultfd
mm/damon
Subsystem: mm/userfaultfd
Mike Kravetz <mike.kravetz@oracle.com>:
userfaultfd/selftests: fix hugetlb area allocations
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
mm/damon/dbgfs: fix 'struct pid' leaks in 'dbgfs_target_ids_write()'
mm/damon/dbgfs.c | 9 +++++++--
tools/testing/selftests/vm/userfaultfd.c | 16 ++++++++++------
2 files changed, 17 insertions(+), 8 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-01-14 22:02 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-01-14 22:02 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
146 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16")
Subsystems affected by this patch series:
kthread
ia64
scripts
ntfs
squashfs
ocfs2
vfs
mm/slab-generic
mm/slab
mm/kmemleak
mm/dax
mm/kasan
mm/debug
mm/pagecache
mm/gup
mm/shmem
mm/frontswap
mm/memremap
mm/memcg
mm/selftests
mm/pagemap
mm/dma
mm/vmalloc
mm/memory-failure
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/mempolicy
mm/oom-kill
mm/hugetlbfs
mm/migration
mm/thp
mm/ksm
mm/page-poison
mm/percpu
mm/rmap
mm/zswap
mm/zram
mm/cleanups
mm/hmm
mm/damon
Subsystem: kthread
Cai Huoqing <caihuoqing@baidu.com>:
kthread: add the helper function kthread_run_on_cpu()
RDMA/siw: make use of the helper function kthread_run_on_cpu()
ring-buffer: make use of the helper function kthread_run_on_cpu()
rcutorture: make use of the helper function kthread_run_on_cpu()
trace/osnoise: make use of the helper function kthread_run_on_cpu()
trace/hwlat: make use of the helper function kthread_run_on_cpu()
Subsystem: ia64
Yang Guang <yang.guang5@zte.com.cn>:
ia64: module: use swap() to make code cleaner
arch/ia64/kernel/setup.c: use swap() to make code cleaner
Jason Wang <wangborong@cdjrlc.com>:
ia64: fix typo in a comment
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
ia64: topology: use default_groups in kobj_type
Subsystem: scripts
Drew Fustini <dfustini@baylibre.com>:
scripts/spelling.txt: add "oveflow"
Subsystem: ntfs
Yang Li <yang.lee@linux.alibaba.com>:
fs/ntfs/attrib.c: fix one kernel-doc comment
Subsystem: squashfs
Zheng Liang <zhengliang6@huawei.com>:
squashfs: provide backing_dev_info in order to disable read-ahead
Subsystem: ocfs2
Zhang Mingyu <zhang.mingyu@zte.com.cn>:
ocfs2: use BUG_ON instead of if condition followed by BUG.
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: clearly handle ocfs2_grab_pages_for_write() return value
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
ocfs2: use default_groups in kobj_type
Colin Ian King <colin.i.king@gmail.com>:
ocfs2: remove redundant assignment to pointer root_bh
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
ocfs2: cluster: use default_groups in kobj_type
Colin Ian King <colin.i.king@gmail.com>:
ocfs2: remove redundant assignment to variable free_space
Subsystem: vfs
Amit Daniel Kachhap <amit.kachhap@arm.com>:
fs/ioctl: remove unnecessary __user annotation
Subsystem: mm/slab-generic
Marco Elver <elver@google.com>:
mm/slab_common: use WARN() if cache still has objects on destroy
Subsystem: mm/slab
Muchun Song <songmuchun@bytedance.com>:
mm: slab: make slab iterator functions static
Subsystem: mm/kmemleak
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
kmemleak: fix kmemleak false positive report with HW tag-based kasan enable
Calvin Zhang <calvinzhang.cool@gmail.com>:
mm: kmemleak: alloc gray object for reserved region with direct map
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: defer kmemleak object creation of module_alloc()
Subsystem: mm/dax
Joao Martins <joao.m.martins@oracle.com>:
Patch series "mm, device-dax: Introduce compound pages in devmap", v7:
mm/page_alloc: split prep_compound_page into head and tail subparts
mm/page_alloc: refactor memmap_init_zone_device() page init
mm/memremap: add ZONE_DEVICE support for compound pages
device-dax: use ALIGN() for determining pgoff
device-dax: use struct_size()
device-dax: ensure dev_dax->pgmap is valid for dynamic devices
device-dax: factor out page mapping initialization
device-dax: set mapping prior to vmf_insert_pfn{,_pmd,pud}()
device-dax: remove pfn from __dev_dax_{pte,pmd,pud}_fault()
device-dax: compound devmap support
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
kasan: test: add globals left-out-of-bounds test
kasan: add ability to detect double-kmem_cache_destroy()
kasan: test: add test case for double-kmem_cache_destroy()
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix quarantine conflicting with init_on_free
Subsystem: mm/debug
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm,fs: split dump_mapping() out from dump_page()
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/debug_vm_pgtable: update comments regarding migration swap entries
Subsystem: mm/pagecache
chiminghao <chi.minghao@zte.com.cn>:
mm/truncate.c: remove unneeded variable
Subsystem: mm/gup
Christophe Leroy <christophe.leroy@csgroup.eu>:
gup: avoid multiple user access locking/unlocking in fault_in_{read/write}able
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/gup.c: stricter check on THP migration entry during follow_pmd_mask
Subsystem: mm/shmem
Yang Shi <shy828301@gmail.com>:
mm: shmem: don't truncate page if memory failure happens
Gang Li <ligang.bdlg@bytedance.com>:
shmem: fix a race between shmem_unused_huge_shrink and shmem_evict_inode
Subsystem: mm/frontswap
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
mm/frontswap.c: use non-atomic '__set_bit()' when possible
Subsystem: mm/memremap
Subsystem: mm/memcg
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: make cgroup_memory_nokmem static
Donghai Qiao <dqiao@redhat.com>:
mm/page_counter: remove an incorrect call to propagate_protected_usage()
Dan Schatzberg <schatzberg.dan@gmail.com>:
mm/memcg: add oom_group_kill memory event
Shakeel Butt <shakeelb@google.com>:
memcg: better bounds on the memcg stats updates
Wang Weiyang <wangweiyang2@huawei.com>:
mm/memcg: use struct_size() helper in kzalloc()
Shakeel Butt <shakeelb@google.com>:
memcg: add per-memcg vmalloc stat
Subsystem: mm/selftests
chiminghao <chi.minghao@zte.com.cn>:
tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner
Subsystem: mm/pagemap
Qi Zheng <zhengqi.arch@bytedance.com>:
mm: remove redundant check about FAULT_FLAG_ALLOW_RETRY bit
Colin Cross <ccross@google.com>:
Patch series "mm: rearrange madvise code to allow for reuse", v11:
mm: rearrange madvise code to allow for reuse
mm: add a field to store names for private anonymous memory
Suren Baghdasaryan <surenb@google.com>:
mm: add anonymous vma name refcounting
Arnd Bergmann <arnd@arndb.de>:
mm: move anon_vma declarations to linux/mm_inline.h
mm: move tlb_flush_pending inline helpers to mm_inline.h
Suren Baghdasaryan <surenb@google.com>:
mm: protect free_pgtables with mmap_lock write lock in exit_mmap
mm: document locking restrictions for vm_operations_struct::close
mm/oom_kill: allow process_mrelease to run under mmap_lock protection
Shuah Khan <skhan@linuxfoundation.org>:
docs/vm: add vmalloced-kernel-stacks document
Pasha Tatashin <pasha.tatashin@soleen.com>:
Patch series "page table check", v3:
mm: change page type prior to adding page table entry
mm: ptep_clear() page table helper
mm: page table check
x86: mm: add x86_64 support for page table check
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: remove last argument of reuse_swap_page()
mm: remove the total_mapcount argument from page_trans_huge_map_swapcount()
mm: remove the total_mapcount argument from page_trans_huge_mapcount()
Subsystem: mm/dma
Christian König <christian.koenig@amd.com>:
mm/dmapool.c: revert "make dma pool to use kmalloc_node"
Subsystem: mm/vmalloc
Michal Hocko <mhocko@suse.com>:
Patch series "extend vmalloc support for constrained allocations", v2:
mm/vmalloc: alloc GFP_NO{FS,IO} for vmalloc
mm/vmalloc: add support for __GFP_NOFAIL
mm/vmalloc: be more explicit about supported gfp flags.
mm: allow !GFP_KERNEL allocations for kvmalloc
mm: make slab and vmalloc allocators __GFP_NOLOCKDEP aware
"NeilBrown" <neilb@suse.de>:
mm: introduce memalloc_retry_wait()
Suren Baghdasaryan <surenb@google.com>:
mm/pagealloc: sysctl: change watermark_scale_factor max limit to 30%
Changcheng Deng <deng.changcheng@zte.com.cn>:
mm: fix boolreturn.cocci warning
Xiongwei Song <sxwjean@gmail.com>:
mm: page_alloc: fix building error on -Werror=array-compare
Michal Hocko <mhocko@suse.com>:
mm: drop node from alloc_pages_vma
Miles Chen <miles.chen@mediatek.com>:
include/linux/gfp.h: further document GFP_DMA32
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/page_alloc.c: modify the comment section for alloc_contig_pages()
Baoquan He <bhe@redhat.com>:
Patch series "Handle warning of allocation failure on DMA zone w/o managed pages", v4:
mm_zone: add function to check if managed dma zone exists
dma/pool: create dma atomic pool only if dma zone has managed pages
mm/page_alloc.c: do not warn allocation failure on zone DMA if no managed pages
Subsystem: mm/memory-failure
Subsystem: mm/hugetlb
Mina Almasry <almasrymina@google.com>:
hugetlb: add hugetlb.*.numa_stat file
Yosry Ahmed <yosryahmed@google.com>:
mm, hugepages: make memory size variable in hugepage-mremap selftest
Yang Yang <yang.yang29@zte.com.cn>:
mm/vmstat: add events for THP max_ptes_* exceeds
Waiman Long <longman@redhat.com>:
selftests/vm: make charge_reserved_hugetlb.sh work with existing cgroup setting
Subsystem: mm/userfaultfd
Peter Xu <peterx@redhat.com>:
selftests/uffd: allow EINTR/EAGAIN
Mike Kravetz <mike.kravetz@oracle.com>:
userfaultfd/selftests: clean up hugetlb allocation code
Subsystem: mm/vmscan
Gang Li <ligang.bdlg@bytedance.com>:
vmscan: make drop_slab_node static
Chen Wandun <chenwandun@huawei.com>:
mm/page_isolation: unset migratetype directly for non Buddy page
Subsystem: mm/mempolicy
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "mm: add new syscall set_mempolicy_home_node", v6:
mm/mempolicy: use policy_node helper with MPOL_PREFERRED_MANY
mm/mempolicy: add set_mempolicy_home_node syscall
mm/mempolicy: wire up syscall set_mempolicy_home_node
Randy Dunlap <rdunlap@infradead.org>:
mm/mempolicy: fix all kernel-doc warnings
Subsystem: mm/oom-kill
Jann Horn <jannh@google.com>:
mm, oom: OOM sysrq should always kill a process
Subsystem: mm/hugetlbfs
Sean Christopherson <seanjc@google.com>:
hugetlbfs: fix off-by-one error in hugetlb_vmdelete_list()
Subsystem: mm/migration
Baolin Wang <baolin.wang@linux.alibaba.com>:
Patch series "Improve the migration stats":
mm: migrate: fix the return value of migrate_pages()
mm: migrate: correct the hugetlb migration stats
mm: compaction: fix the migration stats in trace_mm_compaction_migratepages()
mm: migrate: support multiple target nodes demotion
mm: migrate: add more comments for selecting target node randomly
Huang Ying <ying.huang@intel.com>:
mm/migrate: move node demotion code to near its user
Colin Ian King <colin.i.king@gmail.com>:
mm/migrate: remove redundant variables used in a for-loop
Subsystem: mm/thp
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/thp: drop unused trace events hugepage_[invalidate|splitting]
Subsystem: mm/ksm
Nanyong Sun <sunnanyong@huawei.com>:
mm: ksm: fix use-after-free kasan report in ksm_might_need_to_copy
Subsystem: mm/page-poison
Naoya Horiguchi <naoya.horiguchi@nec.com>:
Patch series "mm/hwpoison: fix unpoison_memory()", v4:
mm/hwpoison: mf_mutex for soft offline and unpoison
mm/hwpoison: remove MF_MSG_BUDDY_2ND and MF_MSG_POISONED_HUGE
mm/hwpoison: fix unpoison_memory()
Subsystem: mm/percpu
Qi Zheng <zhengqi.arch@bytedance.com>:
mm: memcg/percpu: account extra objcg space to memory cgroups
Subsystem: mm/rmap
Huang Ying <ying.huang@intel.com>:
mm/rmap: fix potential batched TLB flush race
Subsystem: mm/zswap
Zhaoyu Liu <zackary.liu.pro@gmail.com>:
zpool: remove the list of pools_head
Subsystem: mm/zram
Luis Chamberlain <mcgrof@kernel.org>:
zram: use ATTRIBUTE_GROUPS
Subsystem: mm/cleanups
Quanfa Fu <fuqf0919@gmail.com>:
mm: fix some comment errors
Ting Liu <liuting.0x7c00@bytedance.com>:
mm: make some vars and functions static or __init
Subsystem: mm/hmm
Alistair Popple <apopple@nvidia.com>:
mm/hmm.c: allow VM_MIXEDMAP to work with hmm_range_fault
Subsystem: mm/damon
Xin Hao <xhao@linux.alibaba.com>:
Patch series "mm/damon: Do some small changes", v4:
mm/damon: unified access_check function naming rules
mm/damon: add 'age' of region tracepoint support
mm/damon/core: use abs() instead of diff_of()
mm/damon: remove some unneeded function definitions in damon.h
Yihao Han <hanyihao@vivo.com>:
mm/damon/vaddr: remove swap_ranges() and replace it with swap()
Xin Hao <xhao@linux.alibaba.com>:
mm/damon/schemes: add the validity judgment of thresholds
mm/damon: move damon_rand() definition into damon.h
mm/damon: modify damon_rand() macro to static inline function
SeongJae Park <sj@kernel.org>:
Patch series "mm/damon: Misc cleanups":
mm/damon: convert macro functions to static inline functions
Docs/admin-guide/mm/damon/usage: update for scheme quotas and watermarks
Docs/admin-guide/mm/damon/usage: remove redundant information
Docs/admin-guide/mm/damon/usage: mention tracepoint at the beginning
Docs/admin-guide/mm/damon/usage: update for kdamond_pid and (mk|rm)_contexts
mm/damon: remove a mistakenly added comment for a future feature
Patch series "mm/damon/schemes: Extend stats for better online analysis and tuning":
mm/damon/schemes: account scheme actions that successfully applied
mm/damon/schemes: account how many times quota limit has exceeded
mm/damon/reclaim: provide reclamation statistics
Docs/admin-guide/mm/damon/reclaim: document statistics parameters
mm/damon/dbgfs: support all DAMOS stats
Docs/admin-guide/mm/damon/usage: update for schemes statistics
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm/damon: add access checking for hugetlb pages
Guoqing Jiang <guoqing.jiang@linux.dev>:
mm/damon: move the implementation of damon_insert_region to damon.h
SeongJae Park <sj@kernel.org>:
Patch series "mm/damon: Hide unnecessary information disclosures":
mm/damon/dbgfs: remove an unnecessary variable
mm/damon/vaddr: use pr_debug() for damon_va_three_regions() failure logging
mm/damon/vaddr: hide kernel pointer from damon_va_three_regions() failure log
mm/damon: hide kernel pointer from tracepoint event
Documentation/admin-guide/cgroup-v1/hugetlb.rst | 4
Documentation/admin-guide/cgroup-v2.rst | 11
Documentation/admin-guide/mm/damon/reclaim.rst | 25
Documentation/admin-guide/mm/damon/usage.rst | 235 +++++--
Documentation/admin-guide/mm/numa_memory_policy.rst | 16
Documentation/admin-guide/sysctl/vm.rst | 2
Documentation/filesystems/proc.rst | 6
Documentation/vm/arch_pgtable_helpers.rst | 20
Documentation/vm/index.rst | 2
Documentation/vm/page_migration.rst | 12
Documentation/vm/page_table_check.rst | 56 +
Documentation/vm/vmalloced-kernel-stacks.rst | 153 ++++
MAINTAINERS | 9
arch/Kconfig | 3
arch/alpha/kernel/syscalls/syscall.tbl | 1
arch/alpha/mm/fault.c | 16
arch/arc/mm/fault.c | 3
arch/arm/mm/fault.c | 2
arch/arm/tools/syscall.tbl | 1
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 2
arch/arm64/kernel/module.c | 4
arch/arm64/mm/fault.c | 6
arch/hexagon/mm/vm_fault.c | 8
arch/ia64/kernel/module.c | 6
arch/ia64/kernel/setup.c | 5
arch/ia64/kernel/syscalls/syscall.tbl | 1
arch/ia64/kernel/topology.c | 3
arch/ia64/kernel/uncached.c | 2
arch/ia64/mm/fault.c | 16
arch/m68k/kernel/syscalls/syscall.tbl | 1
arch/m68k/mm/fault.c | 18
arch/microblaze/kernel/syscalls/syscall.tbl | 1
arch/microblaze/mm/fault.c | 18
arch/mips/kernel/syscalls/syscall_n32.tbl | 1
arch/mips/kernel/syscalls/syscall_n64.tbl | 1
arch/mips/kernel/syscalls/syscall_o32.tbl | 1
arch/mips/mm/fault.c | 19
arch/nds32/mm/fault.c | 16
arch/nios2/mm/fault.c | 18
arch/openrisc/mm/fault.c | 18
arch/parisc/kernel/syscalls/syscall.tbl | 1
arch/parisc/mm/fault.c | 18
arch/powerpc/kernel/syscalls/syscall.tbl | 1
arch/powerpc/mm/fault.c | 6
arch/riscv/mm/fault.c | 2
arch/s390/kernel/module.c | 5
arch/s390/kernel/syscalls/syscall.tbl | 1
arch/s390/mm/fault.c | 28
arch/sh/kernel/syscalls/syscall.tbl | 1
arch/sh/mm/fault.c | 18
arch/sparc/kernel/syscalls/syscall.tbl | 1
arch/sparc/mm/fault_32.c | 16
arch/sparc/mm/fault_64.c | 16
arch/um/kernel/trap.c | 8
arch/x86/Kconfig | 1
arch/x86/entry/syscalls/syscall_32.tbl | 1
arch/x86/entry/syscalls/syscall_64.tbl | 1
arch/x86/include/asm/pgtable.h | 31 -
arch/x86/kernel/module.c | 7
arch/x86/mm/fault.c | 3
arch/xtensa/kernel/syscalls/syscall.tbl | 1
arch/xtensa/mm/fault.c | 17
drivers/block/zram/zram_drv.c | 11
drivers/dax/bus.c | 32 +
drivers/dax/bus.h | 1
drivers/dax/device.c | 140 ++--
drivers/infiniband/sw/siw/siw_main.c | 7
drivers/of/fdt.c | 6
fs/ext4/extents.c | 8
fs/ext4/inline.c | 5
fs/ext4/page-io.c | 9
fs/f2fs/data.c | 4
fs/f2fs/gc.c | 5
fs/f2fs/inode.c | 4
fs/f2fs/node.c | 4
fs/f2fs/recovery.c | 6
fs/f2fs/segment.c | 9
fs/f2fs/super.c | 5
fs/hugetlbfs/inode.c | 7
fs/inode.c | 49 +
fs/ioctl.c | 2
fs/ntfs/attrib.c | 2
fs/ocfs2/alloc.c | 2
fs/ocfs2/aops.c | 26
fs/ocfs2/cluster/masklog.c | 11
fs/ocfs2/dir.c | 2
fs/ocfs2/filecheck.c | 3
fs/ocfs2/journal.c | 6
fs/proc/task_mmu.c | 13
fs/squashfs/super.c | 33 +
fs/userfaultfd.c | 8
fs/xfs/kmem.c | 3
fs/xfs/xfs_buf.c | 2
include/linux/ceph/libceph.h | 1
include/linux/damon.h | 93 +--
include/linux/fs.h | 1
include/linux/gfp.h | 12
include/linux/hugetlb.h | 4
include/linux/hugetlb_cgroup.h | 7
include/linux/kasan.h | 4
include/linux/kthread.h | 25
include/linux/memcontrol.h | 22
include/linux/mempolicy.h | 1
include/linux/memremap.h | 11
include/linux/mm.h | 76 --
include/linux/mm_inline.h | 136 ++++
include/linux/mm_types.h | 252 +++-----
include/linux/mmzone.h | 9
include/linux/page-flags.h | 6
include/linux/page_idle.h | 1
include/linux/page_table_check.h | 147 ++++
include/linux/pgtable.h | 8
include/linux/sched/mm.h | 26
include/linux/swap.h | 8
include/linux/syscalls.h | 3
include/linux/vm_event_item.h | 3
include/linux/vmalloc.h | 7
include/ras/ras_event.h | 2
include/trace/events/compaction.h | 24
include/trace/events/damon.h | 15
include/trace/events/thp.h | 35 -
include/uapi/asm-generic/unistd.h | 5
include/uapi/linux/prctl.h | 3
kernel/dma/pool.c | 4
kernel/fork.c | 3
kernel/kthread.c | 1
kernel/rcu/rcutorture.c | 7
kernel/sys.c | 63 ++
kernel/sys_ni.c | 1
kernel/sysctl.c | 3
kernel/trace/ring_buffer.c | 7
kernel/trace/trace_hwlat.c | 6
kernel/trace/trace_osnoise.c | 3
lib/test_hmm.c | 24
lib/test_kasan.c | 30
mm/Kconfig | 14
mm/Kconfig.debug | 24
mm/Makefile | 1
mm/compaction.c | 7
mm/damon/core.c | 45 -
mm/damon/dbgfs.c | 20
mm/damon/paddr.c | 24
mm/damon/prmtv-common.h | 4
mm/damon/reclaim.c | 46 +
mm/damon/vaddr.c | 186 ++++--
mm/debug.c | 52 -
mm/debug_vm_pgtable.c | 6
mm/dmapool.c | 2
mm/frontswap.c | 4
mm/gup.c | 31 -
mm/hmm.c | 5
mm/huge_memory.c | 32 -
mm/hugetlb.c | 6
mm/hugetlb_cgroup.c | 133 +++-
mm/internal.h | 7
mm/kasan/quarantine.c | 11
mm/kasan/shadow.c | 9
mm/khugepaged.c | 23
mm/kmemleak.c | 21
mm/ksm.c | 5
mm/madvise.c | 510 ++++++++++------
mm/mapping_dirty_helpers.c | 1
mm/memcontrol.c | 44 -
mm/memory-failure.c | 189 +++---
mm/memory.c | 12
mm/mempolicy.c | 95 ++-
mm/memremap.c | 18
mm/migrate.c | 527 ++++++++++-------
mm/mlock.c | 2
mm/mmap.c | 55 +
mm/mmu_gather.c | 1
mm/mprotect.c | 2
mm/oom_kill.c | 30
mm/page_alloc.c | 198 ++++--
mm/page_counter.c | 1
mm/page_ext.c | 8
