Linux MM tree latest commits
 help / color / mirror / Atom feed
* incoming
@ 2016-05-05 23:21 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-05 23:21 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 987 bytes --]

14 fixes, based on c5e0666c5a3ccabdf16bb88451886cdf81849b66:

Subject: mm: thp: correct split_huge_pages file permission
Subject: mm: memcontrol: let v2 cgroups follow changes in system swappiness
Subject: rapidio/mport_cdev: fix uapi type definitions
Subject: huge pagecache: mmap_sem is unlocked when truncation splits pmd
Subject: mm: update min_free_kbytes from khugepaged after core initialization
Subject: mm, cma: prevent nr_isolated_* counters from going negative
Subject: MAINTAINERS: fix Rajendra Nayak's address
Subject: mm: thp: kvm: fix memory corruption in KVM with THP enabled
Subject: mm/zswap: provide unique zpool name
Subject: proc: prevent accessing /proc/<PID>/environ until it's ready
Subject: modpost: fix module autoloading for OF devices with generic compatible property
Subject: mm: fix kcompactd hang during memory offlining
Subject: lib/stackdepot: avoid to return 0 handle
Subject: byteswap: try to avoid __builtin_constant_p gcc bug





[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-05-09 23:28 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-09 23:28 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 302 bytes --]

3 fixes, based on 44549e8f5eea4e0a41b487b63e616cb089922b99:

Subject: Revert "proc/base: make prompt shell start from new line after executing "cat /proc/$pid/wchan""
Subject: zsmalloc: fix zs_can_compact() integer overflow
Subject: compiler-gcc: require gcc 4.8 for powerpc __builtin_bswap16()


[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-05-12 22:41 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-12 22:41 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 344 bytes --]

4 fixes, based on 422ce5a97570cb8a37d016b6bc2021ae4dac5499:

Subject: ocfs2: revert using ocfs2_acl_chmod to avoid inode cluster lock hang
Subject: ocfs2: fix posix_acl_create deadlock
Subject: ksm: fix conflict between mmput and scan_get_next_rmap_item
Subject: mm: thp: calculate the mapcount correctly for THP pages during WP faults


[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-05-20  0:07 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-20  0:07 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 7864 bytes --]


- fsnotify fix

- poll() timeout fix

- a few scripts/ tweaks

- debugobjects updates

- the (small) ocfs2 queue

- Minor fixes to kernel/padata.c

- Maybe half of the MM queue

117 patches, based on 2600a46ee0ed57c0e0a382c2a37ebac64d374d20:

Subject: fsnotify: avoid spurious EMFILE errors from inotify_init()
Subject: time: add missing implementation for timespec64_add_safe()
Subject: fs: poll/select/recvmmsg: use timespec64 for timeout events
Subject: time: remove timespec_add_safe()
Subject: scripts/decode_stacktrace.sh: handle symbols in modules
Subject: scripts/spelling.txt: add "fimware" misspelling
Subject: scripts/bloat-o-meter: print percent change
Subject: debugobjects: make fixup functions return bool instead of int
Subject: debugobjects: correct the usage of fixup call results
Subject: workqueue: update debugobjects fixup callbacks return type
Subject: timer: update debugobjects fixup callbacks return type
Subject: rcu: update debugobjects fixup callbacks return type
Subject: percpu_counter: update debugobjects fixup callbacks return type
Subject: Documentation: update debugobjects doc
Subject: debugobjects: insulate non-fixup logic related to static obj from fixup callbacks
Subject: ocfs2: fix comment in struct ocfs2_extended_slot
Subject: ocfs2: clean up an unused variable 'wants_rotate' in ocfs2_truncate_rec
Subject: ocfs2: clean up unused parameter 'count' in o2hb_read_block_input()
Subject: ocfs2: clean up an unneeded goto in ocfs2_put_slot()
Subject: kernel/padata.c: removed unused code
Subject: kernel/padata.c: hide unused functions
Subject: mm/slab: fix the theoretical race by holding proper lock
Subject: mm/slab: remove BAD_ALIEN_MAGIC again
Subject: mm/slab: drain the free slab as much as possible
Subject: mm/slab: factor out kmem_cache_node initialization code
Subject: mm/slab: clean-up kmem_cache_node setup
Subject: mm/slab: don't keep free slabs if free_objects exceeds free_limit
Subject: mm/slab: racy access/modify the slab color
Subject: mm/slab: make cache_grow() handle the page allocated on arbitrary node
Subject: mm/slab: separate cache_grow() to two parts
Subject: mm/slab: refill cpu cache through a new slab without holding a node lock
Subject: mm/slab: lockless decision to grow cache
Subject: mm/slub.c: replace kick_all_cpus_sync() with synchronize_sched() in kmem_cache_shrink()
Subject: mm: SLAB freelist randomization
Subject: mm: slab: remove ZONE_DMA_FLAG
Subject: mm/slub.c: fix sysfs filename in comment
Subject: mm/page_ref: use page_ref helper instead of direct modification of _count
Subject: mm: rename _count, field of the struct page, to _refcount
Subject: compiler.h: add support for malloc attribute
Subject: include/linux: apply __malloc attribute
Subject: include/linux/nodemask.h: create next_node_in() helper
Subject: mm/hugetlb: optimize minimum size (min_size) accounting
Subject: mm/hugetlb: introduce hugetlb_bad_size()
Subject: arm64: mm: use hugetlb_bad_size()
Subject: metag: mm: use hugetlb_bad_size()
Subject: powerpc: mm: use hugetlb_bad_size()
Subject: tile: mm: use hugetlb_bad_size()
Subject: x86: mm: use hugetlb_bad_size()
Subject: mm/hugetlb: is_vm_hugetlb_page() can return bool
Subject: mm/memory_hotplug: is_mem_section_removable() can return bool
Subject: mm/vmalloc.c: is_vmalloc_addr() can return bool
Subject: mm/mempolicy.c: vma_migratable() can return bool
Subject: mm/memcontrol.c:mem_cgroup_select_victim_node(): clarify comment
Subject: mm/page_alloc: remove useless parameter of __free_pages_boot_core
Subject: mm/hugetlb.c: use first_memory_node
Subject: mm/mempolicy.c:offset_il_node() document and clarify
Subject: mm/rmap: replace BUG_ON(anon_vma->degree) with VM_WARN_ON
Subject: mm, compaction: wrap calculating first and last pfn of pageblock
Subject: mm, compaction: reduce spurious pcplist drains
Subject: mm, compaction: skip blocks where isolation fails in async direct compaction
Subject: mm/highmem: simplify is_highmem()
Subject: mm: uninline page_mapped()
Subject: mm/hugetlb: add same zone check in pfn_range_valid_gigantic()
Subject: mm/memory_hotplug: add comment to some functions related to memory hotplug
Subject: mm/vmstat: add zone range overlapping check
Subject: mm/page_owner: add zone range overlapping check
Subject: power: add zone range overlapping check
Subject: mm/writeback: correct dirty page calculation for highmem
Subject: mm/page_alloc: correct highmem memory statistics
Subject: mm/highmem: make nr_free_highpages() handles all highmem zones by itself
Subject: mm/vmstat: make node_page_state() handles all zones by itself
Subject: mm/mmap: kill hook arch_rebalance_pgtables()
Subject: mm: update_lru_size warn and reset bad lru_size
Subject: mm: update_lru_size do the __mod_zone_page_state
Subject: mm: use __SetPageSwapBacked and dont ClearPageSwapBacked
Subject: tmpfs: preliminary minor tidyups
Subject: tmpfs: mem_cgroup charge fault to vm_mm not current mm
Subject: mm: /proc/sys/vm/stat_refresh to force vmstat update
Subject: huge mm: move_huge_pmd does not need new_vma
Subject: huge pagecache: extend mremap pmd rmap lockout to files
Subject: arch: fix has_transparent_hugepage()
Subject: memory_hotplug: introduce CONFIG_MEMORY_HOTPLUG_DEFAULT_ONLINE
Subject: memory_hotplug: introduce memhp_default_state= command line parameter
Subject: mm, oom: move GFP_NOFS check to out_of_memory
Subject: oom, oom_reaper: try to reap tasks which skip regular OOM killer path
Subject: mm, oom_reaper: clear TIF_MEMDIE for all tasks queued for oom_reaper
Subject: mm, page_alloc: only check PageCompound for high-order pages
Subject: mm, page_alloc: use new PageAnonHead helper in the free page fast path
Subject: mm, page_alloc: reduce branches in zone_statistics
Subject: mm, page_alloc: inline zone_statistics
Subject: mm, page_alloc: inline the fast path of the zonelist iterator
Subject: mm, page_alloc: use __dec_zone_state for order-0 page allocation
Subject: mm, page_alloc: avoid unnecessary zone lookups during pageblock operations
Subject: mm, page_alloc: convert alloc_flags to unsigned
Subject: mm, page_alloc: convert nr_fair_skipped to bool
Subject: mm, page_alloc: remove unnecessary local variable in get_page_from_freelist
Subject: mm, page_alloc: remove unnecessary initialisation in get_page_from_freelist
Subject: mm, page_alloc: remove unnecessary initialisation from __alloc_pages_nodemask()
Subject: mm, page_alloc: simplify last cpupid reset
Subject: mm, page_alloc: move __GFP_HARDWALL modifications out of the fastpath
Subject: mm, page_alloc: check once if a zone has isolated pageblocks
Subject: mm, page_alloc: shorten the page allocator fast path
Subject: mm, page_alloc: reduce cost of fair zone allocation policy retry
Subject: mm, page_alloc: shortcut watermark checks for order-0 pages
Subject: mm, page_alloc: avoid looking up the first zone in a zonelist twice
Subject: mm, page_alloc: remove field from alloc_context
Subject: mm, page_alloc: check multiple page fields with a single branch
Subject: mm, page_alloc: un-inline the bad part of free_pages_check
Subject: mm, page_alloc: pull out side effects from free_pages_check
Subject: mm, page_alloc: remove unnecessary variable from free_pcppages_bulk
Subject: mm, page_alloc: inline pageblock lookup in page free fast paths
Subject: cpuset: use static key better and convert to new API
Subject: mm, page_alloc: defer debugging checks of freed pages until a PCP drain
Subject: mm, page_alloc: defer debugging checks of pages allocated from the PCP
Subject: mm, page_alloc: don't duplicate code in free_pcp_prepare
Subject: mm, page_alloc: uninline the bad page part of check_new_page()
Subject: mm, page_alloc: restore the original nodemask if the fast path allocation failed




[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-05-20 23:55 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-20 23:55 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 297 bytes --]


- the rest of MM

- KASAN updates

- procfs updates

- exit, fork updates

- printk updates

- lib/ updates

- radix-tree testsuite updates

- checkpatch updates

- kprobes updates

- a few other misc bits

162 patches, based on 6eb59af580dcffc6f6982ac8ef6d27a1a5f26b27



[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-05-23 23:21 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-23 23:21 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 5691 bytes --]


- Please have a think about Oleg's "wait/ptrace: assume __WALL if the
  child is traced".  It's a kernel-based workaround for existing
  userspace issues and is a form of non-back-compatible change.

- A few hotfixes

- befs cleanups

- nilfs2 updates

- sys_wait() changes

- kexec updates

- kdump

- scripts/gdb updates

- the last of the MM queue

- a few other misc things

84 patches, based on 7639dad93a5564579987abded4ec05e3db13659d:

Subject: m32r: fix build failure
Subject: : ELF/MIPS build fix
Subject: mm: memcontrol: fix possible css ref leak on oom
Subject: fs/befs/datastream.c:befs_read_datastream(): remove unneeded initialization to NULL
Subject: fs/befs/datastream.c:befs_read_lsymlink(): remove unneeded initialization to NULL
Subject: fs/befs/datastream.c:befs_find_brun_dblindirect(): remove unneeded initializations to NULL
Subject: fs/befs/linuxvfs.c:befs_get_block(): remove unneeded initialization to NULL
Subject: fs/befs/linuxvfs.c:befs_iget(): remove unneeded initialization to NULL
Subject: fs/befs/linuxvfs.c:befs_iget(): remove unneeded raw_inode initialization to NULL
Subject: fs/befs/linuxvfs.c:befs_iget(): remove unneeded befs_nio initialization to NULL
Subject: fs/befs/io.c:befs_bread_iaddr(): remove unneeded initialization to NULL
Subject: fs/befs/io.c:befs_bread(): remove unneeded initialization to NULL
Subject: nilfs2: constify nilfs_sc_operations structures
Subject: nilfs2: fix white space issue in nilfs_mount()
Subject: nilfs2: remove space before comma
Subject: nilfs2: remove FSF mailing address from GPL notices
Subject: nilfs2: clean up old e-mail addresses
Subject: MAINTAINERS: add web link for nilfs project
Subject: nilfs2: clarify permission to replicate the design
Subject: nilfs2: get rid of nilfs_mdt_mark_block_dirty()
Subject: nilfs2: move cleanup code of metadata file from inode routines
Subject: nilfs2: replace __attribute__((packed)) with __packed
Subject: nilfs2: add missing line spacing
Subject: nilfs2: clean trailing semicolons in macros
Subject: nilfs2: do not emit extra newline on nilfs_warning() and nilfs_error()
Subject: nilfs2: remove space before semicolon
Subject: nilfs2: fix code indent coding style issue
Subject: nilfs2: avoid bare use of 'unsigned'
Subject: nilfs2: remove unnecessary else after return or break
Subject: nilfs2: remove loops of single statement macros
Subject: nilfs2: fix block comments
Subject: wait/ptrace: assume __WALL if the child is traced
Subject: wait: allow sys_waitid() to accept __WNOTHREAD/__WCLONE/__WALL
Subject: signal: make oom_flags a bool
Subject: kernel/signal.c: convert printk(KERN_<LEVEL> ...) to pr_<level>(...)
Subject: signal: move the "sig < SIGRTMIN" check into siginmask(sig)
Subject: kernek/fork.c: allocate idle task for a CPU always on its local node
Subject: exec: remove the no longer needed remove_arg_zero()->free_arg_page()
Subject: kexec: introduce a protection mechanism for the crashkernel reserved memory
Subject: kexec: provide arch_kexec_protect(unprotect)_crashkres()
Subject: kexec: make a pair of map/unmap reserved pages in error path
Subject: kexec: do a cleanup for function kexec_load
Subject: s390/kexec: consolidate crash_map/unmap_reserved_pages() and arch_kexec_protect(unprotect)_crashkres()
Subject: kdump: fix gdb macros work work with newer and 64-bit kernels
Subject: rtsx_usb_ms: use schedule_timeout_idle() in polling loop
Subject: drivers/memstick/core/mspro_block: use kmemdup
Subject: arch/defconfig: remove CONFIG_RESOURCE_COUNTERS
Subject: scripts/gdb: Adjust module reference counter reported by lx-lsmod
Subject: scripts/gdb: provide linux constants
Subject: scripts/gdb: provide kernel list item generators
Subject: scripts/gdb: convert modules usage to lists functions
Subject: scripts/gdb: provide exception catching parser
Subject: scripts/gdb: support !CONFIG_MODULES gracefully
Subject: scripts/gdb: provide a dentry_name VFS path helper
Subject: scripts/gdb: add io resource readers
Subject: scripts/gdb: add mount point list command
Subject: scripts/gdb: add cpu iterators
Subject: scripts/gdb: cast CPU numbers to integer
Subject: scripts/gdb: add a Radix Tree Parser
Subject: scripts/gdb: add documentation example for radix tree
Subject: scripts/gdb: add lx_thread_info_by_pid helper
Subject: scripts/gdb: improve types abstraction for gdb python scripts
Subject: scripts/gdb: fix issue with dmesg.py and python 3.X
Subject: scripts/gdb: decode bytestream on dmesg for Python3
Subject: MAINTAINERS: add co-maintainer for scripts/gdb
Subject: mm: make mmap_sem for write waits killable for mm syscalls
Subject: mm: make vm_mmap killable
Subject: mm: make vm_munmap killable
Subject: mm, aout: handle vm_brk failures
Subject: mm, elf: handle vm_brk error
Subject: mm: make vm_brk killable
Subject: mm, proc: make clear_refs killable
Subject: mm, fork: make dup_mmap wait for mmap_sem for write killable
Subject: ipc, shm: make shmem attach/detach wait for mmap_sem killable
Subject: vdso: make arch_setup_additional_pages wait for mmap_sem for write killable
Subject: coredump: make coredump_wait wait for mmap_sem for write killable
Subject: aio: make aio_setup_ring killable
Subject: exec: make exec path waiting for mmap_sem killable
Subject: prctl: make PR_SET_THP_DISABLE wait for mmap_sem killable
Subject: uprobes: wait for mmap_sem for write killable
Subject: drm/i915: make i915_gem_mmap_ioctl wait for mmap_sem killable
Subject: drm/radeon: make radeon_mn_get wait for mmap_sem killable
Subject: drm/amdgpu: make amdgpu_mn_get wait for mmap_sem killable
Subject: kgdb: depends on VT




[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-05-26 22:15 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-26 22:15 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 706 bytes --]

10 fixes, based on ea8ea737c46cffa5d0ee74309f81e55a7e5e9c2a:

Subject: seqlock: fix raw_read_seqcount_latch()
Subject: mm: make CONFIG_DEFERRED_STRUCT_PAGE_INIT depends on !FLATMEM explicitly
Subject: mm: kasan: remove unused 'reserved' field from struct kasan_alloc_meta
Subject: mm: slub: remove unused virt_to_obj()
Subject: ocfs2: fix improper handling of return errno
Subject: memcg: fix mem_cgroup_out_of_memory() return value.
Subject: mm: oom_reaper: remove some bloat
Subject: dma-debug: avoid spinlock recursion when disabling dma-debug
Subject: update "mm/zsmalloc: don't fail if can't create debugfs info"
Subject: drivers/pinctrl/intel/pinctrl-baytrail.c: fix build with gcc-4.4


[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-05-27 21:26 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-27 21:26 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 1273 bytes --]


- late-breaking ocfs2 updates

- random bunch of fixes

19 patches, based on dc03c0f9d12d85286d5e3623aa96d5c2a271b8e6:

Subject: ocfs2: o2hb: add negotiate timer
Subject: ocfs2: o2hb: add NEGO_TIMEOUT message
Subject: ocfs2: o2hb: add NEGOTIATE_APPROVE message
Subject: ocfs2: o2hb: add some user/debug log
Subject: ocfs2: o2hb: don't negotiate if last hb fail
Subject: ocfs2: o2hb: fix hb hung time
Subject: ocfs2: bump up o2cb network protocol version
Subject: direct-io: fix direct write stale data exposure from concurrent buffered read
Subject: mm: oom: do not reap task if there are live threads in threadgroup
Subject: MAINTAINERS: add kexec_core.c and kexec_file.c
Subject: MAINTAINERS: Kdump maintainers update
Subject: mm: use early_pfn_to_nid in page_ext_init
Subject: mm: use early_pfn_to_nid in register_page_bootmem_info_node
Subject: oom_reaper: close race with exiting task
Subject: mm: thp: avoid false positive VM_BUG_ON_PAGE in page_move_anon_rmap()
Subject: mm/cma: silence warnings due to max() usage
Subject: mm/memcontrol.c: fix the margin computation in mem_cgroup_margin()
Subject: mm/memcontrol.c: move comments for get_mctgt_type() to proper position
Subject: mm: disable DEFERRED_STRUCT_PAGE_INIT on !NO_BOOTMEM




[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-06-03 21:51 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-06-03 21:51 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 880 bytes --]

11 fixes, based on 4340fa55298d17049e71c7a34e04647379c269f3:

Subject: mm: fix overflow in vm_map_ram()
Subject: kdump: fix dmesg gdbmacro to work with record based printk
Subject: mm: check the return value of lookup_page_ext for all call sites
Subject: reiserfs: avoid uninitialized variable use
Subject: memcg: add RCU locking around css_for_each_descendant_pre() in memcg_offline_kmem()
Subject: mm/z3fold.c: avoid modifying HEADLESS page and minor cleanup
Subject: checkpatch: reduce git commit description style false positives
Subject: mm, page_alloc: prevent infinite loop in buffered_rmqueue()
Subject: mm, oom_reaper: do not use siglock in try_oom_reaper()
Subject: mm, page_alloc: reset zonelist iterator after resetting fair zone allocation policy
Subject: mm, page_alloc: recalculate the preferred zoneref if the context can ignore memory policies




[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-06-08 22:33 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-06-08 22:33 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 552 bytes --]

7 fixes, based on c8ae067f2635be0f8c7e5db1bb74b757d623e05b:

Subject: mm/hugetlb: fix huge page reserve accounting for private mappings
Subject: kasan: change memory hot-add error messages to info messages
Subject: revert "mm: memcontrol: fix possible css ref leak on oom"
Subject: mm: thp: broken page count after commit aa88b68c
Subject: kernel/relay.c: fix potential memory leak
Subject: mm: introduce dedicated WQ_MEM_RECLAIM workqueue to do lru_add_drain_all
Subject: mm/fadvise.c: do not discard partial pages with POSIX_FADV_DONTNEED


[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-06-24 21:48 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-06-24 21:48 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 2596 bytes --]


Two weeks worth of fixes here.