mm/page_isolation.c | 2
mm/page_owner.c | 4
mm/page_table_check.c | 270 ++++++++
mm/percpu-internal.h | 18
mm/percpu.c | 10
mm/pgtable-generic.c | 1
mm/rmap.c | 43 +
mm/shmem.c | 91 ++
mm/slab.h | 5
mm/slab_common.c | 34 -
mm/swap.c | 2
mm/swapfile.c | 46 -
mm/truncate.c | 5
mm/userfaultfd.c | 5
mm/util.c | 15
mm/vmalloc.c | 75 +-
mm/vmscan.c | 2
mm/vmstat.c | 3
mm/zpool.c | 12
net/ceph/buffer.c | 4
net/ceph/ceph_common.c | 27
net/ceph/crypto.c | 2
net/ceph/messenger.c | 2
net/ceph/messenger_v2.c | 2
net/ceph/osdmap.c | 12
net/sunrpc/svc_xprt.c | 3
scripts/spelling.txt | 1
tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 34 -
tools/testing/selftests/vm/hmm-tests.c | 42 +
tools/testing/selftests/vm/hugepage-mremap.c | 46 -
tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 21
tools/testing/selftests/vm/run_vmtests.sh | 2
tools/testing/selftests/vm/userfaultfd.c | 33 -
tools/testing/selftests/vm/write_hugetlb_memory.sh | 2
211 files changed, 3980 insertions(+), 1759 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-01-20 2:07 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-01-20 2:07 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
55 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16")
Subsystems affected by this patch series:
percpu
procfs
sysctl
misc
core-kernel
get_maintainer
lib
checkpatch
binfmt
nilfs2
hfs
fat
adfs
panic
delayacct
kconfig
kcov
ubsan
Subsystem: percpu
Kefeng Wang <wangkefeng.wang@huawei.com>:
Patch series "mm: percpu: Cleanup percpu first chunk function":
mm: percpu: generalize percpu related config
mm: percpu: add pcpu_fc_cpu_to_node_fn_t typedef
mm: percpu: add generic pcpu_fc_alloc/free funciton
mm: percpu: add generic pcpu_populate_pte() function
Subsystem: procfs
David Hildenbrand <david@redhat.com>:
proc/vmcore: don't fake reading zeroes on surprise vmcore_cb unregistration
Hans de Goede <hdegoede@redhat.com>:
proc: make the proc_create[_data]() stubs static inlines
Qi Zheng <zhengqi.arch@bytedance.com>:
proc: convert the return type of proc_fd_access_allowed() to be boolean
Subsystem: sysctl
Geert Uytterhoeven <geert+renesas@glider.be>:
sysctl: fix duplicate path separator in printed entries
luo penghao <luo.penghao@zte.com.cn>:
sysctl: remove redundant ret assignment
Subsystem: misc
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
include/linux/unaligned: replace kernel.h with the necessary inclusions
kernel.h: include a note to discourage people from including it in headers
Subsystem: core-kernel
Yafang Shao <laoar.shao@gmail.com>:
Patch series "task comm cleanups", v2:
fs/exec: replace strlcpy with strscpy_pad in __set_task_comm
fs/exec: replace strncpy with strscpy_pad in __get_task_comm
drivers/infiniband: replace open-coded string copy with get_task_comm
fs/binfmt_elf: replace open-coded string copy with get_task_comm
samples/bpf/test_overhead_kprobe_kern: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm
tools/bpf/bpftool/skeleton: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm
tools/testing/selftests/bpf: replace open-coded 16 with TASK_COMM_LEN
kthread: dynamically allocate memory to store kthread's full name
Davidlohr Bueso <dave@stgolabs.net>:
kernel/sys.c: only take tasklist_lock for get/setpriority(PRIO_PGRP)
Subsystem: get_maintainer
Randy Dunlap <rdunlap@infradead.org>:
get_maintainer: don't remind about no git repo when --nogit is used
Subsystem: lib
Alexey Dobriyan <adobriyan@gmail.com>:
kstrtox: uninline everything
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
list: introduce list_is_head() helper and re-use it in list.h
Zhen Lei <thunder.leizhen@huawei.com>:
lib/list_debug.c: print more list debugging context in __list_del_entry_valid()
Isabella Basso <isabbasso@riseup.net>:
Patch series "test_hash.c: refactor into KUnit", v3:
hash.h: remove unused define directive
test_hash.c: split test_int_hash into arch-specific functions
test_hash.c: split test_hash_init
lib/Kconfig.debug: properly split hash test kernel entries
test_hash.c: refactor into kunit
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kunit: replace kernel.h with the necessary inclusions
uuid: discourage people from using UAPI header in new code
uuid: remove licence boilerplate text from the header
Andrey Konovalov <andreyknvl@google.com>:
lib/test_meminit: destroy cache in kmem_cache_alloc_bulk() test
Subsystem: checkpatch
Jerome Forissier <jerome@forissier.org>:
checkpatch: relax regexp for COMMIT_LOG_LONG_LINE
Joe Perches <joe@perches.com>:
checkpatch: improve Kconfig help test
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
const_structs.checkpatch: add frequently used ops structs
Subsystem: binfmt
"H.J. Lu" <hjl.tools@gmail.com>:
fs/binfmt_elf: use PT_LOAD p_align values for static PIE
Subsystem: nilfs2
Colin Ian King <colin.i.king@gmail.com>:
nilfs2: remove redundant pointer sbufs
Subsystem: hfs
Kees Cook <keescook@chromium.org>:
hfsplus: use struct_group_attr() for memcpy() region
Subsystem: fat
"NeilBrown" <neilb@suse.de>:
FAT: use io_schedule_timeout() instead of congestion_wait()
Subsystem: adfs
Minghao Chi <chi.minghao@zte.com.cn>:
fs/adfs: remove unneeded variable make code cleaner
Subsystem: panic
Marco Elver <elver@google.com>:
panic: use error_report_end tracepoint on warnings
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
panic: remove oops_id
Subsystem: delayacct
Yang Yang <yang.yang29@zte.com.cn>:
delayacct: support swapin delay accounting for swapping without blkio
delayacct: fix incomplete disable operation when switch enable to disable
delayacct: cleanup flags in struct task_delay_info and functions use it
wangyong <wang.yong12@zte.com.cn>:
Documentation/accounting/delay-accounting.rst: add thrashing page cache and direct compact
delayacct: track delays from memory compact
Subsystem: kconfig
Qian Cai <quic_qiancai@quicinc.com>:
configs: introduce debug.config for CI-like setup
Nathan Chancellor <nathan@kernel.org>:
Patch series "Fix CONFIG_TEST_KMOD with 256kB page size":
arch/Kconfig: split PAGE_SIZE_LESS_THAN_256KB from PAGE_SIZE_LESS_THAN_64KB
btrfs: use generic Kconfig option for 256kB page size limit
lib/Kconfig.debug: make TEST_KMOD depend on PAGE_SIZE_LESS_THAN_256KB
Subsystem: kcov
Marco Elver <elver@google.com>:
kcov: fix generic Kconfig dependencies if ARCH_WANTS_NO_INSTR
Subsystem: ubsan
Kees Cook <keescook@chromium.org>:
ubsan: remove CONFIG_UBSAN_OBJECT_SIZE
Colin Ian King <colin.i.king@gmail.com>:
lib: remove redundant assignment to variable ret
Documentation/accounting/delay-accounting.rst | 63 +-
arch/Kconfig | 4
arch/arm64/Kconfig | 20
arch/ia64/Kconfig | 9
arch/mips/Kconfig | 10
arch/mips/mm/init.c | 28 -
arch/powerpc/Kconfig | 17
arch/powerpc/kernel/setup_64.c | 113 ----
arch/riscv/Kconfig | 10
arch/sparc/Kconfig | 12
arch/sparc/kernel/led.c | 8
arch/sparc/kernel/smp_64.c | 119 -----
arch/x86/Kconfig | 19
arch/x86/kernel/setup_percpu.c | 82 ---
drivers/base/arch_numa.c | 78 ---
drivers/infiniband/hw/qib/qib.h | 2
drivers/infiniband/hw/qib/qib_file_ops.c | 2
drivers/infiniband/sw/rxe/rxe_qp.c | 3
drivers/net/wireless/broadcom/brcm80211/brcmfmac/xtlv.c | 2
fs/adfs/inode.c | 4
fs/binfmt_elf.c | 6
fs/btrfs/Kconfig | 3
fs/exec.c | 5
fs/fat/file.c | 5
fs/hfsplus/hfsplus_raw.h | 12
fs/hfsplus/xattr.c | 4
fs/nilfs2/page.c | 4
fs/proc/array.c | 3
fs/proc/base.c | 4
fs/proc/proc_sysctl.c | 9
fs/proc/vmcore.c | 10
include/kunit/assert.h | 2
include/linux/delayacct.h | 107 ++--
include/linux/elfcore-compat.h | 5
include/linux/elfcore.h | 5
include/linux/hash.h | 5
include/linux/kernel.h | 9
include/linux/kthread.h | 1
include/linux/list.h | 36 -
include/linux/percpu.h | 21
include/linux/proc_fs.h | 12
include/linux/sched.h | 9
include/linux/unaligned/packed_struct.h | 2
include/trace/events/error_report.h | 8
include/uapi/linux/taskstats.h | 6
include/uapi/linux/uuid.h | 10
kernel/configs/debug.config | 105 ++++
kernel/delayacct.c | 49 +-
kernel/kthread.c | 32 +
kernel/panic.c | 21
kernel/sys.c | 16
lib/Kconfig.debug | 45 +
lib/Kconfig.ubsan | 13
lib/Makefile | 5
lib/asn1_encoder.c | 2
lib/kstrtox.c | 12
lib/list_debug.c | 8
lib/lz4/lz4defs.h | 2
lib/test_hash.c | 375 +++++++---------
lib/test_meminit.c | 1
lib/test_ubsan.c | 22
mm/Kconfig | 12
mm/memory.c | 4
mm/page_alloc.c | 3
mm/page_io.c | 3
mm/percpu.c | 168 +++++--
samples/bpf/offwaketime_kern.c | 4
samples/bpf/test_overhead_kprobe_kern.c | 11
samples/bpf/test_overhead_tp_kern.c | 5
scripts/Makefile.ubsan | 1
scripts/checkpatch.pl | 54 +-
scripts/const_structs.checkpatch | 23
scripts/get_maintainer.pl | 2
tools/accounting/getdelays.c | 8
tools/bpf/bpftool/skeleton/pid_iter.bpf.c | 4
tools/include/linux/hash.h | 5
tools/testing/selftests/bpf/progs/test_stacktrace_map.c | 6
tools/testing/selftests/bpf/progs/test_tracepoint.c | 6
78 files changed, 943 insertions(+), 992 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-01-22 6:10 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-01-22 6:10 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
This is the post-linux-next queue. Material which was based on or
dependent upon material which was in -next.
69 patches, based on 9b57f458985742bd1c585f4c7f36d04634ce1143.
Subsystems affected by this patch series:
mm/migration
sysctl
mm/zsmalloc
proc
lib
Subsystem: mm/migration
Alistair Popple <apopple@nvidia.com>:
mm/migrate.c: rework migration_entry_wait() to not take a pageref
Subsystem: sysctl
Xiaoming Ni <nixiaoming@huawei.com>:
Patch series "sysctl: first set of kernel/sysctl cleanups", v2:
sysctl: add a new register_sysctl_init() interface
sysctl: move some boundary constants from sysctl.c to sysctl_vals
hung_task: move hung_task sysctl interface to hung_task.c
watchdog: move watchdog sysctl interface to watchdog.c
Stephen Kitt <steve@sk2.org>:
sysctl: make ngroups_max const
Xiaoming Ni <nixiaoming@huawei.com>:
sysctl: use const for typically used max/min proc sysctls
sysctl: use SYSCTL_ZERO to replace some static int zero uses
aio: move aio sysctl to aio.c
dnotify: move dnotify sysctl to dnotify.c
Luis Chamberlain <mcgrof@kernel.org>:
Patch series "sysctl: second set of kernel/sysctl cleanups", v2:
hpet: simplify subdirectory registration with register_sysctl()
i915: simplify subdirectory registration with register_sysctl()
macintosh/mac_hid.c: simplify subdirectory registration with register_sysctl()
ocfs2: simplify subdirectory registration with register_sysctl()
test_sysctl: simplify subdirectory registration with register_sysctl()
Xiaoming Ni <nixiaoming@huawei.com>:
inotify: simplify subdirectory registration with register_sysctl()
Luis Chamberlain <mcgrof@kernel.org>:
cdrom: simplify subdirectory registration with register_sysctl()
Xiaoming Ni <nixiaoming@huawei.com>:
eventpoll: simplify sysctl declaration with register_sysctl()
Patch series "sysctl: 3rd set of kernel/sysctl cleanups", v2:
firmware_loader: move firmware sysctl to its own files
random: move the random sysctl declarations to its own file
Luis Chamberlain <mcgrof@kernel.org>:
sysctl: add helper to register a sysctl mount point
fs: move binfmt_misc sysctl to its own file
Xiaoming Ni <nixiaoming@huawei.com>:
printk: move printk sysctl to printk/sysctl.c
scsi/sg: move sg-big-buff sysctl to scsi/sg.c
stackleak: move stack_erasing sysctl to stackleak.c
Luis Chamberlain <mcgrof@kernel.org>:
sysctl: share unsigned long const values
Patch series "sysctl: 4th set of kernel/sysctl cleanups":
fs: move inode sysctls to its own file
fs: move fs stat sysctls to file_table.c
fs: move dcache sysctls to its own file
sysctl: move maxolduid as a sysctl specific const
fs: move shared sysctls to fs/sysctls.c
fs: move locking sysctls where they are used
fs: move namei sysctls to its own file
fs: move fs/exec.c sysctls into its own file
fs: move pipe sysctls to is own file
Patch series "sysctl: add and use base directory declarer and registration helper":
sysctl: add and use base directory declarer and registration helper
fs: move namespace sysctls and declare fs base directory
kernel/sysctl.c: rename sysctl_init() to sysctl_init_bases()
Xiaoming Ni <nixiaoming@huawei.com>:
printk: fix build warning when CONFIG_PRINTK=n
fs/coredump: move coredump sysctls into its own file
kprobe: move sysctl_kprobes_optimization to kprobes.c
Colin Ian King <colin.i.king@gmail.com>:
kernel/sysctl.c: remove unused variable ten_thousand
Baokun Li <libaokun1@huawei.com>:
sysctl: returns -EINVAL when a negative value is passed to proc_doulongvec_minmax
Subsystem: mm/zsmalloc
Minchan Kim <minchan@kernel.org>:
Patch series "zsmalloc: remove bit_spin_lock", v2:
zsmalloc: introduce some helper functions
zsmalloc: rename zs_stat_type to class_stat_type
zsmalloc: decouple class actions from zspage works
zsmalloc: introduce obj_allocated
zsmalloc: move huge compressed obj from page to zspage
zsmalloc: remove zspage isolation for migration
locking/rwlocks: introduce write_lock_nested
zsmalloc: replace per zpage lock with pool->migrate_lock
Mike Galbraith <umgwanakikbuti@gmail.com>:
zsmalloc: replace get_cpu_var with local_lock
Subsystem: proc
Muchun Song <songmuchun@bytedance.com>:
fs: proc: store PDE()->data into inode->i_private
proc: remove PDE_DATA() completely
Subsystem: lib
Vlastimil Babka <vbabka@suse.cz>:
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc()
lib/stackdepot: fix spelling mistake and grammar in pr_err message
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup3
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup4
Marco Elver <elver@google.com>:
lib/stackdepot: always do filter_irq_stacks() in stack_depot_save()
Christoph Hellwig <hch@lst.de>:
Patch series "remove Xen tmem leftovers":
mm: remove cleancache
frontswap: remove frontswap_writethrough
frontswap: remove frontswap_tmem_exclusive_gets
frontswap: remove frontswap_shrink
frontswap: remove frontswap_curr_pages
frontswap: simplify frontswap_init
frontswap: remove the frontswap exports
mm: simplify try_to_unuse
frontswap: remove frontswap_test
frontswap: simplify frontswap_register_ops
mm: mark swap_lock and swap_active_head static
frontswap: remove support for multiple ops
mm: hide the FRONTSWAP Kconfig symbol
Documentation/vm/cleancache.rst | 296 ------
Documentation/vm/frontswap.rst | 31
Documentation/vm/index.rst | 1
MAINTAINERS | 7
arch/alpha/kernel/srm_env.c | 4
arch/arm/configs/bcm2835_defconfig | 1
arch/arm/configs/qcom_defconfig | 1
arch/arm/kernel/atags_proc.c | 2
arch/arm/mm/alignment.c | 2
arch/ia64/kernel/salinfo.c | 10
arch/m68k/configs/amiga_defconfig | 1
arch/m68k/configs/apollo_defconfig | 1
arch/m68k/configs/atari_defconfig | 1
arch/m68k/configs/bvme6000_defconfig | 1
arch/m68k/configs/hp300_defconfig | 1
arch/m68k/configs/mac_defconfig | 1
arch/m68k/configs/multi_defconfig | 1
arch/m68k/configs/mvme147_defconfig | 1
arch/m68k/configs/mvme16x_defconfig | 1
arch/m68k/configs/q40_defconfig | 1
arch/m68k/configs/sun3_defconfig | 1
arch/m68k/configs/sun3x_defconfig | 1
arch/powerpc/kernel/proc_powerpc.c | 4
arch/s390/configs/debug_defconfig | 1
arch/s390/configs/defconfig | 1
arch/sh/mm/alignment.c | 4
arch/xtensa/platforms/iss/simdisk.c | 4
block/bdev.c | 5
drivers/acpi/proc.c | 2
drivers/base/firmware_loader/fallback.c | 7
drivers/base/firmware_loader/fallback.h | 11
drivers/base/firmware_loader/fallback_table.c | 25
drivers/cdrom/cdrom.c | 23
drivers/char/hpet.c | 22
drivers/char/random.c | 14
drivers/gpu/drm/drm_dp_mst_topology.c | 1
drivers/gpu/drm/drm_mm.c | 4
drivers/gpu/drm/drm_modeset_lock.c | 9
drivers/gpu/drm/i915/i915_perf.c | 22
drivers/gpu/drm/i915/intel_runtime_pm.c | 3
drivers/hwmon/dell-smm-hwmon.c | 4
drivers/macintosh/mac_hid.c | 24
drivers/net/bonding/bond_procfs.c | 8
drivers/net/wireless/cisco/airo.c | 22
drivers/net/wireless/intersil/hostap/hostap_ap.c | 16
drivers/net/wireless/intersil/hostap/hostap_download.c | 2
drivers/net/wireless/intersil/hostap/hostap_proc.c | 24
drivers/net/wireless/ray_cs.c | 2
drivers/nubus/proc.c | 36
drivers/parisc/led.c | 4
drivers/pci/proc.c | 10
drivers/platform/x86/thinkpad_acpi.c | 4
drivers/platform/x86/toshiba_acpi.c | 16
drivers/pnp/isapnp/proc.c | 2
drivers/pnp/pnpbios/proc.c | 4
drivers/scsi/scsi_proc.c | 4
drivers/scsi/sg.c | 35
drivers/usb/gadget/function/rndis.c | 4
drivers/zorro/proc.c | 2
fs/Makefile | 4
fs/afs/proc.c | 6
fs/aio.c | 31
fs/binfmt_misc.c | 6
fs/btrfs/extent_io.c | 10
fs/btrfs/super.c | 2
fs/coredump.c | 66 +
fs/dcache.c | 37
fs/eventpoll.c | 10
fs/exec.c | 145 +--
fs/ext4/mballoc.c | 14
fs/ext4/readpage.c | 6
fs/ext4/super.c | 3
fs/f2fs/data.c | 13
fs/file_table.c | 47 -
fs/inode.c | 39
fs/jbd2/journal.c | 2
fs/locks.c | 34
fs/mpage.c | 7
fs/namei.c | 58 +
fs/namespace.c | 24
fs/notify/dnotify/dnotify.c | 21
fs/notify/fanotify/fanotify_user.c | 10
fs/notify/inotify/inotify_user.c | 11
fs/ntfs3/ntfs_fs.h | 1
fs/ocfs2/stackglue.c | 25
fs/ocfs2/super.c | 2
fs/pipe.c | 64 +
fs/proc/generic.c | 6
fs/proc/inode.c | 1
fs/proc/internal.h | 5
fs/proc/proc_net.c | 8
fs/proc/proc_sysctl.c | 67 +
fs/super.c | 3
fs/sysctls.c | 47 -
include/linux/aio.h | 4
include/linux/cleancache.h | 124 --
include/linux/coredump.h | 10
include/linux/dcache.h | 10
include/linux/dnotify.h | 1
include/linux/fanotify.h | 2
include/linux/frontswap.h | 35
include/linux/fs.h | 18
include/linux/inotify.h | 3
include/linux/kprobes.h | 6
include/linux/migrate.h | 2
include/linux/mount.h | 3
include/linux/pipe_fs_i.h | 4
include/linux/poll.h | 2
include/linux/printk.h | 4
include/linux/proc_fs.h | 17
include/linux/ref_tracker.h | 2
include/linux/rwlock.h | 6
include/linux/rwlock_api_smp.h | 8
include/linux/rwlock_rt.h | 10
include/linux/sched/sysctl.h | 14
include/linux/seq_file.h | 2
include/linux/shmem_fs.h | 3
include/linux/spinlock_api_up.h | 1
include/linux/stackdepot.h | 25
include/linux/stackleak.h | 5
include/linux/swapfile.h | 3
include/linux/sysctl.h | 67 +
include/scsi/sg.h | 4
init/main.c | 9
ipc/util.c | 2
kernel/hung_task.c | 81 +
kernel/irq/proc.c | 8
kernel/kprobes.c | 30
kernel/locking/spinlock.c | 10
kernel/locking/spinlock_rt.c | 12
kernel/printk/Makefile | 5
kernel/printk/internal.h | 8
kernel/printk/printk.c | 4
kernel/printk/sysctl.c | 85 +
kernel/resource.c | 4
kernel/stackleak.c | 26
kernel/sysctl.c | 790 +----------------
kernel/watchdog.c | 101 ++
lib/Kconfig | 4
lib/Kconfig.kasan | 2
lib/stackdepot.c | 46
lib/test_sysctl.c | 22
mm/Kconfig | 40
mm/Makefile | 1
mm/cleancache.c | 315 ------
mm/filemap.c | 102 +-
mm/frontswap.c | 259 -----
mm/kasan/common.c | 1
mm/migrate.c | 38
mm/page_owner.c | 2
mm/shmem.c | 33
mm/swapfile.c | 90 -
mm/truncate.c | 15
mm/zsmalloc.c | 557 ++++-------
mm/zswap.c | 8
net/atm/proc.c | 4
net/bluetooth/af_bluetooth.c | 8
net/can/bcm.c | 2
net/can/proc.c | 2
net/core/neighbour.c | 6
net/core/pktgen.c | 6
net/ipv4/netfilter/ipt_CLUSTERIP.c | 6
net/ipv4/raw.c | 8
net/ipv4/tcp_ipv4.c | 2
net/ipv4/udp.c | 6
net/netfilter/x_tables.c | 10
net/netfilter/xt_hashlimit.c | 18
net/netfilter/xt_recent.c | 4
net/sunrpc/auth_gss/svcauth_gss.c | 4
net/sunrpc/cache.c | 24
net/sunrpc/stats.c | 2
sound/core/info.c | 4
172 files changed, 1877 insertions(+), 2931 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-01-29 2:13 Andrew Morton
2022-01-29 4:25 ` incoming Matthew Wilcox
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2022-01-29 2:13 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f.