41 fixes, based on 63c04ee7d3b7c8d8e2726cb7c5f8a5f6fcc1e3b2:

Subject: mm,oom_reaper: don't call mmput_async() without atomic_inc_not_zero()
Subject: oom_reaper: avoid pointless atomic_inc_not_zero usage.
Subject: selftests/vm/compaction_test: fix write to restore nr_hugepages
Subject: tmpfs: don't undo fallocate past its last page
Subject: tree wide: get rid of __GFP_REPEAT for order-0 allocations part I
Subject: x86: get rid of superfluous __GFP_REPEAT
Subject: x86/efi: get rid of superfluous __GFP_REPEAT
Subject: arm64: get rid of superfluous __GFP_REPEAT
Subject: arc: get rid of superfluous __GFP_REPEAT
Subject: mips: get rid of superfluous __GFP_REPEAT
Subject: nios2: get rid of superfluous __GFP_REPEAT
Subject: parisc: get rid of superfluous __GFP_REPEAT
Subject: score: get rid of superfluous __GFP_REPEAT
Subject: powerpc: get rid of superfluous __GFP_REPEAT
Subject: sparc: get rid of superfluous __GFP_REPEAT
Subject: s390: get rid of superfluous __GFP_REPEAT
Subject: sh: get rid of superfluous __GFP_REPEAT
Subject: tile: get rid of superfluous __GFP_REPEAT
Subject: unicore32: get rid of superfluous __GFP_REPEAT
Subject: jbd2: get rid of superfluous __GFP_REPEAT
Subject: MAINTAINERS: update Calgary IOMMU
Subject: mm: mempool: kasan: don't poot mempool objects in quarantine
Subject: mm, sl[au]b: add __GFP_ATOMIC to the GFP reclaim mask
Subject: mailmap: add Antoine Tenart's email
Subject: mailmap: add Boris Brezillon's email
Subject: Revert "mm: make faultaround produce old ptes"
Subject: Revert "mm: disable fault around on emulated access bit architecture"
Subject: hugetlb: fix nr_pmds accounting with shared page tables
Subject: memcg: mem_cgroup_migrate() may be called with irq disabled
Subject: memcg: css_alloc should return an ERR_PTR value on error
Subject: mm/swap.c: flush lru pvecs on compound page arrival
Subject: mm/hugetlb: clear compound_mapcount when freeing gigantic pages
Subject: mm: prevent KASAN false positives in kmemleak
Subject: mm, compaction: abort free scanner if split fails
Subject: ocfs2: disable BUG assertions in reading blocks
Subject: oom, suspend: fix oom_reaper vs. oom_killer_disable race
Subject: fs/nilfs2: fix potential underflow in call to crc32_le
Subject: tools/vm/slabinfo: fix spelling mistake: "Ocurrences" -> "Occurrences"
Subject: mm/page_owner: avoid null pointer dereference
Subject: autofs: don't get stuck in a loop if vfs_write() returns an error
Subject: init/main.c: fix initcall_blacklisted on ia64, ppc64 and parisc64





[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-07-14 19:06 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-07-14 19:06 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 1338 bytes --]

20 fixes, based on f97d10454e4da2aceb44dfa7c59bb43ba9f50199:

Subject: mm, compaction: prevent VM_BUG_ON when terminating freeing scanner
Subject: kasan: add newline to messages
Subject: scripts/gdb: silence 'nothing to do' message
Subject: scripts/gdb: rebuild constants.py on dependancy change
Subject: scripts/gdb: add constants.py to .gitignore
Subject: scripts/gdb: Perform path expansion to lx-symbol's arguments
Subject: Revert "scripts/gdb: add a Radix Tree Parser"
Subject: Revert "scripts/gdb: add documentation example for radix tree"
Subject: madvise_free, thp: fix madvise_free_huge_pmd return value after splitting
Subject: uapi: export lirc.h header
Subject: kasan/quarantine: fix bugs on qlist_move_cache()
Subject: mm, meminit: always return a valid node from early_pfn_to_nid
Subject: mm, meminit: ensure node is online before checking whether pages are uninitialised
Subject: gcov: add support for gcc version >= 6
Subject: vmlinux.lds: account for destructor sections
Subject: mm: thp: move pmd check inside ptl for freeze_page()
Subject: mm: rmap: call page_check_address() with sync enabled to avoid racy check
Subject: mm: thp: refix false positive BUG in page_move_anon_rmap()
Subject: mm: workingset: printk missing log level, use pr_info()
Subject: m32r: fix build warning about putc




[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-07-20 22:44 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-07-20 22:44 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 378 bytes --]

5 fixes, based on 47ef4ad2684d380dd6d596140fb79395115c3950:

Subject: mm: memcontrol: fix cgroup creation failure after many small jobs
Subject: radix-tree: fix radix_tree_iter_retry() for tagged iterators.
Subject: testing/radix-tree: fix a macro expansion bug
Subject: tools/vm/slabinfo: fix an unintentional printf
Subject: pps: do not crash when failed to register


[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-07-26 22:16 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-07-26 22:16 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 7441 bytes --]


- a few misc bits

- ocfs2

- most(?) of MM


126 patches, based on e65805251f2db69c9f67ed8062ab82526be5a374:

Subject: arm: get rid of superfluous __GFP_REPEAT
Subject: dax: some small updates to dax.txt documentation
Subject: dax: remote unused fault wrappers
Subject: dma-debug: track bucket lock state for static checkers
Subject: fbmon: remove unused function argument
Subject: CFLAGS: add -Wunused-but-set-parameter
Subject: kbuild: abort build on bad stack protector flag
Subject: scripts/bloat-o-meter: fix percent on <1% changes
Subject: m32r: add __ucmpdi2 to fix build failure
Subject: debugobjects.h: fix trivial kernel doc warning
Subject: ocfs2: fix a redundant re-initialization
Subject: ocfs2: improve recovery performance
Subject: ocfs2: cleanup unneeded goto in ocfs2_create_new_inode_locks
Subject: ocfs2/dlm: fix memory leak of dlm_debug_ctxt
Subject: ocfs2: cleanup implemented prototypes
Subject: ocfs2: remove obscure BUG_ON in dlmglue
Subject: ocfs2/cluster: clean up unnecessary assignment for 'ret'
Subject: fs/fs-writeback.c: add a new writeback list for sync
Subject: fs/fs-writeback.c: inode writeback list tracking tracepoints
Subject: mm: reorganize SLAB freelist randomization
Subject: mm: SLUB freelist randomization
Subject: slab: make GFP_SLAB_BUG_MASK information more human readable
Subject: slab: do not panic on invalid gfp_mask
Subject: mm: faster kmalloc_array(), kcalloc()
Subject: mm/slab: use list_move instead of list_del/list_add
Subject: mm/memcontrol.c: remove the useless parameter for mc_handle_swap_pte
Subject: mm/init: fix zone boundary creation
Subject: memory-hotplug: add move_pfn_range()
Subject: memory-hotplug: more general validation of zone during online
Subject: memory-hotplug: use zone_can_shift() for sysfs valid_zones attribute
Subject: mm: zap ZONE_OOM_LOCKED
Subject: mm: oom: add memcg to oom_control
Subject: include/linux/mmdebug.h: add VM_WARN which maps to WARN()
Subject: powerpc/mm: check for irq disabled() only if DEBUG_VM is enabled
Subject: zram: rename zstrm find-release functions
Subject: zram: switch to crypto compress API
Subject: zram: use crypto api to check alg availability
Subject: zram: cosmetic: cleanup documentation
Subject: zram: delete custom lzo/lz4
Subject: zram: add more compression algorithms
Subject: zram: drop gfp_t from zcomp_strm_alloc()
Subject: mm: use put_page() to free page instead of putback_lru_page()
Subject: mm: migrate: support non-lru movable page migration
Subject: mm: balloon: use general non-lru movable page feature
Subject: zsmalloc: keep max_object in size_class
Subject: zsmalloc: use bit_spin_lock
Subject: zsmalloc: use accessor
Subject: zsmalloc: factor page chain functionality out
Subject: zsmalloc: introduce zspage structure
Subject: zsmalloc: separate free_zspage from putback_zspage
Subject: zsmalloc: use freeobj for index
Subject: zsmalloc: page migration support
Subject: zram: use __GFP_MOVABLE for memory allocation
Subject: zsmalloc: use OBJ_TAG_BIT for bit shifter
Subject: mm/compaction: split freepages without holding the zone lock
Subject: mm/page_owner: initialize page owner without holding the zone lock
Subject: mm/page_owner: copy last_migrate_reason in copy_page_owner()
Subject: mm/page_owner: introduce split_page_owner and replace manual handling
Subject: tools/vm/page_owner: increase temporary buffer size
Subject: mm/page_owner: use stackdepot to store stacktrace
Subject: mm/page_alloc: introduce post allocation processing on page allocator
Subject: mm/page_isolation: clean up confused code
Subject: mm: thp: check pmd_trans_unstable() after split_huge_pmd()
Subject: mm/hugetlb: simplify hugetlb unmap
Subject: mm: change the interface for __tlb_remove_page()
Subject: mm/mmu_gather: track page size with mmu gather and force flush if page size change
Subject: mm: remove pointless struct in struct page definition
Subject: mm: clean up non-standard page->_mapcount users
Subject: mm: memcontrol: cleanup kmem charge functions
Subject: mm: charge/uncharge kmemcg from generic page allocator paths
Subject: mm: memcontrol: teach uncharge_list to deal with kmem pages
Subject: arch: x86: charge page tables to kmemcg
Subject: pipe: account to kmemcg
Subject: af_unix: charge buffers to kmemcg
Subject: mm,oom: remove unused argument from oom_scan_process_thread().
Subject: mm, frontswap: convert frontswap_enabled to static key
Subject: mm: add NR_ZSMALLOC to vmstat
Subject: include/linux/memblock.h: Clean up code for several trivial details
Subject: mm, oom_reaper: make sure that mmput_async is called only when memory was reaped
Subject: mm, memcg: use consistent gfp flags during readahead
Subject: mm/memblock.c:memblock_add_range(): if nr_new is 0 just return
Subject: mm: make optimistic check for swapin readahead
Subject: mm: make swapin readahead to improve thp collapse rate
Subject: mm, thp: make swapin readahead under down_read of mmap_sem
Subject: mm, thp: fix locking inconsistency in collapse_huge_page
Subject: khugepaged: recheck pmd after mmap_sem re-acquired
Subject: thp, mlock: update unevictable-lru.txt
Subject: mm: do not pass mm_struct into handle_mm_fault
Subject: mm: introduce fault_env
Subject: mm: postpone page table allocation until we have page to map
Subject: rmap: support file thp
Subject: mm: introduce do_set_pmd()
Subject: thp, vmstats: add counters for huge file pages
Subject: thp: support file pages in zap_huge_pmd()
Subject: thp: handle file pages in split_huge_pmd()
Subject: thp: handle file COW faults
Subject: thp: skip file huge pmd on copy_huge_pmd()
Subject: thp: prepare change_huge_pmd() for file thp
Subject: thp: run vma_adjust_trans_huge() outside i_mmap_rwsem
Subject: thp: file pages support for split_huge_page()
Subject: thp, mlock: do not mlock PTE-mapped file huge pages
Subject: vmscan: split file huge pages before paging them out
Subject: page-flags: relax policy for PG_mappedtodisk and PG_reclaim
Subject: radix-tree: implement radix_tree_maybe_preload_order()
Subject: filemap: prepare find and delete operations for huge pages
Subject: truncate: handle file thp
Subject: mm, rmap: account shmem thp pages
Subject: shmem: prepare huge= mount option and sysfs knob
Subject: shmem: get_unmapped_area align huge page
Subject: shmem: add huge pages support
Subject: shmem, thp: respect MADV_{NO,}HUGEPAGE for file mappings
Subject: thp: extract khugepaged from mm/huge_memory.c
Subject: khugepaged: move up_read(mmap_sem) out of khugepaged_alloc_page()
Subject: shmem: make shmem_inode_info::lock irq-safe
Subject: khugepaged: add support of collapse for tmpfs/shmem pages
Subject: thp: introduce CONFIG_TRANSPARENT_HUGE_PAGECACHE
Subject: shmem: split huge pages beyond i_size under memory pressure
Subject: thp: update Documentation/{vm/transhuge,filesystems/proc}.txt
Subject: mm, thp: fix comment inconsistency for swapin readahead functions
Subject: mm, thp: convert from optimistic swapin collapsing to conservative
Subject: mm: fix build warnings in <linux/compaction.h>
Subject: mm: memcontrol: remove BUG_ON in uncharge_list
Subject: mm: memcontrol: fix documentation for compound parameter
Subject: cgroup: fix idr leak for the first cgroup root
Subject: cgroup: remove unnecessary 0 check from css_from_id()
Subject: thp: fix comments of __pmd_trans_huge_lock()


[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-07-28 22:42 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-07-28 22:42 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 6861 bytes --]


- the rest of MM

101 patches, based on 194dc870a5890e855ecffb30f3b80ba7c88f96d6:

Subject: proc, oom: drop bogus task_lock and mm check
Subject: proc, oom: drop bogus sighand lock
Subject: proc, oom_adj: extract oom_score_adj setting into a helper
Subject: mm, oom_adj: make sure processes sharing mm have same view of oom_score_adj
Subject: mm, oom: skip vforked tasks from being selected
Subject: mm, oom: kill all tasks sharing the mm
Subject: mm, oom: fortify task_will_free_mem()
Subject: mm, oom: task_will_free_mem should skip oom_reaped tasks
Subject: mm, oom_reaper: do not attempt to reap a task more than twice
Subject: mm, oom: hide mm which is shared with kthread or global init
Subject: mm, oom: tighten task_will_free_mem() locking
Subject: mm: update the comment in __isolate_free_page
Subject: mm: fix vm-scalability regression in cgroup-aware workingset code
Subject: mm/compaction: remove unnecessary order check in try_to_compact_pages()
Subject: freezer, oom: check TIF_MEMDIE on the correct task
Subject: cpuset, mm: fix TIF_MEMDIE check in cpuset_change_task_nodemask
Subject: mm, meminit: remove early_page_nid_uninitialised
Subject: mm, vmstat: add infrastructure for per-node vmstats
Subject: mm, vmscan: move lru_lock to the node
Subject: mm, vmscan: move LRU lists to node
Subject: mm, mmzone: clarify the usage of zone padding
Subject: mm, vmscan: begin reclaiming pages on a per-node basis
Subject: mm, vmscan: have kswapd only scan based on the highest requested zone
Subject: mm, vmscan: make kswapd reclaim in terms of nodes
Subject: mm, vmscan: remove balance gap
Subject: mm, vmscan: simplify the logic deciding whether kswapd sleeps
Subject: mm, vmscan: by default have direct reclaim only shrink once per node
Subject: mm, vmscan: remove duplicate logic clearing node congestion and dirty state
Subject: mm: vmscan: do not reclaim from kswapd if there is any eligible zone
Subject: mm, vmscan: make shrink_node decisions more node-centric
Subject: mm, memcg: move memcg limit enforcement from zones to nodes
Subject: mm, workingset: make working set detection node-aware
Subject: mm, page_alloc: consider dirtyable memory in terms of nodes
Subject: mm: move page mapped accounting to the node
Subject: mm: rename NR_ANON_PAGES to NR_ANON_MAPPED
Subject: mm: move most file-based accounting to the node
Subject: mm: move vmscan writes and file write accounting to the node
Subject: mm, vmscan: only wakeup kswapd once per node for the requested classzone
Subject: mm, page_alloc: wake kswapd based on the highest eligible zone
Subject: mm: convert zone_reclaim to node_reclaim
Subject: mm, vmscan: avoid passing in classzone_idx unnecessarily to shrink_node
Subject: mm, vmscan: avoid passing in classzone_idx unnecessarily to compaction_ready
Subject: mm, vmscan: avoid passing in `remaining' unnecessarily to prepare_kswapd_sleep()
Subject: mm, vmscan: Have kswapd reclaim from all zones if reclaiming and buffer_heads_over_limit
Subject: mm, vmscan: add classzone information to tracepoints
Subject: mm, page_alloc: remove fair zone allocation policy
Subject: mm: page_alloc: cache the last node whose dirty limit is reached
Subject: mm: vmstat: replace __count_zone_vm_events with a zone id equivalent
Subject: mm: vmstat: account per-zone stalls and pages skipped during reclaim
Subject: mm, vmstat: print node-based stats in zoneinfo file
Subject: mm, vmstat: remove zone and node double accounting by approximating retries
Subject: mm, page_alloc: fix dirtyable highmem calculation
Subject: mm, pagevec: release/reacquire lru_lock on pgdat change
Subject: mm: show node_pages_scanned per node, not zone
Subject: mm, vmscan: Update all zone LRU sizes before updating memcg
Subject: mm, vmscan: remove redundant check in shrink_zones()
Subject: mm, vmscan: release/reacquire lru_lock on pgdat change
Subject: mm: add per-zone lru list stat
Subject: mm, vmscan: remove highmem_file_pages
Subject: mm: remove reclaim and compaction retry approximations
Subject: mm: consider whether to decivate based on eligible zones inactive ratio
Subject: mm, vmscan: account for skipped pages as a partial scan
Subject: mm: bail out in shrink_inactive_list()
Subject: mm/zsmalloc: use obj_index to keep consistent with others
Subject: mm/zsmalloc: take obj index back from find_alloced_obj
Subject: mm/zsmalloc: use class->objs_per_zspage to get num of max objects
Subject: mm/zsmalloc: avoid calculate max objects of zspage twice
Subject: mm/zsmalloc: keep comments consistent with code
Subject: mm/zsmalloc: add __init,__exit attribute
Subject: mm/zsmalloc: use helper to clear page->flags bit
Subject: mm, THP: clean up return value of madvise_free_huge_pmd
Subject: memblock: include <asm/sections.h> instead of <asm-generic/sections.h>
Subject: mm: CONFIG_ZONE_DEVICE stop depending on CONFIG_EXPERT
Subject: mm: cleanup ifdef guards for vmem_altmap
Subject: mm: track NR_KERNEL_STACK in KiB instead of number of stacks
Subject: mm: fix memcg stack accounting for sub-page stacks
Subject: kdb: use task_cpu() instead of task_thread_info()->cpu
Subject: printk: when dumping regs, show the stack, not thread_info
Subject: mm/memblock.c: add new infrastructure to address the mem limit issue
Subject: arm64:acpi: fix the acpi alignment exception when 'mem=' specified
Subject: kmemleak: don't hang if user disables scanning early
Subject: make __section_nr() more efficient
Subject: mm: hwpoison: remove incorrect comments
Subject: mm, compaction: don't isolate PageWriteback pages in MIGRATE_SYNC_LIGHT mode
Subject: Revert "mm, mempool: only set __GFP_NOMEMALLOC if there are free elements"
Subject: mm: add cond_resched() to generic_swapfile_activate()
Subject: mm: optimize copy_page_to/from_iter_iovec
Subject: mem-hotplug: alloc new page from a nearest neighbor node when mem-offline
Subject: mm/memblock.c: fix index adjustment error in  __next_mem_range_rev()
Subject: zsmalloc: Delete an unnecessary check before the function call "iput"
Subject: mm: fix use-after-free if memory allocation failed in vma_adjust()
Subject: mm, kasan: account for object redzone in SLUB's nearest_obj()
Subject: mm, kasan: switch SLUB to stackdepot, enable memory quarantine for SLUB
Subject: lib/stackdepot.c: use __GFP_NOWARN for stack allocations
Subject: mm, page_alloc: set alloc_flags only once in slowpath
Subject: mm, page_alloc: don't retry initial attempt in slowpath
Subject: mm, page_alloc: restructure direct compaction handling in slowpath
Subject: mm, page_alloc: make THP-specific decisions more generic
Subject: mm, thp: remove __GFP_NORETRY from khugepaged and madvised allocations
Subject: mm, compaction: introduce direct compaction priority
Subject: mm, compaction: simplify contended compaction handling




[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-08-02 21:01 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-08-02 21:01 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 7166 bytes --]


- the rest of ocfs2

- various hotfixes, mainly MM

- quite a bit of misc stuff - drivers, fork, exec, signals, etc.

- printk updates

- firmware

- checkpatch

- nilfs2

- more kexec stuff than usual

- rapidio updates

- w1 things


111 patches, based on f7b32e4c021fd788f13f6785e17efbc3eb05b351:

Subject: ocfs2: ensure that dlm lockspace is created by kernel module
Subject: ocfs2: retry on ENOSPC if sufficient space in truncate log
Subject: ocfs2/dlm: disable BUG_ON when DLM_LOCK_RES_DROPPING_REF is cleared before dlm_deref_lockres_done_handler
Subject: ocfs2/dlm: solve a BUG when deref failed in dlm_drop_lockres_ref
Subject: ocfs2/dlm: continue to purge recovery lockres when recovery master goes down
Subject: mm: fail prefaulting if page table allocation fails
Subject: mm: move swap-in anonymous page into active list
Subject: tools/testing/radix-tree/linux/gfp.h: fix bitrotted value
Subject: mm/hugetlb: avoid soft lockup in set_max_huge_pages()
Subject: mm, hugetlb: fix huge_pte_alloc BUG_ON
Subject: memcg: put soft limit reclaim out of way if the excess tree is empty
Subject: mm/kasan: fix corruptions and false positive reports
Subject: mm/kasan: don't reduce quarantine in atomic contexts
Subject: mm/kasan, slub: don't disable interrupts when object leaves quarantine
Subject: mm/kasan: get rid of ->alloc_size in struct kasan_alloc_meta
Subject: mm/kasan: get rid of ->state in struct kasan_alloc_meta
Subject: kasan: improve double-free reports
Subject: kasan: avoid overflowing quarantine size on low memory systems
Subject: radix-tree: account nodes to memcg only if explicitly requested
Subject: mm: vmscan: fix memcg-aware shrinkers not called on global reclaim
Subject: sysv, ipc: fix security-layer leaking
Subject: UBSAN: fix typo in format string
Subject: cgroup: update cgroup's document path
Subject: MAINTAINERS: befs: add new maintainers
Subject: proc_oom_score: remove tasklist_lock and pid_alive()
Subject: procfs: avoid 32-bit time_t in /proc/*/stat
Subject: fs/proc/task_mmu.c: suppress compilation warnings with W=1
Subject: init/Kconfig: make COMPILE_TEST depend on !UML
Subject: memstick: don't allocate unused major for ms_block
Subject: treewide: replace obsolete _refok by __ref
Subject: uapi: move forward declarations of internal structures
Subject: mailmap: add Linus L_ssing
Subject: include: mman: use bool instead of int for the return value of arch_validate_prot
Subject: task_work: use READ_ONCE/lockless_dereference, avoid pi_lock if !task_works
Subject: dynamic_debug: only add header when used
Subject: printk: do not include interrupt.h
Subject: printk: create pr_<level> functions
Subject: printk: introduce suppress_message_printing()
Subject: printk: include <asm/sections.h> instead of <asm-generic/sections.h>
Subject: fbdev/bfin_adv7393fb: move DRIVER_NAME before its first use
Subject: ratelimit: extend to print suppressed messages on release
Subject: printk: add kernel parameter to control writes to /dev/kmsg
Subject: get_maintainer.pl: reduce need for command-line option -f
Subject: lib/iommu-helper: skip to next segment
Subject: crc32: use ktime_get_ns() for measurement
Subject: radix-tree: fix comment about "exceptional" bits
Subject: firmware: consolidate kmap/read/write logic
Subject: firmware: provide infrastructure to make fw caching optional
Subject: firmware: support loading into a pre-allocated buffer
Subject: checkpatch: skip long lines that use an EFI_GUID macro
Subject: checkpatch: allow c99 style // comments
Subject: checkpatch: yet another commit id improvement
Subject: checkpatch: don't complain about BIT macro in uapi
Subject: checkpatch: improve 'bare use of' signed/unsigned types warning
Subject: checkpatch: check signoff when reading stdin
Subject: checkpatch: if no filenames then read stdin
Subject: binfmt_elf: fix calculations for bss padding
Subject: mm: refuse wrapped vm_brk requests
Subject: fs/binfmt_em86.c: fix incompatible pointer type
Subject: nilfs2: hide function name argument from nilfs_error()
Subject: nilfs2: add nilfs_msg() message interface
Subject: nilfs2: embed a back pointer to super block instance in nilfs object
Subject: nilfs2: reduce bare use of printk() with nilfs_msg()
Subject: nilfs2: replace nilfs_warning() with nilfs_msg()
Subject: nilfs2: emit error message when I/O error is detected
Subject: nilfs2: do not use yield()
Subject: nilfs2: refactor parser of snapshot mount option
Subject: nilfs2: fix misuse of a semaphore in sysfs code
Subject: nilfs2: use BIT() macro
Subject: nilfs2: move ioctl interface and disk layout to uapi separately
Subject: reiserfs: fix "new_insert_key may be used uninitialized ..."
Subject: signal: consolidate {TS,TLF}_RESTORE_SIGMASK code
Subject: kernel/exit.c: quieten greatest stack depth printk
Subject: cpumask: fix code comment
Subject: kexec: return error number directly
Subject: ARM: kdump: advertise boot aliased crash kernel resource
Subject: ARM: kexec: advertise location of bootable RAM
Subject: kexec: don't invoke OOM-killer for control page allocation
Subject: kexec: ensure user memory sizes do not wrap
Subject: kdump: arrange for paddr_vmcoreinfo_note() to return phys_addr_t
Subject: kexec: allow architectures to override boot mapping
Subject: ARM: keystone: dts: add psci command definition
Subject: ARM: kexec: fix kexec for Keystone 2
Subject: kexec: use core_param for crash_kexec_post_notifiers boot option
Subject: kexec: add a kexec_crash_loaded() function
Subject: kexec: allow kdump with crash_kexec_post_notifiers
Subject: kexec: add restriction on kexec_load() segment sizes
Subject: rapidio: add RapidIO channelized messaging driver
Subject: rapidio: remove unnecessary 0x prefixes before %pa extension uses
Subject: rapidio/documentation: fix mangled paragraph in mport_cdev
Subject: rapidio: fix return value description for dma_prep functions
Subject: rapidio/tsi721_dma: add channel mask and queue size parameters
Subject: rapidio/tsi721: add PCIe MRRS override parameter
Subject: rapidio/tsi721: add messaging mbox selector parameter
Subject: rapidio/tsi721_dma: advance queue processing from transfer submit call
Subject: rapidio: fix error handling in mbox request/release functions
Subject: rapidio/idt_gen2: fix locking warning
Subject: rapidio: change inbound window size type to u64
Subject: rapidio: modify for rev.3 specification changes
Subject: powerpc/fsl_rio: apply changes for RIO spec rev 3
Subject: rapidio/switches: add driver for IDT gen3 switches
Subject: w1: remove need for ida and use PLATFORM_DEVID_AUTO
Subject: w1: add helper macro module_w1_family
Subject: w1:omap_hdq: fix regression
Subject: init: allow blacklisting of module_init functions
Subject: relay: add global mode support for buffer-only channels
Subject: init/Kconfig: ban CONFIG_LOCALVERSION_AUTO with allmodconfig
Subject: config: add android config fragments
Subject: init/Kconfig: add clarification for out-of-tree modules
Subject: kcov: allow more fine-grained coverage instrumentation
Subject: ipc: delete "nr_ipc_ns"


[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-08-03 20:45 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-08-03 20:45 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 1288 bytes --]


- dma-mapping API cleanup

- a few cleanups and misc things

- use jump labels in dynamic-debug

18 patches, based on bf0f500bd0199aab613eb0ecb3412edd5472740d:

Subject: drivers/fpga/Kconfig: fix build failure
Subject: tree-wide: replace config_enabled() with IS_ENABLED()
Subject: include/linux/bitmap.h: cleanup
Subject: media: mtk-vcodec: remove unused dma_attrs
Subject: dma-mapping: use unsigned long for dma_attrs
Subject: samples/kprobe: convert the printk to pr_info/pr_err
Subject: samples/jprobe: convert the printk to pr_info/pr_err
Subject: samples/kretprobe: convert the printk to pr_info/pr_err
Subject: samples/kretprobe: fix the wrong type
Subject: block: remove BLK_DEV_DAX config option
Subject: MAINTAINERS: update email and list of Samsung HW driver maintainers
Subject: drivers/media/dvb-frontends/cxd2841er.c: avoid misleading gcc warning
Subject: powerpc: add explicit #include <asm/asm-compat.h> for jump label
Subject: sparc: support static_key usage in non-module __exit sections
Subject: tile: support static_key usage in non-module __exit sections
Subject: arm: jump label may reference text in __exit
Subject: jump_label: remove bug.h, atomic.h dependencies for HAVE_JUMP_LABEL
Subject: dynamic_debug: add jump label support




[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-08-04 22:31 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-08-04 22:31 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


A few late-breaking fixes.