Subsystems affected by this patch series:
sysctl
binfmt
ia64
mm/memory-failure
mm/folios
selftests
mm/kasan
mm/psi
ocfs2
Subsystem: sysctl
Andrew Morton <akpm@linux-foundation.org>:
include/linux/sysctl.h: fix register_sysctl_mount_point() return type
Subsystem: binfmt
Tong Zhang <ztong0001@gmail.com>:
binfmt_misc: fix crash when load/unload module
Subsystem: ia64
Randy Dunlap <rdunlap@infradead.org>:
ia64: make IA64_MCA_RECOVERY bool instead of tristate
Subsystem: mm/memory-failure
Joao Martins <joao.m.martins@oracle.com>:
memory-failure: fetch compound_head after pgmap_pfn_valid()
Subsystem: mm/folios
Wei Yang <richard.weiyang@gmail.com>:
mm: page->mapping folio->mapping should have the same offset
Subsystem: selftests
Maor Gottlieb <maorg@nvidia.com>:
tools/testing/scatterlist: add missing defines
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
kasan: test: fix compatibility with FORTIFY_SOURCE
Peter Collingbourne <pcc@google.com>:
mm, kasan: use compare-exchange operation to set KASAN page tag
Subsystem: mm/psi
Suren Baghdasaryan <surenb@google.com>:
psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n
psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n
Subsystem: ocfs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
Patch series "ocfs2: fix a deadlock case":
jbd2: export jbd2_journal_[grab|put]_journal_head
ocfs2: fix a deadlock when commit trans
arch/ia64/Kconfig | 2
fs/binfmt_misc.c | 8 +--
fs/jbd2/journal.c | 2
fs/ocfs2/suballoc.c | 25 ++++-------
include/linux/mm.h | 17 +++++--
include/linux/mm_types.h | 1
include/linux/psi.h | 11 ++--
include/linux/sysctl.h | 2
kernel/sched/psi.c | 79 ++++++++++++++++++-----------------
lib/test_kasan.c | 5 ++
mm/memory-failure.c | 6 ++
tools/testing/scatterlist/linux/mm.h | 3 -
12 files changed, 91 insertions(+), 70 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2022-01-29 2:13 incoming Andrew Morton
@ 2022-01-29 4:25 ` Matthew Wilcox
2022-01-29 6:23 ` incoming Andrew Morton
0 siblings, 1 reply; 419+ messages in thread
From: Matthew Wilcox @ 2022-01-29 4:25 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linus Torvalds, mm-commits, linux-mm
On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote:
> 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f.
^^
I see 7?
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2022-01-29 4:25 ` incoming Matthew Wilcox
@ 2022-01-29 6:23 ` Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-01-29 6:23 UTC (permalink / raw)
To: Matthew Wilcox; +Cc: Linus Torvalds, mm-commits, linux-mm
On Sat, 29 Jan 2022 04:25:33 +0000 Matthew Wilcox <willy@infradead.org> wrote:
> On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote:
> > 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f.
> ^^
>
> I see 7?
Crap, sorry, ignore all this, shall redo tomorrow.
(It wasn't a good day over here. The thing with disk drives is that
the bigger they are, the harder they fall).
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-01-29 21:40 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-01-29 21:40 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
12 patches, based on f8c7e4ede46fe63ff10000669652648aab09d112.
Subsystems affected by this patch series:
sysctl
binfmt
ia64
mm/memory-failure
mm/folios
selftests
mm/kasan
mm/psi
ocfs2
Subsystem: sysctl
Andrew Morton <akpm@linux-foundation.org>:
include/linux/sysctl.h: fix register_sysctl_mount_point() return type
Subsystem: binfmt
Tong Zhang <ztong0001@gmail.com>:
binfmt_misc: fix crash when load/unload module
Subsystem: ia64
Randy Dunlap <rdunlap@infradead.org>:
ia64: make IA64_MCA_RECOVERY bool instead of tristate
Subsystem: mm/memory-failure
Joao Martins <joao.m.martins@oracle.com>:
memory-failure: fetch compound_head after pgmap_pfn_valid()
Subsystem: mm/folios
Wei Yang <richard.weiyang@gmail.com>:
mm: page->mapping folio->mapping should have the same offset
Subsystem: selftests
Maor Gottlieb <maorg@nvidia.com>:
tools/testing/scatterlist: add missing defines
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
kasan: test: fix compatibility with FORTIFY_SOURCE
Peter Collingbourne <pcc@google.com>:
mm, kasan: use compare-exchange operation to set KASAN page tag
Subsystem: mm/psi
Suren Baghdasaryan <surenb@google.com>:
psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n
psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n
Subsystem: ocfs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
Patch series "ocfs2: fix a deadlock case":
jbd2: export jbd2_journal_[grab|put]_journal_head
ocfs2: fix a deadlock when commit trans
arch/ia64/Kconfig | 2
fs/binfmt_misc.c | 8 +--
fs/jbd2/journal.c | 2
fs/ocfs2/suballoc.c | 25 ++++-------
include/linux/mm.h | 17 +++++--
include/linux/mm_types.h | 1
include/linux/psi.h | 11 ++--
include/linux/sysctl.h | 2
kernel/sched/psi.c | 79 ++++++++++++++++++-----------------
lib/test_kasan.c | 5 ++
mm/memory-failure.c | 6 ++
tools/testing/scatterlist/linux/mm.h | 3 -
12 files changed, 91 insertions(+), 70 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-02-04 4:48 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-02-04 4:48 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
10 patches, based on 1f2cfdd349b7647f438c1e552dc1b983da86d830.
Subsystems affected by this patch series:
mm/vmscan
mm/debug
mm/pagemap
ipc
mm/kmemleak
MAINTAINERS
mm/selftests
Subsystem: mm/vmscan
Chen Wandun <chenwandun@huawei.com>:
Revert "mm/page_isolation: unset migratetype directly for non Buddy page"
Subsystem: mm/debug
Pasha Tatashin <pasha.tatashin@soleen.com>:
Patch series "page table check fixes and cleanups", v5:
mm/debug_vm_pgtable: remove pte entry from the page table
mm/page_table_check: use unsigned long for page counters and cleanup
mm/khugepaged: unify collapse pmd clear, flush and free
mm/page_table_check: check entries at pmd levels
Subsystem: mm/pagemap
Mike Rapoport <rppt@linux.ibm.com>:
mm/pgtable: define pte_index so that preprocessor could recognize it
Subsystem: ipc
Minghao Chi <chi.minghao@zte.com.cn>:
ipc/sem: do not sleep with a spin lock held
Subsystem: mm/kmemleak
Lang Yu <lang.yu@amd.com>:
mm/kmemleak: avoid scanning potential huge holes
Subsystem: MAINTAINERS
Mike Rapoport <rppt@linux.ibm.com>:
MAINTAINERS: update rppt's email
Subsystem: mm/selftests
Shuah Khan <skhan@linuxfoundation.org>:
kselftest/vm: revert "tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner"
MAINTAINERS | 2 -
include/linux/page_table_check.h | 19 ++++++++++
include/linux/pgtable.h | 1
ipc/sem.c | 4 +-
mm/debug_vm_pgtable.c | 2 +
mm/khugepaged.c | 37 +++++++++++---------
mm/kmemleak.c | 13 +++----
mm/page_isolation.c | 2 -
mm/page_table_check.c | 55 +++++++++++++++----------------
tools/testing/selftests/vm/userfaultfd.c | 11 ++++--
10 files changed, 89 insertions(+), 57 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-02-12 0:27 Andrew Morton
2022-02-12 2:02 ` incoming Linus Torvalds
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2022-02-12 0:27 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43.
Subsystems affected by this patch series:
binfmt
procfs
mm/vmscan
mm/memcg
mm/kfence
Subsystem: binfmt
Mike Rapoport <rppt@linux.ibm.com>:
fs/binfmt_elf: fix PT_LOAD p_align values for loaders
Subsystem: procfs
Yang Shi <shy828301@gmail.com>:
fs/proc: task_mmu.c: don't read mapcount for migration entry
Subsystem: mm/vmscan
Mel Gorman <mgorman@suse.de>:
mm: vmscan: remove deadlock due to throttling failing to make progress
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: memcg: synchronize objcg lists with a dedicated spinlock
Subsystem: mm/kfence
Peng Liu <liupeng256@huawei.com>:
kfence: make test case compatible with run time set sample interval
fs/binfmt_elf.c | 2 +-
fs/proc/task_mmu.c | 40 +++++++++++++++++++++++++++++++---------
include/linux/kfence.h | 2 ++
include/linux/memcontrol.h | 5 +++--
mm/kfence/core.c | 3 ++-
mm/kfence/kfence_test.c | 8 ++++----
mm/memcontrol.c | 10 +++++-----
mm/vmscan.c | 4 +++-
8 files changed, 51 insertions(+), 23 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2022-02-12 0:27 incoming Andrew Morton
@ 2022-02-12 2:02 ` Linus Torvalds
2022-02-12 5:24 ` incoming Andrew Morton
0 siblings, 1 reply; 419+ messages in thread
From: Linus Torvalds @ 2022-02-12 2:02 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits, patches
On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43.
So this *completely* flummoxed 'b4', because you first sent the wrong
series, and then sent the right one in the same thread.
I fetched the emails manually, but honestly, this was confusing even
then, with two "[PATCH x/5]" series where the only way to tell the
right one was basically by date of email. They did arrive in the same
order in my mailbox, but even that wouldn't have been guaranteed if
there had been some mailer delays somewhere..
So next time when you mess up, resend it all as a completely new
series and completely new threading - so with a new header email too.
Please?
And since I'm here, let me just verify that yes, the series you
actually want me to apply is this one (as described by the head
email):
Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values ..
Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f..
Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl..
Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a ..
Subject: [patch 5/5] kfence: make test case compatible with run..
and not the other one with GUP patches?
Linus
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2022-02-12 2:02 ` incoming Linus Torvalds
@ 2022-02-12 5:24 ` Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-02-12 5:24 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Linux-MM, mm-commits, patches
On Fri, 11 Feb 2022 18:02:53 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43.
>
> So this *completely* flummoxed 'b4', because you first sent the wrong
> series, and then sent the right one in the same thread.
>
> I fetched the emails manually, but honestly, this was confusing even
> then, with two "[PATCH x/5]" series where the only way to tell the
> right one was basically by date of email. They did arrive in the same
> order in my mailbox, but even that wouldn't have been guaranteed if
> there had been some mailer delays somewhere..
Yes, I wondered. Sorry bout that.
> So next time when you mess up, resend it all as a completely new
> series and completely new threading - so with a new header email too.
> Please?
Wilco.
> And since I'm here, let me just verify that yes, the series you
> actually want me to apply is this one (as described by the head
> email):
>
> Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values ..
> Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f..
> Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl..
> Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a ..
> Subject: [patch 5/5] kfence: make test case compatible with run..
>
> and not the other one with GUP patches?
Those are the ones. Five fixes, three with cc:stable.
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-02-26 3:10 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-02-26 3:10 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
12 patches, based on c47658311d60be064b839f329c0e4d34f5f0735b.
Subsystems affected by this patch series:
MAINTAINERS
mm/hugetlb
mm/kasan
mm/hugetlbfs
mm/pagemap
mm/selftests
mm/memcg
m/slab
mailmap
memfd
Subsystem: MAINTAINERS
Luis Chamberlain <mcgrof@kernel.org>:
MAINTAINERS: add sysctl-next git tree
Subsystem: mm/hugetlb
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/hugetlb: fix kernel crash with hugetlb mremap
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: test: prevent cache merging in kmem_cache_double_destroy
Subsystem: mm/hugetlbfs
Liu Yuntao <liuyuntao10@huawei.com>:
hugetlbfs: fix a truncation issue in hugepages parameter
Subsystem: mm/pagemap
Suren Baghdasaryan <surenb@google.com>:
mm: fix use-after-free bug when mm->mmap is reused after being freed
Subsystem: mm/selftests
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
selftest/vm: fix map_fixed_noreplace test failure
Subsystem: mm/memcg
Roman Gushchin <roman.gushchin@linux.dev>:
MAINTAINERS: add Roman as a memcg co-maintainer
Vladimir Davydov <vdavydov.dev@gmail.com>:
MAINTAINERS: remove Vladimir from memcg maintainers
Shakeel Butt <shakeelb@google.com>:
MAINTAINERS: add Shakeel as a memcg co-maintainer
Subsystem: m/slab
Vlastimil Babka <vbabka@suse.cz>:
MAINTAINERS, SLAB: add Roman as reviewer, git tree
Subsystem: mailmap
Roman Gushchin <roman.gushchin@linux.dev>:
mailmap: update Roman Gushchin's email
Subsystem: memfd
Mike Kravetz <mike.kravetz@oracle.com>:
selftests/memfd: clean up mapping in mfd_fail_write
.mailmap | 3 +
MAINTAINERS | 6 ++
lib/test_kasan.c | 5 +-
mm/hugetlb.c | 11 ++---
mm/mmap.c | 1
tools/testing/selftests/memfd/memfd_test.c | 1
tools/testing/selftests/vm/map_fixed_noreplace.c | 49 +++++++++++++++++------
7 files changed, 56 insertions(+), 20 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-03-05 4:28 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-03-05 4:28 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
8 patches, based on 07ebd38a0da24d2534da57b4841346379db9f354.
Subsystems affected by this patch series:
mm/hugetlb
mm/pagemap
memfd
selftests
mm/userfaultfd
kconfig
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
selftests/vm: cleanup hugetlb file after mremap test
Subsystem: mm/pagemap
Suren Baghdasaryan <surenb@google.com>:
mm: refactor vm_area_struct::anon_vma_name usage code
mm: prevent vm_area_struct::anon_name refcount saturation
mm: fix use-after-free when anon vma name is used after vma is freed
Subsystem: memfd
Hugh Dickins <hughd@google.com>:
memfd: fix F_SEAL_WRITE after shmem huge page allocated
Subsystem: selftests
Chengming Zhou <zhouchengming@bytedance.com>:
kselftest/vm: fix tests build with old libc
Subsystem: mm/userfaultfd
Yun Zhou <yun.zhou@windriver.com>:
proc: fix documentation and description of pagemap
Subsystem: kconfig
Qian Cai <quic_qiancai@quicinc.com>:
configs/debug: set CONFIG_DEBUG_INFO=y properly
Documentation/admin-guide/mm/pagemap.rst | 2
fs/proc/task_mmu.c | 9 +-
fs/userfaultfd.c | 6 -
include/linux/mm.h | 7 +
include/linux/mm_inline.h | 105 ++++++++++++++++++---------
include/linux/mm_types.h | 5 +
kernel/configs/debug.config | 2
kernel/fork.c | 4 -
kernel/sys.c | 19 +++-
mm/madvise.c | 98 +++++++++----------------
mm/memfd.c | 40 +++++++---
mm/mempolicy.c | 2
mm/mlock.c | 2
mm/mmap.c | 12 +--
mm/mprotect.c | 2
tools/testing/selftests/vm/hugepage-mremap.c | 26 ++++--
tools/testing/selftests/vm/run_vmtests.sh | 3
tools/testing/selftests/vm/userfaultfd.c | 1
18 files changed, 201 insertions(+), 144 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-03-16 23:14 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-03-16 23:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
4 patches, based on 56e337f2cf1326323844927a04e9dbce9a244835.
Subsystems affected by this patch series:
mm/swap
kconfig
ocfs2
selftests
Subsystem: mm/swap
Guo Ziliang <guo.ziliang@zte.com.cn>:
mm: swap: get rid of deadloop in swapin readahead
Subsystem: kconfig
Qian Cai <quic_qiancai@quicinc.com>:
configs/debug: restore DEBUG_INFO=y for overriding
Subsystem: ocfs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: fix crash when initialize filecheck kobj fails
Subsystem: selftests
Yosry Ahmed <yosryahmed@google.com>:
selftests: vm: fix clang build error multiple output files
fs/ocfs2/super.c | 22 +++++++++++-----------
kernel/configs/debug.config | 1 +
mm/swap_state.c | 2 +-
tools/testing/selftests/vm/Makefile | 6 ++----
4 files changed, 15 insertions(+), 16 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-03-22 21:38 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-03-22 21:38 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
- A few misc subsystems
- There is a lot of MM material in Willy's tree. Folio work and
non-folio patches which depended on that work.