7 fixes, based on c1ece76719205690f4b448460d9b85c130e8021b:

Subject: mm: disable CONFIG_MEMORY_HOTPLUG when KASAN is enabled
Subject: mm/memblock: fix a typo in a comment
Subject: mm: initialise per_cpu_nodestats for all online pgdats at boot
Subject: powerpc/fsl_rio: fix a missing error code
Subject: slub: drop bogus inline for fixup_red_left()
Subject: MAINTAINERS: update cgroup's document path
Subject: mm/memblock.c: fix NULL dereference error


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-08-11 22:32 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-08-11 22:32 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 579 bytes --]

7 fixes, based on 85e97be32c6242c98dbbc7a241b4a78c1b93327b:

Subject: mm/hugetlb: fix incorrect hugepages count during mem hotplug
Subject: proc, meminfo: use correct helpers for calculating LRU sizes in meminfo
Subject: mm: memcontrol: fix swap counter leak on swapout from offline cgroup
Subject: mm: memcontrol: fix memcg id ref counter on swap charge move
Subject: kasan: remove the unnecessary WARN_ONCE from quarantine.c
Subject: mm, oom: fix uninitialized ret in task_will_free_mem()
Subject: mm/memory_hotplug.c: initialize per_cpu_nodestats for hotadded pgdats

[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-08-25 22:16 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-08-25 22:16 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 738 bytes --]

12 fixes, based on 61c04572de404e52a655a36752e696bbcb483cf5:

Subject: byteswap: don't use __builtin_bswap*() with sparse
Subject: get_maintainer: quiet noisy implicit -f vcs_file_exists checking
Subject: sysctl: handle error writing UINT_MAX to u32 fields
Subject: stackdepot: fix mempolicy use-after-free
Subject: soft_dirty: fix soft_dirty during THP split
Subject: printk: fix parsing of "brl=" option
Subject: treewide: replace config_enabled() with IS_ENABLED() (2nd round)
Subject: mm: clarify COMPACTION Kconfig text
Subject: mm: memcontrol: avoid unused function warning
Subject: fs/seq_file: fix out-of-bounds read
Subject: dax: fix device-dax region base
Subject: mm: silently skip readahead for DAX inodes




[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-09-01 23:14 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-09-01 23:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 1144 bytes --]

14 fixes, based on 071e31e254e0e0c438eecba3dba1d6e2d0da36c2:

Subject: mm, oom: prevent premature OOM killer invocation for high order request
Subject: kexec: fix double-free when failing to relocate the purgatory
Subject: kconfig: tinyconfig: provide whole choice blocks to avoid warnings
Subject: lib/test_hash.c: fix warning in two-dimensional array init
Subject: lib/test_hash.c: fix warning in preprocessor symbol evaluation
Subject: mm, vmscan: only allocate and reclaim from zones with pages managed by the buddy allocator
Subject: drivers/scsi/wd719x.c: remove last declaration using DEFINE_PCI_DEVICE_TABLE
Subject: treewide: remove references to the now unnecessary DEFINE_PCI_DEVICE_TABLE
Subject: printk/nmi: avoid direct printk()-s from __printk_nmi_flush()
Subject: mm, mempolicy: task->mempolicy must be NULL before dropping final reference
Subject: MAINTAINERS: Vladimir has moved
Subject: kernel/fork: fix CLONE_CHILD_CLEARTID regression in nscd
Subject: rapidio/documentation/mport_cdev: add missing parameter description
Subject: rapidio/tsi721: fix incorrect detection of address translation condition




[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-09-19 21:43 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-09-19 21:43 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 1326 bytes --]


20 fixes, based on 3be7988674ab33565700a37b210f502563d932e6:

Subject: mem-hotplug: don't clear the only node in new_node_page()
Subject: ocfs2/dlm: fix race between convert and migration
Subject: MAINTAINERS: Maik has moved
Subject: khugepaged: fix use-after-free in collapse_huge_page()
Subject: mm, thp: fix leaking mapped pte in __collapse_huge_page_swapin()
Subject: mm: avoid endless recursion in dump_page()
Subject: MAINTAINERS: update email for VLYNQ bus entry
Subject: autofs: use dentry flags to block walks during expire
Subject: mm: fix the page_swap_info() BUG_ON check
Subject: ipc/shm: fix crash if CONFIG_SHMEM is not set
Subject: ocfs2: fix trans extend while flush truncate log
Subject: ocfs2: fix trans extend while free cached blocks
Subject: fsnotify: add a way to stop queueing events on group shutdown
Subject: fanotify: fix list corruption in fanotify_get_response()
Subject: ocfs2: fix double unlock in case retry after free truncate log
Subject: mm: memcontrol: make per-cpu charge cache IRQ-safe for socket accounting
Subject: cgroup: duplicate cgroup reference when cloning sockets
Subject: ocfs2: fix start offset to ocfs2_zero_range_for_truncate()
Subject: Revert "ocfs2: bump up o2cb network protocol version"
Subject: rapidio/rio_cm: avoid GFP_KERNEL in atomic context

[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-09-28 22:22 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-09-28 22:22 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 393 bytes --]

5 fixes, based on 8ab293e3a1376574e11f9059c09cc0db212546cb:

Subject: mm,ksm: fix endless looping in allocating memory when ksm enable
Subject: dma-mapping.h: preserve unmap info for CONFIG_DMA_API_DEBUG
Subject: scripts/recordmcount.c: account for .softirqentry.text
Subject: mem-hotplug: use nodes that contain memory as mask in new_node_page()
Subject: MAINTAINERS: Mark has moved


[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-09-30 22:11 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-09-30 22:11 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

[-- Attachment #1: Type: text/plain, Size: 338 bytes --]

4 fixes, based on e3b3656ca63e23b5755183718df36fb9ff518b02:

Subject: mm: workingset: fix crash in shadow node shrinker caused by replace_page_cache_page()
Subject: ocfs2: fix deadlock on mmapped page in ocfs2_write_begin_nolock()
Subject: include/linux/property.h: fix typo/compile error
Subject: MAINTAINERS: Javi has moved




[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-10-07 23:53 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-10-07 23:53 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- fsnotify updates

- ocfs2 updates

- all of MM


127 patches, based on 87840a2b7e048018d18d60bdac5c09224de85370:

Subject: fsnotify: drop notification_mutex before destroying event
Subject: fsnotify: convert notification_mutex to a spinlock
Subject: fanotify: use notification_lock instead of access_lock
Subject: fanotify: fix possible false warning when freeing events
Subject: fsnotify: clean up spinlock assertions
Subject: jiffies: add time comparison functions for 64 bit jiffies
Subject: fs/ocfs2/dlmfs: remove deprecated create_singlethread_workqueue()
Subject: fs/ocfs2/cluster: remove deprecated create_singlethread_workqueue()
Subject: fs/ocfs2/super: remove deprecated create_singlethread_workqueue()
Subject: fs/ocfs2/dlm: remove deprecated create_singlethread_workqueue()
Subject: ocfs2: fix undefined struct variable in inode.h
Subject: mm: oom: deduplicate victim selection code for memcg and global oom
Subject: mm/vmalloc.c: fix align value calculation error
Subject: mm: memcontrol: add sanity checks for memcg->id.ref on get/put
Subject: mm/oom_kill.c: fix task_will_free_mem() comment
Subject: mm, compaction: make whole_zone flag ignore cached scanner positions
Subject: mm, compaction: cleanup unused functions
Subject: mm, compaction: rename COMPACT_PARTIAL to COMPACT_SUCCESS
Subject: mm, compaction: don't recheck watermarks after COMPACT_SUCCESS
Subject: mm, compaction: add the ultimate direct compaction priority
Subject: mm, compaction: use correct watermark when checking compaction success
Subject: mm, compaction: create compact_gap wrapper
Subject: mm, compaction: use proper alloc_flags in __compaction_suitable()
Subject: mm, compaction: require only min watermarks for non-costly orders
Subject: mm, vmscan: make compaction_ready() more accurate and readable
Subject: mem-hotplug: fix node spanned pages when we have a movable node
Subject: mm: fix set pageblock migratetype in deferred struct page init
Subject: mm, vmscan: get rid of throttle_vm_writeout
Subject: mm/debug_pagealloc.c: clean-up guard page handling code
Subject: mm/debug_pagealloc.c: don't allocate page_ext if we don't use guard page
Subject: mm/page_owner: move page_owner specific function to page_owner.c
Subject: mm/page_ext: rename offset to index
Subject: mm/page_ext: support extra space allocation by page_ext user
Subject: mm/page_owner: don't define fields on struct page_ext by hard-coding
Subject: do_generic_file_read(): fail immediately if killed
Subject: mm: pagewalk: fix the comment for test_walk
Subject: mm: unrig VMA cache hit ratio
Subject: mm, swap: add swap_cluster_list
Subject: mm,oom_reaper: reduce find_lock_task_mm() usage
Subject: mm,oom_reaper: do not attempt to reap a task twice
Subject: oom: keep mm of the killed task available
Subject: kernel, oom: fix potential pgd_lock deadlock from __mmdrop
Subject: mm, oom: get rid of signal_struct::oom_victims
Subject: oom, suspend: fix oom_killer_disable vs. pm suspend properly
Subject: mm, oom: enforce exit_oom_victim on current task
Subject: mm: make sure that kthreads will not refault oom reaped memory
Subject: oom, oom_reaper: allow to reap mm shared by the kthreads
Subject: mm: use zonelist name instead of using hardcoded index
Subject: mm: introduce arch_reserved_kernel_pages()
Subject: mm/memblock.c: expose total reserved memory
Subject: powerpc: implement arch_reserved_kernel_pages
Subject: mm/nobootmem.c: remove duplicate macro ARCH_LOW_ADDRESS_LIMIT statements
Subject: mm/bootmem.c: replace kzalloc() by kzalloc_node()
Subject: mm: don't use radix tree writeback tags for pages in swap cache
Subject: oom: warn if we go OOM for higher order and compaction is disabled
Subject: mm: mlock: check against vma for actual mlock() size
Subject: mm: mlock: avoid increase mm->locked_vm on mlock() when already mlock2(,MLOCK_ONFAULT)
Subject: selftest: split mlock2_ funcs into separate mlock2.h
Subject: selftests/vm: add test for mlock() when areas are intersected
Subject: selftest: move seek_to_smaps_entry() out of mlock2-tests.c
Subject: selftests: expanding more mlock selftest
Subject: thp, dax: add thp_get_unmapped_area for pmd mappings
Subject: ext2/4, xfs: call thp_get_unmapped_area() for pmd mappings
Subject: cpu: fix node state for whether it contains CPU
Subject: fs/proc/task_mmu.c: make the task_mmu walk_page_range() limit in clear_refs_write() obvious
Subject: thp: reduce usage of huge zero page's atomic counter
Subject: mm/memcontrol.c: make the walk_page_range() limit obvious
Subject: memory-hotplug: fix store_mem_state() return value
Subject: mm: fix cache mode tracking in vm_insert_mixed()
Subject: mm, swap: use offset of swap entry as key of swap cache
Subject: mm: remove page_file_index
Subject: Revert "mm, oom: prevent premature OOM killer invocation for high order request"
Subject: mm, compaction: more reliably increase direct compaction priority
Subject: mm, compaction: restrict full priority to non-costly orders
Subject: mm, compaction: make full priority ignore pageblock suitability
Subject: mm, page_alloc: pull no_progress_loops update to should_reclaim_retry()
Subject: mm, compaction: ignore fragindex from compaction_zonelist_suitable()
Subject: mm, compaction: restrict fragindex to costly orders
Subject: mm: don't emit warning from pagefault_out_of_memory()
Subject: mm/page_io.c: replace some BUG_ON()s with VM_BUG_ON_PAGE()
Subject: mm: move phys_mem_access_prot_allowed() declaration to pgtable.h
Subject: mm: memcontrol: consolidate cgroup socket tracking
Subject: mm/shmem.c: constify anon_ops
Subject: mm: nobootmem: move the comment of free_all_bootmem
Subject: mm/hugetlb: fix memory offline with hugepage size > memory block size
Subject: mm/hugetlb: check for reserved hugepages during memory offline
Subject: mm/hugetlb: improve locking in dissolve_free_huge_pages()
Subject: mm/page_isolation: fix typo: "paes" -> "pages"
Subject: mm,ksm: add __GFP_HIGH to the allocation in alloc_stable_node()
Subject: mm: vm_page_prot: update with WRITE_ONCE/READ_ONCE
Subject: mm: vma_adjust: remove superfluous confusing update in remove_next == 1 case
Subject: mm: vma_merge: fix vm_page_prot SMP race condition against rmap_walk
Subject: mm: vma_adjust: remove superfluous check for next not NULL
Subject: mm: vma_adjust: minor comment correction
Subject: mm: vma_merge: correct false positive from __vma_unlink->validate_mm_rb
Subject: mm: clarify why we avoid page_mapcount() for slab pages in dump_page()
Subject: oom: print nodemask in the oom report
Subject: mm/hugetlb: introduce ARCH_HAS_GIGANTIC_PAGE
Subject: arm64 Kconfig: select gigantic page
Subject: vfs,mm: fix a dead loop in truncate_inode_pages_range()
Subject: mm: consolidate warn_alloc_failed users
Subject: mm: warn about allocations which stall for too long
Subject: mm: remove unnecessary condition in remove_inode_hugepages
Subject: linux/mm.h: canonicalize macro PAGE_ALIGNED() definition
Subject: ia64: implement atomic64_dec_if_positive
Subject: atomic64: no need for CONFIG_ARCH_HAS_ATOMIC64_DEC_IF_POSITIVE
Subject: proc: much faster /proc/vmstat
Subject: proc: faster /proc/*/status
Subject: seq/proc: modify seq_put_decimal_[u]ll to take a const char *, not char
Subject: meminfo: break apart a very long seq_printf with #ifdefs
Subject: proc: relax /proc/<tid>/timerslack_ns capability requirements
Subject: proc: add LSM hook checks to /proc/<tid>/timerslack_ns
Subject: proc: fix timerslack_ns CAP_SYS_NICE check when adjusting self
Subject: mm, proc: fix region lost in /proc/self/smaps
Subject: Documentation/filesystems/proc.txt: add more description for maps/smaps
Subject: min/max: remove sparse warnings when they're nested
Subject: nmi_backtrace: add more trigger_*_cpu_backtrace() methods
Subject: nmi_backtrace: do a local dump_stack() instead of a self-NMI
Subject: arch/tile: adopt the new nmi_backtrace framework
Subject: nmi_backtrace: generate one-line reports for idle cpus
Subject: spelling.txt: "modeled" is spelt correctly
Subject: uprobes: remove function declarations from arch/{mips,s390}
Subject: .gitattributes: set git diff driver for C source code files
Subject: mailmap: add Johan Hovold
Subject: CREDITS: update Pavel's information, add GPG key, remove snail mail address
Subject: cred: simpler, 1D supplementary groups
Subject: console: don't prefer first registered if DT specifies stdout-path


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-10-11 20:49 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-10-11 20:49 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- a few block updates that fell in my lap

- lib/ updates

- checkpatch

- autofs

- ipc

- A ton of misc other things


102 patches, based on 1689c73a739d094b544c680b0dfdebe52ffee8fb:

Subject: ocfs2: fix memory leak in dlm_migrate_request_handler()
Subject: block: invalidate the page cache when issuing BLKZEROOUT
Subject: block: require write_same and discard requests align to logical block size
Subject: block: implement (some of) fallocate for block devices
Subject: fs/select: add vmalloc fallback for select(2)
Subject: radix-tree: 'slot' can be NULL in radix_tree_next_slot()
Subject: radix-tree tests: add iteration test
Subject: radix-tree tests: properly initialize mutex
Subject: lib: harden strncpy_from_user
Subject: include/linux/ctype.h: make isdigit() table lookupless
Subject: lib/kstrtox.c: smaller _parse_integer()
Subject: lib/bitmap.c: enhance bitmap syntax
Subject: include/linux: provide a safe version of container_of()
Subject: llist: introduce llist_entry_safe()
Subject: checkpatch: see if modified files are marked obsolete in MAINTAINERS
Subject: checkpatch: look for symbolic permissions and suggest octal instead
Subject: checkpatch: test multiple line block comment alignment
Subject: checkpatch: don't test for prefer ether_addr_<foo>
Subject: checkpatch: externalize the structs that should be const
Subject: const_structs.checkpatch: add frequently used from Julia Lawall's list
Subject: checkpatch: speed up checking for filenames in sections marked obsolete
Subject: checkpatch: improve the block comment * alignment test
Subject: checkpatch: add --strict test for macro argument reuse
Subject: checkpatch: add --strict test for precedence challenged macro arguments
Subject: checkpatch: improve MACRO_ARG_PRECEDENCE test
Subject: checkpatch: add warning for unnamed function definition arguments
Subject: checkpatch: improve the octal permissions tests
Subject: kprobes: include <asm/sections.h> instead of <asm-generic/sections.h>
Subject: autofs: fix typos in Documentation/filesystems/autofs4.txt
Subject: autofs: drop unnecessary extern in autofs_i.h
Subject: autofs: test autofs versions first on sb initialization
Subject: autofs: fix autofs4_fill_super() error exit handling
Subject: autofs: add WARN_ON(1) for non dir/link inode case
Subject: autofs: remove ino free in autofs4_dir_symlink()
Subject: autofs: use autofs4_free_ino() to kfree dentry data
Subject: autofs: remove obsolete sb fields
Subject: autofs: don't fail to free_dev_ioctl(param)
Subject: autofs: remove AUTOFS_DEVID_LEN
Subject: autofs: fix Documentation regarding devid on ioctl
Subject: autofs: update struct autofs_dev_ioctl in Documentation
Subject: autofs: fix pr_debug() message
Subject: autofs: fix dev ioctl number range check
Subject: autofs: add autofs_dev_ioctl_version() for AUTOFS_DEV_IOCTL_VERSION_CMD
Subject: autofs: fix print format for ioctl warning message
Subject: autofs: move inclusion of linux/limits.h to uapi
Subject: autofs4: move linux/auto_dev-ioctl.h to uapi/linux
Subject: autofs: remove possibly misleading /* #define DEBUG */
Subject: autofs: refactor ioctl fn vector in iookup_dev_ioctl()
Subject: pipe: relocate round_pipe_size() above pipe_set_size()
Subject: pipe: move limit checking logic into pipe_set_size()
Subject: pipe: refactor argument for account_pipe_buffers()
Subject: pipe: fix limit checking in pipe_set_size()
Subject: pipe: simplify logic in alloc_pipe_info()
Subject: pipe: fix limit checking in alloc_pipe_info()
Subject: pipe: make account_pipe_buffers() return a value, and use it
Subject: pipe: cap initial pipe capacity according to pipe-max-size limit
Subject: ptrace: clear TIF_SYSCALL_TRACE on ptrace detach
Subject: rapidio/rio_cm: use memdup_user() instead of duplicating code
Subject: random: simplify API for random address requests
Subject: x86: use simpler API for random address requests
Subject: ARM: use simpler API for random address requests
Subject: arm64: use simpler API for random address requests
Subject: tile: use simpler API for random address requests
Subject: unicore32: use simpler API for random address requests
Subject: random: remove unused randomize_range()
Subject: dma-mapping: introduce the DMA_ATTR_NO_WARN attribute
Subject: powerpc: implement the DMA_ATTR_NO_WARN attribute
Subject: nvme: use the DMA_ATTR_NO_WARN attribute
Subject: x86/panic: replace smp_send_stop() with kdump friendly version in panic path
Subject: mips/panic: replace smp_send_stop() with kdump friendly version in panic path
Subject: pps: kc: fix non-tickless system config dependency
Subject: relay: Use irq_work instead of plain timer for deferred wakeup
Subject: config/android: Remove CONFIG_IPV6_PRIVACY
Subject: config: android: move device mapper options to recommended
Subject: config: android: set SELinux as default security mode
Subject: config: android: enable CONFIG_SECCOMP
Subject: kcov: do not instrument lib/stackdepot.c
Subject: ipc/sem.c: fix complex_count vs. simple op race
Subject: ipc/msg: implement lockless pipelined wakeups
Subject: ipc/msg: batch queue sender wakeups
Subject: ipc/msg: make ss_wakeup() kill arg boolean
Subject: ipc/msg: avoid waking sender upon full queue
Subject: ipc/sem.c: Add cond_resched in exit_sme
Subject: kdump, vmcoreinfo: report memory sections virtual addresses
Subject: mm: kmemleak: avoid using __va() on addresses that don't have a lowmem mapping
Subject: scripts/tags.sh: enable code completion in VIM
Subject: kthread: rename probe_kthread_data() to kthread_probe_data()
Subject: kthread: kthread worker API cleanup
Subject: kthread/smpboot: do not park in kthread_create_on_cpu()
Subject: kthread: allow to call __kthread_create_on_node() with va_list args
Subject: kthread: add kthread_create_worker*()
Subject: kthread: add kthread_destroy_worker()
Subject: kthread: detect when a kthread work is used by more workers
Subject: kthread: initial support for delayed kthread work
Subject: kthread: allow to cancel kthread work
Subject: kthread: allow to modify delayed kthread work
Subject: kthread: better support freezable kthread workers
Subject: kthread: add kerneldoc for kthread_create()
Subject: hung_task: allow hung_task_panic when hung_task_warnings is 0
Subject: treewide: remove redundant #include <linux/kconfig.h>
Subject: fs: use mapping_set_error instead of opencoded set_bit
Subject: mm: split gfp_mask and mapping flags into separate fields


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-11-10 18:45 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-11-10 18:45 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

15 fixes, based on 27bcd37e0240bbe33f0efe244b5aad52104115b3:

Subject: mm: remove extra newline from allocation stall warning
Subject: mm, frontswap: make sure allocated frontswap map is assigned
Subject: shmem: fix pageflags after swapping DMA32 object
Subject: scripts/bloat-o-meter: fix SIGPIPE
Subject: mm/cma.c: check the max limit for cma allocation
Subject: swapfile: fix memory corruption via malformed swapfile
Subject: mm: hwpoison: fix thp split handling in memory_failure()
Subject: Revert "console: don't prefer first registered if DT specifies stdout-path"
Subject: ocfs2: fix not enough credit panic
Subject: mm/hugetlb: fix huge page reservation leak in private mapping error paths
Subject: mm/filemap: don't allow partially uptodate page for pipes
Subject: coredump: fix unfreezable coredumping task
Subject: memcg: prevent memcg caches to be both OFF_SLAB & OBJFREELIST_SLAB
Subject: mm: kmemleak: scan .data.ro_after_init
Subject: lib/stackdepot: export save/fetch stack for drivers