Here I send almost all the MM patches which precede the patches in
Willy's tree. The remaining ~100 MM patches are staged on Willy's
tree and I'll send those along once Willy is merged up.
I tried this batch against your current tree (as of
51912904076680281) and a couple need some extra persuasion to apply,
but all looks OK otherwise.
227 patches, based on f443e374ae131c168a065ea1748feac6b2e76613
Subsystems affected by this patch series:
kthread
scripts
ntfs
ocfs2
block
vfs
mm/kasan
mm/pagecache
mm/gup
mm/swap
mm/shmem
mm/memcg
mm/selftests
mm/pagemap
mm/mremap
mm/sparsemem
mm/vmalloc
mm/pagealloc
mm/memory-failure
mm/mlock
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/compaction
mm/mempolicy
mm/oom-kill
mm/migration
mm/thp
mm/cma
mm/autonuma
mm/psi
mm/ksm
mm/page-poison
mm/madvise
mm/memory-hotplug
mm/rmap
mm/zswap
mm/uaccess
mm/ioremap
mm/highmem
mm/cleanups
mm/kfence
mm/hmm
mm/damon
Subsystem: kthread
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
linux/kthread.h: remove unused macros
Subsystem: scripts
Colin Ian King <colin.i.king@gmail.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ntfs
Dongliang Mu <mudongliangabcd@gmail.com>:
ntfs: add sanity check on allocation size
Subsystem: ocfs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: cleanup some return variables
hongnanli <hongnan.li@linux.alibaba.com>:
fs/ocfs2: fix comments mentioning i_mutex
Subsystem: block
NeilBrown <neilb@suse.de>:
Patch series "Remove remaining parts of congestion tracking code", v2:
doc: convert 'subsection' to 'section' in gfp.h
mm: document and polish read-ahead code
mm: improve cleanup when ->readpages doesn't process all pages
fuse: remove reliance on bdi congestion
nfs: remove reliance on bdi congestion
ceph: remove reliance on bdi congestion
remove inode_congested()
remove bdi_congested() and wb_congested() and related functions
f2fs: replace congestion_wait() calls with io_schedule_timeout()
block/bfq-iosched.c: use "false" rather than "BLK_RW_ASYNC"
remove congestion tracking framework
Subsystem: vfs
Anthony Iliopoulos <ailiop@suse.com>:
mount: warn only once about timestamp range expiration
Subsystem: mm/kasan
Miaohe Lin <linmiaohe@huawei.com>:
mm/memremap: avoid calling kasan_remove_zero_shadow() for device private memory
Subsystem: mm/pagecache
Miaohe Lin <linmiaohe@huawei.com>:
filemap: remove find_get_pages()
mm/writeback: minor clean up for highmem_dirtyable_memory
Minchan Kim <minchan@kernel.org>:
mm: fs: fix lru_cache_disabled race in bh_lru
Subsystem: mm/gup
Peter Xu <peterx@redhat.com>:
Patch series "mm/gup: some cleanups", v5:
mm: fix invalid page pointer returned with FOLL_PIN gups
John Hubbard <jhubbard@nvidia.com>:
mm/gup: follow_pfn_pte(): -EEXIST cleanup
mm/gup: remove unused pin_user_pages_locked()
mm: change lookup_node() to use get_user_pages_fast()
mm/gup: remove unused get_user_pages_locked()
Subsystem: mm/swap
Bang Li <libang.linuxer@gmail.com>:
mm/swap: fix confusing comment in folio_mark_accessed
Subsystem: mm/shmem
Xavier Roche <xavier.roche@algolia.com>:
tmpfs: support for file creation time
Hugh Dickins <hughd@google.com>:
shmem: mapping_set_exiting() to help mapped resilience
tmpfs: do not allocate pages on read
Miaohe Lin <linmiaohe@huawei.com>:
mm: shmem: use helper macro __ATTR_RW
Subsystem: mm/memcg
Shakeel Butt <shakeelb@google.com>:
memcg: replace in_interrupt() with !in_task()
Yosry Ahmed <yosryahmed@google.com>:
memcg: add per-memcg total kernel memory stat
Wei Yang <richard.weiyang@gmail.com>:
mm/memcg: mem_cgroup_per_node is already set to 0 on allocation
mm/memcg: retrieve parent memcg from css.parent
Shakeel Butt <shakeelb@google.com>:
Patch series "memcg: robust enforcement of memory.high", v2:
memcg: refactor mem_cgroup_oom
memcg: unify force charging conditions
selftests: memcg: test high limit for single entry allocation
memcg: synchronously enforce memory.high for large overcharges
Randy Dunlap <rdunlap@infradead.org>:
mm/memcontrol: return 1 from cgroup.memory __setup() handler
Michal Hocko <mhocko@suse.com>:
Patch series "mm/memcg: Address PREEMPT_RT problems instead of disabling it", v5:
mm/memcg: revert ("mm/memcg: optimize user context object stock access")
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/memcg: disable threshold event handlers on PREEMPT_RT
mm/memcg: protect per-CPU counter by disabling preemption on PREEMPT_RT where needed.
Johannes Weiner <hannes@cmpxchg.org>:
mm/memcg: opencode the inner part of obj_cgroup_uncharge_pages() in drain_obj_stock()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/memcg: protect memcg_stock with a local_lock_t
mm/memcg: disable migration instead of preemption in drain_all_stock().
Muchun Song <songmuchun@bytedance.com>:
Patch series "Optimize list lru memory consumption", v6:
mm: list_lru: transpose the array of per-node per-memcg lru lists
mm: introduce kmem_cache_alloc_lru
fs: introduce alloc_inode_sb() to allocate filesystems specific inode
fs: allocate inode by using alloc_inode_sb()
f2fs: allocate inode by using alloc_inode_sb()
mm: dcache: use kmem_cache_alloc_lru() to allocate dentry
xarray: use kmem_cache_alloc_lru to allocate xa_node
mm: memcontrol: move memcg_online_kmem() to mem_cgroup_css_online()
mm: list_lru: allocate list_lru_one only when needed
mm: list_lru: rename memcg_drain_all_list_lrus to memcg_reparent_list_lrus
mm: list_lru: replace linear array with xarray
mm: memcontrol: reuse memory cgroup ID for kmem ID
mm: memcontrol: fix cannot alloc the maximum memcg ID
mm: list_lru: rename list_lru_per_memcg to list_lru_memcg
mm: memcontrol: rename memcg_cache_id to memcg_kmem_id
Vasily Averin <vvs@virtuozzo.com>:
memcg: enable accounting for tty-related objects
Subsystem: mm/selftests
Guillaume Tucker <guillaume.tucker@collabora.com>:
selftests, x86: fix how check_cc.sh is being invoked
Subsystem: mm/pagemap
Anshuman Khandual <anshuman.khandual@arm.com>:
mm: merge pte_mkhuge() call into arch_make_huge_pte()
Stafford Horne <shorne@gmail.com>:
mm: remove mmu_gathers storage from remaining architectures
Muchun Song <songmuchun@bytedance.com>:
Patch series "Fix some cache flush bugs", v5:
mm: thp: fix wrong cache flush in remove_migration_pmd()
mm: fix missing cache flush for all tail pages of compound page
mm: hugetlb: fix missing cache flush in copy_huge_page_from_user()
mm: hugetlb: fix missing cache flush in hugetlb_mcopy_atomic_pte()
mm: shmem: fix missing cache flush in shmem_mfill_atomic_pte()
mm: userfaultfd: fix missing cache flush in mcopy_atomic_pte() and __mcopy_atomic()
mm: replace multiple dcache flush with flush_dcache_folio()
Peter Xu <peterx@redhat.com>:
Patch series "mm: Rework zap ptes on swap entries", v5:
mm: don't skip swap entry even if zap_details specified
mm: rename zap_skip_check_mapping() to should_zap_page()
mm: change zap_details.zap_mapping into even_cows
mm: rework swap handling of zap_pte_range
Randy Dunlap <rdunlap@infradead.org>:
mm/mmap: return 1 from stack_guard_gap __setup() handler
Miaohe Lin <linmiaohe@huawei.com>:
mm/memory.c: use helper function range_in_vma()
mm/memory.c: use helper macro min and max in unmap_mapping_range_tree()
Hugh Dickins <hughd@google.com>:
mm: _install_special_mapping() apply VM_LOCKED_CLEAR_MASK
Miaohe Lin <linmiaohe@huawei.com>:
mm/mmap: remove obsolete comment in ksys_mmap_pgoff
Subsystem: mm/mremap
Miaohe Lin <linmiaohe@huawei.com>:
mm/mremap:: use vma_lookup() instead of find_vma()
Subsystem: mm/sparsemem
Miaohe Lin <linmiaohe@huawei.com>:
mm/sparse: make mminit_validate_memmodel_limits() static
Subsystem: mm/vmalloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/vmalloc: remove unneeded function forward declaration
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: Move draining areas out of caller context
Uladzislau Rezki <uladzislau.rezki@sony.com>:
mm/vmalloc: add adjust_search_size parameter
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: eliminate an extra orig_gfp_mask
Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
mm/vmalloc.c: fix "unused function" warning
Bang Li <libang.linuxer@gmail.com>:
mm/vmalloc: fix comments about vmap_area struct
Subsystem: mm/pagealloc
Zi Yan <ziy@nvidia.com>:
mm: page_alloc: avoid merging non-fallbackable pageblocks with others
Peter Collingbourne <pcc@google.com>:
mm/mmzone.c: use try_cmpxchg() in page_cpupid_xchg_last()
Miaohe Lin <linmiaohe@huawei.com>:
mm/mmzone.h: remove unused macros
Nicolas Saenz Julienne <nsaenzju@redhat.com>:
mm/page_alloc: don't pass pfn to free_unref_page_commit()
David Hildenbrand <david@redhat.com>:
Patch series "mm: enforce pageblock_order < MAX_ORDER":
cma: factor out minimum alignment requirement
mm: enforce pageblock_order < MAX_ORDER
Nathan Chancellor <nathan@kernel.org>:
mm/page_alloc: mark pagesets as __maybe_unused
Alistair Popple <apopple@nvidia.com>:
mm/pages_alloc.c: don't create ZONE_MOVABLE beyond the end of a node
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Follow-up on high-order PCP caching", v2:
mm/page_alloc: fetch the correct pcp buddy during bulk free
mm/page_alloc: track range of active PCP lists during bulk free
mm/page_alloc: simplify how many pages are selected per pcp list during bulk free
mm/page_alloc: drain the requested list first during bulk free
mm/page_alloc: free pages in a single pass during bulk free
mm/page_alloc: limit number of high-order pages on PCP during bulk free
mm/page_alloc: do not prefetch buddies during bulk free
Oscar Salvador <osalvador@suse.de>:
arch/x86/mm/numa: Do not initialize nodes twice
Suren Baghdasaryan <surenb@google.com>:
mm: count time in drain_all_pages during direct reclaim as memory pressure
Eric Dumazet <edumazet@google.com>:
mm/page_alloc: call check_new_pages() while zone spinlock is not held
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: check high-order pages for corruption during PCP operations
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/memory-failure.c: remove obsolete comment
mm/hwpoison: fix error page recovered but reported "not recovered"
Rik van Riel <riel@surriel.com>:
mm: invalidate hwpoison page cache page in fault path
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "A few cleanup and fixup patches for memory failure", v3:
mm/memory-failure.c: minor clean up for memory_failure_dev_pagemap
mm/memory-failure.c: catch unexpected -EFAULT from vma_address()
mm/memory-failure.c: rework the signaling logic in kill_proc
mm/memory-failure.c: fix race with changing page more robustly
mm/memory-failure.c: remove PageSlab check in hwpoison_filter_dev
mm/memory-failure.c: rework the try_to_unmap logic in hwpoison_user_mappings()
mm/memory-failure.c: remove obsolete comment in __soft_offline_page
mm/memory-failure.c: remove unnecessary PageTransTail check
mm/hwpoison-inject: support injecting hwpoison to free page
luofei <luofei@unicloud.com>:
mm/hwpoison: avoid the impact of hwpoison_filter() return value on mce handler
mm/hwpoison: add in-use hugepage hwpoison filter judgement
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "A few fixup patches for memory failure", v2:
mm/memory-failure.c: fix race with changing page compound again
mm/memory-failure.c: avoid calling invalidate_inode_page() with unexpected pages
mm/memory-failure.c: make non-LRU movable pages unhandlable
Vlastimil Babka <vbabka@suse.cz>:
mm, fault-injection: declare should_fail_alloc_page()
Subsystem: mm/mlock
Miaohe Lin <linmiaohe@huawei.com>:
mm/mlock: fix potential imbalanced rlimit ucounts adjustment
Subsystem: mm/hugetlb
Muchun Song <songmuchun@bytedance.com>:
Patch series "Free the 2nd vmemmap page associated with each HugeTLB page", v7:
mm: hugetlb: free the 2nd vmemmap page associated with each HugeTLB page
mm: hugetlb: replace hugetlb_free_vmemmap_enabled with a static_key
mm: sparsemem: use page table lock to protect kernel pmd operations
selftests: vm: add a hugetlb test case
mm: sparsemem: move vmemmap related to HugeTLB to CONFIG_HUGETLB_PAGE_FREE_VMEMMAP
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/hugetlb: generalize ARCH_WANT_GENERAL_HUGETLB
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: clean up potential spectre issue warnings
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: use helper macro __ATTR_RW
David Howells <dhowells@redhat.com>:
mm/hugetlb.c: export PageHeadHuge()
Miaohe Lin <linmiaohe@huawei.com>:
mm: remove unneeded local variable follflags
Subsystem: mm/userfaultfd
Nadav Amit <namit@vmware.com>:
userfaultfd: provide unmasked address on page-fault
Guo Zhengkui <guozhengkui@vivo.com>:
userfaultfd/selftests: fix uninitialized_var.cocci warning
Subsystem: mm/vmscan
Hugh Dickins <hughd@google.com>:
mm/fs: delete PF_SWAPWRITE
mm: __isolate_lru_page_prepare() in isolate_migratepages_block()
Waiman Long <longman@redhat.com>:
mm/list_lru: optimize memcg_reparent_list_lru_node()
Marcelo Tosatti <mtosatti@redhat.com>:
mm: lru_cache_disable: replace work queue synchronization with synchronize_rcu
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm: workingset: replace IRQ-off check with a lockdep assert.
Charan Teja Kalla <quic_charante@quicinc.com>:
mm: vmscan: fix documentation for page_check_references()
Subsystem: mm/compaction
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: compaction: cleanup the compaction trace events
Subsystem: mm/mempolicy
Hugh Dickins <hughd@google.com>:
mempolicy: mbind_range() set_policy() after vma_merge()
Subsystem: mm/oom-kill
Miaohe Lin <linmiaohe@huawei.com>:
mm/oom_kill: remove unneeded is_memcg_oom check
Subsystem: mm/migration
Huang Ying <ying.huang@intel.com>:
mm,migrate: fix establishing demotion target
"andrew.yang" <andrew.yang@mediatek.com>:
mm/migrate: fix race between lock page and clear PG_Isolated
Subsystem: mm/thp
Hugh Dickins <hughd@google.com>:
mm/thp: refix __split_huge_pmd_locked() for migration PMD
Subsystem: mm/cma
Hari Bathini <hbathini@linux.ibm.com>:
Patch series "powerpc/fadump: handle CMA activation failure appropriately", v3:
mm/cma: provide option to opt out from exposing pages on activation failure
powerpc/fadump: opt out from freeing pages on cma activation failure
Subsystem: mm/autonuma
Huang Ying <ying.huang@intel.com>:
Patch series "NUMA balancing: optimize memory placement for memory tiering system", v13:
NUMA Balancing: add page promotion counter
NUMA balancing: optimize page placement for memory tiering system
memory tiering: skip to scan fast memory
Subsystem: mm/psi
Johannes Weiner <hannes@cmpxchg.org>:
mm: page_io: fix psi memory pressure error on cold swapins
Subsystem: mm/ksm
Yang Yang <yang.yang29@zte.com.cn>:
mm/vmstat: add event for ksm swapping in copy
Miaohe Lin <linmiaohe@huawei.com>:
mm/ksm: use helper macro __ATTR_RW
Subsystem: mm/page-poison
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/hwpoison: check the subpage, not the head page
Subsystem: mm/madvise
Miaohe Lin <linmiaohe@huawei.com>:
mm/madvise: use vma_lookup() instead of find_vma()
Charan Teja Kalla <quic_charante@quicinc.com>:
Patch series "mm: madvise: return correct bytes processed with:
mm: madvise: return correct bytes advised with process_madvise
mm: madvise: skip unmapped vma holes passed to process_madvise
Subsystem: mm/memory-hotplug
Michal Hocko <mhocko@suse.com>:
Patch series "mm, memory_hotplug: handle unitialized numa node gracefully":
mm, memory_hotplug: make arch_alloc_nodedata independent on CONFIG_MEMORY_HOTPLUG
mm: handle uninitialized numa nodes gracefully
mm, memory_hotplug: drop arch_free_nodedata
mm, memory_hotplug: reorganize new pgdat initialization
mm: make free_area_init_node aware of memory less nodes
Wei Yang <richard.weiyang@gmail.com>:
memcg: do not tweak node in alloc_mem_cgroup_per_node_info
David Hildenbrand <david@redhat.com>:
drivers/base/memory: add memory block to memory group after registration succeeded
drivers/base/node: consolidate node device subsystem initialization in node_dev_init()
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "A few cleanup patches around memory_hotplug":
mm/memory_hotplug: remove obsolete comment of __add_pages
mm/memory_hotplug: avoid calling zone_intersects() for ZONE_NORMAL
mm/memory_hotplug: clean up try_offline_node
mm/memory_hotplug: fix misplaced comment in offline_pages
David Hildenbrand <david@redhat.com>:
Patch series "drivers/base/memory: determine and store zone for single-zone memory blocks", v2:
drivers/base/node: rename link_mem_sections() to register_memory_block_under_node()
drivers/base/memory: determine and store zone for single-zone memory blocks
drivers/base/memory: clarify adding and removing of memory blocks
Oscar Salvador <osalvador@suse.de>:
mm: only re-generate demotion targets when a numa node changes its N_CPU state
Subsystem: mm/rmap
Hugh Dickins <hughd@google.com>:
mm/thp: ClearPageDoubleMap in first page_add_file_rmap()
Subsystem: mm/zswap
"Maciej S. Szmigiero" <maciej.szmigiero@oracle.com>:
mm/zswap.c: allow handling just same-value filled pages
Subsystem: mm/uaccess
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm: remove usercopy_warn()
mm: uninline copy_overflow()
Randy Dunlap <rdunlap@infradead.org>:
mm/usercopy: return 1 from hardened_usercopy __setup() handler
Subsystem: mm/ioremap
Vlastimil Babka <vbabka@suse.cz>:
mm/early_ioremap: declare early_memremap_pgprot_adjust()
Subsystem: mm/highmem
Ira Weiny <ira.weiny@intel.com>:
highmem: document kunmap_local()
Miaohe Lin <linmiaohe@huawei.com>:
mm/highmem: remove unnecessary done label
Subsystem: mm/cleanups
"Dr. David Alan Gilbert" <linux@treblig.org>:
mm/page_table_check.c: use strtobool for param parsing
Subsystem: mm/kfence
tangmeng <tangmeng@uniontech.com>:
mm/kfence: remove unnecessary CONFIG_KFENCE option
Tianchen Ding <dtcccc@linux.alibaba.com>:
Patch series "provide the flexibility to enable KFENCE", v3:
kfence: allow re-enabling KFENCE after system startup
kfence: alloc kfence_pool after system startup
Peng Liu <liupeng256@huawei.com>:
Patch series "kunit: fix a UAF bug and do some optimization", v2:
kunit: fix UAF when run kfence test case test_gfpzero
kunit: make kunit_test_timeout compatible with comment
kfence: test: try to avoid test_gfpzero trigger rcu_stall
Marco Elver <elver@google.com>:
kfence: allow use of a deferrable timer
Subsystem: mm/hmm
Miaohe Lin <linmiaohe@huawei.com>:
mm/hmm.c: remove unneeded local variable ret
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
Patch series "Remove the type-unclear target id concept":
mm/damon/dbgfs/init_regions: use target index instead of target id
Docs/admin-guide/mm/damon/usage: update for changed initail_regions file input
mm/damon/core: move damon_set_targets() into dbgfs
mm/damon: remove the target id concept
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm/damon: remove redundant page validation
SeongJae Park <sj@kernel.org>:
Patch series "Allow DAMON user code independent of monitoring primitives":
mm/damon: rename damon_primitives to damon_operations
mm/damon: let monitoring operations can be registered and selected
mm/damon/paddr,vaddr: register themselves to DAMON in subsys_initcall
mm/damon/reclaim: use damon_select_ops() instead of damon_{v,p}a_set_operations()
mm/damon/dbgfs: use damon_select_ops() instead of damon_{v,p}a_set_operations()
mm/damon/dbgfs: use operations id for knowing if the target has pid
mm/damon/dbgfs-test: fix is_target_id() change
mm/damon/paddr,vaddr: remove damon_{p,v}a_{target_valid,set_operations}()
tangmeng <tangmeng@uniontech.com>:
mm/damon: remove unnecessary CONFIG_DAMON option
SeongJae Park <sj@kernel.org>:
Patch series "Docs/damon: Update documents for better consistency":
Docs/vm/damon: call low level monitoring primitives the operations
Docs/vm/damon/design: update DAMON-Idle Page Tracking interference handling
Docs/damon: update outdated term 'regions update interval'
Patch series "Introduce DAMON sysfs interface", v3:
mm/damon/core: allow non-exclusive DAMON start/stop
mm/damon/core: add number of each enum type values
mm/damon: implement a minimal stub for sysfs-based DAMON interface
mm/damon/sysfs: link DAMON for virtual address spaces monitoring
mm/damon/sysfs: support the physical address space monitoring
mm/damon/sysfs: support DAMON-based Operation Schemes
mm/damon/sysfs: support DAMOS quotas
mm/damon/sysfs: support schemes prioritization
mm/damon/sysfs: support DAMOS watermarks
mm/damon/sysfs: support DAMOS stats
selftests/damon: add a test for DAMON sysfs interface
Docs/admin-guide/mm/damon/usage: document DAMON sysfs interface
Docs/ABI/testing: add DAMON sysfs interface ABI document
Xin Hao <xhao@linux.alibaba.com>:
mm/damon/sysfs: remove repeat container_of() in damon_sysfs_kdamond_release()
Documentation/ABI/testing/sysfs-kernel-mm-damon | 274 ++
Documentation/admin-guide/cgroup-v1/memory.rst | 2
Documentation/admin-guide/cgroup-v2.rst | 5
Documentation/admin-guide/kernel-parameters.txt | 2
Documentation/admin-guide/mm/damon/usage.rst | 380 +++
Documentation/admin-guide/mm/zswap.rst | 22
Documentation/admin-guide/sysctl/kernel.rst | 31
Documentation/core-api/mm-api.rst | 19
Documentation/dev-tools/kfence.rst | 12
Documentation/filesystems/porting.rst | 6
Documentation/filesystems/vfs.rst | 16
Documentation/vm/damon/design.rst | 43
Documentation/vm/damon/faq.rst | 2
MAINTAINERS | 1
arch/arm/Kconfig | 4
arch/arm64/kernel/setup.c | 3
arch/arm64/mm/hugetlbpage.c | 1
arch/hexagon/mm/init.c | 2
arch/ia64/kernel/topology.c | 10
arch/ia64/mm/discontig.c | 11
arch/mips/kernel/topology.c | 5
arch/nds32/mm/init.c | 1
arch/openrisc/mm/init.c | 2
arch/powerpc/include/asm/fadump-internal.h | 5
arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h | 4
arch/powerpc/kernel/fadump.c | 8
arch/powerpc/kernel/sysfs.c | 17
arch/riscv/Kconfig | 4
arch/riscv/kernel/setup.c | 3
arch/s390/kernel/numa.c | 7
arch/sh/kernel/topology.c | 5
arch/sparc/kernel/sysfs.c | 12
arch/sparc/mm/hugetlbpage.c | 1
arch/x86/Kconfig | 4
arch/x86/kernel/cpu/mce/core.c | 8
arch/x86/kernel/topology.c | 5
arch/x86/mm/numa.c | 33
block/bdev.c | 2
block/bfq-iosched.c | 2
drivers/base/init.c | 1
drivers/base/memory.c | 149 +
drivers/base/node.c | 48
drivers/block/drbd/drbd_int.h | 3
drivers/block/drbd/drbd_req.c | 3
drivers/dax/super.c | 2
drivers/of/of_reserved_mem.c | 9
drivers/tty/tty_io.c | 2
drivers/virtio/virtio_mem.c | 9
fs/9p/vfs_inode.c | 2
fs/adfs/super.c | 2
fs/affs/super.c | 2
fs/afs/super.c | 2
fs/befs/linuxvfs.c | 2
fs/bfs/inode.c | 2
fs/btrfs/inode.c | 2
fs/buffer.c | 8
fs/ceph/addr.c | 22
fs/ceph/inode.c | 2
fs/ceph/super.c | 1
fs/ceph/super.h | 1
fs/cifs/cifsfs.c | 2
fs/coda/inode.c | 2
fs/dcache.c | 3
fs/ecryptfs/super.c | 2
fs/efs/super.c | 2
fs/erofs/super.c | 2
fs/exfat/super.c | 2
fs/ext2/ialloc.c | 5
fs/ext2/super.c | 2
fs/ext4/super.c | 2
fs/f2fs/compress.c | 4
fs/f2fs/data.c | 3
fs/f2fs/f2fs.h | 6
fs/f2fs/segment.c | 8
fs/f2fs/super.c | 14
fs/fat/inode.c | 2
fs/freevxfs/vxfs_super.c | 2
fs/fs-writeback.c | 40
fs/fuse/control.c | 17
fs/fuse/dev.c | 8
fs/fuse/file.c | 17
fs/fuse/inode.c | 2
fs/gfs2/super.c | 2
fs/hfs/super.c | 2
fs/hfsplus/super.c | 2
fs/hostfs/hostfs_kern.c | 2
fs/hpfs/super.c | 2
fs/hugetlbfs/inode.c | 2
fs/inode.c | 2
fs/isofs/inode.c | 2
fs/jffs2/super.c | 2
fs/jfs/super.c | 2
fs/minix/inode.c | 2
fs/namespace.c | 2
fs/nfs/inode.c | 2
fs/nfs/write.c | 14
fs/nilfs2/segbuf.c | 16
fs/nilfs2/super.c | 2
fs/ntfs/inode.c | 6
fs/ntfs3/super.c | 2
fs/ocfs2/alloc.c | 2
fs/ocfs2/aops.c | 2
fs/ocfs2/cluster/nodemanager.c | 2
fs/ocfs2/dir.c | 4
fs/ocfs2/dlmfs/dlmfs.c | 2
fs/ocfs2/file.c | 13
fs/ocfs2/inode.c | 2
fs/ocfs2/localalloc.c | 6
fs/ocfs2/namei.c | 2
fs/ocfs2/ocfs2.h | 4
fs/ocfs2/quota_global.c | 2
fs/ocfs2/stack_user.c | 18
fs/ocfs2/super.c | 2
fs/ocfs2/xattr.c | 2
fs/openpromfs/inode.c | 2
fs/orangefs/super.c | 2
fs/overlayfs/super.c | 2
fs/proc/inode.c | 2
fs/qnx4/inode.c | 2
fs/qnx6/inode.c | 2
fs/reiserfs/super.c | 2
fs/romfs/super.c | 2
fs/squashfs/super.c | 2
fs/sysv/inode.c | 2
fs/ubifs/super.c | 2
fs/udf/super.c | 2
fs/ufs/super.c | 2
fs/userfaultfd.c | 5
fs/vboxsf/super.c | 2
fs/xfs/libxfs/xfs_btree.c | 2
fs/xfs/xfs_buf.c | 3
fs/xfs/xfs_icache.c | 2
fs/zonefs/super.c | 2
include/linux/backing-dev-defs.h | 8
include/linux/backing-dev.h | 50
include/linux/cma.h | 14
include/linux/damon.h | 95
include/linux/fault-inject.h | 2
include/linux/fs.h | 21
include/linux/gfp.h | 10
include/linux/highmem-internal.h | 10
include/linux/hugetlb.h | 8
include/linux/kthread.h | 22
include/linux/list_lru.h | 45
include/linux/memcontrol.h | 46
include/linux/memory.h | 12
include/linux/memory_hotplug.h | 132 -
include/linux/migrate.h | 8
include/linux/mm.h | 11
include/linux/mmzone.h | 22
include/linux/nfs_fs_sb.h | 1
include/linux/node.h | 25
include/linux/page-flags.h | 96
include/linux/pageblock-flags.h | 7
include/linux/pagemap.h | 7
include/linux/sched.h | 1
include/linux/sched/sysctl.h | 10
include/linux/shmem_fs.h | 1
include/linux/slab.h | 3
include/linux/swap.h | 6
include/linux/thread_info.h | 5
include/linux/uaccess.h | 2
include/linux/vm_event_item.h | 3
include/linux/vmalloc.h | 4
include/linux/xarray.h | 9
include/ras/ras_event.h | 1
include/trace/events/compaction.h | 26
include/trace/events/writeback.h | 28
include/uapi/linux/userfaultfd.h | 8
ipc/mqueue.c | 2
kernel/dma/contiguous.c | 4
kernel/sched/core.c | 21
kernel/sysctl.c | 2
lib/Kconfig.kfence | 12
lib/kunit/try-catch.c | 3
lib/xarray.c | 10
mm/Kconfig | 6
mm/backing-dev.c | 57
mm/cma.c | 31
mm/cma.h | 1
mm/compaction.c | 60
mm/damon/Kconfig | 19
mm/damon/Makefile | 7
mm/damon/core-test.h | 23
mm/damon/core.c | 190 +
mm/damon/dbgfs-test.h | 103
mm/damon/dbgfs.c | 264 +-
mm/damon/ops-common.c | 133 +
mm/damon/ops-common.h | 16
mm/damon/paddr.c | 62
mm/damon/prmtv-common.c | 133 -
mm/damon/prmtv-common.h | 16
mm/damon/reclaim.c | 11
mm/damon/sysfs.c | 2632 ++++++++++++++++++++++-
mm/damon/vaddr-test.h | 8
mm/damon/vaddr.c | 67
mm/early_ioremap.c | 1
mm/fadvise.c | 5
mm/filemap.c | 17
mm/gup.c | 103
mm/highmem.c | 9
mm/hmm.c | 3
mm/huge_memory.c | 41
mm/hugetlb.c | 23
mm/hugetlb_vmemmap.c | 74
mm/hwpoison-inject.c | 7
mm/internal.h | 19
mm/kfence/Makefile | 2
mm/kfence/core.c | 147 +
mm/kfence/kfence_test.c | 3
mm/ksm.c | 6
mm/list_lru.c | 690 ++----
mm/maccess.c | 6
mm/madvise.c | 18
mm/memcontrol.c | 549 ++--
mm/memory-failure.c | 148 -
mm/memory.c | 116 -
mm/memory_hotplug.c | 136 -
mm/mempolicy.c | 29
mm/memremap.c | 3
mm/migrate.c | 128 -
mm/mlock.c | 1
mm/mmap.c | 5
mm/mmzone.c | 7
mm/mprotect.c | 13
mm/mremap.c | 4
mm/oom_kill.c | 3
mm/page-writeback.c | 12
mm/page_alloc.c | 429 +--
mm/page_io.c | 7
mm/page_table_check.c | 10
mm/ptdump.c | 16
mm/readahead.c | 124 +
mm/rmap.c | 15
mm/shmem.c | 46
mm/slab.c | 39
mm/slab.h | 25
mm/slob.c | 6
mm/slub.c | 42
mm/sparse-vmemmap.c | 70
mm/sparse.c | 2
mm/swap.c | 25
mm/swapfile.c | 1
mm/usercopy.c | 16
mm/userfaultfd.c | 3
mm/vmalloc.c | 102
mm/vmscan.c | 138 -
mm/vmstat.c | 19
mm/workingset.c | 7
mm/zswap.c | 15
net/socket.c | 2
net/sunrpc/rpc_pipe.c | 2
scripts/spelling.txt | 16
tools/testing/selftests/cgroup/cgroup_util.c | 15
tools/testing/selftests/cgroup/cgroup_util.h | 1
tools/testing/selftests/cgroup/test_memcontrol.c | 78
tools/testing/selftests/damon/Makefile | 1
tools/testing/selftests/damon/sysfs.sh | 306 ++
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 7
tools/testing/selftests/vm/hugepage-vmemmap.c | 144 +
tools/testing/selftests/vm/run_vmtests.sh | 11
tools/testing/selftests/vm/userfaultfd.c | 2
tools/testing/selftests/x86/Makefile | 6
264 files changed, 7205 insertions(+), 3090 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-03-23 23:04 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-03-23 23:04 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
Various misc subsystems, before getting into the post-linux-next material.
This is all based on v5.17. I tested applying and compiling against
today's 1bc191051dca28fa6. One patch required an extra whack, all
looks good.
41 patches, based on f443e374ae131c168a065ea1748feac6b2e76613.
Subsystems affected by this patch series:
procfs
misc
core-kernel
lib
checkpatch
init
pipe
minix
fat
cgroups
kexec
kdump
taskstats
panic
kcov
resource
ubsan
Subsystem: procfs
Hao Lee <haolee.swjtu@gmail.com>:
proc: alloc PATH_MAX bytes for /proc/${pid}/fd/ symlinks
David Hildenbrand <david@redhat.com>:
proc/vmcore: fix possible deadlock on concurrent mmap and read
Yang Li <yang.lee@linux.alibaba.com>:
proc/vmcore: fix vmcore_alloc_buf() kernel-doc comment
Subsystem: misc
Bjorn Helgaas <bhelgaas@google.com>:
linux/types.h: remove unnecessary __bitwise__
Documentation/sparse: add hints about __CHECKER__
Subsystem: core-kernel
Miaohe Lin <linmiaohe@huawei.com>:
kernel/ksysfs.c: use helper macro __ATTR_RW
Subsystem: lib
Kees Cook <keescook@chromium.org>:
Kconfig.debug: make DEBUG_INFO selectable from a choice
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
include: drop pointless __compiler_offsetof indirection
Christophe Leroy <christophe.leroy@csgroup.eu>:
ilog2: force inlining of __ilog2_u32() and __ilog2_u64()
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
bitfield: add explicit inclusions to the example
Feng Tang <feng.tang@intel.com>:
lib/Kconfig.debug: add ARCH dependency for FUNCTION_ALIGN option
Randy Dunlap <rdunlap@infradead.org>:
lib: bitmap: fix many kernel-doc warnings
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: prefer MODULE_LICENSE("GPL") over MODULE_LICENSE("GPL v2")
checkpatch: add --fix option for some TRAILING_STATEMENTS
checkpatch: add early_param exception to blank line after struct/function test
Sagar Patel <sagarmp@cs.unc.edu>:
checkpatch: use python3 to find codespell dictionary
Subsystem: init
Mark-PK Tsai <mark-pk.tsai@mediatek.com>:
init: use ktime_us_delta() to make initcall_debug log more precise
Randy Dunlap <rdunlap@infradead.org>:
init.h: improve __setup and early_param documentation
init/main.c: return 1 from handled __setup() functions
Subsystem: pipe
Andrei Vagin <avagin@gmail.com>:
fs/pipe: use kvcalloc to allocate a pipe_buffer array
fs/pipe.c: local vars have to match types of proper pipe_inode_info fields
Subsystem: minix
Qinghua Jin <qhjin.dev@gmail.com>:
minix: fix bug when opening a file with O_DIRECT
Subsystem: fat
Helge Deller <deller@gmx.de>:
fat: use pointer to simple type in put_user()
Subsystem: cgroups
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
cgroup: use irqsave in cgroup_rstat_flush_locked().
cgroup: add a comment to cgroup_rstat_flush_locked().
Subsystem: kexec
Jisheng Zhang <jszhang@kernel.org>:
Patch series "kexec: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef", v2:
kexec: make crashk_res, crashk_low_res and crash_notes symbols always visible
riscv: mm: init: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef
x86/setup: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef
arm64: mm: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef
Subsystem: kdump
Tiezhu Yang <yangtiezhu@loongson.cn>:
Patch series "Update doc and fix some issues about kdump", v2:
docs: kdump: update description about sysfs file system support
docs: kdump: add scp example to write out the dump file
panic: unset panic_on_warn inside panic()
ubsan: no need to unset panic_on_warn in ubsan_epilogue()
kasan: no need to unset panic_on_warn in end_report()
Subsystem: taskstats
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
taskstats: remove unneeded dead assignment
Subsystem: panic
"Guilherme G. Piccoli" <gpiccoli@igalia.com>:
Patch series "Some improvements on panic_print":
docs: sysctl/kernel: add missing bit to panic_print
panic: add option to dump all CPUs backtraces in panic_print
panic: move panic_print before kmsg dumpers
Subsystem: kcov
Aleksandr Nogikh <nogikh@google.com>:
Patch series "kcov: improve mmap processing", v3:
kcov: split ioctl handling into locked and unlocked parts
kcov: properly handle subsequent mmap calls
Subsystem: resource
Miaohe Lin <linmiaohe@huawei.com>:
kernel/resource: fix kfree() of bootmem memory again
Subsystem: ubsan
Marco Elver <elver@google.com>:
Revert "ubsan, kcsan: Don't combine sanitizer with kcov on clang"
Documentation/admin-guide/kdump/kdump.rst | 10 +
Documentation/admin-guide/kernel-parameters.txt | 5
Documentation/admin-guide/sysctl/kernel.rst | 2
Documentation/dev-tools/sparse.rst | 2
arch/arm64/mm/init.c | 9 -
arch/riscv/mm/init.c | 6 -
arch/x86/kernel/setup.c | 10 -
fs/fat/dir.c | 2
fs/minix/inode.c | 3
fs/pipe.c | 13 +-
fs/proc/base.c | 8 -
fs/proc/vmcore.c | 43 +++----
include/linux/bitfield.h | 3
include/linux/compiler_types.h | 3
include/linux/init.h | 11 +
include/linux/kexec.h | 12 +-
include/linux/log2.h | 4
include/linux/stddef.h | 6 -
include/uapi/linux/types.h | 6 -
init/main.c | 14 +-
kernel/cgroup/rstat.c | 13 +-
kernel/kcov.c | 102 ++++++++---------
kernel/ksysfs.c | 3
kernel/panic.c | 37 ++++--
kernel/resource.c | 41 +-----
kernel/taskstats.c | 5
lib/Kconfig.debug | 142 ++++++++++++------------
lib/Kconfig.kcsan | 11 -
lib/Kconfig.ubsan | 12 --
lib/bitmap.c | 24 ++--
lib/ubsan.c | 10 -
mm/kasan/report.c | 10 -
scripts/checkpatch.pl | 31 ++++-
tools/include/linux/types.h | 5
34 files changed, 313 insertions(+), 305 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-03-25 1:07 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-03-25 1:07 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
This is the material which was staged after willystuff in linux-next.
Everything applied seamlessly on your latest, all looks well.
114 patches, based on 52deda9551a01879b3562e7b41748e85c591f14c.
Subsystems affected by this patch series:
mm/debug
mm/selftests
mm/pagecache
mm/thp
mm/rmap
mm/migration
mm/kasan
mm/hugetlb
mm/pagemap
mm/madvise
selftests
Subsystem: mm/debug
Sean Anderson <seanga2@gmail.com>:
tools/vm/page_owner_sort.c: sort by stacktrace before culling
tools/vm/page_owner_sort.c: support sorting by stack trace
Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: add switch between culling by stacktrace and txt
Chongxi Zhao <zhaochongxi2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: support sorting pid and time
Shenghong Han <hanshenghong2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: two trivial fixes
Yixuan Cao <caoyixuan2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: delete invalid duplicate code
Shenghong Han <hanshenghong2019@email.szu.edu.cn>:
Documentation/vm/page_owner.rst: update the documentation
Shuah Khan <skhan@linuxfoundation.org>:
Documentation/vm/page_owner.rst: fix unexpected indentation warns
Waiman Long <longman@redhat.com>:
Patch series "mm/page_owner: Extend page_owner to show memcg information", v4:
lib/vsprintf: avoid redundant work with 0 size
mm/page_owner: use scnprintf() to avoid excessive buffer overrun check
mm/page_owner: print memcg information
mm/page_owner: record task command name
Yixuan Cao <caoyixuan2019@email.szu.edu.cn>:
mm/page_owner.c: record tgid
tools/vm/page_owner_sort.c: fix the instructions for use
Jiajian Ye <yejiajian2018@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: fix comments
tools/vm/page_owner_sort.c: add a security check
tools/vm/page_owner_sort.c: support sorting by tgid and update documentation
tools/vm/page_owner_sort: fix three trivival places
tools/vm/page_owner_sort: support for sorting by task command name
tools/vm/page_owner_sort.c: support for selecting by PID, TGID or task command name
tools/vm/page_owner_sort.c: support for user-defined culling rules
Christoph Hellwig <hch@lst.de>:
mm: unexport page_init_poison
Subsystem: mm/selftests
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
selftest/vm: add util.h and and move helper functions there
Mike Rapoport <rppt@kernel.org>:
selftest/vm: add helpers to detect PAGE_SIZE and PAGE_SHIFT
Subsystem: mm/pagecache
Hugh Dickins <hughd@google.com>:
mm: delete __ClearPageWaiters()
mm: filemap_unaccount_folio() large skip mapcount fixup
Subsystem: mm/thp
Hugh Dickins <hughd@google.com>:
mm/thp: fix NR_FILE_MAPPED accounting in page_*_file_rmap()
Subsystem: mm/rmap
Subsystem: mm/migration
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/migration: Add trace events", v3:
mm/migration: add trace events for THP migrations
mm/migration: add trace events for base page and HugeTLB migrations
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan, vmalloc, arm64: add vmalloc tagging support for SW/HW_TAGS", v6:
kasan, page_alloc: deduplicate should_skip_kasan_poison
kasan, page_alloc: move tag_clear_highpage out of kernel_init_free_pages
kasan, page_alloc: merge kasan_free_pages into free_pages_prepare
kasan, page_alloc: simplify kasan_poison_pages call site
kasan, page_alloc: init memory of skipped pages on free
kasan: drop skip_kasan_poison variable in free_pages_prepare
mm: clarify __GFP_ZEROTAGS comment
kasan: only apply __GFP_ZEROTAGS when memory is zeroed
kasan, page_alloc: refactor init checks in post_alloc_hook
kasan, page_alloc: merge kasan_alloc_pages into post_alloc_hook
kasan, page_alloc: combine tag_clear_highpage calls in post_alloc_hook
kasan, page_alloc: move SetPageSkipKASanPoison in post_alloc_hook
kasan, page_alloc: move kernel_init_free_pages in post_alloc_hook
kasan, page_alloc: rework kasan_unpoison_pages call site
kasan: clean up metadata byte definitions
kasan: define KASAN_VMALLOC_INVALID for SW_TAGS
kasan, x86, arm64, s390: rename functions for modules shadow
kasan, vmalloc: drop outdated VM_KASAN comment
kasan: reorder vmalloc hooks
kasan: add wrappers for vmalloc hooks
kasan, vmalloc: reset tags in vmalloc functions
kasan, fork: reset pointer tags of vmapped stacks
kasan, arm64: reset pointer tags of vmapped stacks
kasan, vmalloc: add vmalloc tagging for SW_TAGS
kasan, vmalloc, arm64: mark vmalloc mappings as pgprot_tagged
kasan, vmalloc: unpoison VM_ALLOC pages after mapping
kasan, mm: only define ___GFP_SKIP_KASAN_POISON with HW_TAGS
kasan, page_alloc: allow skipping unpoisoning for HW_TAGS
kasan, page_alloc: allow skipping memory init for HW_TAGS
kasan, vmalloc: add vmalloc tagging for HW_TAGS
kasan, vmalloc: only tag normal vmalloc allocations
kasan, arm64: don't tag executable vmalloc allocations
kasan: mark kasan_arg_stacktrace as __initdata
kasan: clean up feature flags for HW_TAGS mode
kasan: add kasan.vmalloc command line flag
kasan: allow enabling KASAN_VMALLOC and SW/HW_TAGS
arm64: select KASAN_VMALLOC for SW/HW_TAGS modes
kasan: documentation updates
kasan: improve vmalloc tests
kasan: test: support async (again) and asymm modes for HW_TAGS
tangmeng <tangmeng@uniontech.com>:
mm/kasan: remove unnecessary CONFIG_KASAN option
Peter Collingbourne <pcc@google.com>:
kasan: update function name in comments
Andrey Konovalov <andreyknvl@google.com>:
kasan: print virtual mapping info in reports
Patch series "kasan: report clean-ups and improvements":
kasan: drop addr check from describe_object_addr
kasan: more line breaks in reports
kasan: rearrange stack frame info in reports
kasan: improve stack frame info in reports
kasan: print basic stack frame info for SW_TAGS
kasan: simplify async check in end_report()
kasan: simplify kasan_update_kunit_status() and call sites
kasan: check CONFIG_KASAN_KUNIT_TEST instead of CONFIG_KUNIT
kasan: move update_kunit_status to start_report
kasan: move disable_trace_on_warning to start_report
kasan: split out print_report from __kasan_report
kasan: simplify kasan_find_first_bad_addr call sites
kasan: restructure kasan_report
kasan: merge __kasan_report into kasan_report
kasan: call print_report from kasan_report_invalid_free
kasan: move and simplify kasan_report_async
kasan: rename kasan_access_info to kasan_report_info
kasan: add comment about UACCESS regions to kasan_report
kasan: respect KASAN_BIT_REPORTED in all reporting routines
kasan: reorder reporting functions
kasan: move and hide kasan_save_enable/restore_multi_shot
kasan: disable LOCKDEP when printing reports
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "Add hugetlb MADV_DONTNEED support", v3:
mm: enable MADV_DONTNEED for hugetlb mappings
selftests/vm: add hugetlb madvise MADV_DONTNEED MADV_REMOVE test
userfaultfd/selftests: enable hugetlb remap and remove event testing
Miaohe Lin <linmiaohe@huawei.com>:
mm/huge_memory: make is_transparent_hugepage() static
Subsystem: mm/pagemap
David Hildenbrand <david@redhat.com>:
Patch series "mm: COW fixes part 1: fix the COW security issue for THP and swap", v3:
mm: optimize do_wp_page() for exclusive pages in the swapcache
mm: optimize do_wp_page() for fresh pages in local LRU pagevecs
mm: slightly clarify KSM logic in do_swap_page()
mm: streamline COW logic in do_swap_page()
mm/huge_memory: streamline COW logic in do_huge_pmd_wp_page()
mm/khugepaged: remove reuse_swap_page() usage
mm/swapfile: remove stale reuse_swap_page()
mm/huge_memory: remove stale page_trans_huge_mapcount()
mm/huge_memory: remove stale locking logic from __split_huge_pmd()
Hugh Dickins <hughd@google.com>:
mm: warn on deleting redirtied only if accounted
mm: unmap_mapping_range_tree() with i_mmap_rwsem shared
Anshuman Khandual <anshuman.khandual@arm.com>:
mm: generalize ARCH_HAS_FILTER_PGPROT
Subsystem: mm/madvise
Mauricio Faria de Oliveira <mfo@canonical.com>:
mm: fix race between MADV_FREE reclaim and blkdev direct IO read
Johannes Weiner <hannes@cmpxchg.org>:
mm: madvise: MADV_DONTNEED_LOCKED
Subsystem: selftests
Muhammad Usama Anjum <usama.anjum@collabora.com>:
selftests: vm: remove dependecy from internal kernel macros
Kees Cook <keescook@chromium.org>:
selftests: kselftest framework: provide "finished" helper
Documentation/dev-tools/kasan.rst | 17
Documentation/vm/page_owner.rst | 72 ++
arch/alpha/include/uapi/asm/mman.h | 2
arch/arm64/Kconfig | 2
arch/arm64/include/asm/vmalloc.h | 6
arch/arm64/include/asm/vmap_stack.h | 5
arch/arm64/kernel/module.c | 5
arch/arm64/mm/pageattr.c | 2
arch/arm64/net/bpf_jit_comp.c | 3
arch/mips/include/uapi/asm/mman.h | 2
arch/parisc/include/uapi/asm/mman.h | 2
arch/powerpc/mm/book3s64/trace.c | 1
arch/s390/kernel/module.c | 2
arch/x86/Kconfig | 3
arch/x86/kernel/module.c | 2
arch/x86/mm/init.c | 1
arch/xtensa/include/uapi/asm/mman.h | 2
include/linux/gfp.h | 53 +-
include/linux/huge_mm.h | 6
include/linux/kasan.h | 136 +++--
include/linux/mm.h | 5
include/linux/page-flags.h | 2
include/linux/pagemap.h | 3
include/linux/swap.h | 4
include/linux/vmalloc.h | 18
include/trace/events/huge_memory.h | 1
include/trace/events/migrate.h | 31 +
include/trace/events/mmflags.h | 18
include/trace/events/thp.h | 27 +
include/uapi/asm-generic/mman-common.h | 2
kernel/fork.c | 13
kernel/scs.c | 16
lib/Kconfig.kasan | 18
lib/test_kasan.c | 239 ++++++++-
lib/vsprintf.c | 8
mm/Kconfig | 3
mm/debug.c | 1
mm/filemap.c | 63 +-
mm/huge_memory.c | 109 ----
mm/kasan/Makefile | 2
mm/kasan/common.c | 4
mm/kasan/hw_tags.c | 243 +++++++---
mm/kasan/kasan.h | 76 ++-
mm/kasan/report.c | 516 +++++++++++----------
mm/kasan/report_generic.c | 34 -
mm/kasan/report_hw_tags.c | 1
mm/kasan/report_sw_tags.c | 16
mm/kasan/report_tags.c | 2
mm/kasan/shadow.c | 76 +--
mm/khugepaged.c | 11
mm/madvise.c | 57 +-
mm/memory.c | 129 +++--
mm/memremap.c | 2
mm/migrate.c | 4
mm/page-writeback.c | 18
mm/page_alloc.c | 270 ++++++-----
mm/page_owner.c | 86 ++-
mm/rmap.c | 62 +-
mm/swap.c | 4
mm/swapfile.c | 104 ----
mm/vmalloc.c | 167 ++++--
tools/testing/selftests/kselftest.h | 10
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 1
tools/testing/selftests/vm/gup_test.c | 3
tools/testing/selftests/vm/hugetlb-madvise.c | 410 ++++++++++++++++
tools/testing/selftests/vm/ksm_tests.c | 38 -
tools/testing/selftests/vm/memfd_secret.c | 2
tools/testing/selftests/vm/run_vmtests.sh | 15
tools/testing/selftests/vm/transhuge-stress.c | 41 -
tools/testing/selftests/vm/userfaultfd.c | 72 +-
tools/testing/selftests/vm/util.h | 75 ++-
tools/vm/page_owner_sort.c | 628 +++++++++++++++++++++-----
73 files changed, 2797 insertions(+), 1288 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-04-01 18:20 Andrew Morton
2022-04-01 18:27 ` incoming Andrew Morton
0 siblings, 1 reply; 419+ messages in thread
From: Andrew Morton @ 2022-04-01 18:20 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696.
Subsystems affected by this patch series:
mm/madvise
ofs2
nilfs2
mm/mlock
mm/mfence
mailmap
mm/memory-failure
mm/kasan
mm/debug
mm/kmemleak
mm/damon
Subsystem: mm/madvise
Charan Teja Kalla <quic_charante@quicinc.com>:
Revert "mm: madvise: skip unmapped vma holes passed to process_madvise"
Subsystem: ofs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: fix crash when mount with quota enabled
Subsystem: nilfs2
Ryusuke Konishi <konishi.ryusuke@gmail.com>:
Patch series "nilfs2 lockdep warning fixes":
nilfs2: fix lockdep warnings in page operations for btree nodes
nilfs2: fix lockdep warnings during disk space reclamation
nilfs2: get rid of nilfs_mapping_init()
Subsystem: mm/mlock
Hugh Dickins <hughd@google.com>:
mm/munlock: add lru_add_drain() to fix memcg_stat_test
mm/munlock: update Documentation/vm/unevictable-lru.rst
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/munlock: protect the per-CPU pagevec by a local_lock_t
Subsystem: mm/kfence
Muchun Song <songmuchun@bytedance.com>:
mm: kfence: fix objcgs vector allocation
Subsystem: mailmap
Kirill Tkhai <kirill.tkhai@openvz.org>:
mailmap: update Kirill's email
Subsystem: mm/memory-failure
Rik van Riel <riel@surriel.com>:
mm,hwpoison: unmap poisoned page before invalidation
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP
Subsystem: mm/debug
Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: remove -c option
doc/vm/page_owner.rst: remove content related to -c option
Subsystem: mm/kmemleak
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
mm/kmemleak: reset tag when compare object pointer
Subsystem: mm/damon
Jonghyeon Kim <tome01@ajou.ac.kr>:
mm/damon: prevent activated scheme from sleeping by deactivated schemes
.mailmap | 1
Documentation/vm/page_owner.rst | 1
Documentation/vm/unevictable-lru.rst | 473 +++++++++++++++--------------------
fs/nilfs2/btnode.c | 23 +
fs/nilfs2/btnode.h | 1
fs/nilfs2/btree.c | 27 +
fs/nilfs2/dat.c | 4
fs/nilfs2/gcinode.c | 7
fs/nilfs2/inode.c | 167 +++++++++++-
fs/nilfs2/mdt.c | 45 ++-
fs/nilfs2/mdt.h | 6
fs/nilfs2/nilfs.h | 16 -
fs/nilfs2/page.c | 16 -
fs/nilfs2/page.h | 1
fs/nilfs2/segment.c | 9
fs/nilfs2/super.c | 5
fs/ocfs2/quota_global.c | 23 -
fs/ocfs2/quota_local.c | 2
include/linux/gfp.h | 4
mm/damon/core.c | 5
mm/gup.c | 10
mm/internal.h | 6
mm/kfence/core.c | 11
mm/kfence/kfence.h | 3
mm/kmemleak.c | 9
mm/madvise.c | 9
mm/memory.c | 12
mm/migrate.c | 2
mm/mlock.c | 46 ++-
mm/page_alloc.c | 1
mm/rmap.c | 4
mm/swap.c | 4
tools/vm/page_owner_sort.c | 6
33 files changed, 560 insertions(+), 399 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* Re: incoming
2022-04-01 18:20 incoming Andrew Morton
@ 2022-04-01 18:27 ` Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-04-01 18:27 UTC (permalink / raw)
To: Linus Torvalds, linux-mm, mm-commits, patches
Argh, messed up in-reply-to. Let me redo...
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-04-01 18:27 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-04-01 18:27 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696.
Subsystems affected by this patch series:
mm/madvise
ofs2
nilfs2
mm/mlock
mm/mfence
mailmap
mm/memory-failure
mm/kasan
mm/debug
mm/kmemleak
mm/damon
Subsystem: mm/madvise
Charan Teja Kalla <quic_charante@quicinc.com>:
Revert "mm: madvise: skip unmapped vma holes passed to process_madvise"
Subsystem: ofs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: fix crash when mount with quota enabled
Subsystem: nilfs2
Ryusuke Konishi <konishi.ryusuke@gmail.com>:
Patch series "nilfs2 lockdep warning fixes":
nilfs2: fix lockdep warnings in page operations for btree nodes
nilfs2: fix lockdep warnings during disk space reclamation
nilfs2: get rid of nilfs_mapping_init()
Subsystem: mm/mlock
Hugh Dickins <hughd@google.com>:
mm/munlock: add lru_add_drain() to fix memcg_stat_test
mm/munlock: update Documentation/vm/unevictable-lru.rst
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/munlock: protect the per-CPU pagevec by a local_lock_t
Subsystem: mm/kfence
Muchun Song <songmuchun@bytedance.com>:
mm: kfence: fix objcgs vector allocation
Subsystem: mailmap
Kirill Tkhai <kirill.tkhai@openvz.org>:
mailmap: update Kirill's email
Subsystem: mm/memory-failure
Rik van Riel <riel@surriel.com>:
mm,hwpoison: unmap poisoned page before invalidation
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP
Subsystem: mm/debug
Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: remove -c option
doc/vm/page_owner.rst: remove content related to -c option
Subsystem: mm/kmemleak
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
mm/kmemleak: reset tag when compare object pointer
Subsystem: mm/damon
Jonghyeon Kim <tome01@ajou.ac.kr>:
mm/damon: prevent activated scheme from sleeping by deactivated schemes
.mailmap | 1
Documentation/vm/page_owner.rst | 1
Documentation/vm/unevictable-lru.rst | 473 +++++++++++++++--------------------
fs/nilfs2/btnode.c | 23 +
fs/nilfs2/btnode.h | 1
fs/nilfs2/btree.c | 27 +
fs/nilfs2/dat.c | 4
fs/nilfs2/gcinode.c | 7
fs/nilfs2/inode.c | 167 +++++++++++-
fs/nilfs2/mdt.c | 45 ++-
fs/nilfs2/mdt.h | 6
fs/nilfs2/nilfs.h | 16 -
fs/nilfs2/page.c | 16 -
fs/nilfs2/page.h | 1
fs/nilfs2/segment.c | 9
fs/nilfs2/super.c | 5
fs/ocfs2/quota_global.c | 23 -
fs/ocfs2/quota_local.c | 2
include/linux/gfp.h | 4
mm/damon/core.c | 5
mm/gup.c | 10
mm/internal.h | 6
mm/kfence/core.c | 11
mm/kfence/kfence.h | 3
mm/kmemleak.c | 9
mm/madvise.c | 9
mm/memory.c | 12
mm/migrate.c | 2
mm/mlock.c | 46 ++-
mm/page_alloc.c | 1
mm/rmap.c | 4
mm/swap.c | 4
tools/vm/page_owner_sort.c | 6
33 files changed, 560 insertions(+), 399 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-04-08 20:08 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-04-08 20:08 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
9 patches, based on d00c50b35101b862c3db270ffeba53a63a1063d9.
Subsystems affected by this patch series:
mm/migration
mm/highmem
lz4
mm/sparsemem
mm/mremap
mm/mempolicy
mailmap
mm/memcg
MAINTAINERS
Subsystem: mm/migration
Zi Yan <ziy@nvidia.com>:
mm: migrate: use thp_order instead of HPAGE_PMD_ORDER for new page allocation.
Subsystem: mm/highmem
Max Filippov <jcmvbkbc@gmail.com>:
highmem: fix checks in __kmap_local_sched_{in,out}
Subsystem: lz4
Guo Xuenan <guoxuenan@huawei.com>:
lz4: fix LZ4_decompress_safe_partial read out of bound
Subsystem: mm/sparsemem
Waiman Long <longman@redhat.com>:
mm/sparsemem: fix 'mem_section' will never be NULL gcc 12 warning
Subsystem: mm/mremap
Paolo Bonzini <pbonzini@redhat.com>:
mmmremap.c: avoid pointless invalidate_range_start/end on mremap(old_size=0)
Subsystem: mm/mempolicy
Miaohe Lin <linmiaohe@huawei.com>:
mm/mempolicy: fix mpol_new leak in shared_policy_replace
Subsystem: mailmap
Vasily Averin <vasily.averin@linux.dev>:
mailmap: update Vasily Averin's email address
Subsystem: mm/memcg
Andrew Morton <akpm@linux-foundation.org>:
mm/list_lru.c: revert "mm/list_lru: optimize memcg_reparent_list_lru_node()"
Subsystem: MAINTAINERS
Tom Rix <trix@redhat.com>:
MAINTAINERS: add Tom as clang reviewer
.mailmap | 4 ++++
MAINTAINERS | 1 +
include/linux/mmzone.h | 11 +++++++----
lib/lz4/lz4_decompress.c | 8 ++++++--
mm/highmem.c | 4 ++--
mm/list_lru.c | 6 ------
mm/mempolicy.c | 3 ++-
mm/migrate.c | 2 +-
mm/mremap.c | 3 +++
9 files changed, 26 insertions(+), 16 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-04-15 2:12 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-04-15 2:12 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
14 patches, based on 115acbb56978941bb7537a97dfc303da286106c1.
Subsystems affected by this patch series:
MAINTAINERS
mm/tmpfs
m/secretmem
mm/kasan
mm/kfence
mm/pagealloc
mm/zram
mm/compaction
mm/hugetlb
binfmt
mm/vmalloc
mm/kmemleak
Subsystem: MAINTAINERS
Joe Perches <joe@perches.com>:
MAINTAINERS: Broadcom internal lists aren't maintainers
Subsystem: mm/tmpfs
Hugh Dickins <hughd@google.com>:
tmpfs: fix regressions from wider use of ZERO_PAGE
Subsystem: m/secretmem
Axel Rasmussen <axelrasmussen@google.com>:
mm/secretmem: fix panic when growing a memfd_secret
Subsystem: mm/kasan
Zqiang <qiang1.zhang@intel.com>:
irq_work: use kasan_record_aux_stack_noalloc() record callstack
Vincenzo Frascino <vincenzo.frascino@arm.com>:
kasan: fix hw tags enablement when KUNIT tests are disabled
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
mm, kfence: support kmem_dump_obj() for KFENCE objects
Subsystem: mm/pagealloc
Juergen Gross <jgross@suse.com>:
mm, page_alloc: fix build_zonerefs_node()
Subsystem: mm/zram
Minchan Kim <minchan@kernel.org>:
mm: fix unexpected zeroed page mapping with zram swap
Subsystem: mm/compaction
Charan Teja Kalla <quic_charante@quicinc.com>:
mm: compaction: fix compiler warning when CONFIG_COMPACTION=n
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: do not demote poisoned hugetlb pages
Subsystem: binfmt
Andrew Morton <akpm@linux-foundation.org>:
revert "fs/binfmt_elf: fix PT_LOAD p_align values for loaders"
revert "fs/binfmt_elf: use PT_LOAD p_align values for static PIE"
Subsystem: mm/vmalloc
Omar Sandoval <osandov@fb.com>:
mm/vmalloc: fix spinning drain_vmap_work after reading from /proc/vmcore
Subsystem: mm/kmemleak
Patrick Wang <patrick.wang.shcn@gmail.com>:
mm: kmemleak: take a full lowmem check in kmemleak_*_phys()
MAINTAINERS | 64 ++++++++++++++++++++--------------------
arch/x86/include/asm/io.h | 2 -
arch/x86/kernel/crash_dump_64.c | 1
fs/binfmt_elf.c | 6 +--
include/linux/kfence.h | 24 +++++++++++++++
kernel/irq_work.c | 2 -
mm/compaction.c | 10 +++---
mm/filemap.c | 6 ---
mm/hugetlb.c | 17 ++++++----
mm/kasan/hw_tags.c | 5 +--
mm/kasan/kasan.h | 10 +++---
mm/kfence/core.c | 21 -------------
mm/kfence/kfence.h | 21 +++++++++++++
mm/kfence/report.c | 47 +++++++++++++++++++++++++++++
mm/kmemleak.c | 8 ++---
mm/page_alloc.c | 2 -
mm/page_io.c | 54 ---------------------------------
mm/secretmem.c | 17 ++++++++++
mm/shmem.c | 31 ++++++++++++-------
mm/slab.c | 2 -
mm/slab.h | 2 -
mm/slab_common.c | 9 +++++
mm/slob.c | 2 -
mm/slub.c | 2 -
mm/vmalloc.c | 11 ------
25 files changed, 207 insertions(+), 169 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-04-21 23:35 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-04-21 23:35 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
13 patches, based on b253435746d9a4a701b5f09211b9c14d3370d0da.