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-11-30 23:53 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-11-30 23:53 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

7 fixes, based on ded6e842cf499ef04b0d611d92b859d5b846c497:

Subject: mm, thp: propagation of conditional compilation in khugepaged.c
Subject: thp: fix corner case of munlock() of PTE-mapped THPs
Subject: zram: fix unbalanced idr management at hot removal
Subject: lib/debugobjects: export for use in modules
Subject: kasan: update kasan_global for gcc 7
Subject: kasan: support use-after-scope detection
Subject: mm: fix false-positive WARN_ON() in truncate/invalidate for hugetlb



^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-12-03  1:26 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-12-03  1:26 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

2 fixes, based on 8dc0f265d39a3933f4c1f846c7c694f12a2ab88a:

Subject: mm: workingset: fix NULL ptr in count_shadow_nodes
Subject: mm, vmscan: add cond_resched() into shrink_node_memcg()


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-12-07 22:44 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-12-07 22:44 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

3 fixes, based on ea5a9eff96fed8252f3a8c94a84959f981a93cae:

Subject: zram: restrict add/remove attributes to root only
Subject: radix tree test suite: fix compilation
Subject: kcov: add missing #include <linux/sched.h>


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-12-13  0:40 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-12-13  0:40 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- various misc bits

- most of MM (quite a lot of MM material is awaiting the merge of
  linux-next dependencies)

- kasan

- printk updates

- procfs updates

- MAINTAINERS

- /lib updates

- checkpatch updates

123 patches, based on df5f0f0a028c9bf43949398a175dbaafaf513e14:

Subject: kthread: add __printf attributes
Subject: prctl: remove one-shot limitation for changing exe link
Subject: scripts/bloat-o-meter: don't use readlines()
Subject: scripts/bloat-o-meter: compile .NUMBER regex
Subject: scripts/tags.sh: handle OMAP platforms properly
Subject: m32r: add simple dma
Subject: m32r: fix build warning
Subject: drivers/pcmcia/m32r_pcc.c: check return from request_irq
Subject: drivers/pcmcia/m32r_pcc.c: use common error path
Subject: drivers/pcmcia/m32r_pcc.c: check return from add_pcc_socket
Subject: ocfs2/dlm: clean up useless BUG_ON default case in dlm_finalize_reco_handler()
Subject: ocfs2: delete redundant code and set the node bit into maybe_map directly
Subject: ocfs2/dlm: clean up deadcode in dlm_master_request_handler()
Subject: ocfs2: clean up unused 'page' parameter in ocfs2_write_end_nolock()
Subject: ocfs2: fix double put of recount tree in ocfs2_lock_refcount_tree()
Subject: ocfs2: use time64_t to represent orphan scan times
Subject: ocfs2: replace CURRENT_TIME macro
Subject: mm: memcontrol: use special workqueue for creating per-memcg caches
Subject: slub: move synchronize_sched out of slab_mutex on shrink
Subject: slub: avoid false-postive warning
Subject: mm/slab_common.c: check kmem_create_cache flags are common
Subject: mm, slab: faster active and free stats
Subject: mm, slab: maintain total slab count instead of active count
Subject: mm/mprotect.c: don't touch single threaded PTEs which are on the right node
Subject: mm/vmscan.c: set correct defer count for shrinker
Subject: mm/gup.c: make unnecessarily global vma_permits_fault() static
Subject: mm/hugetlb.c: use the right pte val for compare in hugetlb_cow
Subject: mm/hugetlb.c: use huge_pte_lock instead of opencoding the lock
Subject: kmemleak: fix reference to Documentation
Subject: mm: don't steal highatomic pageblock
Subject: mm: prevent double decrease of nr_reserved_highatomic
Subject: mm: try to exhaust highatomic reserve before the OOM
Subject: mm: make unreserve highatomic functions reliable
Subject: mm/vmalloc.c: simplify /proc/vmallocinfo implementation
Subject: mm, thp: avoid unlikely branches for split_huge_pmd
Subject: mm, mempolicy: clean up __GFP_THISNODE confusion in policy_zonelist
Subject: mm, compaction: fix NR_ISOLATED_* stats for pfn based migration
Subject: shmem: avoid maybe-uninitialized warning
Subject: mm: use the correct page size when removing the page
Subject: mm: update mmu_gather range correctly
Subject: mm/hugetlb: add tlb_remove_hugetlb_entry for handling hugetlb pages
Subject: mm: add tlb_remove_check_page_size_change to track page size change
Subject: mm: remove the page size change check in tlb_remove_page
Subject: mm: fix up get_user_pages* comments
Subject: mm/mempolicy.c: forbid static or relative flags for local NUMA mode
Subject: powerpc/mm: allow memory hotplug into a memoryless node
Subject: mm: remove x86-only restriction of movable_node
Subject: mm: enable CONFIG_MOVABLE_NODE on non-x86 arches
Subject: of/fdt: mark hotpluggable memory
Subject: dt: add documentation of "hotpluggable" memory property
Subject: mm/pkeys: generate pkey system call code only if ARCH_HAS_PKEYS is selected
Subject: mm: disable numa migration faults for dax vmas
Subject: mm: cma: make linux/cma.h standalone includible
Subject: mm/filemap.c: add comment for confusing logic in page_cache_tree_insert()
Subject: fs/fs-writeback.c: remove redundant if check
Subject: shmem: fix compilation warnings on unused functions
Subject: mm: don't cap request size based on read-ahead setting
Subject: include/linux/backing-dev-defs.h: shrink struct backing_dev_info
Subject: mm: khugepaged: close use-after-free race during shmem collapsing
Subject: mm: khugepaged: fix radix tree node leak in shmem collapse error path
Subject: mm: workingset: turn shadow node shrinker bugs into warnings
Subject: lib: radix-tree: native accounting of exceptional entries
Subject: lib: radix-tree: check accounting of existing slot replacement users
Subject: lib: radix-tree: add entry deletion support to __radix_tree_replace()
Subject: lib: radix-tree: update callback for changing leaf nodes
Subject: mm: workingset: move shadow entry tracking to radix tree exceptional tracking
Subject: mm: workingset: restore refault tracking for single-page files
Subject: mm: workingset: update shadow limit to reflect bigger active list
Subject: mm: remove free_unmap_vmap_area_noflush()
Subject: mm: remove free_unmap_vmap_area_addr()
Subject: mm: refactor __purge_vmap_area_lazy()
Subject: mm: add vfree_atomic()
Subject: kernel/fork: use vfree_atomic() to free thread stack
Subject: x86/ldt: use vfree_atomic() to free ldt entries
Subject: mm: mark all calls into the vmalloc subsystem as potentially sleeping
Subject: mm: turn vmap_purge_lock into a mutex
Subject: mm: add preempt points into __purge_vmap_area_lazy()
Subject: mm: move vma_is_anonymous check within pmd_move_must_withdraw
Subject: mm: THP page cache support for ppc64
Subject: mm, debug: print raw struct page data in __dump_page()
Subject: mm, rmap: handle anon_vma_prepare() common case inline
Subject: mm, page_alloc: keep pcp count and list contents in sync if struct page is corrupted
Subject: mm: add three more cond_resched() in swapoff
Subject: mm: add cond_resched() in gather_pte_stats()
Subject: mm: make transparent hugepage size public
Subject: kasan: support panic_on_warn
Subject: kasan: eliminate long stalls during quarantine reduction
Subject: kasan: turn on -fsanitize-address-use-after-scope
Subject: mm/percpu.c: fix panic triggered by BUG_ON() falsely
Subject: proc: report no_new_privs state
Subject: proc: make struct pid_entry::len unsigned
Subject: proc: make struct struct map_files_info::len unsigned int
Subject: proc: just list_del() struct pde_opener
Subject: proc: fix type of struct pde_opener::closing field
Subject: proc: kmalloc struct pde_opener
Subject: proc: tweak comments about 2 stage open and everything
Subject: fs/proc/array.c: slightly improve render_sigset_t
Subject: fs/proc/base.c: save decrement during lookup/readdir in /proc/$PID
Subject: fs/proc: calculate /proc/* and /proc/*/task/* nlink at init time
Subject: hung_task: decrement sysctl_hung_task_warnings only if it is positive
Subject: compiler-gcc.h: use "proved" instead of "proofed"
Subject: printk/NMI: fix up handling of the full nmi log buffer
Subject: printk/NMI: handle continuous lines and missing newline
Subject: printk/kdb: handle more message headers
Subject: printk/btrfs: handle more message headers
Subject: printk/sound: handle more message headers
Subject: printk: add Kconfig option to set default console loglevel
Subject: get_maintainer: look for arbitrary letter prefixes in sections
Subject: MAINTAINERS: add "B:" for URI where to file bugs
Subject: MAINTAINERS: add drm and drm/i915 bug filing info
Subject: MAINTAINERS: add "C:" for URI for chat where developers hang out
Subject: MAINTAINERS: add drm and drm/i915 irc channels
Subject: lib/Kconfig.debug: make CONFIG_STRICT_DEVMEM depend on CONFIG_DEVMEM
Subject: lib/rbtree.c: fix typo in comment of ____rb_erase_color
Subject: lib/ida: document locking requirements a bit better
Subject: checkpatch: don't try to get maintained status when --no-tree is given
Subject: scripts/checkpatch.pl: fix spelling
Subject: checkpatch: don't check .pl files, improve absolute path commit log test
Subject: checkpatch: avoid multiple line dereferences
Subject: checkpatch: don't check c99 types like uint8_t under tools
Subject: checkpatch: don't emit unified-diff error for rename-only patches
Subject: binfmt_elf: use vmalloc() for allocation of vma_filesz
Subject: init: reduce rootwait polling interval time to 5ms




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-12-14 23:04 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-12-14 23:04 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- a few misc things

- kexec updates

- DMA-mapping updates to better support networking DMA operations

- IPC updates

- various MM changes to improve DAX fault handling

- lots of radix-tree changes, mainly to the test suite.  All leading
  up to reimplementing the IDA/IDR code to be a wrapper layer over the
  radix-tree.  However the final trigger-pulling patch is held off for
  4.11.

114 patches, based on 775a2e29c3bbcf853432f47d3caa9ff8808807ad:

Subject: btrfs: better handle btrfs_printk() defaults
Subject: kernel/watchdog: use nmi registers snapshot in hardlockup handler
Subject: mm, compaction: allow compaction for GFP_NOFS requests
Subject: signals: avoid unnecessary taking of sighand->siglock
Subject: coredump: clarify "unsafe core_pattern" warning
Subject: Revert "kdump, vmcoreinfo: report memory sections virtual addresses"
Subject: kexec: export the value of phys_base instead of symbol address
Subject: kexec: add cond_resched into kimage_alloc_crash_control_pages
Subject: sysctl: add KERN_CONT to deprecated_sysctl_warning()
Subject: arch/arc: add option to skip sync on DMA mapping
Subject: arch/arm: add option to skip sync on DMA map and unmap
Subject: arch/avr32: add option to skip sync on DMA map
Subject: arch/blackfin: add option to skip sync on DMA map
Subject: arch/c6x: add option to skip sync on DMA map and unmap
Subject: arch/frv: add option to skip sync on DMA map
Subject: arch/hexagon: Add option to skip DMA sync as a part of mapping
Subject: arch/m68k: add option to skip DMA sync as a part of mapping
Subject: arch/metag: add option to skip DMA sync as a part of map and unmap
Subject: arch/microblaze: add option to skip DMA sync as a part of map and unmap
Subject: arch/mips: add option to skip DMA sync as a part of map and unmap
Subject: arch/nios2: add option to skip DMA sync as a part of map and unmap
Subject: arch/openrisc: add option to skip DMA sync as a part of mapping
Subject: arch/parisc: add option to skip DMA sync as a part of map and unmap
Subject: arch/powerpc: add option to skip DMA sync as a part of mapping
Subject: arch/sh: add option to skip DMA sync as a part of mapping
Subject: arch/sparc: add option to skip DMA sync as a part of map and unmap
Subject: arch/tile: add option to skip DMA sync as a part of map and unmap
Subject: arch/xtensa: add option to skip DMA sync as a part of mapping
Subject: dma: add calls for dma_map_page_attrs and dma_unmap_page_attrs
Subject: mm: add support for releasing multiple instances of a page
Subject: igb: update driver to make use of DMA_ATTR_SKIP_CPU_SYNC
Subject: igb: update code to better handle incrementing page count
Subject: relay: check array offset before using it
Subject: Kconfig: lib/Kconfig.debug: fix references to Documenation
Subject: Kconfig: lib/Kconfig.ubsan fix reference to ubsan documentation
Subject: kcov: add more missing includes
Subject: kernel/debug/debug_core.c: more properly delay for secondary CPUs
Subject: kdb: remove unused kdb_event handling
Subject: kdb: properly synchronize vkdb_printf() calls with other CPUs
Subject: kdb: call vkdb_printf() from vprintk_default() only when wanted
Subject: initramfs: select builtin initram compression algorithm on KConfig instead of Makefile
Subject: initramfs: allow again choice of the embedded initram compression algorithm
Subject: ipc: msg, make msgrcv work with LONG_MIN
Subject: ipc/shm.c: coding style fixes
Subject: posix-timers: give lazy compilers some help optimizing code away
Subject: drivers/net/wireless/intel/iwlwifi/dvm/calib.c: simplfy min() expression
Subject: ktest.pl: fix english
Subject: kernel/watchdog.c: move shared definitions to nmi.h
Subject: kernel/watchdog.c: move hardlockup detector to separate file
Subject: sparc: implement watchdog_nmi_enable and watchdog_nmi_disable
Subject: ipc/sem: do not call wake_sem_queue_do() prematurely
Subject: ipc/sem: rework task wakeups
Subject: ipc/sem: optimize perform_atomic_semop()
Subject: ipc/sem: explicitly inline check_restart
Subject: ipc/sem: use proper list api for pending_list wakeups
Subject: ipc/sem: simplify wait-wake loop
Subject: ipc/sem: avoid idr tree lookup for interrupted semop
Subject: mm: add locked parameter to get_user_pages_remote()
Subject: mm: unexport __get_user_pages_unlocked()
Subject: mm: join struct fault_env and vm_fault
Subject: mm: use vmf->address instead of of vmf->virtual_address
Subject: mm: use pgoff in struct vm_fault instead of passing it separately
Subject: mm: use passed vm_fault structure in __do_fault()
Subject: mm: trim __do_fault() arguments
Subject: mm: use passed vm_fault structure for in wp_pfn_shared()
Subject: mm: add orig_pte field into vm_fault
Subject: mm: allow full handling of COW faults in ->fault handlers
Subject: mm: factor out functionality to finish page faults
Subject: mm: move handling of COW faults into DAX code
Subject: mm: factor out common parts of write fault handling
Subject: mm: pass vm_fault structure into do_page_mkwrite()
Subject: mm: use vmf->page during WP faults
Subject: mm: move part of wp_page_reuse() into the single call site
Subject: mm: provide helper for finishing mkwrite faults
Subject: mm: change return values of finish_mkwrite_fault()
Subject: mm: export follow_pte()
Subject: dax: make cache flushing protected by entry lock
Subject: dax: protect PTE modification on WP fault by radix tree entry lock
Subject: dax: clear dirty entry tags on cache flush
Subject: tools: add WARN_ON_ONCE
Subject: radix tree test suite: allow GFP_ATOMIC allocations to fail
Subject: radix tree test suite: track preempt_count
Subject: radix tree test suite: free preallocated nodes
Subject: radix tree test suite: make runs more reproducible
Subject: radix tree test suite: iteration test misuses RCU
Subject: radix tree test suite: benchmark for iterator
Subject: radix tree test suite: use rcu_barrier
Subject: radix tree test suite: handle exceptional entries
Subject: radix tree test suite: record order in each item
Subject: tools: add more bitmap functions
Subject: radix tree test suite: use common find-bit code
Subject: radix-tree: fix typo
Subject: radix-tree: move rcu_head into a union with private_list
Subject: radix-tree: create node_tag_set()
Subject: radix-tree: make radix_tree_find_next_bit more useful
Subject: radix-tree: improve dump output
Subject: btrfs: fix race in btrfs_free_dummy_fs_info()
Subject: radix-tree: improve multiorder iterators
Subject: radix-tree: delete radix_tree_locate_item()
Subject: radix-tree: delete radix_tree_range_tag_if_tagged()
Subject: radix-tree: add radix_tree_join
Subject: radix-tree: add radix_tree_split
Subject: radix-tree: add radix_tree_split_preload()
Subject: radix-tree: fix replacement for multiorder entries
Subject: radix tree test suite: check multiorder iteration
Subject: idr: add ida_is_empty
Subject: tpm: use idr_find(), not idr_find_slowpath()
Subject: rxrpc: abstract away knowledge of IDR internals
Subject: idr: reduce the number of bits per level from 8 to 6
Subject: radix tree test suite: add some more functionality
Subject: radix tree test suite: cache recently freed objects
Subject: radix-tree: ensure counts are initialised
Subject: radix tree test suite: add new tag check
Subject: radix tree test suite: delete unused rcupdate.c


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2016-12-20  0:22 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-12-20  0:22 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- a series to make IMA play better across kexec

- a handful of random fixes

15 patches, based on e93b1cc8a8965da137ffea0b88e5f62fa1d2a9e6:

Subject: powerpc: ima: get the kexec buffer passed by the previous kernel
Subject: ima: on soft reboot, restore the measurement list
Subject: ima: permit duplicate measurement list entries
Subject: ima: maintain memory size needed for serializing the measurement list
Subject: powerpc: ima: send the kexec buffer to the next kernel
Subject: ima: on soft reboot, save the measurement list
Subject: ima: store the builtin/custom template definitions in a list
Subject: ima: support restoring multiple template formats
Subject: ima: define a canonical binary_runtime_measurements list format
Subject: ima: platform-independent hash value
Subject: mm: fadvise: avoid expensive remote LRU cache draining after FADV_DONTNEED
Subject: arm64: setup: introduce kaslr_offset()
Subject: kcov: make kcov work properly with KASLR enabled
Subject: ratelimit: fix WARN_ON_RATELIMIT return value
Subject: printk: fix typo in CONSOLE_LOGLEVEL_DEFAULT help text




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-01-11  0:57 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-01-11  0:57 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

27 fixes, based on bd5d7428f5e50cc10b98cf0abc13ccac391e1e33:

The three patches

Subject: mm: rename __alloc_page_frag to page_frag_alloc and __free_page_frag to page_frag_free
Subject: mm: rename __page_frag functions to __page_frag_cache, drop order from drain
Subject: mm: add documentation for page fragment APIs

aren't actually fixes.  They're simple function renamings which are
nice-to-have in mainline as ongoing net development depends on them.


Subject: MAINTAINERS: remove duplicate bug filling description
Subject: dax: fix deadlock with DAX 4k holes
Subject: mm/thp/pagecache/collapse: free the pte page table on collapse for thp page cache.
Subject: mm: add follow_pte_pmd()
Subject: dax: wrprotect pmd_t in dax_mapping_entry_mkclean
Subject: mm, slab: make sure that KMALLOC_MAX_SIZE will fit into MAX_ORDER
Subject: bpf: do not use KMALLOC_SHIFT_MAX
Subject: ocfs2: fix crash caused by stale lvb with fsdlm plugin
Subject: mm: fix devm_memremap_pages crash, use mem_hotplug_{begin, done}
Subject: mm: fix remote numa hits statistics
Subject: mm: get rid of __GFP_OTHER_NODE
Subject: lib/Kconfig.debug: fix frv build failure
Subject: ipc/sem.c: fix incorrect sem_lock pairing
Subject: mm: pmd dirty emulation in page fault handler
Subject: signal: protect SIGNAL_UNKILLABLE from unintentional clearing.
Subject: mailmap: add codeaurora.org names for nameless email commits
Subject: mm: don't dereference struct page fields of invalid pages
Subject: mm, memcg: fix the active list aging for lowmem requests when memcg is enabled
Subject: mm: rename __alloc_page_frag to page_frag_alloc and __free_page_frag to page_frag_free
Subject: mm: rename __page_frag functions to __page_frag_cache, drop order from drain
Subject: mm: add documentation for page fragment APIs
Subject: mm: support anonymous stable page
Subject: zram: revalidate disk under init_lock
Subject: zram: support BDI_CAP_STABLE_WRITES
Subject: mm/slab.c: fix SLAB freelist randomization duplicate entries
Subject: mm/hugetlb.c: fix reservation race when freeing surplus pages
Subject: timerfd: export defines to userspace


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-01-24 23:17 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-01-24 23:17 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

26 fixes, based on a4685d2f58e2230d4e27fb2ee581d7ea35e5d046:

Subject: memory_hotplug: make zone_can_shift() return a boolean value
Subject: mm/huge_memory.c: respect FOLL_FORCE/FOLL_COW for thp
Subject: dax: fix build warnings with FS_DAX and !FS_IOMAP
Subject: kernel/watchdog: prevent false hardlockup on overloaded system
Subject: drivers/memstick/core/memstick.c: avoid -Wnonnull warning
Subject: userfaultfd: fix SIGBUS resulting from false rwsem wakeups
Subject: mm/slub.c: trace free objects at KERN_INFO
Subject: mm: alloc_contig: re-allow CMA to compact FS pages
Subject: proc: add a schedule point in proc_pid_readdir()
Subject: mm, memcg: do not retry precharge charges
Subject: Documentation/filesystems/proc.txt: add VmPin
Subject: radix-tree: fix private list warnings
Subject: mm/mempolicy.c: do not put mempolicy before using its nodemask
Subject: frv: add atomic64_add_unless()
Subject: fbdev: color map copying bounds checking
Subject: kernel/panic.c: add missing \n
Subject: mm, page_alloc: fix check for NULL preferred_zone
Subject: mm, page_alloc: fix fast-path race with cpuset update or removal
Subject: mm, page_alloc: move cpuset seqcount checking to slowpath
Subject: mm, page_alloc: fix premature OOM when racing with cpuset mems update
Subject: frv: add missing atomic64 operations
Subject: romfs: use different way to generate fsid for BLOCK or MTD
Subject: mn10300: fix build error of missing fpu_save()
Subject: mm: do not export ioremap_page_range symbol for external module
Subject: MAINTAINERS: add Dan Streetman to zswap maintainers
Subject: MAINTAINERS: add Dan Streetman to zbud maintainers

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-02-08 22:30 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-02-08 22:30 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

4 fixes, based on 926af6273fc683cd98cd0ce7bf0d04a02eed6742:

Subject: kernel/ucount.c: mark user_header with kmemleak_ignore()
Subject: mm: avoid returning VM_FAULT_RETRY from ->page_mkwrite handlers
Subject: cpumask: use nr_cpumask_bits for parsing functions
Subject: mm/slub.c: fix random_seq offset destruction

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-02-18 11:42 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-02-18 11:42 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

1 fix, based on 2fe1e8a7b2f4dcac3fcb07ff06b0ae7396201fd6:

Subject: printk: use rcuidle console tracepoint

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-02-22 23:38 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-02-22 23:38 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

142 patches, based on 37c85961c3f87f2141c84e53df31e59db072fd2e:

- DAX updates

- various misc bits

- OCFS2 updates

- most of MM

Subject: tracing: add __print_flags_u64()
Subject: dax: add tracepoint infrastructure, PMD tracing
Subject: dax: update MAINTAINERS entries for FS DAX
Subject: dax: add tracepoints to dax_pmd_load_hole()
Subject: dax: add tracepoints to dax_pmd_insert_mapping()
Subject: mm, dax: make pmd_fault() and friends be the same as fault()
Subject: mm, dax: change pmd_fault() to take only vmf parameter
Subject: dma-debug: add comment for failed to check map error
Subject: tools/vm: add missing Makefile rules
Subject: scripts/spelling.txt: add several more common spelling mistakes
Subject: scripts/spelling.txt: fix incorrect typo-words
Subject: scripts/Lindent: clean up and optimize
Subject: scripts/checkstack.pl: add support for nios2
Subject: scripts/checkincludes.pl: add exit message for no duplicates found
Subject: scripts/tags.sh: include arch/Kconfig* for tags generation
Subject: m32r: use generic current.h
Subject: m32r: fix build warning
Subject: score: remove asm/current.h
Subject: ocfs2/dlmglue: prepare tracking logic to avoid recursive cluster lock
Subject: ocfs2: fix deadlock issue when taking inode lock at vfs entry points
Subject: parisc: use generic current.h
Subject: block: use for_each_thread() in sys_ioprio_set()/sys_ioprio_get()
Subject: 9p: fix a potential acl leak
Subject: kernel/watchdog.c: do not hardcode CPU 0 as the initial thread
Subject: slub: do not merge cache if slub_debug contains a never-merge flag
Subject: mm/slub: add a dump_stack() to the unexpected GFP check
Subject: mm, slab: rename kmalloc-node cache to kmalloc-<size>
Subject: Revert "slub: move synchronize_sched out of slab_mutex on shrink"
Subject: slub: separate out sysfs_slab_release() from sysfs_slab_remove()
Subject: slab: remove synchronous rcu_barrier() call in memcg cache release path
Subject: slab: reorganize memcg_cache_params
Subject: slab: link memcg kmem_caches on their associated memory cgroup
Subject: slab: implement slab_root_caches list
Subject: slab: introduce __kmemcg_cache_deactivate()
Subject: slab: remove synchronous synchronize_sched() from memcg cache deactivation path
Subject: slab: remove slub sysfs interface files early for empty memcg caches
Subject: slab: use memcg_kmem_cache_wq for slab destruction operations
Subject: slub: make sysfs directories for memcg sub-caches optional
Subject: tmpfs: change shmem_mapping() to test shmem_aops
Subject: mm: throttle show_mem() from warn_alloc()
Subject: mm, page_alloc: don't convert pfn to idx when merging
Subject: mm, page_alloc: avoid page_to_pfn() when merging buddies
Subject: mm/vmalloc.c: use rb_entry_safe
Subject: mm, trace: extract COMPACTION_STATUS and ZONE_TYPE to a common header
Subject: oom, trace: add oom detection tracepoints
Subject: oom, trace: add compaction retry tracepoint
Subject: userfaultfd: document _IOR/_IOW
Subject: userfaultfd: correct comment about UFFD_FEATURE_PAGEFAULT_FLAG_WP
Subject: userfaultfd: convert BUG() to WARN_ON_ONCE()
Subject: userfaultfd: use vma_is_anonymous
Subject: userfaultfd: non-cooperative: Split the find_userfault() routine
Subject: userfaultfd: non-cooperative: add ability to report non-PF events from uffd descriptor
Subject: userfaultfd: non-cooperative: report all available features to userland
Subject: userfaultfd: non-cooperative: Add fork() event
Subject: userfaultfd: non-cooperative: dup_userfaultfd: use mm_count instead of mm_users
Subject: userfaultfd: non-cooperative: add mremap() event
Subject: userfaultfd: non-cooperative: optimize mremap_userfaultfd_complete()
Subject: userfaultfd: non-cooperative: add madvise() event for MADV_DONTNEED request
Subject: userfaultfd: non-cooperative: avoid MADV_DONTNEED race condition
Subject: userfaultfd: non-cooperative: wake userfaults after UFFDIO_UNREGISTER
Subject: userfaultfd: hugetlbfs: add copy_huge_page_from_user for hugetlb userfaultfd support
Subject: userfaultfd: hugetlbfs: add hugetlb_mcopy_atomic_pte for userfaultfd support
Subject: userfaultfd: hugetlbfs: add __mcopy_atomic_hugetlb for huge page UFFDIO_COPY
Subject: userfaultfd: hugetlbfs: fix __mcopy_atomic_hugetlb retry/error processing
Subject: userfaultfd: hugetlbfs: add userfaultfd hugetlb hook
Subject: userfaultfd: hugetlbfs: allow registration of ranges containing huge pages
Subject: userfaultfd: hugetlbfs: add userfaultfd_hugetlb test
Subject: userfaultfd: hugetlbfs: userfaultfd_huge_must_wait for hugepmd ranges
Subject: userfaultfd: hugetlbfs: gup: support VM_FAULT_RETRY
Subject: userfaultfd: hugetlbfs: reserve count on error in __mcopy_atomic_hugetlb
Subject: userfaultfd: hugetlbfs: UFFD_FEATURE_MISSING_HUGETLBFS
Subject: userfaultfd: introduce vma_can_userfault
Subject: userfaultfd: shmem: add shmem_mcopy_atomic_pte for userfaultfd support
Subject: userfaultfd: shmem: introduce vma_is_shmem
Subject: userfaultfd: shmem: add tlbflush.h header for microblaze
Subject: userfaultfd: shmem: use shmem_mcopy_atomic_pte for shared memory
Subject: userfaultfd: shmem: add userfaultfd hook for shared memory faults
Subject: userfaultfd: shmem: allow registration of shared memory ranges
Subject: userfaultfd: hugetlbfs: add UFFDIO_COPY support for shared mappings
Subject: userfaultfd: shmem: add userfaultfd_shmem test
Subject: userfaultfd: shmem: lock the page before adding it to pagecache
Subject: userfaultfd: shmem: avoid a lockup resulting from corrupted page->flags
Subject: userfaultfd: shmem: avoid leaking blocks and used blocks in UFFDIO_COPY
Subject: userfaultfd: hugetlbfs: UFFD_FEATURE_MISSING_SHMEM
Subject: userfaultfd: non-cooperative: selftest: introduce userfaultfd_open
Subject: userfaultfd: non-cooperative: selftest: add ufd parameter to copy_page
Subject: userfaultfd: non-cooperative: selftest: add test for FORK, MADVDONTNEED and REMAP events
Subject: userfaultfd: selftest: test UFFDIO_ZEROPAGE on all memory types
Subject: mm: mprotect: use pmd_trans_unstable instead of taking the pmd_lock
Subject: mm, vmscan: remove unused mm_vmscan_memcg_isolate
Subject: mm, vmscan: add active list aging tracepoint
Subject: mm, vmscan: show the number of skipped pages in mm_vmscan_lru_isolate
Subject: mm, vmscan: show LRU name in mm_vmscan_lru_isolate tracepoint
Subject: mm, vmscan: extract shrink_page_list reclaim counters into a struct
Subject: mm, vmscan: enhance mm_vmscan_lru_shrink_inactive tracepoint
Subject: mm, vmscan: add mm_vmscan_inactive_list_is_low tracepoint
Subject: trace-vmscan-postprocess: sync with tracepoints updates
Subject: nfs: no PG_private waiters remain, remove waker
Subject: mm: un-export wake_up_page functions
Subject: mm: fix filemap.c kernel-doc warnings
Subject: mm/mmzone.c: swap likely to unlikely as code logic is different for next_zones_zonelist()
Subject: mm, compaction: add vmstats for kcompactd work
Subject: mm: page_alloc: skip over regions of invalid pfns where possible
Subject: mm,compaction: serialize waitqueue_active() checks
Subject: mm/bootmem.c: cosmetic improvement of code readability
Subject: mm: fix some typos in mm/zsmalloc.c
Subject: mm/memblock.c: trivial code refine in memblock_is_region_memory()
Subject: mm/memblock.c: check return value of memblock_reserve() in memblock_virt_alloc_internal()
Subject: mm/sparse: use page_private() to get page->private value
Subject: mm/memory_hotplug: set magic number to page->freelist instead of page->lru.next
Subject: powerpc: do not make the entire heap executable
Subject: mm/swap: fix kernel message in swap_info_get()
Subject: mm/swap: add cluster lock
Subject: mm/swap: split swap cache into 64MB trunks
Subject: mm/swap: skip readahead for unreferenced swap slots
Subject: mm/swap: allocate swap slots in batches
Subject: mm/swap: free swap slots in batch
Subject: mm/swap: add cache for swap slots allocation
Subject: mm/swap: enable swap slots cache usage
Subject: mm/swap: skip readahead only when swap slot cache is enabled
Subject: mm, thp: add new defer+madvise defrag option
Subject: mm/backing-dev.c: use rb_entry()
Subject: mm, vmscan: do not count freed pages as PGDEACTIVATE
Subject: mm, vmscan: cleanup lru size claculations
Subject: mm, vmscan: consider eligible zones in get_scan_count
Subject: Revert "mm: bail out in shrink_inactive_list()"
Subject: mm, page_alloc: do not report all nodes in show_mem
Subject: mm, page_alloc: warn_alloc print nodemask
Subject: arch, mm: remove arch specific show_mem
Subject: lib/show_mem.c: teach show_mem to work with the given nodemask
Subject: mm: consolidate GFP_NOFAIL checks in the allocator slowpath
Subject: mm, oom: do not enforce OOM killer for __GFP_NOFAIL automatically
Subject: mm: help __GFP_NOFAIL allocations which do not trigger OOM killer
Subject: mm, page_alloc: warn_alloc nodemask is NULL when cpusets are disabled
Subject: mm: drop zap_details::ignore_dirty
Subject: mm: drop zap_details::check_swap_entries
Subject: mm: drop unused argument of zap_page_range()
Subject: oom-reaper: use madvise_dontneed() logic to decide if unmap the VMA
Subject: mm/memblock.c: remove unnecessary log and clean up
Subject: zram: remove obsolete sysfs attrs
Subject: mm: fix <linux/pagemap.h> stray kernel-doc notation
Subject: mm/z3fold.c: limit first_num to the actual range of possible buddy indexes


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-02-24 22:55 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-02-24 22:55 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- almost all of the rest of MM

- misc bits

- KASAN updates

- procfs

- lib/ updates

- checkpatch updates


124 patches, based on f1ef09fde17f9b77ca1435a5b53a28b203afb81c:

Subject: cris: use generic current.h
Subject: mm/ksm: improve deduplication of zero pages with colouring
Subject: mm, oom: header nodemask is NULL when cpusets are disabled
Subject: mm, devm_memremap_pages: hold device_hotplug lock over mem_hotplug_{begin, done}
Subject: mm: validate device_hotplug is held for memory hotplug
Subject: mm/memory_hotplug.c: unexport __remove_pages()
Subject: memblock: let memblock_type_name know about physmem type
Subject: memblock: also dump physmem list within __memblock_dump_all
Subject: memblock: embed memblock type name within struct memblock_type
Subject: userfaultfd: non-cooperative: rename *EVENT_MADVDONTNEED to *EVENT_REMOVE
Subject: userfaultfd: non-cooperative: add madvise() event for MADV_REMOVE request
Subject: userfaultfd: non-cooperative: selftest: enable REMOVE event test for shmem
Subject: mm: vmscan: scan dirty pages even in laptop mode
Subject: mm: vmscan: kick flushers when we encounter dirty pages on the LRU
Subject: mm: vmscan: remove old flusher wakeup from direct reclaim path
Subject: mm: vmscan: only write dirty pages that the scanner has seen twice
Subject: mm: vmscan: move dirty pages out of the way until they're flushed
Subject: mm, page_alloc: split buffered_rmqueue()
Subject: mm, page_alloc: split alloc_pages_nodemask()
Subject: mm, page_alloc: drain per-cpu pages from workqueue context
Subject: mm, page_alloc: do not depend on cpu hotplug locks inside the allocator
Subject: mm, page_alloc: only use per-cpu allocator for irq-safe requests
Subject: mm, fs: reduce fault, page_mkwrite, and pfn_mkwrite to take only vmf
Subject: mm: fix comments for mmap_init()
Subject: zram: remove waitqueue for IO done
Subject: mm, page_alloc: remove redundant checks from alloc fastpath
Subject: mm, page_alloc: don't check cpuset allowed twice in fast-path
Subject: mm, page_alloc: use static global work_struct for draining per-cpu pages
Subject: mm,fs,dax: change ->pmd_fault to ->huge_fault
Subject: mm, x86: add support for PUD-sized transparent hugepages
Subject: dax: support for transparent PUD pages for device DAX
Subject: mm: replace FAULT_FLAG_SIZE with parameter to huge_fault
Subject: mm: fix get_user_pages() vs device-dax pud mappings
Subject: z3fold: make pages_nr atomic
Subject: z3fold: fix header size related issues
Subject: z3fold: extend compaction function
Subject: z3fold: use per-page spinlock
Subject: z3fold: add kref refcounting
Subject: mm/migration: make isolate_movable_page() return int type
Subject: mm/migration: make isolate_movable_page always defined
Subject: HWPOISON: soft offlining for non-lru movable page
Subject: mm/hotplug: enable memory hotplug for non-lru movable pages
Subject: uprobes: split THPs before trying to replace them
Subject: mm: introduce page_vma_mapped_walk()
Subject: mm: fix handling PTE-mapped THPs in page_referenced()
Subject: mm: fix handling PTE-mapped THPs in page_idle_clear_pte_refs()
Subject: mm, rmap: check all VMAs that PTE-mapped THP can be part of
Subject: mm: convert page_mkclean_one() to use page_vma_mapped_walk()
Subject: mm: convert try_to_unmap_one() to use page_vma_mapped_walk()
Subject: mm, ksm: convert write_protect_page() to use page_vma_mapped_walk()
Subject: mm, uprobes: convert __replace_page() to use page_vma_mapped_walk()
Subject: mm: convert page_mapped_in_vma() to use page_vma_mapped_walk()
Subject: mm: drop page_check_address{,_transhuge}
Subject: mm: convert remove_migration_pte() to use page_vma_mapped_walk()
Subject: mm: call vm_munmap in munmap syscall instead of using open coded version
Subject: userfaultfd: non-cooperative: add event for memory unmaps
Subject: userfaultfd: non-cooperative: add event for exit() notification
Subject: userfaultfd: mcopy_atomic: return -ENOENT when no compatible VMA found
Subject: userfaultfd_copy: return -ENOSPC in case mm has gone
Subject: userfaultfd: documentation update
Subject: mm: alloc_contig_range: allow to specify GFP mask
Subject: mm: cma_alloc: allow to specify GFP mask
Subject: mm: wire up GFP flag passing in dma_alloc_from_contiguous
Subject: mm, madvise: fail with ENOMEM when splitting vma will hit max_map_count
Subject: mm: cma: print allocation failure reason and bitmap status
Subject: vmalloc: back off when the current task is killed
Subject: mm/page_alloc.c: remove duplicate inclusion of page_ext.h
Subject: mm/memory.c: use NULL instead of literal 0
Subject: mm: codgin-style fixes
Subject: drm: remove unnecessary fault wrappers
Subject: mm, vmscan: clear PGDAT_WRITEBACK when zone is balanced
Subject: mm/shmem.c: fix unlikely() test of info->seals to test only for WRITE and GROW
Subject: mm/autonuma: don't use set_pte_at when updating protnone ptes
Subject: mm/autonuma: let architecture override how the write bit should be stashed in a protnone pte.
Subject: mm/ksm: handle protnone saved writes when making page write protect
Subject: powerpc/mm/autonuma: switch ppc64 to its own implementation of saved write
Subject: mm/page-writeback.c: place "not" inside of unlikely() statement in wb_domain_writeout_inc()
Subject: zram: extend zero pages to same element pages
Subject: mm/memory_hotplug.c: fix overflow in test_pages_in_a_zone()
Subject: mm/page_alloc: fix nodes for reclaim in fast path
Subject: mm: remove shmem_mapping() shmem_zero_setup() duplicates
Subject: mm: vmpressure: fix sending wrong events on underflow
Subject: mm/zsmalloc: remove redundant SetPagePrivate2 in create_page_chain
Subject: mm/page_alloc.c: remove redundant init code for ZONE_MOVABLE
Subject: mm/zsmalloc: fix comment in zsmalloc
Subject: mm: cleanups for printing phys_addr_t and dma_addr_t
Subject: mm/gup: check for protnone only if it is a PTE entry
Subject: mm/thp/autonuma: use TNF flag instead of vm fault
Subject: mm: do not access page->mapping directly on page_endio
Subject: memory-hotplug: use dev_online for memhp_auto_online
Subject: kasan: drain quarantine of memcg slab objects
Subject: kasan: add memcg kmem_cache test
Subject: arch/frv/mb93090-mb00/pci-frv.c: fix build warning
Subject: alpha: use generic current.h
Subject: proc: use rb_entry()
Subject: proc: less code duplication in /proc/*/cmdline
Subject: procfs: use an enum for possible hidepid values
Subject: uapi: mqueue.h: add missing linux/types.h include
Subject: include/linux/iopoll.h: include <linux/ktime.h> instead of <linux/hrtimer.h>
Subject: compiler-gcc.h: add a new macro to wrap gcc attribute
Subject: m68k: replace gcc specific macros with ones from compiler.h
Subject: bug: switch data corruption check to __must_check
Subject: mm balloon: umount balloon_mnt when removing vb device
Subject: kernel/notifier.c: simplify expression
Subject: kernel/ksysfs.c: add __ro_after_init to bin_attribute structure
Subject: lib: add module support to crc32 tests
Subject: lib: add module support to glob tests
Subject: lib: add module support to atomic64 tests
Subject: lib/find_bit.c: micro-optimise find_next_*_bit
Subject: linux/kernel.h: fix DIV_ROUND_CLOSEST to support negative divisors
Subject: rbtree: use designated initializers
Subject: lib: add CONFIG_TEST_SORT to enable self-test of sort()
Subject: lib/test_sort.c: make it explicitly non-modular
Subject: lib: update LZ4 compressor module
Subject: lib/decompress_unlz4: change module to work with new LZ4 module version
Subject: crypto: change LZ4 modules to work with new LZ4 module version
Subject: fs/pstore: fs/squashfs: change usage of LZ4 to work with new LZ4 version
Subject: lib/lz4: remove back-compat wrappers
Subject: checkpatch: warn on embedded function names
Subject: checkpatch: warn on logging continuations
Subject: checkpatch: update $logFunctions
Subject: checkpatch: add another old address for the FSF
Subject: checkpatch: notice unbalanced else braces in a patch
Subject: checkpatch: remove false unbalanced braces warning




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-02-27 22:25 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-02-27 22:25 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- a few MM remainders

- misc things

- autofs updates

- signals

- affs updates

- ipc

- nilfs2

- spelling.txt updates

78 patches, based on e5d56efc97f8240d0b5d66c03949382b6d7e5570:

Subject: mm,fs,dax: mark dax_iomap_pmd_fault as const
Subject: zswap: allow initialization at boot without pool
Subject: zswap: clear compressor or zpool param if invalid at init
Subject: zswap: don't param_set_charp while holding spinlock
Subject: kprobes: move kprobe declarations to asm-generic/kprobes.h
Subject: autofs: remove wrong comment
Subject: autofs: fix typo in Documentation
Subject: autofs: fix wrong ioctl documentation regarding devid
Subject: autofs: update ioctl documentation regarding struct autofs_dev_ioctl
Subject: autofs: add command enum/macros for root-dir ioctls
Subject: autofs: remove duplicated AUTOFS_DEV_IOCTL_SIZE definition
Subject: autofs: take more care to not update last_used on path walk
Subject: hfsplus: atomically read inode size
Subject: fs/reiserfs: atomically read inode size
Subject: sigaltstack: support SS_AUTODISARM for CONFIG_COMPAT
Subject: tools/testing/selftests/sigaltstack/sas.c: improve output of sigaltstack testcase
Subject: /proc/kcore: update physical address for kcore ram and text
Subject: rapidio: use get_user_pages_unlocked()
Subject: include/linux/pid.h: use for_each_thread() in do_each_pid_thread()
Subject: fs,eventpoll: Don't test for bitfield with stack value
Subject: fs/affs: remove reference to affs_parent_ino()
Subject: fs/affs: add validation block function
Subject: fs/affs: make affs exportable
Subject: fs/affs: use octal for permissions
Subject: fs/affs: add prefix to some functions
Subject: fs/affs/namei.c: forward declarations clean-up
Subject: fs/affs: make export work with cold dcache
Subject: config: android-recommended: disable aio support
Subject: config: android-base: enable hardened usercopy and kernel ASLR
Subject: lib/fonts/Kconfig: keep non-Sparc fonts listed together
Subject: initramfs: finish fput() before accessing any binary from initramfs
Subject: ipc/sem.c: avoid using spin_unlock_wait()
Subject: ipc/sem: add hysteresis
Subject: ipc/mqueue: add missing sparse annotation
Subject: ipc/shm: Fix shmat mmap nil-page protection
Subject: scatterlist: reorder compound boolean expression
Subject: scatterlist: do not disable IRQs in sg_copy_buffer
Subject: fs: add i_blocksize()
Subject: nilfs2: use nilfs_btree_node_size()
Subject: nilfs2: use i_blocksize()
Subject: scripts/spelling.txt: add "swith" pattern and fix typo instances
Subject: scripts/spelling.txt: add "swithc" pattern and fix typo instances
Subject: scripts/spelling.txt: add "an user" pattern and fix typo instances
Subject: scripts/spelling.txt: add "an union" pattern and fix typo instances
Subject: scripts/spelling.txt: add "an one" pattern and fix typo instances
Subject: scripts/spelling.txt: add "partiton" pattern and fix typo instances
Subject: scripts/spelling.txt: add "aligment" pattern and fix typo instances
Subject: scripts/spelling.txt: add "algined" pattern and fix typo instances
Subject: scripts/spelling.txt: add "efective" pattern and fix typo instances
Subject: scripts/spelling.txt: add "varible" pattern and fix typo instances
Subject: scripts/spelling.txt: add "embeded" pattern and fix typo instances
Subject: scripts/spelling.txt: add "againt" pattern and fix typo instances
Subject: scripts/spelling.txt: add "neded" pattern and fix typo instances
Subject: scripts/spelling.txt: add "unneded" pattern and fix typo instances
Subject: scripts/spelling.txt: add "intialization" pattern and fix typo instances
Subject: scripts/spelling.txt: add "initialiazation" pattern and fix typo instances
Subject: scripts/spelling.txt: add "comsume(r)" pattern and fix typo instances
Subject: scripts/spelling.txt: add "overrided" pattern and fix typo instances
Subject: scripts/spelling.txt: add "configuartion" pattern and fix typo instances
Subject: scripts/spelling.txt: add "applys" pattern and fix typo instances
Subject: scripts/spelling.txt: add "explictely" pattern and fix typo instances
Subject: scripts/spelling.txt: add "omited" pattern and fix typo instances
Subject: scripts/spelling.txt: add "disassocation" pattern and fix typo instances
Subject: scripts/spelling.txt: add "deintialize(d)" pattern and fix typo instances
Subject: scripts/spelling.txt: add "overwritting" pattern and fix typo instances
Subject: scripts/spelling.txt: add "overwriten" pattern and fix typo instances
Subject: scripts/spelling.txt: add "therfore" pattern and fix typo instances
Subject: scripts/spelling.txt: add "followings" pattern and fix typo instances
Subject: scripts/spelling.txt: add some typo-words
Subject: lib/vsprintf.c: remove %Z support
Subject: checkpatch: warn when formats use %Z and suggest %z
Subject: mm: add new mmgrab() helper
Subject: mm: add new mmget() helper
Subject: mm: use mmget_not_zero() helper
Subject: mm: clarify mm_struct.mm_{users,count} documentation
Subject: hfs: atomically read inode size
Subject: mm: add arch-independent testcases for RODATA
Subject: mm, x86: fix HIGHMEM64 && PARAVIRT build config for native_pud_clear()


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-03-10  0:15 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-03-10  0:15 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

26 fixes, based on ea6200e84182989a3cce9687cf79a23ac44ec4db:

Subject: userfaultfd: shmem: __do_fault requires VM_FAULT_NOPAGE
Subject: scripts/spelling.txt: add "disble(d)" pattern and fix typo instances
Subject: scripts/spelling.txt: add "overide" pattern and fix typo instances
Subject: powerpc/mm: handle protnone ptes on fork
Subject: power/mm: update pte_write and pte_wrprotect to handle savedwrite
Subject: x86, mm: fix gup_pte_range() vs DAX mappings
Subject: x86, mm: unify exit paths in gup_pte_range()
Subject: userfaultfd: non-cooperative: rollback userfaultfd_exit
Subject: userfaultfd: non-cooperative: robustness check
Subject: userfaultfd: non-cooperative: release all ctx in dup_userfaultfd_complete
Subject: include/linux/fs.h: fix unsigned enum warning with gcc-4.2
Subject: mm/vmstats: add thp_split_pud event for clarity
Subject: drivers/md/bcache/util.h: remove duplicate inclusion of blkdev.h
Subject: mm/cgroup: avoid panic when init with low memory
Subject: userfaultfd: non-cooperative: fix fork fctx->new memleak
Subject: userfaultfd: non-cooperative: userfaultfd_remove revalidate vma in MADV_DONTNEED
Subject: userfaultfd: selftest: vm: allow to build in vm/ directory
Subject: mm/memblock.c: fix memblock_next_valid_pfn()
Subject: rmap: fix NULL-pointer dereference on THP munlocking
Subject: thp: fix another corner case of munlock() vs. THPs
Subject: mm: do not call mem_cgroup_free() from within mem_cgroup_alloc()
Subject: kasan: resched in quarantine_remove_cache()
Subject: kasan: fix races in quarantine_remove_cache()
Subject: sh: cayman: IDE support fix
Subject: fat: fix using uninitialized fields of fat_inode/fsinfo_inode
Subject: userfaultfd: remove wrong comment from userfaultfd_ctx_get()




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-03-16 23:40 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-03-16 23:40 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

6 fixes, based on 69eea5a4ab9c705496e912b55a9d312325de19e6:

Subject: z3fold: fix spinlock unlocking in page reclaim
Subject: kasan: add a prototype of task_struct to avoid warning
Subject: mm, x86: fix native_pud_clear build error
Subject: mm: don't warn when vmalloc() fails due to a fatal signal
Subject: mm: add private lock to serialize memory hotplug operations
Subject: drivers core: remove assert_held_device_hotplug()




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-03-31 22:11 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-03-31 22:11 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

11 fixes, based on d4562267b995fa3917717cc7773dad9c1f1ca658:

Subject: mm: migrate: fix remove_migration_pte() for ksm pages
Subject: mm: move mm_percpu_wq initialization earlier
Subject: mm: rmap: fix huge file mmap accounting in the memcg stats
Subject: mm: workingset: fix premature shadow node shrinking with cgroups
Subject: mm, hugetlb: use pte_present() instead of pmd_present() in follow_huge_pmd()
Subject: mm: fix section name for .data..ro_after_init
Subject: hugetlbfs: initialize shared policy as part of inode allocation
Subject: kasan: report only the first error by default
Subject: mm/hugetlb.c: don't call region_abort if region_chg fails
Subject: drivers/rapidio/devices/tsi721.c: make module parameter variable name unique
Subject: kasan: do not sanitize kexec purgatory




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-04-07 23:04 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-04-07 23:04 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

10 fixes, based on 81d4bab4ce87228c37ab14a885438544af5c9ce6:

Subject: mm: fix page_vma_mapped_walk() for ksm pages
Subject: userfaultfd: report actual registered features in fdinfo
Subject: mm/page_alloc.c: fix print order in show_free_areas()
Subject: vmlinux.lds: add missing VMLINUX_SYMBOL macros
Subject: ptrace: fix PTRACE_LISTEN race corrupting task->state
Subject: mm, thp: fix setting of defer+madvise thp defrag mode
Subject: dax: fix radix tree insertion race
Subject: mm, swap_cgroup: reschedule when neeed in swap_cgroup_swapoff()
Subject: mailmap: update Yakir Yang email address
Subject: mm: move pcp and lru-pcp draining into single wq


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-04-13 21:56 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-04-13 21:56 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

11 fixes, based on 2760078203a6b46b96307f4b06030ab0b801c97e:

Subject: z3fold: fix page locking in z3fold_alloc()
Subject: thp: reduce indentation level in change_huge_pmd()
Subject: thp: fix MADV_DONTNEED vs. numa balancing race
Subject: mm: drop unused pmdp_huge_get_and_clear_notify()
Subject: thp: fix MADV_DONTNEED vs. MADV_FREE race
Subject: thp: fix MADV_DONTNEED vs clear soft dirty race
Subject: hugetlbfs: fix offset overflow in hugetlbfs mmap
Subject: zram: fix operator precedence to get offset
Subject: zram: do not use copy_page with non-page aligned address
Subject: zsmalloc: expand class bit
Subject: mailmap: add Martin Kepplinger's email

The presence of "thp: reduce indentation level in change_huge_pmd()" is
unfortunate.  But the patchset had been decently reviewed and tested
before we decided it was needed in -stable and I felt it best not to
churn things at the last minute.


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-04-20 21:37 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-04-20 21:37 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

2 fixes, based on f61143c45077df4fa78e2f1ba455a00bbe1d5b8c:

Subject: Revert "mm, page_alloc: only use per-cpu allocator for irq-safe requests"
Subject: mm: prevent NR_ISOLATE_* stats from going negative



^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-05-03 21:50 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-05-03 21:50 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- a few misc things

- most of MM

- KASAN updates

102 patches, based on 46f0537b1ecf672052007c97f102a7e6bf0791e4:

Subject: lib/dma-debug.c: make locking work for RT
Subject: scripts/spelling.txt: add several more common spelling mistakes
Subject: blackfin: bf609: let clk_disable() return immediately if clk is NULL
Subject: fs/ocfs2/cluster: use setup_timer
Subject: ocfs2: o2hb: revert hb threshold to keep compatible
Subject: fs/ocfs2/cluster: use offset_in_page() macro
Subject: slab: avoid IPIs when creating kmem caches
Subject: mm: fix 100% CPU kswapd busyloop on unreclaimable nodes
Subject: mm: fix check for reclaimable pages in PF_MEMALLOC reclaim throttling
Subject: mm: remove seemingly spurious reclaimability check from laptop_mode gating
Subject: mm: remove unnecessary reclaimability check from NUMA balancing target
Subject: mm: don't avoid high-priority reclaim on unreclaimable nodes
Subject: mm: don't avoid high-priority reclaim on memcg limit reclaim
Subject: mm: delete NR_PAGES_SCANNED and pgdat_reclaimable()
Subject: Revert "mm, vmscan: account for skipped pages as a partial scan"
Subject: mm: remove unnecessary back-off function when retrying page reclaim
Subject: mm/page-writeback.c: use setup_deferrable_timer
Subject: mm: delete unnecessary TTU_* flags
Subject: mm: don't assume anonymous pages have SwapBacked flag
Subject: mm: move MADV_FREE pages into LRU_INACTIVE_FILE list
Subject: mm: reclaim MADV_FREE pages
Subject: mm: fix lazyfree BUG_ON check in try_to_unmap_one()
Subject: mm: enable MADV_FREE for swapless system
Subject: proc: show MADV_FREE pages info in smaps
Subject: mm: memcontrol: provide shmem statistics
Subject: mm, swap: Fix a race in free_swap_and_cache()
Subject: mm: use is_migrate_highatomic() to simplify the code
Subject: mm: use is_migrate_isolate_page() to simplify the code
Subject: mm, vmstat: print non-populated zones in zoneinfo
Subject: mm, vmstat: suppress pcp stats for unpopulated zones in zoneinfo
Subject: lockdep: teach lockdep about memalloc_noio_save
Subject: lockdep: allow to disable reclaim lockup detection
Subject: xfs: abstract PF_FSTRANS to PF_MEMALLOC_NOFS
Subject: mm: introduce memalloc_nofs_{save,restore} API
Subject: xfs: use memalloc_nofs_{save,restore} instead of memalloc_noio*
Subject: jbd2: mark the transaction context with the scope GFP_NOFS context
Subject: jbd2: make the whole kjournald2 kthread NOFS safe
Subject: mm: tighten up the fault path a little
Subject: mm: remove rodata_test_data export, add pr_fmt
Subject: mm: do not use double negation for testing page flags
Subject: mm, vmscan: fix zone balance check in prepare_kswapd_sleep
Subject: mm, vmscan: only clear pgdat congested/dirty/writeback state when balanced
Subject: mm, vmscan: prevent kswapd sleeping prematurely due to mismatched classzone_idx
Subject: mm: page_alloc: __GFP_NOWARN shouldn't suppress stall warnings
Subject: mm/sparse: refine usemap_size() a little
Subject: mm/compaction: ignore block suitable after check large free page
Subject: mm/vmscan: more restrictive condition for retry in do_try_to_free_pages
Subject: mm: remove unncessary ret in page_referenced
Subject: mm: remove SWAP_DIRTY in ttu
Subject: mm: remove SWAP_MLOCK check for SWAP_SUCCESS in ttu
Subject: mm: make try_to_munlock() return void
Subject: mm: remove SWAP_MLOCK in ttu
Subject: mm: remove SWAP_AGAIN in ttu
Subject: mm: make ttu's return boolean
Subject: mm: make rmap_walk() return void
Subject: mm: make rmap_one boolean function
Subject: mm: remove SWAP_[SUCCESS|AGAIN|FAIL]
Subject: mm, swap: fix comment in __read_swap_cache_async
Subject: mm, swap: improve readability via make spin_lock/unlock balanced
Subject: mm, swap: avoid lock swap_avail_lock when held cluster lock
Subject: mm: enable page poisoning early at boot
Subject: include/linux/migrate.h: add arg names to prototype
Subject: mm/swap_slots.c: add warning if swap slots cache failed to initialize
Subject: mm: fix spelling error
Subject: userfaultfd: selftest: combine all cases into a single executable
Subject: oom: improve oom disable handling
Subject: mm/mmap: replace SHM_HUGE_MASK with MAP_HUGE_MASK inside mmap_pgoff
Subject: mm: vmscan: fix IO/refault regression in cache workingset transition
Subject: mm: memcontrol: clean up memory.events counting function
Subject: mm: memcontrol: re-use global VM event enum
Subject: mm: memcontrol: re-use node VM page state enum
Subject: mm: memcontrol: use node page state naming scheme for memcg
Subject: mm, swap: remove unused function prototype
Subject: Documentation: vm, add hugetlbfs reservation overview
Subject: mm/madvise.c: clean up MADV_SOFT_OFFLINE and MADV_HWPOISON
Subject: mm/madvise: move up the behavior parameter validation
Subject: mm/memory-failure.c: add page flag description in error paths
Subject: mm, page_alloc: remove debug_guardpage_minorder() test in warn_alloc()
Subject: zram: handle multiple pages attached bio's bvec
Subject: zram: partial IO refactoring
Subject: zram: use zram_slot_lock instead of raw bit_spin_lock op
Subject: zram: remove zram_meta structure
Subject: zram: introduce zram data accessor
Subject: zram: use zram_free_page instead of open-coded
Subject: zram: reduce load operation in page_same_filled
Subject: fs: fix data invalidation in the cleancache during direct IO
Subject: fs/block_dev: always invalidate cleancache in invalidate_bdev()
Subject: mm/truncate: bail out early from invalidate_inode_pages2_range() if mapping is empty
Subject: mm/truncate: avoid pointless cleancache_invalidate_inode() calls.
Subject: mm/gup.c: fix access_ok() argument type
Subject: mm/swapfile.c: fix swap space leak in error path of swap_free_entries()
Subject: mm: hwpoison: call shake_page() unconditionally
Subject: mm: hwpoison: call shake_page() after try_to_unmap() for mlocked page
Subject: kasan: introduce helper functions for determining bug type
Subject: kasan: unify report headers
Subject: kasan: change allocation and freeing stack traces headers
Subject: kasan: simplify address description logic
Subject: kasan: change report header
Subject: kasan: improve slab object description
Subject: kasan: print page description after stacks
Subject: kasan: improve double-free report format
Subject: kasan: separate report parts by empty lines


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-05-08 22:53 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-05-08 22:53 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- the rest of MM

- various misc things

- procfs updates

- lib/ updates

- checkpatch updates

- kdump/kexec updates

- add kvmalloc helpers, use them

- time helper updates for Y2038 issues.  We're almost ready to remove
  current_fs_time() but that awaits a btrfs merge.

- add tracepoints to DAX.


114 patches, based on 13e0988140374123bead1dd27c287354cb95108e:

Subject: mm, compaction: reorder fields in struct compact_control
Subject: mm, compaction: remove redundant watermark check in compact_finished()
Subject: mm, page_alloc: split smallest stolen page in fallback
Subject: mm, page_alloc: count movable pages when stealing from pageblock
Subject: mm, compaction: change migrate_async_suitable() to suitable_migration_source()
Subject: mm, compaction: add migratetype to compact_control
Subject: mm, compaction: restrict async compaction to pageblocks of same migratetype
Subject: mm, compaction: finish whole pageblock to reduce fragmentation
Subject: fs/proc/inode.c: remove cast from memory allocation
Subject: proc/sysctl: fix the int overflow for jiffies conversion
Subject: drivers/virt/fsl_hypervisor.c: use get_user_pages_unlocked()
Subject: jiffies.h: declare jiffies and jiffies_64 with ____cacheline_aligned_in_smp
Subject: make help: add tools help target
Subject: kernel/hung_task.c: defer showing held locks
Subject: drivers/misc/vmw_vmci/vmci_queue_pair.c: fix a couple integer overflow tests
Subject: drivers/misc/c2port/c2port-duramar2150.c: checking for NULL instead of IS_ERR()
Subject: Revert "lib/test_sort.c: make it explicitly non-modular"
Subject: lib: add module support to array-based sort tests
Subject: lib: add module support to linked list sorting tests
Subject: firmware/Makefile: force recompilation if makefile changes
Subject: checkpatch: remove obsolete CONFIG_EXPERIMENTAL checks
Subject: checkpatch: add ability to find bad uses of vsprintf %p<foo> extensions
Subject: checkpatch: improve EMBEDDED_FUNCTION_NAME test
Subject: checkpatch: allow space leading blank lines in email headers
Subject: checkpatch: avoid suggesting struct definitions should be const
Subject: checkpatch: improve MULTISTATEMENT_MACRO_USE_DO_WHILE test
Subject: checkpatch: clarify the EMBEDDED_FUNCTION_NAME message
Subject: checkpatch: special audit for revert commit line
Subject: checkpatch: improve k.alloc with multiplication and sizeof test
Subject: checkpatch: add --typedefsfile
Subject: checkpatch: improve the embedded function name test for patch contexts
Subject: checkpatch: improve the SUSPECT_CODE_INDENT test
Subject: reiserfs: use designated initializers
Subject: fork: free vmapped stacks in cache when cpus are offline
Subject: cpumask: make "nr_cpumask_bits" unsigned
Subject: crash: move crashkernel parsing and vmcore related code under CONFIG_CRASH_CORE
Subject: ia64: reuse append_elf_note() and final_note() functions
Subject: powerpc/fadump: remove dependency with CONFIG_KEXEC
Subject: powerpc/fadump: reuse crashkernel parameter for fadump memory reservation
Subject: powerpc/fadump: update documentation about crashkernel parameter reuse
Subject: pidns: disable pid allocation if pid_ns_prepare_proc() is failed in alloc_pid()
Subject: ns: allow ns_entries to have custom symlink content
Subject: pidns: expose task pid_ns_for_children to userspace
Subject: taskstats: add e/u/stime for TGID command
Subject: kcov: simplify interrupt check
Subject: lib/fault-inject.c: use correct check for interrupts
Subject: lib/zlib_inflate/inftrees.c: fix potential buffer overflow
Subject: initramfs: provide a way to ignore image provided by bootloader
Subject: initramfs: use vfs_stat/lstat directly
Subject: ipc/shm: some shmat cleanups
Subject: sysv,ipc: cacheline align kern_ipc_perm
Subject: mm: introduce kv[mz]alloc helpers
Subject: mm, vmalloc: properly track vmalloc users
Subject: mm: support __GFP_REPEAT in kvmalloc_node for >32kB
Subject: lib/rhashtable.c: simplify a strange allocation pattern
Subject: net/ipv6/ila/ila_xlat.c: simplify a strange allocation pattern
Subject: fs/xattr.c: zero out memory copied to userspace in getxattr
Subject: treewide: use kv[mz]alloc* rather than opencoded variants
Subject: net: use kvmalloc with __GFP_REPEAT rather than open coded variant
Subject: drivers/md/dm-ioctl.c: use kvmalloc rather than opencoded variant
Subject: drivers/md/bcache/super.c: use kvmalloc
Subject: mm, swap: use kvzalloc to allocate some swap data structures
Subject: mm, vmalloc: use __GFP_HIGHMEM implicitly
Subject: scripts/spelling.txt: add "memory" pattern and fix typos
Subject: scripts/spelling.txt: add regsiter -> register spelling mistake
Subject: scripts/spelling.txt: add "intialise(d)" pattern and fix typo instances
Subject: treewide: spelling: correct diffrent[iate] and banlance typos
Subject: treewide: move set_memory_* functions away from cacheflush.h
Subject: arm: use set_memory.h header
Subject: arm64: use set_memory.h header
Subject: s390: use set_memory.h header
Subject: x86: use set_memory.h header
Subject: agp: use set_memory.h header
Subject: drm: use set_memory.h header
Subject: drivers/hwtracing/intel_th/msu.c: use set_memory.h header
Subject: drivers/watchdog/hpwdt.c: use set_memory.h header
Subject: include/linux/filter.h: use set_memory.h header
Subject: kernel/module.c: use set_memory.h header
Subject: kernel/power/snapshot.c: use set_memory.h header
Subject: alsa: use set_memory.h header
Subject: drivers/misc/sram-exec.c: use set_memory.h header
Subject: drivers/video/fbdev/vermilion/vermilion.c: use set_memory.h header
Subject: drivers/staging/media/atomisp/pci/atomisp2: use set_memory.h
Subject: treewide: decouple cacheflush.h and set_memory.h
Subject: kref: remove WARN_ON for NULL release functions
Subject: drivers/scsi/megaraid: remove expensive inline from megasas_return_cmd
Subject: include/linux/uaccess.h: remove expensive WARN_ON in pagefault_disabled_dec
Subject: fs: semove set but not checked AOP_FLAG_UNINTERRUPTIBLE flag
Subject: Documentation/vm/transhuge.txt: fix trivial typos
Subject: format-security: move static strings to const
Subject: fs: f2fs: use ktime_get_real_seconds for sit_info times
Subject: trace: make trace_hwlat timestamp y2038 safe
Subject: fs: cifs: replace CURRENT_TIME by other appropriate apis
Subject: fs: ceph: CURRENT_TIME with ktime_get_real_ts()
Subject: fs: ufs: use ktime_get_real_ts64() for birthtime
Subject: fs: ubifs: replace CURRENT_TIME_SEC with current_time
Subject: lustre: replace CURRENT_TIME macro
Subject: apparmorfs: replace CURRENT_TIME with current_time()
Subject: gfs2: replace CURRENT_TIME with current_time
Subject: time: delete CURRENT_TIME_SEC and CURRENT_TIME
Subject: mm/huge_memory.c: use zap_deposited_table() more
Subject: mm/huge_memory.c: deposit a pgtable for DAX PMD faults when required
Subject: mm: prevent potential recursive reclaim due to clearing PF_MEMALLOC
Subject: mm: introduce memalloc_noreclaim_{save,restore}
Subject: treewide: convert PF_MEMALLOC manipulations to new helpers
Subject: mtd: nand: nandsim: convert to memalloc_noreclaim_*()
Subject: dax: add tracepoints to dax_iomap_pte_fault()
Subject: dax: add tracepoints to dax_pfn_mkwrite()
Subject: dax: add tracepoints to dax_load_hole()
Subject: dax: add tracepoints to dax_writeback_mapping_range()
Subject: dax: add tracepoint to dax_writeback_one()
Subject: dax: add tracepoint to dax_insert_mapping()
Subject: selftests/vm: add a test for virtual address range mapping
Subject: drivers/staging/ccree/ssi_hash.c: fix build with gcc-4.4.4




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-05-12 22:45 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-05-12 22:45 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

15 fixes, based on deac8429d62ca19c1571853e2a18f60e760ee04c:

Subject: hwpoison, memcg: forcibly uncharge LRU pages
Subject: time: delete current_fs_time()
Subject: mm, vmstat: Remove spurious WARN() during zoneinfo print
Subject: gcov: support GCC 7.1
Subject: mm/khugepaged: add missed tracepoint for collapse_huge_page_swapin
Subject: mm, vmalloc: fix vmalloc users tracking properly
Subject: Tigran has moved
Subject: dax: prevent invalidation of mapped DAX entries
Subject: mm: fix data corruption due to stale mmap reads
Subject: ext4: return to starting transaction in ext4_dax_huge_fault()
Subject: dax: fix data corruption when fault races with write
Subject: dax: fix PMD data corruption when fault races with write
Subject: mm, thp: copying user pages must schedule on collapse
Subject: mm: vmscan: scan until it finds eligible pages
Subject: mm, docs: update memory.stat description with workingset* entries




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-06-02 21:45 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-06-02 21:45 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

15 fixes, baed on c531577bcdac51225f50033e0c89644873f4dc6d:

Subject: ksm: prevent crash after write_protect_page fails
Subject: include/linux/gfp.h: fix  ___GFP_NOLOCKDEP value
Subject: frv: declare jiffies to be located in the .data section
Subject: mm: clarify why we want kmalloc before falling backto vmallock
Subject: initramfs: fix disabling of initramfs (and its compression)
Subject: slub/memcg: cure the brainless abuse of sysfs attributes
Subject: pcmcia: remove left-over %Z format
Subject: mm/page_alloc.c: make sure OOM victim can try allocations with no watermarks once
Subject: mm: avoid spurious 'bad pmd' warning messages
Subject: dax: fix race between colliding PMD & PTE entries
Subject: mm/migrate: fix refcount handling when !hugepage_migration_supported()
Subject: mlock: fix mlock count can not decrease in race condition
Subject: mm/hugetlb: report -EHWPOISON not -EFAULT when FOLL_HWPOISON is specified
Subject: mm: consider memblock reservations for deferred memory initialization sizing
Subject: scripts/gdb: make lx-dmesg command work (reliably)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-06-16 21:02 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-06-16 21:02 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

5 fixes, based on ab2789b72df3cf7a01e30636ea86cbbf44ba2e99:

Subject: mm/memory-failure.c: use compound_head() flags for huge pages
Subject: swap: cond_resched in swap_cgroup_prepare()
Subject: mm: numa: avoid waiting on freed migrated pages
Subject: userfaultfd: shmem: handle coredumping in handle_userfault()
Subject: mm: correct the comment when reclaimed pages exceed the scanned pages




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-06-23 22:08 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-06-23 22:08 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

8 fixes, based on a38371cba67539ce6a5d5324db34bc2ddaf66cc1:

Subject: mm, thp: remove cond_resched from __collapse_huge_page_copy
Subject: mm/vmalloc.c: huge-vmap: fail gracefully on unexpected huge vmap mappings
Subject: autofs: sanity check status reported with AUTOFS_DEV_IOCTL_FAIL
Subject: fs/dax.c: fix inefficiency in dax_writeback_mapping_range()
Subject: lib/cmdline.c: fix get_options() overflow while parsing ranges
Subject: slub: make sysfs file removal asynchronous
Subject: ocfs2: fix deadlock caused by recursive locking in xattr
Subject: fs/exec.c: account for argv/envp pointers


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-07-06 22:34 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-07-06 22:34 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- a few hotfixes

- various misc updates

- ocfs2 updates

- most of MM

108 patches, based on 9ced560b82606b35adb33a27012a148d418a4c1f:

Subject: compiler, clang: always inline when CONFIG_OPTIMIZE_INLINING is disabled
Subject: thp, mm: fix crash due race in MADV_FREE handling
Subject: kernel/extable.c: mark core_kernel_text notrace
Subject: mn10300: remove wrapper header for asm/device.h
Subject: mn10300: use generic fb.h
Subject: tile: provide default ioremap declaration
Subject: scripts/gen_initramfs_list.sh: teach INITRAMFS_ROOT_UID and INITRAMFS_ROOT_GID that -1 means "current user".
Subject: ramfs: clarify help text that compression applies to ramfs as well as legacy ramdisk.
Subject: scripts/spelling.txt: add a bunch more spelling mistakes
Subject: provide linux/set_memory.h
Subject: kernel/power/snapshot.c: use linux/set_memory.h
Subject: kernel/module.c: use linux/set_memory.h
Subject: include/linux/filter.h: use linux/set_memory.h
Subject: drivers/sh/intc/virq.c: delete an error message for a failed memory allocation in add_virq_to_pirq()
Subject: ocfs2: fix a static checker warning
Subject: ocfs2: use magic.h
Subject: ocfs2: free 'dummy_sc' in sc_fop_release() to prevent memory leak
Subject: ocfs2: constify attribute_group structures
Subject: fs/file.c: replace alloc_fdmem() with kvmalloc() alternative
Subject: mm/slub.c: remove a redundant assignment in ___slab_alloc()
Subject: mm/slub: reset cpu_slab's pointer in deactivate_slab()
Subject: mm/slub.c: pack red_left_pad with another int to save a word
Subject: mm/slub.c: wrap cpu_slab->partial in CONFIG_SLUB_CPU_PARTIAL
Subject: mm/slub.c: wrap kmem_cache->cpu_partial in config CONFIG_SLUB_CPU_PARTIAL
Subject: mm/slab.c: replace open-coded round-up code with ALIGN
Subject: mm: allow slab_nomerge to be set at build time
Subject: mm, sparsemem: break out of loops early
Subject: mm/mmap.c: mark protection_map as __ro_after_init
Subject: mm/vmscan.c: fix unsequenced modification and access warning
Subject: mm/nobootmem.c: return 0 when start_pfn equals end_pfn
Subject: ksm: introduce ksm_max_page_sharing per page deduplication limit
Subject: ksm: fix use after free with merge_across_nodes = 0
Subject: ksm: cleanup stable_node chain collapse case
Subject: ksm: swap the two output parameters of chain/chain_prune
Subject: ksm: optimize refile of stable_node_dup at the head of the chain
Subject: zram: count same page write as page_stored
Subject: mm/vmstat.c: standardize file operations variable names
Subject: mm, THP, swap: delay splitting THP during swap out
Subject: mm, THP, swap: unify swap slot free functions to put_swap_page
Subject: mm, THP, swap: move anonymous THP split logic to vmscan
Subject: mm, THP, swap: check whether THP can be split firstly
Subject: mm, THP, swap: enable THP swap optimization only if has compound map
Subject: mm: remove return value from init_currently_empty_zone
Subject: mm, memory_hotplug: use node instead of zone in can_online_high_movable
Subject: mm: drop page_initialized check from get_nid_for_pfn
Subject: mm, memory_hotplug: get rid of is_zone_device_section
Subject: mm, memory_hotplug: split up register_one_node()
Subject: mm, memory_hotplug: consider offline memblocks removable
Subject: mm: consider zone which is not fully populated to have holes
Subject: mm, compaction: skip over holes in __reset_isolation_suitable
Subject: mm: __first_valid_page skip over offline pages
Subject: mm, vmstat: skip reporting offline pages in pagetypeinfo
Subject: mm, memory_hotplug: do not associate hotadded memory to zones until online
Subject: mm, memory_hotplug: fix MMOP_ONLINE_KEEP behavior
Subject: mm, memory_hotplug: do not assume ZONE_NORMAL is default kernel zone
Subject: mm, memory_hotplug: replace for_device by want_memblock in arch_add_memory
Subject: mm, memory_hotplug: fix the section mismatch warning
Subject: mm, memory_hotplug: remove unused cruft after memory hotplug rework
Subject: kernel/exit.c: don't include unused userfaultfd_k.h
Subject: fs/userfaultfd.c: drop dead code
Subject: mm/madvise: enable (soft|hard) offline of HugeTLB pages at PGD level
Subject: mm/hugetlb/migration: use set_huge_pte_at instead of set_pte_at
Subject: mm/follow_page_mask: split follow_page_mask to smaller functions.
Subject: mm/hugetlb: export hugetlb_entry_migration helper
Subject: mm/follow_page_mask: add support for hugetlb pgd entries
Subject: mm/hugetlb: move default definition of hugepd_t earlier in the header
Subject: mm/follow_page_mask: add support for hugepage directory entry
Subject: powerpc/hugetlb: add follow_huge_pd implementation for ppc64
Subject: powerpc/mm/hugetlb: remove follow_huge_addr for powerpc
Subject: powerpc/hugetlb: enable hugetlb migration for ppc64
Subject: mm: zero hash tables in allocator
Subject: mm: update callers to use HASH_ZERO flag
Subject: mm: adaptive hash table scaling
Subject: mm/hugetlb: clean up ARCH_HAS_GIGANTIC_PAGE
Subject: powerpc/mm/hugetlb: add support for 1G huge pages
Subject: mm/page_alloc.c: mark bad_range() and meminit_pfn_in_nid() as __maybe_unused
Subject: mm: drop NULL return check of pte_offset_map_lock()
Subject: arm64: hugetlb: refactor find_num_contig()
Subject: arm64: hugetlb: remove spurious calls to huge_ptep_offset()
Subject: mm, gup: remove broken VM_BUG_ON_PAGE compound check for hugepages
Subject: mm, gup: ensure real head page is ref-counted when using hugepages
Subject: mm/hugetlb: add size parameter to huge_pte_offset()
Subject: mm/hugetlb: allow architectures to override huge_pte_clear()
Subject: mm/hugetlb: introduce set_huge_swap_pte_at() helper
Subject: mm: rmap: use correct helper when poisoning hugepages
Subject: mm, page_alloc: fix more premature OOM due to race with cpuset update
Subject: mm, mempolicy: stop adjusting current->il_next in mpol_rebind_nodemask()
Subject: mm, page_alloc: pass preferred nid instead of zonelist to allocator
Subject: mm, mempolicy: simplify rebinding mempolicies when updating cpusets
Subject: mm, cpuset: always use seqlock when changing task's nodemask
Subject: mm, mempolicy: don't check cpuset seqlock where it doesn't matter
Subject: mm: kmemleak: slightly reduce the size of some structures on 64-bit architectures
Subject: mm: kmemleak: factor object reference updating out of scan_block()
Subject: mm: kmemleak: treat vm_struct as alternative reference to vmalloc'ed objects
Subject: mm: per-cgroup memory reclaim stats
Subject: mm/oom_kill: count global and memory cgroup oom kills
Subject: mm/swapfile.c: sort swap entries before free
Subject: mm/zswap.c: delete an error message for a failed memory allocation in zswap_pool_create()
Subject: mm/zswap.c: improve a size determination in zswap_frontswap_init()
Subject: mm/zswap.c: delete an error message for a failed memory allocation in zswap_dstmem_prepare()
Subject: mm: vmstat: move slab statistics from zone to node counters
Subject: mm: memcontrol: use the node-native slab memory counters
Subject: mm: memcontrol: use generic mod_memcg_page_state for kmem pages
Subject: mm: memcontrol: per-lruvec stats infrastructure
Subject: mm: memcontrol: account slab stats per lruvec
Subject: mm, memory_hotplug: drop artificial restriction on online/offline
Subject: mm, memory_hotplug: drop CONFIG_MOVABLE_NODE
Subject: mm, memory_hotplug: move movable_node to the hotplug proper




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-07-10 22:46 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-07-10 22:46 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- most of the rest of MM

- KASAN updates

- lib/ updates

- checkpatch updates

- some binfmt_elf changes

- various misc bits


115 patches, based on 9eb788800510ae1a6bc419636a66071ee4deafd5:

Subject: swap: add block io poll in swapin path
Subject: mm, page_alloc: fallback to smallest page when not stealing whole pageblock
Subject: mm/memory.c: convert to DEFINE_DEBUGFS_ATTRIBUTE
Subject: mm, vmscan: avoid thrashing anon lru when free + file is low
Subject: mm/memory_hotplug.c: add NULL check to avoid potential NULL pointer dereference
Subject: mm/zsmalloc.c: fix -Wunneeded-internal-declaration warning
Subject: fs/buffer.c: make bh_lru_install() more efficient
Subject: mm: hugetlb: prevent reuse of hwpoisoned free hugepages
Subject: mm: hugetlb: return immediately for hugetlb page in __delete_from_page_cache()
Subject: mm: hwpoison: change PageHWPoison behavior on hugetlb pages
Subject: mm: hugetlb: soft-offline: dissolve source hugepage after successful migration
Subject: mm: soft-offline: dissolve free hugepage if soft-offlined
Subject: mm: hwpoison: introduce memory_failure_hugetlb()
Subject: mm: hwpoison: dissolve in-use hugepage in unrecoverable memory error
Subject: mm: hugetlb: delete dequeue_hwpoisoned_huge_page()
Subject: mm: hwpoison: introduce idenfity_page_state
Subject: mm, vmpressure: pass-through notification support
Subject: mm: make PR_SET_THP_DISABLE immediately active
Subject: mm/memcontrol: exclude @root from checks in mem_cgroup_low
Subject: vmalloc: show lazy-purged vma info in vmallocinfo
Subject: mm/cma.c: warn if the CMA area could not be activated
Subject: mm/hugetlb.c: warn the user when issues arise on boot due to hugepages
Subject: oom, trace: remove ENUM evaluation of COMPACTION_FEEDBACK
Subject: mm: improve readability of transparent_hugepage_enabled()
Subject: mm: always enable thp for dax mappings
Subject: include/linux/page_ref.h: ensure page_ref_unfreeze is ordered against prior accesses
Subject: mm/migrate.c: stabilise page count when migrating transparent hugepages
Subject: zram: use __sysfs_match_string() helper
Subject: mm, memory_hotplug: support movable_node for hotpluggable nodes
Subject: mm, memory_hotplug: simplify empty node mask handling in new_node_page
Subject: hugetlb, memory_hotplug: prefer to use reserved pages for migration
Subject: mm: unify new_node_page and alloc_migrate_target
Subject: mm, hugetlb: schedule when potentially allocating many hugepages
Subject: mm, memcg: fix potential undefined behavior in mem_cgroup_event_ratelimit()
Subject: mm/hugetlb.c: replace memfmt with string_get_size
Subject: mm/truncate.c: fix THP handling in invalidate_mapping_pages()
Subject: userfaultfd: non-cooperative: add madvise() event for MADV_FREE request
Subject: mm/oom_kill.c: add tracepoints for oom reaper-related events
Subject: mm, hugetlb: unclutter hugetlb allocation layers
Subject: hugetlb: add support for preferred node to alloc_huge_page_nodemask
Subject: mm, hugetlb, soft_offline: use new_page_nodemask for soft offline migration
Subject: mm: avoid taking zone lock in pagetypeinfo_showmixed()
Subject: mm: drop useless local parameters of __register_one_node()
Subject: fs/proc/task_mmu.c: remove obsolete comment in show_map_vma()
Subject: mm/page_alloc.c: eliminate unsigned confusion in __rmqueue_fallback
Subject: mm/swap_slots.c: don't disable preemption while taking the per-CPU cache
Subject: include/linux/mmzone.h: remove ancient/ambiguous comment
Subject: include/linux/backing-dev.h: simplify wb_stat_sum
Subject: mm: document highmem_is_dirtyable sysctl
Subject: mm/memory_hotplug.c: remove unused local zone_type from __remove_zone()
Subject: cma: fix calculation of aligned offset
Subject: mm/balloon_compaction.c: enqueue zero page to balloon device
Subject: mm/mmap.c: do not blow on PROT_NONE MAP_FIXED holes in the stack
Subject: mm/mmap.c: expand_downwards: don't require the gap if !vm_prev
Subject: mm/list_lru.c: fix list_lru_count_node() to be race free
Subject: fs/dcache.c: fix spin lockup issue on nlru->lock
Subject: mm: use dedicated helper to access rlimit value
Subject: mm: swap: provide lru_add_drain_all_cpuslocked()
Subject: mm/memory-hotplug: switch locking to a percpu rwsem
Subject: mm: disallow early_pfn_to_nid on configurations which do not implement it
Subject: zram: constify attribute_group structures.
Subject: mm/zsmalloc: simplify zs_max_alloc_size handling
Subject: mm/kasan/kasan_init.c: use kasan_zero_pud for p4d table
Subject: mm/kasan: get rid of speculative shadow checks
Subject: x86/kasan: don't allocate extra shadow memory
Subject: arm64/kasan: don't allocate extra shadow memory
Subject: mm/kasan: add support for memory hotplug
Subject: mm/kasan/kasan.c: rename XXX_is_zero to XXX_is_nonzero
Subject: kasan: make get_wild_bug_type() static
Subject: frv: remove wrapper header for asm/device.h
Subject: frv: use generic fb.h
Subject: frv: cmpxchg: implement cmpxchg64()
Subject: fs/proc/generic.c: switch to ida_simple_get/remove
Subject: asm-generic/bug.h: declare struct pt_regs; before function prototype
Subject: linux/bug.h: correct formatting of block comment
Subject: linux/bug.h: correct "(foo*)" should be "(foo *)"
Subject: linux/bug.h: correct "space required before that '-'"
Subject: bug: split BUILD_BUG stuff out into <linux/build_bug.h>
Subject: ARM: fix rd_size declaration
Subject: kernel/ksysfs.c: constify attribute_group structures.
Subject: kernel/groups.c: use sort library function
Subject: kernel/kallsyms.c: replace all_var with IS_ENABLED(CONFIG_KALLSYMS_ALL)
Subject: MAINTAINERS: give proc sysctl some maintainer love
Subject: lib/test_bitmap.c: add optimisation tests
Subject: bitmap: optimise bitmap_set and bitmap_clear of a single bit
Subject: include/linux/bitmap.h: turn bitmap_set and bitmap_clear into memset when possible
Subject: bitmap: use memcmp optimisation in more situations
Subject: lib/kstrtox.c: delete end-of-string test
Subject: lib/kstrtox.c: use "unsigned int" more
Subject: lib/interval_tree_test.c: allow the module to be compiled-in
Subject: lib/interval_tree_test.c: make test options module parameters
Subject: lib/interval_tree_test.c: allow users to limit scope of endpoint
Subject: lib/interval_tree_test.c: allow full tree search
Subject: lib/rhashtable.c: use kvzalloc() in bucket_table_alloc() when possible
Subject: lib/extable.c: use bsearch() library function in search_extable()
Subject: lib/bsearch.c: micro-optimize pivot position calculation
Subject: checkpatch: improve the unnecessary OOM message test
Subject: checkpatch: warn when a MAINTAINERS entry isn't [A-Z]:\t
Subject: checkpatch: [HLP]LIST_HEAD is also declaration
Subject: checkpatch: fix stepping through statements with $stat and ctx_statement_block
Subject: checkpatch: remove false warning for commit reference
Subject: checkpatch: improve tests for multiple line function definitions
Subject: checkpatch: silence perl 5.26.0 unescaped left brace warnings
Subject: checkpatch: change format of --color argument to --color[=WHEN]
Subject: checkpatch: improve macro reuse test
Subject: checkpatch: improve multi-line alignment test
Subject: fs, epoll: short circuit fetching events if thread has been killed
Subject: binfmt_elf: use ELF_ET_DYN_BASE only for PIE
Subject: arm: move ELF_ET_DYN_BASE to 4MB
Subject: arm64: move ELF_ET_DYN_BASE to 4GB / 4MB
Subject: powerpc: move ELF_ET_DYN_BASE to 4GB / 4MB
Subject: s390: reduce ELF_ET_DYN_BASE
Subject: binfmt_elf: safely increment argv pointers
Subject: kernel/signal.c: avoid undefined behaviour in kill_something_info
Subject: kernel/exit.c: avoid undefined behaviour when calling wait4()




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-07-12 21:32 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-07-12 21:32 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- various misc things

- kexec updates

- sysctl core updates

- scripts/gdb udpates

- checkpoint-restart updates

- ipc updates

- kernel/watchdog updates

- Kees's "rough equivalent to the glibc _FORTIFY_SOURCE=1 feature"

- "stackprotector: ascii armor the stack canary"

- more MM bits

- checkpatch updates


96 patches, based on 235b84fc862ae2637dc0dabada18d97f1bfc18e1:

Subject: include/linux/dcache.h: use unsigned chars in struct name_snapshot
Subject: kernel.h: handle pointers to arrays better in container_of()
Subject: mm/memory.c: mark create_huge_pmd() inline to prevent build failure
Subject: kernel/fork.c: virtually mapped stacks: do not disable interrupts
Subject: kexec: move vmcoreinfo out of the kernel's .bss section
Subject: powerpc/fadump: use the correct VMCOREINFO_NOTE_SIZE for phdr
Subject: kdump: protect vmcoreinfo data under the crash memory
Subject: kexec/kdump: minor Documentation updates for arm64 and Image
Subject: sysctl: fix lax sysctl_check_table() sanity check
Subject: sysctl: kdoc'ify sysctl_writes_strict
Subject: sysctl: fold sysctl_writes_strict checks into helper
Subject: sysctl: simplify unsigned int support
Subject: sysctl: add unsigned int range support
Subject: test_sysctl: add dedicated proc sysctl test driver
Subject: test_sysctl: add generic script to expand on tests
Subject: test_sysctl: test against PAGE_SIZE for int
Subject: test_sysctl: add simple proc_dointvec() case
Subject: test_sysctl: add simple proc_douintvec() case
Subject: test_sysctl: test against int proc_dointvec() array support
Subject: kernel/sysctl_binary.c: check name array length in deprecated_sysctl_warning()
Subject: random: do not ignore early device randomness
Subject: bfs: fix sanity checks for empty files
Subject: fs/Kconfig: kill CONFIG_PERCPU_RWSEM some more
Subject: scripts/gdb: add lx-fdtdump command
Subject: scripts/gdb: lx-dmesg: cast log_buf to void* for addr fetch
Subject: scripts/gdb: lx-dmesg: use explicit encoding=utf8 errors=replace
Subject: kfifo: clean up example to not use page_link
Subject: procfs: fdinfo: extend information about epoll target files
Subject: kcmp: add KCMP_EPOLL_TFD mode to compare epoll target files
Subject: kcmp: fs/epoll: wrap kcmp code with CONFIG_CHECKPOINT_RESTORE
Subject: fault-inject: support systematic fault injection
Subject: ipc/sem.c: remove sem_base, embed struct sem
Subject: ipc: merge ipc_rcu and kern_ipc_perm
Subject: include/linux/sem.h: correctly document sem_ctime
Subject: ipc: drop non-RCU allocation
Subject: ipc/sem: do not use ipc_rcu_free()
Subject: ipc/shm: do not use ipc_rcu_free()
Subject: ipc/msg: do not use ipc_rcu_free()
Subject: ipc/util: drop ipc_rcu_free()
Subject: ipc/sem: avoid ipc_rcu_alloc()
Subject: ipc/shm: avoid ipc_rcu_alloc()
Subject: ipc/msg: avoid ipc_rcu_alloc()
Subject: ipc/util: drop ipc_rcu_alloc()
Subject: ipc/sem.c: avoid ipc_rcu_putref for failed ipc_addid()
Subject: ipc/shm.c: avoid ipc_rcu_putref for failed ipc_addid()
Subject: ipc/msg.c: avoid ipc_rcu_putref for failed ipc_addid()
Subject: ipc: move atomic_set() to where it is needed
Subject: ipc/shm: remove special shm_alloc/free
Subject: ipc/msg: remove special msg_alloc/free
Subject: ipc/sem: drop __sem_free()
Subject: ipc/util.h: update documentation for ipc_getref() and ipc_putref()
Subject: net/netfilter/x_tables.c: use kvmalloc() in xt_alloc_table_info()
Subject: kernel/watchdog: remove unused declaration
Subject: kernel/watchdog: introduce arch_touch_nmi_watchdog()
Subject: kernel/watchdog: split up config options
Subject: kernel/watchdog: provide watchdog_nmi_reconfigure() for arch watchdogs
Subject: powerpc/64s: implement arch-specific hardlockup watchdog
Subject: efi: avoid fortify checks in EFI stub
Subject: kexec_file: adjust declaration of kexec_purgatory
Subject: IB/rxe: do not copy extra stack memory to skb
Subject: powerpc: don't fortify prom_init
Subject: powerpc: make feature-fixup tests fortify-safe
Subject: include/linux/string.h: add the option of fortified string.h functions
Subject: sh: mark end of BUG() implementation as unreachable
Subject: random,stackprotect: introduce get_random_canary function
Subject: fork,random: use get_random_canary() to set tsk->stack_canary
Subject: x86: ascii armor the x86_64 boot init stack canary
Subject: arm64: ascii armor the arm64 boot init stack canary
Subject: sh64: ascii armor the sh64 boot init stack canary
Subject: x86/mmap: properly account for stack randomization in mmap_base
Subject: arm64/mmap: properly account for stack randomization in mmap_base
Subject: powerpc,mmap: properly account for stack randomization in mmap_base
Subject: MIPS: do not use __GFP_REPEAT for order-0 request
Subject: mm, tree wide: replace __GFP_REPEAT by __GFP_RETRY_MAYFAIL with more useful semantic
Subject: xfs: map KM_MAYFAIL to __GFP_RETRY_MAYFAIL
Subject: mm: kvmalloc support __GFP_RETRY_MAYFAIL for all sizes
Subject: drm/i915: use __GFP_RETRY_MAYFAIL
Subject: mm, migration: do not trigger OOM killer when migrating memory
Subject: checkpatch: improve the STORAGE_CLASS test
Subject: ARM: KVM: move asmlinkage before type
Subject: ARM: HP Jornada 7XX: move inline before return type
Subject: CRIS: gpio: move inline before return type
Subject: FRV: tlbflush: move asmlinkage before return type
Subject: ia64: move inline before return type
Subject: ia64: sn: pci: move inline before type
Subject: m68k: coldfire: move inline before return type
Subject: MIPS: SMP: move asmlinkage before return type
Subject: sh: move inline before return type
Subject: x86/efi: move asmlinkage before return type
Subject: drivers: s390: move static and inline before return type
Subject: drivers: tty: serial: move inline before return type
Subject: USB: serial: safe_serial: move __inline__ before return type
Subject: video: fbdev: intelfb: move inline before return type
Subject: video: fbdev: omap: move inline before return type
Subject: ARM: samsung: usb-ohci: move inline before return type
Subject: writeback: rework wb_[dec|inc]_stat family of functions


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-07-14 21:46 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-07-14 21:46 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- a few leftovers

- fault-injector rework

- add a module loader test driver

13 patches, based on b86faee6d111294fa95a2e89b5f771b2da3c9782:

Subject: mm: fix overflow check in expand_upwards()
Subject: lib/atomic64_test.c: add a test that atomic64_inc_not_zero() returns an int
Subject: MAINTAINERS: move the befs tree to kernel.org
Subject: kernel/watchdog.c: use better pr_fmt prefix
Subject: fault-inject: automatically detect the number base for fail-nth write interface
Subject: fault-inject: parse as natural 1-based value for fail-nth write interface
Subject: fault-inject: make fail-nth read/write interface symmetric
Subject: fault-inject: simplify access check for fail-nth
Subject: fault-inject: add /proc/<pid>/fail-nth
Subject: xtensa: use generic fb.h
Subject: MAINTAINERS: give kmod some maintainer love
Subject: kmod: add test driver to stress test the module loader
Subject: kmod: throttle kmod thread limit


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-08-02 20:31 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-08-02 20:31 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

16 fixes, based on 4d3f5d04d69e9479a3df88ceb0e2cd8188a49366:

Subject: mm/hugetlb.c: __get_user_pages ignores certain follow_hugetlb_page errors
Subject: pid: kill pidhash_size in pidhash_init()
Subject: mm, mprotect: flush TLB if potentially racing with a parallel reclaim leaving stale TLB entries
Subject: userfaultfd: non-cooperative: notify about unmap of destination during mremap
Subject: kasan: avoid -Wmaybe-uninitialized warning
Subject: kthread: fix documentation build warning
Subject: zram: do not free pool->size_class
Subject: fortify: use WARN instead of BUG for now
Subject: mm/page_io.c: fix oops during block io poll in swapin path
Subject: mm: take memory hotplug lock within numa_zonelist_order_handler()
Subject: userfaultfd_zeropage: return -ENOSPC in case mm has gone
Subject: cpuset: fix a deadlock due to incomplete patching of cpusets_enabled()
Subject: ipc: add missing container_of()s for randstruct
Subject: userfaultfd: non-cooperative: flush event_wqh at release time
Subject: mm: allow page_cache_get_speculative in interrupt context
Subject: ocfs2: don't clear SGID when inheriting ACLs