Subsystems affected by this patch series:
mm/memory-failure
mm/memcg
mm/userfaultfd
mm/hugetlbfs
mm/mremap
mm/oom-kill
mm/kasan
kcov
mm/hmm
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/hwpoison: fix race between hugetlb free/demotion and memory_failure_hugetlb()
Xu Yu <xuyu@linux.alibaba.com>:
mm/memory-failure.c: skip huge_zero_page in memory_failure()
Subsystem: mm/memcg
Shakeel Butt <shakeelb@google.com>:
memcg: sync flush only if periodic flush is delayed
Subsystem: mm/userfaultfd
Nadav Amit <namit@vmware.com>:
userfaultfd: mark uffd_wp regardless of VM_WRITE flag
Subsystem: mm/hugetlbfs
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm, hugetlb: allow for "high" userspace addresses
Subsystem: mm/mremap
Sidhartha Kumar <sidhartha.kumar@oracle.com>:
selftest/vm: verify mmap addr in mremap_test
selftest/vm: verify remap destination address in mremap_test
selftest/vm: support xfail in mremap_test
selftest/vm: add skip support to mremap_test
Subsystem: mm/oom-kill
Nico Pache <npache@redhat.com>:
oom_kill.c: futex: delay the OOM reaper to allow time for proper futex cleanup
Subsystem: mm/kasan
Vincenzo Frascino <vincenzo.frascino@arm.com>:
MAINTAINERS: add Vincenzo Frascino to KASAN reviewers
Subsystem: kcov
Aleksandr Nogikh <nogikh@google.com>:
kcov: don't generate a warning on vm_insert_page()'s failure
Subsystem: mm/hmm
Alistair Popple <apopple@nvidia.com>:
mm/mmu_notifier.c: fix race in mmu_interval_notifier_remove()
MAINTAINERS | 1
fs/hugetlbfs/inode.c | 9 -
include/linux/hugetlb.h | 6 +
include/linux/memcontrol.h | 5
include/linux/mm.h | 8 +
include/linux/sched.h | 1
include/linux/sched/mm.h | 8 +
kernel/kcov.c | 7 -
mm/hugetlb.c | 10 +
mm/memcontrol.c | 12 ++
mm/memory-failure.c | 158 ++++++++++++++++++++++--------
mm/mmap.c | 8 -
mm/mmu_notifier.c | 14 ++
mm/oom_kill.c | 54 +++++++---
mm/userfaultfd.c | 15 +-
mm/workingset.c | 2
tools/testing/selftests/vm/mremap_test.c | 85 +++++++++++++++-
tools/testing/selftests/vm/run_vmtests.sh | 11 +-
18 files changed, 327 insertions(+), 87 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
* incoming
@ 2022-04-27 19:41 Andrew Morton
0 siblings, 0 replies; 419+ messages in thread
From: Andrew Morton @ 2022-04-27 19:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
2 patches, based on d615b5416f8a1afeb82d13b238f8152c572d59c0.
Subsystems affected by this patch series:
mm/kasan
mm/debug
Subsystem: mm/kasan
Zqiang <qiang1.zhang@intel.com>:
kasan: prevent cpu_quarantine corruption when CPU offline and cache shrink occur at same time
Subsystem: mm/debug
Akira Yokosawa <akiyks@gmail.com>:
docs: vm/page_owner: use literal blocks for param description
Documentation/vm/page_owner.rst | 5 +++--
mm/kasan/quarantine.c | 7 +++++++
2 files changed, 10 insertions(+), 2 deletions(-)
^ permalink raw reply [flat|nested] 419+ messages in thread
end of thread, other threads:[~2022-04-27 19:41 UTC | newest]
Thread overview: 419+ messages (download: mbox.gz follow: Atom feed
-- links below jump to the message on this page --
2020-12-15 3:02 incoming Andrew Morton
2020-12-15 3:03 ` [patch 001/200] kthread: add kthread_work tracepoints Andrew Morton
2020-12-15 3:03 ` [patch 002/200] kthread_worker: document CPU hotplug handling Andrew Morton
2020-12-15 3:03 ` [patch 003/200] uapi: move constants from <linux/kernel.h> to <linux/const.h> Andrew Morton
2020-12-15 3:03 ` [patch 004/200] ide/falcon: remove in_interrupt() usage Andrew Morton
2020-12-15 3:03 ` [patch 005/200] ide: remove BUG_ON(in_interrupt() || irqs_disabled()) from ide_unregister() Andrew Morton
2020-12-15 3:03 ` [patch 006/200] fs/ntfs: remove unused varibles Andrew Morton
2020-12-15 3:03 ` [patch 007/200] fs/ntfs: remove unused variable attr_len Andrew Morton
2020-12-15 3:03 ` [patch 008/200] fs/ocfs2/cluster/tcp.c: remove unneeded break Andrew Morton
2020-12-15 3:03 ` [patch 009/200] ocfs2: ratelimit the 'max lookup times reached' notice Andrew Morton
2020-12-15 3:03 ` [patch 010/200] arch/Kconfig: fix spelling mistakes Andrew Morton
2020-12-15 3:03 ` [patch 011/200] mm/slab_common.c: use list_for_each_entry in dump_unreclaimable_slab() Andrew Morton
2020-12-15 3:03 ` [patch 012/200] mm: slab: clarify krealloc()'s behavior with __GFP_ZERO Andrew Morton
2020-12-15 14:30 ` Christian König
2020-12-15 19:08 ` Andy Shevchenko
2020-12-16 7:47 ` Christian König
2020-12-16 11:23 ` Andy Shevchenko
2020-12-15 3:03 ` [patch 013/200] mm: slab: provide krealloc_array() Andrew Morton
2020-12-15 3:03 ` [patch 014/200] ALSA: pcm: use krealloc_array() Andrew Morton
2020-12-15 3:04 ` [patch 015/200] vhost: vringh: " Andrew Morton
2020-12-15 3:04 ` [patch 016/200] pinctrl: " Andrew Morton
2020-12-15 3:04 ` [patch 017/200] edac: ghes: " Andrew Morton
2020-12-15 3:04 ` [patch 018/200] drm: atomic: " Andrew Morton
2020-12-15 3:04 ` [patch 019/200] hwtracing: intel: " Andrew Morton
2020-12-15 3:04 ` [patch 020/200] dma-buf: " Andrew Morton
2020-12-15 7:42 ` Christian König
2020-12-15 3:04 ` [patch 021/200] mm, slab, slub: clear the slab_cache field when freeing page Andrew Morton
2020-12-15 3:04 ` [patch 022/200] mm/slab: rerform init_on_free earlier Andrew Morton
2020-12-15 16:45 ` Alexander Potapenko
2020-12-15 20:46 ` Alexander Popov
2020-12-15 21:08 ` Alexander Popov
2020-12-15 3:04 ` [patch 023/200] mm, slub: use kmem_cache_debug_flags() in deactivate_slab() Andrew Morton
2020-12-15 3:04 ` [patch 024/200] mm/slub: let number of online CPUs determine the slub page order Andrew Morton
2020-12-15 3:04 ` [patch 025/200] device-dax/kmem: use struct_size() Andrew Morton
2020-12-15 3:04 ` [patch 026/200] mm: fix page_owner initializing issue for arm32 Andrew Morton
2020-12-15 3:04 ` [patch 027/200] mm/page_owner: record timestamp and pid Andrew Morton
2020-12-15 3:04 ` [patch 028/200] mm/filemap/c: break generic_file_buffered_read up into multiple functions Andrew Morton
2020-12-15 3:04 ` [patch 029/200] mm/filemap.c: generic_file_buffered_read() now uses find_get_pages_contig Andrew Morton
2020-12-15 3:04 ` [patch 030/200] mm/truncate: add parameter explanation for invalidate_mapping_pagevec Andrew Morton
2020-12-15 3:05 ` [patch 031/200] mm/filemap.c: remove else after a return Andrew Morton
2020-12-15 3:05 ` [patch 032/200] mm/gup_benchmark: rename to mm/gup_test Andrew Morton
2020-12-15 3:05 ` [patch 033/200] selftests/vm: use a common gup_test.h Andrew Morton
2020-12-15 3:05 ` [patch 034/200] selftests/vm: rename run_vmtests --> run_vmtests.sh Andrew Morton
2020-12-15 3:05 ` [patch 035/200] selftests/vm: minor cleanup: Makefile and gup_test.c Andrew Morton
2020-12-15 3:05 ` [patch 036/200] selftests/vm: only some gup_test items are really benchmarks Andrew Morton
2020-12-15 3:05 ` [patch 037/200] selftests/vm: gup_test: introduce the dump_pages() sub-test Andrew Morton
2020-12-15 3:05 ` [patch 038/200] selftests/vm: run_vmtests.sh: update and clean up gup_test invocation Andrew Morton
2020-12-15 3:05 ` [patch 039/200] selftests/vm: hmm-tests: remove the libhugetlbfs dependency Andrew Morton
2020-12-15 3:05 ` [patch 040/200] selftests/vm: 2x speedup for run_vmtests.sh Andrew Morton
2020-12-15 3:05 ` [patch 041/200] mm/gup_test.c: mark gup_test_init as __init function Andrew Morton
2020-12-15 3:05 ` [patch 042/200] mm/gup_test: GUP_TEST depends on DEBUG_FS Andrew Morton
2020-12-15 3:05 ` [patch 043/200] mm/gup: reorganize internal_get_user_pages_fast() Andrew Morton
2020-12-15 3:05 ` [patch 044/200] mm/gup: prevent gup_fast from racing with COW during fork Andrew Morton
2020-12-15 3:05 ` [patch 045/200] mm/gup: remove the vma allocation from gup_longterm_locked() Andrew Morton
2020-12-15 3:05 ` [patch 046/200] mm/gup: combine put_compound_head() and unpin_user_page() Andrew Morton
2020-12-15 3:05 ` [patch 047/200] mm: handle zone device pages in release_pages() Andrew Morton
2020-12-15 3:05 ` [patch 048/200] mm/swapfile.c: use helper function swap_count() in add_swap_count_continuation() Andrew Morton
2020-12-15 3:06 ` [patch 049/200] mm/swap_state: skip meaningless swap cache readahead when ra_info.win == 0 Andrew Morton
2020-12-15 3:06 ` [patch 050/200] mm/swapfile.c: remove unnecessary out label in __swap_duplicate() Andrew Morton
2020-12-15 3:06 ` [patch 051/200] mm/swapfile.c: use memset to fill the swap_map with SWAP_HAS_CACHE Andrew Morton
2020-12-15 3:06 ` [patch 052/200] mm: remove pagevec_lookup_range_nr_tag() Andrew Morton
2020-12-15 3:06 ` [patch 053/200] mm/shmem.c: make shmem_mapping() inline Andrew Morton
2020-12-15 3:06 ` [patch 054/200] tmpfs: fix Documentation nits Andrew Morton
2020-12-15 3:06 ` [patch 055/200] mm: memcontrol: add file_thp, shmem_thp to memory.stat Andrew Morton
2020-12-15 3:06 ` [patch 056/200] mm: memcontrol: remove unused mod_memcg_obj_state() Andrew Morton
2020-12-15 3:06 ` [patch 057/200] mm: memcontrol: eliminate redundant check in __mem_cgroup_insert_exceeded() Andrew Morton
2020-12-15 3:06 ` [patch 058/200] mm: memcg/slab: fix return of child memcg objcg for root memcg Andrew Morton
2020-12-15 3:06 ` [patch 059/200] mm: memcg/slab: fix use after free in obj_cgroup_charge Andrew Morton
2020-12-15 3:06 ` [patch 060/200] mm/rmap: always do TTU_IGNORE_ACCESS Andrew Morton
2020-12-15 3:06 ` [patch 061/200] mm/memcg: update page struct member in comments Andrew Morton
2020-12-15 3:06 ` [patch 062/200] mm: memcg: fix obsolete code comments Andrew Morton
2020-12-15 3:06 ` [patch 063/200] mm: memcg: deprecate the non-hierarchical mode Andrew Morton
2020-12-15 3:06 ` [patch 064/200] docs: cgroup-v1: reflect the deprecation of " Andrew Morton
2020-12-15 3:06 ` [patch 065/200] cgroup: remove obsoleted broken_hierarchy and warned_broken_hierarchy Andrew Morton
2020-12-15 3:06 ` [patch 066/200] mm/page_counter: use page_counter_read in page_counter_set_max Andrew Morton
2020-12-15 3:07 ` [patch 067/200] mm: memcg: remove obsolete memcg_has_children() Andrew Morton
2020-12-15 3:07 ` [patch 068/200] mm: memcg/slab: rename *_lruvec_slab_state to *_lruvec_kmem_state Andrew Morton
2020-12-15 3:07 ` [patch 069/200] mm: memcontrol: sssign boolean values to a bool variable Andrew Morton
2020-12-15 3:07 ` [patch 070/200] mm/memcg: remove incorrect comment Andrew Morton
2020-12-15 3:07 ` [patch 071/200] mm: move lruvec stats update functions to vmstat.h Andrew Morton
2020-12-15 3:07 ` [patch 072/200] mm: memcontrol: account pagetables per node Andrew Morton
2020-12-15 3:07 ` [patch 073/200] xen/unpopulated-alloc: consolidate pgmap manipulation Andrew Morton
2020-12-15 3:07 ` [patch 074/200] kselftests: vm: add mremap tests Andrew Morton
2020-12-15 3:07 ` [patch 075/200] mm: speedup mremap on 1GB or larger regions Andrew Morton
2020-12-15 19:52 ` Linus Torvalds
2020-12-15 23:16 ` Kalesh Singh
2020-12-15 3:07 ` [patch 076/200] arm64: mremap speedup - enable HAVE_MOVE_PUD Andrew Morton
2020-12-15 3:07 ` [patch 077/200] x86: mremap speedup - Enable HAVE_MOVE_PUD Andrew Morton
2020-12-15 3:07 ` [patch 078/200] mm: cleanup: remove unused tsk arg from __access_remote_vm Andrew Morton
2020-12-15 3:07 ` [patch 079/200] mm/mapping_dirty_helpers: enhance the kernel-doc markups Andrew Morton
2020-12-15 3:07 ` [patch 080/200] mm/page_vma_mapped.c: add colon to fix kernel-doc markups error for check_pte Andrew Morton
2020-12-15 3:07 ` [patch 081/200] mm: mmap_lock: add tracepoints around lock acquisition Andrew Morton
2020-12-15 3:07 ` [patch 082/200] sparc: fix handling of page table constructor failure Andrew Morton
2020-12-15 3:08 ` [patch 083/200] mm: move free_unref_page to mm/internal.h Andrew Morton
2020-12-15 3:08 ` [patch 084/200] mm/mremap: account memory on do_munmap() failure Andrew Morton
2020-12-15 3:08 ` [patch 085/200] mm/mremap: for MREMAP_DONTUNMAP check security_vm_enough_memory_mm() Andrew Morton
2020-12-15 3:08 ` [patch 086/200] mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio Andrew Morton
2020-12-28 17:59 ` Brian Geffon
2020-12-15 3:08 ` [patch 087/200] vm_ops: rename .split() callback to .may_split() Andrew Morton
2020-12-15 3:08 ` [patch 088/200] mremap: check if it's possible to split original vma Andrew Morton
2020-12-15 3:08 ` [patch 089/200] mm: forbid splitting special mappings Andrew Morton
2020-12-15 3:08 ` [patch 090/200] mm: track mmu notifiers in fs_reclaim_acquire/release Andrew Morton
2020-12-15 3:08 ` [patch 091/200] mm: extract might_alloc() debug check Andrew Morton
2020-12-15 3:08 ` [patch 092/200] locking/selftests: add testcases for fs_reclaim Andrew Morton
2020-12-15 3:08 ` [patch 093/200] mm/vmalloc.c:__vmalloc_area_node(): avoid 32-bit overflow Andrew Morton
2020-12-15 3:08 ` [patch 094/200] mm/vmalloc: use free_vm_area() if an allocation fails Andrew Morton
2020-12-15 3:08 ` [patch 095/200] mm/vmalloc: rework the drain logic Andrew Morton
2020-12-15 3:08 ` [patch 096/200] mm/vmalloc: add 'align' parameter explanation for pvm_determine_end_from_reverse Andrew Morton
2020-12-15 3:08 ` [patch 097/200] mm/vmalloc.c: remove unnecessary return statement Andrew Morton
2020-12-15 3:08 ` [patch 098/200] mm/vmalloc: Fix unlock order in s_stop() Andrew Morton
2020-12-15 3:09 ` [patch 099/200] docs/vm: remove unused 3 items explanation for /proc/vmstat Andrew Morton
2020-12-15 3:09 ` [patch 100/200] mm/vmalloc.c: fix kasan shadow poisoning size Andrew Morton
2020-12-15 3:09 ` [patch 101/200] workqueue: kasan: record workqueue stack Andrew Morton
2020-12-15 3:09 ` [patch 102/200] kasan: print " Andrew Morton
2020-12-15 3:09 ` [patch 103/200] lib/test_kasan.c: add workqueue test case Andrew Morton
2020-12-15 3:09 ` [patch 104/200] kasan: update documentation for generic kasan Andrew Morton
2020-12-15 3:09 ` [patch 105/200] lkdtm: disable KASAN for rodata.o Andrew Morton
2020-12-15 3:09 ` [patch 106/200] alpha: switch from DISCONTIGMEM to SPARSEMEM Andrew Morton
2020-12-15 3:09 ` [patch 107/200] ia64: remove custom __early_pfn_to_nid() Andrew Morton
2020-12-15 3:09 ` [patch 108/200] ia64: remove 'ifdef CONFIG_ZONE_DMA32' statements Andrew Morton
2020-12-15 3:09 ` [patch 109/200] ia64: discontig: paging_init(): remove local max_pfn calculation Andrew Morton
2020-12-15 3:09 ` [patch 110/200] ia64: split virtual map initialization out of paging_init() Andrew Morton
2020-12-15 3:09 ` [patch 111/200] ia64: forbid using VIRTUAL_MEM_MAP with FLATMEM Andrew Morton
2020-12-15 3:09 ` [patch 112/200] ia64: make SPARSEMEM default and disable DISCONTIGMEM Andrew Morton
2020-12-15 3:09 ` [patch 113/200] arm: remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL Andrew Morton
2020-12-15 3:09 ` [patch 114/200] arm, arm64: move free_unused_memmap() to generic mm Andrew Morton
2020-12-15 3:10 ` [patch 115/200] arc: use FLATMEM with freeing of unused memory map instead of DISCONTIGMEM Andrew Morton
2020-12-15 3:10 ` [patch 116/200] m68k/mm: make node data and node setup depend on CONFIG_DISCONTIGMEM Andrew Morton
2020-12-15 3:10 ` [patch 117/200] m68k/mm: enable use of generic memory_model.h for !DISCONTIGMEM Andrew Morton
2020-12-15 3:10 ` [patch 118/200] m68k: deprecate DISCONTIGMEM Andrew Morton
2020-12-15 3:10 ` [patch 119/200] mm: introduce debug_pagealloc_{map,unmap}_pages() helpers Andrew Morton
2020-12-15 3:10 ` [patch 120/200] PM: hibernate: make direct map manipulations more explicit Andrew Morton
2020-12-15 3:10 ` [patch 121/200] arch, mm: restore dependency of __kernel_map_pages() on DEBUG_PAGEALLOC Andrew Morton
2020-12-15 3:10 ` [patch 122/200] arch, mm: make kernel_page_present() always available Andrew Morton
2020-12-15 3:10 ` [patch 123/200] mm, page_alloc: clean up pageset high and batch update Andrew Morton
2020-12-15 3:10 ` [patch 124/200] mm, page_alloc: calculate pageset high and batch once per zone Andrew Morton
2020-12-15 3:10 ` [patch 125/200] mm, page_alloc: remove setup_pageset() Andrew Morton
2020-12-15 3:10 ` [patch 126/200] mm, page_alloc: simplify pageset_update() Andrew Morton
2020-12-15 3:10 ` [patch 127/200] mm, page_alloc: cache pageset high and batch in struct zone Andrew Morton
2020-12-15 3:10 ` [patch 128/200] mm, page_alloc: move draining pcplists to page isolation users Andrew Morton
2020-12-15 3:10 ` [patch 129/200] mm, page_alloc: disable pcplists during memory offline Andrew Morton
2020-12-15 3:11 ` [patch 130/200] include/linux/page-flags.h: remove unused __[Set|Clear]PagePrivate Andrew Morton
2020-12-15 3:11 ` [patch 131/200] mm/page-flags: fix comment Andrew Morton
2020-12-15 3:11 ` [patch 132/200] mm/page_alloc: add __free_pages() documentation Andrew Morton
2020-12-15 3:11 ` [patch 133/200] mm/page_alloc: mark some symbols with static keyword Andrew Morton
2020-12-15 3:11 ` [patch 134/200] mm/page_alloc: clear all pages in post_alloc_hook() with init_on_alloc=1 Andrew Morton
2020-12-15 3:11 ` [patch 135/200] init/main: fix broken buffer_init when DEFERRED_STRUCT_PAGE_INIT set Andrew Morton
2020-12-15 3:11 ` [patch 136/200] mm: page_alloc: refactor setup_per_zone_lowmem_reserve() Andrew Morton
2020-12-15 3:11 ` [patch 137/200] mm/page_alloc: speed up the iteration of max_order Andrew Morton
2020-12-15 3:11 ` [patch 138/200] mm,hwpoison: drain pcplists before bailing out for non-buddy zero-refcount page Andrew Morton
2020-12-15 3:11 ` [patch 139/200] mm,hwpoison: take free pages off the buddy freelists Andrew Morton
2020-12-15 3:11 ` [patch 140/200] mm,hwpoison: drop unneeded pcplist draining Andrew Morton
2020-12-15 3:11 ` [patch 141/200] mm,hwpoison: refactor get_any_page Andrew Morton
2020-12-15 3:11 ` [patch 142/200] mm,hwpoison: disable pcplists before grabbing a refcount Andrew Morton
2020-12-15 3:11 ` [patch 143/200] mm,hwpoison: remove drain_all_pages from shake_page Andrew Morton
2020-12-15 3:11 ` [patch 144/200] mm,memory_failure: always pin the page in madvise_inject_error Andrew Morton
2020-12-15 3:11 ` [patch 145/200] mm,hwpoison: return -EBUSY when migration fails Andrew Morton
2020-12-15 3:11 ` [patch 146/200] mm/hugetlb.c: just use put_page_testzero() instead of page_count() Andrew Morton
2020-12-15 3:11 ` [patch 147/200] include/linux/huge_mm.h: remove extern keyword Andrew Morton
2020-12-15 3:12 ` [patch 148/200] khugepaged: add parameter explanations for kernel-doc markup Andrew Morton
2020-12-15 3:12 ` [patch 149/200] mm: hugetlb: fix type of delta parameter and related local variables in gather_surplus_pages() Andrew Morton
2020-12-15 3:12 ` [patch 150/200] mm,hugetlb: remove unneeded initialization Andrew Morton
2020-12-15 3:12 ` [patch 151/200] hugetlb: fix an error code in hugetlb_reserve_pages() Andrew Morton
2020-12-15 3:12 ` [patch 152/200] mm: don't wake kswapd prematurely when watermark boosting is disabled Andrew Morton
2020-12-15 3:12 ` [patch 153/200] mm/vmscan: drop unneeded assignment in kswapd() Andrew Morton
2020-12-15 3:12 ` [patch 154/200] mm/vmscan.c: remove the filename in the top of file comment Andrew Morton
2020-12-15 3:12 ` [patch 155/200] mm/page_isolation: do not isolate the max order page Andrew Morton
2020-12-15 3:12 ` [patch 156/200] z3fold: simplify freeing slots Andrew Morton
2020-12-15 3:12 ` [patch 157/200] z3fold: stricter locking and more careful reclaim Andrew Morton
2020-12-15 3:12 ` [patch 158/200] z3fold: remove preempt disabled sections for RT Andrew Morton
2020-12-15 3:12 ` [patch 159/200] mm/compaction: rename 'start_pfn' to 'iteration_start_pfn' in compact_zone() Andrew Morton
2020-12-15 3:12 ` [patch 160/200] mm/compaction: move compaction_suitable's comment to right place Andrew Morton
2020-12-15 3:12 ` [patch 161/200] mm/compaction: make defer_compaction and compaction_deferred static Andrew Morton
2020-12-15 3:12 ` [patch 162/200] mm/oom_kill: change comment and rename is_dump_unreclaim_slabs() Andrew Morton
2020-12-15 3:12 ` [patch 163/200] mm/migrate.c: fix comment spelling Andrew Morton
2020-12-15 3:12 ` [patch 164/200] mm/migrate.c: optimize migrate_vma_pages() mmu notifier Andrew Morton
2020-12-15 3:12 ` [patch 165/200] mm: support THPs in zero_user_segments Andrew Morton
2020-12-15 3:13 ` [patch 166/200] mm: truncate_complete_page() does not exist any more Andrew Morton
2020-12-15 3:13 ` [patch 167/200] mm: migrate: simplify the logic for handling permanent failure Andrew Morton
2020-12-15 3:13 ` [patch 168/200] mm: migrate: skip shared exec THP for NUMA balancing Andrew Morton
2020-12-15 3:13 ` [patch 169/200] mm: migrate: clean up migrate_prep{_local} Andrew Morton
2020-12-15 3:13 ` [patch 170/200] mm: migrate: return -ENOSYS if THP migration is unsupported Andrew Morton
2020-12-15 3:13 ` [patch 171/200] mm: migrate: remove unused parameter in migrate_vma_insert_page() Andrew Morton
2020-12-15 3:13 ` [patch 172/200] mm/cma.c: remove redundant cma_mutex lock Andrew Morton
2020-12-15 3:13 ` [patch 173/200] mm: cma: improve pr_debug log in cma_release() Andrew Morton
2020-12-15 3:13 ` [patch 174/200] mm, page_alloc: do not rely on the order of page_poison and init_on_alloc/free parameters Andrew Morton
2020-12-15 3:13 ` [patch 175/200] mm, page_poison: use static key more efficiently Andrew Morton
2020-12-15 3:13 ` [patch 176/200] kernel/power: allow hibernation with page_poison sanity checking Andrew Morton
2020-12-15 3:13 ` [patch 177/200] mm, page_poison: remove CONFIG_PAGE_POISONING_NO_SANITY Andrew Morton
2020-12-15 3:13 ` [patch 178/200] mm, page_poison: remove CONFIG_PAGE_POISONING_ZERO Andrew Morton
2020-12-15 3:13 ` [patch 179/200] userfaultfd: add UFFD_USER_MODE_ONLY Andrew Morton
2020-12-15 3:13 ` [patch 180/200] userfaultfd: add user-mode only option to unprivileged_userfaultfd sysctl knob Andrew Morton
2020-12-15 3:13 ` [patch 181/200] userfaultfd: selftests: make __{s,u}64 format specifiers portable Andrew Morton
2020-12-15 3:14 ` [patch 182/200] userfaultfd/selftests: always dump something in modes Andrew Morton
2020-12-15 3:14 ` [patch 183/200] userfaultfd/selftests: fix retval check for userfaultfd_open() Andrew Morton
2020-12-15 3:14 ` [patch 184/200] userfaultfd/selftests: hint the test runner on required privilege Andrew Morton
2020-12-15 3:14 ` [patch 185/200] mm/zswap: make struct kernel_param_ops definitions const Andrew Morton
2020-12-15 3:14 ` [patch 186/200] mm/zswap: fix passing zero to 'PTR_ERR' warning Andrew Morton
2020-12-15 3:14 ` [patch 187/200] mm/zswap: move to use crypto_acomp API for hardware acceleration Andrew Morton
2020-12-15 3:14 ` [patch 188/200] mm/zsmalloc.c: rework the list_add code in insert_zspage() Andrew Morton
2020-12-15 3:14 ` [patch 189/200] mm/process_vm_access: remove redundant initialization of iov_r Andrew Morton
2020-12-15 3:14 ` [patch 190/200] zram: support page writeback Andrew Morton
2020-12-15 3:14 ` [patch 191/200] zram: add stat to gather incompressible pages since zram set up Andrew Morton
2020-12-15 3:14 ` [patch 192/200] zram: break the strict dependency from lzo Andrew Morton
2020-12-15 3:14 ` [patch 193/200] mm: fix kernel-doc markups Andrew Morton
2020-12-15 3:14 ` [patch 194/200] mm: use sysfs_emit for struct kobject * uses Andrew Morton
2020-12-15 3:14 ` [patch 195/200] mm: huge_memory: convert remaining use of sprintf to sysfs_emit and neatening Andrew Morton
2020-12-15 3:14 ` [patch 196/200] mm:backing-dev: use sysfs_emit in macro defining functions Andrew Morton
2020-12-15 3:14 ` [patch 197/200] mm: shmem: convert shmem_enabled_show to use sysfs_emit_at Andrew Morton
2020-12-15 3:14 ` [patch 198/200] mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at Andrew Morton
2020-12-15 3:15 ` [patch 199/200] mm: fix fall-through warnings for Clang Andrew Morton
2020-12-15 3:15 ` [patch 200/200] mm: cleanup kstrto*() usage Andrew Morton
2020-12-15 3:25 ` incoming Linus Torvalds
2020-12-15 3:30 ` incoming Linus Torvalds
2020-12-15 14:04 ` incoming Konstantin Ryabitsev
-- strict thread matches above, loose matches on Subject: below --
2022-04-27 19:41 incoming Andrew Morton
2022-04-21 23:35 incoming Andrew Morton
2022-04-15 2:12 incoming Andrew Morton
2022-04-08 20:08 incoming Andrew Morton
2022-04-01 18:27 incoming Andrew Morton
2022-04-01 18:20 incoming Andrew Morton
2022-04-01 18:27 ` incoming Andrew Morton
2022-03-25 1:07 incoming Andrew Morton
2022-03-23 23:04 incoming Andrew Morton
2022-03-22 21:38 incoming Andrew Morton
2022-03-16 23:14 incoming Andrew Morton
2022-03-05 4:28 incoming Andrew Morton
2022-02-26 3:10 incoming Andrew Morton
2022-02-12 0:27 incoming Andrew Morton
2022-02-12 2:02 ` incoming Linus Torvalds
2022-02-12 5:24 ` incoming Andrew Morton
2022-02-04 4:48 incoming Andrew Morton
2022-01-29 21:40 incoming Andrew Morton
2022-01-29 2:13 incoming Andrew Morton
2022-01-29 4:25 ` incoming Matthew Wilcox
2022-01-29 6:23 ` incoming Andrew Morton
2022-01-22 6:10 incoming Andrew Morton
2022-01-20 2:07 incoming Andrew Morton
2022-01-14 22:02 incoming Andrew Morton
2021-12-31 4:12 incoming Andrew Morton
2021-12-25 5:11 incoming Andrew Morton
2021-12-10 22:45 incoming Andrew Morton
2021-11-20 0:42 incoming Andrew Morton
2021-11-11 4:32 incoming Andrew Morton
2021-11-09 2:30 incoming Andrew Morton
2021-11-05 20:34 incoming Andrew Morton
2021-10-28 21:35 incoming Andrew Morton
2021-10-18 22:14 incoming Andrew Morton
2021-09-24 22:42 incoming Andrew Morton
2021-09-10 3:09 incoming Andrew Morton
2021-09-10 17:11 ` incoming Kees Cook
2021-09-10 20:13 ` incoming Kees Cook
2021-09-09 1:08 incoming Andrew Morton
2021-09-08 22:17 incoming Andrew Morton
2021-09-08 2:52 incoming Andrew Morton
2021-09-08 8:57 ` incoming Vlastimil Babka
2021-09-02 21:48 incoming Andrew Morton
2021-09-02 21:49 ` incoming Andrew Morton
2021-08-25 19:17 incoming Andrew Morton
2021-08-20 2:03 incoming Andrew Morton
2021-08-13 23:53 incoming Andrew Morton
2021-07-29 21:52 incoming Andrew Morton
2021-07-23 22:49 incoming Andrew Morton
2021-07-15 4:26 incoming Andrew Morton
2021-07-08 0:59 incoming Andrew Morton
2021-07-01 1:46 incoming Andrew Morton
2021-07-03 0:28 ` incoming Linus Torvalds
2021-07-03 1:06 ` incoming Linus Torvalds
2021-06-29 2:32 incoming Andrew Morton
2021-06-25 1:38 incoming Andrew Morton
2021-06-16 1:22 incoming Andrew Morton
2021-06-05 3:00 incoming Andrew Morton
2021-05-23 0:41 incoming Andrew Morton
2021-05-15 0:26 incoming Andrew Morton
2021-05-07 1:01 incoming Andrew Morton
2021-05-07 7:12 ` incoming Linus Torvalds
2021-05-05 1:32 incoming Andrew Morton
2021-05-05 1:47 ` incoming Linus Torvalds
2021-05-05 3:16 ` incoming Andrew Morton
2021-05-05 17:10 ` incoming Linus Torvalds
2021-05-05 17:44 ` incoming Andrew Morton
2021-05-06 3:19 ` incoming Anshuman Khandual
2021-04-30 5:52 incoming Andrew Morton
2021-04-23 21:28 incoming Andrew Morton
2021-04-16 22:45 incoming Andrew Morton
2021-04-09 20:26 incoming Andrew Morton
2021-03-25 4:36 incoming Andrew Morton
2021-03-13 5:06 incoming Andrew Morton
2021-02-26 1:14 incoming Andrew Morton
2021-02-26 17:55 ` incoming Linus Torvalds
2021-02-26 19:16 ` incoming Andrew Morton
2021-02-24 19:58 incoming Andrew Morton
2021-02-24 21:30 ` incoming Linus Torvalds
2021-02-24 21:37 ` incoming Linus Torvalds
2021-02-25 8:53 ` incoming Arnd Bergmann
2021-02-25 9:12 ` incoming Andrey Ryabinin
2021-02-25 11:07 ` incoming Walter Wu
2021-02-13 4:52 incoming Andrew Morton
2021-02-09 21:41 incoming Andrew Morton
2021-02-10 19:30 ` incoming Linus Torvalds
2021-02-05 2:31 incoming Andrew Morton
2021-01-24 5:00 incoming Andrew Morton
2021-01-12 23:48 incoming Andrew Morton
2021-01-15 23:32 ` incoming Linus Torvalds
2020-12-29 23:13 incoming Andrew Morton
2020-12-22 19:58 incoming Andrew Morton
2020-12-22 21:43 ` incoming Linus Torvalds
2020-12-18 22:00 incoming Andrew Morton
2020-12-16 4:41 incoming Andrew Morton
2020-12-15 20:32 incoming Andrew Morton
2020-12-15 21:00 ` incoming Linus Torvalds
2020-12-15 22:48 ` incoming Linus Torvalds
2020-12-15 22:49 ` incoming Linus Torvalds
2020-12-15 22:55 ` incoming Andrew Morton
2020-12-11 21:35 incoming Andrew Morton
2020-12-06 6:14 incoming Andrew Morton
2020-11-22 6:16 incoming Andrew Morton
2020-11-14 6:51 incoming Andrew Morton
2020-11-02 1:06 incoming Andrew Morton
2020-10-17 23:13 incoming Andrew Morton
2020-10-16 2:40 incoming Andrew Morton
2020-10-16 3:03 ` incoming Andrew Morton
2020-10-13 23:46 incoming Andrew Morton
2020-10-11 6:15 incoming Andrew Morton
2020-10-03 5:20 incoming Andrew Morton
2020-09-26 4:17 incoming Andrew Morton
2020-09-19 4:19 incoming Andrew Morton
2020-09-04 23:34 incoming Andrew Morton
2020-08-21 0:41 incoming Andrew Morton
2020-08-15 0:29 incoming Andrew Morton
2020-08-12 1:29 incoming Andrew Morton
2020-08-07 6:16 incoming Andrew Morton
2020-07-24 4:14 incoming Andrew Morton
2020-07-03 22:14 incoming Andrew Morton
2020-06-26 3:28 incoming Andrew Morton
2020-06-26 6:51 ` incoming Linus Torvalds
2020-06-26 7:31 ` incoming Linus Torvalds
2020-06-26 17:39 ` incoming Konstantin Ryabitsev
2020-06-26 17:40 ` incoming Konstantin Ryabitsev
2020-06-12 0:30 incoming Andrew Morton
2020-06-11 1:40 incoming Andrew Morton
2020-06-09 4:29 incoming Andrew Morton
2020-06-09 16:58 ` incoming Linus Torvalds
2020-06-08 4:35 incoming Andrew Morton
2020-06-04 23:45 incoming Andrew Morton
2020-06-03 22:55 incoming Andrew Morton
2020-06-02 20:09 incoming Andrew Morton
2020-06-02 4:44 incoming Andrew Morton
2020-06-02 20:08 ` incoming Andrew Morton
2020-06-02 20:45 ` incoming Linus Torvalds
2020-06-02 21:38 ` incoming Andrew Morton
2020-06-02 22:18 ` incoming Linus Torvalds
2020-05-28 5:20 incoming Andrew Morton
2020-05-28 20:10 ` incoming Linus Torvalds
2020-05-29 20:31 ` incoming Andrew Morton
2020-05-29 20:38 ` incoming Linus Torvalds
2020-05-29 21:12 ` incoming Andrew Morton
2020-05-29 21:20 ` incoming Linus Torvalds
2020-05-23 5:22 incoming Andrew Morton
2020-05-14 0:50 incoming Andrew Morton
2020-05-08 1:35 incoming Andrew Morton
2020-04-21 1:13 incoming Andrew Morton
2020-04-12 7:41 incoming Andrew Morton
2020-04-10 21:30 incoming Andrew Morton
2020-04-07 3:02 incoming Andrew Morton
2020-04-02 4:01 incoming Andrew Morton
2020-03-29 2:14 incoming Andrew Morton
2020-03-22 1:19 incoming Andrew Morton
2020-03-06 6:27 incoming Andrew Morton
2020-02-21 4:00 incoming Andrew Morton
2020-02-21 4:03 ` incoming Andrew Morton
2020-02-21 18:21 ` incoming Linus Torvalds
2020-02-21 18:32 ` incoming Konstantin Ryabitsev
2020-02-27 9:59 ` incoming Vlastimil Babka
2020-02-21 19:33 ` incoming Linus Torvalds
2020-02-04 1:33 incoming Andrew Morton
2020-02-04 2:27 ` incoming Linus Torvalds
2020-02-04 2:46 ` incoming Andrew Morton
2020-02-04 3:11 ` incoming Linus Torvalds
2020-01-31 6:10 incoming Andrew Morton
2020-01-14 0:28 incoming Andrew Morton
2020-01-04 20:55 incoming Andrew Morton
2019-12-18 4:50 incoming Andrew Morton
2019-12-05 0:48 incoming Andrew Morton
2019-12-01 1:47 incoming Andrew Morton
2019-12-01 5:17 ` incoming James Bottomley
2019-12-01 21:07 ` incoming Linus Torvalds
2019-12-02 8:21 ` incoming Steven Price
2019-11-22 1:53 incoming Andrew Morton
2019-11-16 1:34 incoming Andrew Morton
2019-11-06 5:16 incoming Andrew Morton
2019-10-19 3:19 incoming Andrew Morton
2019-10-14 21:11 incoming Andrew Morton
2019-10-07 0:57 incoming Andrew Morton
2019-09-25 23:45 incoming Andrew Morton
2019-09-23 22:31 incoming Andrew Morton
2019-09-24 0:55 ` incoming Linus Torvalds
2019-09-24 4:31 ` incoming Andrew Morton
2019-09-24 7:48 ` incoming Michal Hocko
2019-09-24 15:34 ` incoming Linus Torvalds
2019-09-25 6:36 ` incoming Michal Hocko
2019-09-24 19:55 ` incoming Vlastimil Babka
2019-08-30 23:04 incoming Andrew Morton
2019-08-25 0:54 incoming Andrew Morton
[not found] <20190716162536.bb52b8f34a8ecf5331a86a42@linux-foundation.org>
2019-07-17 8:47 ` incoming Vlastimil Babka
2019-07-17 8:57 ` incoming Bhaskar Chowdhury
2019-07-17 16:13 ` incoming Linus Torvalds
2019-07-17 17:09 ` incoming Christian Brauner
2019-07-17 18:13 ` incoming Vlastimil Babka
2007-05-02 22:02 incoming Andrew Morton
2007-05-02 22:31 ` incoming Benjamin Herrenschmidt
2007-05-03 7:55 ` incoming Russell King
2007-05-03 8:05 ` incoming Andrew Morton
2007-05-04 13:37 ` incoming Greg KH
2007-05-04 16:14 ` incoming Andrew Morton
2007-05-04 17:02 ` incoming Greg KH
2007-05-04 18:57 ` incoming Roland McGrath
2007-05-04 19:24 ` incoming Greg KH
2007-05-04 19:29 ` incoming Roland McGrath
This is a public inbox, see mirroring instructions
for how to clone and mirror all data and code used for this inbox