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-08-10 22:23 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-08-10 22:23 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

21 fixes, based on 26273939ace935dd7553b31d279eab30b40f7b9a:

Subject: mm: fix global NR_SLAB_.*CLAIMABLE counter reads
Subject: mm: ratelimit PFNs busy info message
Subject: userfaultfd: hugetlbfs: remove superfluous page unlock in VM_SHARED case
Subject: test_kmod: fix spelling mistake: "EMTPY" -> "EMPTY"
Subject: test_kmod: fix bug which allows negative values on two config options
Subject: test_kmod: fix the lock in register_test_dev_kmod()
Subject: test_kmod: fix small memory leak on filesystem tests
Subject: fault-inject: fix wrong should_fail() decision in task context
Subject: mm: migrate: prevent racy access to tlb_flush_pending
Subject: mm: migrate: fix barriers around tlb_flush_pending
Subject: Revert "mm: numa: defer TLB flush for THP migration as long as possible"
Subject: mm: refactor TLB gathering API
Subject: mm: make tlb_flush_pending global
Subject: mm: fix MADV_[FREE|DONTNEED] TLB flush miss problem
Subject: mm: fix KSM data corruption
Subject: MAINTAINERS: copy virtio on balloon_compaction.c
Subject: mm/balloon_compaction.c: don't zero ballooned pages
Subject: mm: fix list corruptions on shmem shrinklist
Subject: rmap: do not call mmu_notifier_invalidate_page() under ptl
Subject: zram: rework copy of compressor name in comp_algorithm_store()
Subject: userfaultfd: replace ENOSPC with ESRCH in case mm has gone during copy/zeropage


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-08-18 22:15 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-08-18 22:15 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

14 fixes, based on 039a8e38473323ed9f6c4415b4c3a36777efac34:

Subject: mm: memcontrol: fix NULL pointer crash in test_clear_page_writeback()
Subject: kernel/watchdog: fix Kconfig constraints for perf hardlockup watchdog
Subject: wait: add wait_event_killable_timeout()
Subject: kmod: fix wait on recursive loop
Subject: test_kmod: fix description for -s -and -c parameters
Subject: mm: discard memblock data later
Subject: slub: fix per memcg cache leak on css offline
Subject: mm: fix double mmap_sem unlock on MMF_UNSTABLE enforced SIGBUS
Subject: mm, oom: fix potential data corruption when oom_reaper races with writer
Subject: signal: don't remove SIGNAL_UNKILLABLE for traced tasks.
Subject: mm/cma_debug.c: fix stack corruption due to sprintf usage
Subject: mm/mempolicy: fix use after free when calling get_mempolicy
Subject: mm/vmalloc.c: don't unconditonally use __GFP_HIGHMEM
Subject: mm: revert x86_64 and arm64 ELF_ET_DYN_BASE base changes


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-08-25 22:55 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-08-25 22:55 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

6 fixes, based on 90a6cd503982bfd33ce8c70eb49bd2dd33bc6325:

Subject: PM/hibernate: touch NMI watchdog when creating snapshot
Subject: mm, shmem: fix handling /sys/kernel/mm/transparent_hugepage/shmem_enabled
Subject: dax: fix deadlock due to misaligned PMD faults
Subject: mm/madvise.c: fix freeing of locked page with MADV_FREE
Subject: fork: fix incorrect fput of ->exe_file causing use-after-free
Subject: mm/memblock.c: reversed logic in memblock_discard()




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-08-31 23:15 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-08-31 23:15 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

6 fixes, baed on 42ff72cf27027fa28dd79acabe01d9196f1480a7:

Subject: mm,page_alloc: don't call __node_reclaim() with oom_lock held.
Subject: kernel/kthread.c: kthread_worker: don't hog the cpu
Subject: mm, uprobes: fix multiple free of ->uprobes_state.xol_area
Subject: mm, madvise: ensure poisoned pages are removed from per-cpu lists
Subject: include/linux/compiler.h: don't perform compiletime_assert with -O0
Subject: scripts/dtc: fix '%zx' warning




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-09-06 23:17 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-09-06 23:17 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- various misc bits

- DAX updates

- OCFS2

- most of MM

119 patches, based on e7d0c41ecc2e372a81741a30894f556afec24315:

Subject: metag/numa: remove the unused parent_node() macro
Subject: mm: add vm_insert_mixed_mkwrite()
Subject: dax: relocate some dax functions
Subject: dax: use common 4k zero page for dax mmap reads
Subject: dax: remove DAX code from page_cache_tree_insert()
Subject: dax: move all DAX radix tree defs to fs/dax.c
Subject: dax: explain how read(2)/write(2) addresses are validated
Subject: dax: use PG_PMD_COLOUR instead of open coding
Subject: dax: initialize variable pfn before using it
Subject: modpost: simplify sec_name()
Subject: ocfs2: make ocfs2_set_acl() static
Subject: ocfs2: clean up some dead code
Subject: slub: tidy up initialization ordering
Subject: mm: add SLUB free list pointer obfuscation
Subject: mm/slub.c: add a naive detection of double free or corruption
Subject: mm: track actual nr_scanned during shrink_slab()
Subject: drm/i915: wire up shrinkctl->nr_scanned
Subject: mm/memory_hotplug: just build zonelist for newly added node
Subject: mm, memory_hotplug: display allowed zones in the preferred ordering
Subject: mm, memory_hotplug: remove zone restrictions
Subject: zram: clean up duplicated codes in __zram_bvec_write
Subject: zram: inline zram_compress
Subject: zram: rename zram_decompress_page to __zram_bvec_read
Subject: zram: add interface to specif backing device
Subject: zram: add free space management in backing device
Subject: zram: identify asynchronous IO's return value
Subject: zram: write incompressible pages to backing device
Subject: zram: read page from backing device
Subject: zram: add config and doc file for writeback feature
Subject: mm, page_alloc: rip out ZONELIST_ORDER_ZONE
Subject: mm, page_alloc: remove boot pageset initialization from memory hotplug
Subject: mm, page_alloc: do not set_cpu_numa_mem on empty nodes initialization
Subject: mm, memory_hotplug: drop zone from build_all_zonelists
Subject: mm, memory_hotplug: remove explicit build_all_zonelists from try_online_node
Subject: mm, page_alloc: simplify zonelist initialization
Subject: mm, page_alloc: remove stop_machine from build_all_zonelists
Subject: mm, memory_hotplug: get rid of zonelists_mutex
Subject: mm, sparse, page_ext: drop ugly N_HIGH_MEMORY branches for allocations
Subject: mm, page_owner: make init_pages_in_zone() faster
Subject: mm, page_ext: periodically reschedule during page_ext_init()
Subject: mm, page_owner: don't grab zone->lock for init_pages_in_zone()
Subject: mm/mremap: fail map duplication attempts for private mappings
Subject: mm/gup: make __gup_device_* require THP
Subject: mm/hugetlb.c: make huge_pte_offset() consistent and document behaviour
Subject: mm: always flush VMA ranges affected by zap_page_range
Subject: zsmalloc: zs_page_migrate: skip unnecessary loops but not return -EBUSY if zspage is not inuse
Subject: mm, vmscan: do not loop on too_many_isolated for ever
Subject: fscache: remove unused ->now_uncached callback
Subject: mm: make pagevec_lookup() update index
Subject: mm: implement find_get_pages_range()
Subject: fs: fix performance regression in clean_bdev_aliases()
Subject: ext4: use pagevec_lookup_range() in ext4_find_unwritten_pgoff()
Subject: ext4: use pagevec_lookup_range() in writeback code
Subject: hugetlbfs: use pagevec_lookup_range() in remove_inode_hugepages()
Subject: fs: use pagevec_lookup_range() in page_cache_seek_hole_data()
Subject: mm: use find_get_pages_range() in filemap_range_has_page()
Subject: mm: remove nr_pages argument from pagevec_lookup{,_range}()
Subject: mm, memcg: reset memory.low during memcg offlining
Subject: cgroup: revert fa06235b8eb0 ("cgroup: reset css on destruction")
Subject: mm/ksm.c: constify attribute_group structures
Subject: mm/slub.c: constify attribute_group structures
Subject: mm/page_idle.c: constify attribute_group structures
Subject: mm/huge_memory.c: constify attribute_group structures
Subject: mm/hugetlb.c: constify attribute_group structures
Subject: mm: memcontrol: use int for event/state parameter in several functions
Subject: mm, THP, swap: support to clear swap cache flag for THP swapped out
Subject: mm, THP, swap: support to reclaim swap space for THP swapped out
Subject: mm, THP, swap: make reuse_swap_page() works for THP swapped out
Subject: mm, THP, swap: don't allocate huge cluster for file backed swap device
Subject: block, THP: make block_device_operations.rw_page support THP
Subject: mm: test code to write THP to swap device as a whole
Subject: mm, THP, swap: support splitting THP for THP swap out
Subject: memcg, THP, swap: support move mem cgroup charge for THP swapped out
Subject: memcg, THP, swap: avoid to duplicated charge THP in swap cache
Subject: memcg, THP, swap: make mem_cgroup_swapout() support THP
Subject: mm, THP, swap: delay splitting THP after swapped out
Subject: mm, THP, swap: add THP swapping out fallback counting
Subject: shmem: shmem_charge: verify max_block is not exceeded before inode update
Subject: shmem: introduce shmem_inode_acct_block
Subject: userfaultfd: shmem: add shmem_mfill_zeropage_pte for userfaultfd support
Subject: userfaultfd: mcopy_atomic: introduce mfill_atomic_pte helper
Subject: userfaultfd: shmem: wire up shmem_mfill_zeropage_pte
Subject: userfaultfd: report UFFDIO_ZEROPAGE as available for shmem VMAs
Subject: userfaultfd: selftest: enable testing of UFFDIO_ZEROPAGE for shmem
Subject: fs/sync.c: remove unnecessary NULL f_mapping check in sync_file_range
Subject: include/linux/fs.h: remove unneeded forward definition of mm_struct
Subject: mm: hugetlb: define system call hugetlb size encodings in single file
Subject: mm: arch: consolidate mmap hugetlb size encodings
Subject: mm: shm: use new hugetlb size encoding definitions
Subject: mm: rename global_page_state to global_zone_page_state
Subject: mm: userfaultfd: add feature to request for a signal delivery
Subject: userfaultfd: selftest: add tests for UFFD_FEATURE_SIGBUS feature
Subject: userfaultfd: selftest: exercise UFFDIO_COPY/ZEROPAGE -EEXIST
Subject: userfaultfd: selftest: explicit failure if the SIGBUS test failed
Subject: userfaultfd: call userfaultfd_unmap_prep only if __split_vma succeeds
Subject: userfaultfd: provide pid in userfault msg
Subject: userfaultfd: provide pid in userfault msg - add feat union
Subject: mm, hugetlb: do not allocate non-migrateable gigantic pages from movable zones
Subject: mm/vmstat: fix divide error at __fragmentation_index
Subject: mm/vmalloc.c: halve the number of comparisons performed in pcpu_get_vm_areas()
Subject: mm, devm_memremap_pages: use multi-order radix for ZONE_DEVICE lookups
Subject: mm/shmem: add hugetlbfs support to memfd_create()
Subject: selftests/memfd: add memfd_create hugetlbfs selftest
Subject: mm/vmstat.c: fix wrong comment
Subject: mm/vmalloc.c: don't reinvent the wheel but use existing llist API
Subject: mm, swap: add swap readahead hit statistics
Subject: mm, swap: fix swap readahead marking
Subject: mm, swap: VMA based swap readahead
Subject: mm, swap: add sysfs interface for VMA based swap readahead
Subject: mm, swap: don't use VMA based swap readahead if HDD is used as swap
Subject: z3fold: use per-cpu unbuddied lists
Subject: mm, oom: do not rely on TIF_MEMDIE for memory reserves access
Subject: mm: replace TIF_MEMDIE checks by tsk_is_oom_victim
Subject: swap: choose swap device according to numa node
Subject: mm: oom: let oom_reap_task and exit_mmap run concurrently
Subject: mm: hugetlb: clear target sub-page last when clearing huge page
Subject: mm: add /proc/pid/smaps_rollup
Subject: x86,mpx: make mpx depend on x86-64 to free up VMA flag
Subject: mm,fork: introduce MADV_WIPEONFORK




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-09-08 23:10 Andrew Morton
       [not found] ` <CA+55aFwRXB5_kSuN7o+tqN6Eft6w5oZuLG3B8Rns=0ZZa2ihgA@mail.gmail.com>
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2017-09-08 23:10 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

126 patches, based on 015a9e66b9b8c1f28097ed09bf9350708e26249a:

- most of the rest of MM

- a small number of misc things

- lib/ updates

- checkpatch

- autofs updates

- ipc/ updates


Subject: mm: mempolicy: add queue_pages_required()
Subject: mm: x86: move _PAGE_SWP_SOFT_DIRTY from bit 7 to bit 1
Subject: mm: thp: introduce separate TTU flag for thp freezing
Subject: mm: thp: introduce CONFIG_ARCH_ENABLE_THP_MIGRATION
Subject: mm: thp: enable thp migration in generic path
Subject: mm: thp: check pmd migration entry in common path
Subject: mm: soft-dirty: keep soft-dirty bits over thp migration
Subject: mm: mempolicy: mbind and migrate_pages support thp migration
Subject: mm: migrate: move_pages() supports thp migration
Subject: mm: memory_hotplug: memory hotremove supports thp migration
Subject: hmm: heterogeneous memory management documentation
Subject: mm/hmm: heterogeneous memory management (HMM for short)
Subject: mm/hmm/mirror: mirror process address space on device with HMM helpers
Subject: mm/hmm/mirror: helper to snapshot CPU page table
Subject: mm/hmm/mirror: device page fault handler
Subject: mm/memory_hotplug: introduce add_pages
Subject: mm/ZONE_DEVICE: new type of ZONE_DEVICE for unaddressable memory
Subject: mm/ZONE_DEVICE: special case put_page() for device private pages
Subject: mm/memcontrol: allow to uncharge page without using page->lru field
Subject: mm/memcontrol: support MEMORY_DEVICE_PRIVATE
Subject: mm/hmm/devmem: device memory hotplug using ZONE_DEVICE
Subject: mm/hmm/devmem: dummy HMM device for ZONE_DEVICE memory
Subject: mm/migrate: new migrate mode MIGRATE_SYNC_NO_COPY
Subject: mm/migrate: new memory migration helper for use with device memory
Subject: mm/migrate: migrate_vma() unmap page from vma while collecting pages
Subject: mm/migrate: support un-addressable ZONE_DEVICE page in migration
Subject: mm/migrate: allow migrate_vma() to alloc new page on empty entry
Subject: mm/device-public-memory: device memory cache coherent with CPU
Subject: mm/hmm: add new helper to hotplug CDM memory region
Subject: mm/hmm: avoid bloating arch that do not make use of HMM
Subject: mm/hmm: fix build when HMM is disabled
Subject: mm: remove useless vma parameter to offset_il_node
Subject: userfaultfd: non-cooperative: closing the uffd without triggering SIGBUS
Subject: mm/memory.c: remove reduntant check for write access
Subject: mm: change the call sites of numa statistics items
Subject: mm: update NUMA counter threshold size
Subject: mm: consider the number in local CPUs when reading NUMA stats
Subject: mm/mlock.c: use page_zone() instead of page_zone_id()
Subject: mm/zsmalloc.c: change stat type parameter to int
Subject: mm: fadvise: avoid fadvise for fs without backing device
Subject: mm: memcontrol: use per-cpu stocks for socket memory uncharging
Subject: mm/memory.c: fix mem_cgroup_oom_disable() call missing
Subject: mm/sparse.c: fix typo in online_mem_sections
Subject: tools/testing/selftests/kcmp/kcmp_test.c: add KCMP_EPOLL_TFD testing
Subject: mm/page_alloc.c: apply gfp_allowed_mask before the first allocation attempt
Subject: mm: kvfree the swap cluster info if the swap file is unsatisfactory
Subject: mm/swapfile.c: fix swapon frontswap_map memory leak on error
Subject: mm/mempolicy.c: remove BUG_ON() checks for VMA inside mpol_misplaced()
Subject: fs, proc: remove priv argument from is_stack
Subject: proc: uninline proc_create()
Subject: fs, proc: unconditional cond_resched when reading smaps
Subject: linux/kernel.h: move DIV_ROUND_DOWN_ULL() macro
Subject: lib/string.c: add multibyte memset functions
Subject: lib/string.c: add testcases for memset16/32/64
Subject: x86: implement memset16, memset32 & memset64
Subject: ARM: implement memset32 & memset64
Subject: alpha: add support for memset16
Subject: drivers/block/zram/zram_drv.c: convert to using memset_l
Subject: drivers/scsi/sym53c8xx_2/sym_hipd.c: convert to use memset32
Subject: vga: optimise console scrolling
Subject: treewide: make "nr_cpu_ids" unsigned
Subject: arch: define CPU_BIG_ENDIAN for all fixed big endian archs
Subject: arch/microblaze: add choice for endianness and update Makefile
Subject: include: warn for inconsistent endian config definition
Subject: bitops: avoid integer overflow in GENMASK(_ULL)
Subject: rbtree: cache leftmost node internally
Subject: rbtree: optimize root-check during rebalancing loop
Subject: rbtree: add some additional comments for rebalancing cases
Subject: lib/rbtree_test.c: make input module parameters
Subject: lib/rbtree_test.c: add (inorder) traversal test
Subject: lib/rbtree_test.c: support rb_root_cached
Subject: sched/fair: replace cfs_rq->rb_leftmost
Subject: sched/deadline: replace earliest dl and rq leftmost caching
Subject: locking/rtmutex: replace top-waiter and pi_waiters leftmost caching
Subject: block/cfq: replace cfq_rb_root leftmost caching
Subject: lib/interval_tree: fast overlap detection
Subject: lib/interval-tree: correct comment wrt generic flavor
Subject: procfs: use faster rb_first_cached()
Subject: fs/epoll: use faster rb_first_cached()
Subject: mem/memcg: cache rightmost node
Subject: block/cfq: cache rightmost rb_node
Subject: lib/hexdump.c: return -EINVAL in case of error in hex2bin()
Subject: lib: add test module for CONFIG_DEBUG_VIRTUAL
Subject: lib/bitmap.c: make bitmap_parselist() thread-safe and much faster
Subject: lib/test_bitmap.c: add test for bitmap_parselist()
Subject: bitmap: introduce BITMAP_FROM_U64()
Subject: lib/rhashtable: fix comment on locks_mul default value
Subject: lib/string.c: check for kmalloc() failure
Subject: lib/cmdline.c: remove meaningless comment
Subject: radix-tree: must check __radix_tree_preload() return value
Subject: lib/oid_registry.c: X.509: fix the buffer overflow in the utility function for OID string
Subject: checkpatch: add --strict check for ifs with unnecessary parentheses
Subject: checkpatch: fix typo in comment
Subject: checkpatch: rename variables to avoid confusion
Subject: checkpatch: add 6 missing types to --list-types
Subject: binfmt_flat: delete two error messages for a failed memory allocation in decompress_exec()
Subject: init: move stack canary initialization after setup_arch
Subject: init/main.c: extract early boot entropy from the passed cmdline
Subject: autofs: fix AT_NO_AUTOMOUNT not being honored
Subject: autofs: make disc device user accessible
Subject: autofs: make dev ioctl version and ismountpoint user accessible
Subject: autofs: remove unused AUTOFS_IOC_EXPIRE_DIRECT/INDIRECT
Subject: autofs: non functional header inclusion cleanup
Subject: autofs: use AUTOFS_DEV_IOCTL_SIZE
Subject: autofs: drop wrong comment
Subject: autofs: use unsigned int/long instead of uint/ulong for ioctl args
Subject: vfat: deduplicate hex2bin()
Subject: test_kmod: remove paranoid UINT_MAX check on uint range processing
Subject: test_kmod: flip INT checks to be consistent
Subject: kmod: split out umh code into its own file
Subject: MAINTAINERS: clarify kmod is just a kernel module loader
Subject: kmod: split off umh headers into its own file
Subject: kmod: move #ifdef CONFIG_MODULES wrapper to Makefile
Subject: cpumask: make cpumask_next() out-of-line
Subject: drivers/pps: aesthetic tweaks to PPS-related content
Subject: drivers/pps: use surrounding "if PPS" to remove numerous dependency checks
Subject: m32r: defconfig: cleanup from old Kconfig options
Subject: mn10300: defconfig: cleanup from old Kconfig options
Subject: sh: defconfig: cleanup from old Kconfig options
Subject: kcov: support compat processes
Subject: ipc: convert ipc_namespace.count from atomic_t to refcount_t
Subject: ipc: convert sem_undo_list.refcnt from atomic_t to refcount_t
Subject: ipc: convert kern_ipc_perm.refcount from atomic_t to refcount_t
Subject: ipc/sem: drop sem_checkid helper
Subject: ipc/sem: play nicer with large nsops allocations
Subject: ipc: optimize semget/shmget/msgget for lots of keys




^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
       [not found]   ` <CA+55aFw+z3HDT4s1C41j=d5_0QTSu8NLSSpnk_jxZ39w34xgnA@mail.gmail.com>
@ 2017-09-09 18:09     ` Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-09-09 18:09 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Stephen Rothwell, mm-commits

On Sat, 9 Sep 2017 10:40:21 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Fri, Sep 8, 2017 at 6:27 PM, Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > Git does all of this right. Your quilt scripts are garbage. Please
> > please start fixing this.
> >
> > I've worked around it by just editing the patch, but..
> 
> .. and I just realized that your patches must obviously be ok in your
> tree, since you can apply them, and apparently Stephen can apply them
> in linux-next.
> 
> I'm assuming Stephen applies them from your quilt series directly, and
> thus never saw the problem with bad locale conversion.
> 
> Maybe we should just change the workflow, with you sending me a raw
> tar-ball of the quilt series (or whatever the equivalent quilt
> "bundle" is) as an attachment and we forego the traditional
> patch-bombing model?
> 
> That would avoid the locale issues with email.
> 

Leave it with me - I need to sit down and have fiddle for a while.  For
some reason I can't recall I had LOCALE=C set, and using en_US.UTF-8
changes things quite a lot.

And I need to figure out why the heck I did this:

iconv -f latin1 | mailx -s "$subject" "$all"

!

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-09-13 23:28 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-09-13 23:28 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


A few leftovers.  Now with fixed up locale stuff, fingers crossed.

9 patches, based on 46c1e79fee417f151547aa46fae04ab06cb666f4:

Subject: idr: remove WARN_ON_ONCE() when trying to replace negative ID
Subject: drivers/media/cec/cec-adap.c: fix build with gcc-4.4.4
Subject: procfs: remove unused variable
Subject: lib/test_bitmap.c: use ULL suffix for 64-bit constants
Subject: fscache: fix fscache_objlist_show format processing
Subject: IB/mlx4: fix sprintf format warning
Subject: mm: treewide: remove GFP_TEMPORARY allocation flag
Subject: arm64: stacktrace: avoid listing stacktrace functions in stacktrace
Subject: mm, page_owner: skip unnecessary stack_trace entries




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-10-03 23:14 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-10-03 23:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


A lot of stuff, sorry about that.  A week on a beach, then a bunch of
time catching up then more time letting it bake in -next.  Shan't do
that again!

51 fixes, based on d81fa669e3de7eb8a631d7d95dac5fbcb2bf9d4e:

Subject: alpha: fix build failures
Subject: kernel/params.c: align add_sysfs_param documentation with code
Subject: scripts/spelling.txt: add more spelling mistakes to spelling.txt
Subject: include/linux/mm.h: fix typo in VM_MPX definition
Subject: ksm: fix unlocked iteration over vmas in cmp_and_merge_page()
Subject: mm, hugetlb, soft_offline: save compound page order before page migration
Subject: sh: sh7722: remove nonexistent GPIO_PTQ7 to fix pinctrl registration
Subject: sh: sh7757: remove nonexistent GPIO_PT[JLNQ]7_RESV to fix pinctrl registration
Subject: sh: sh7264: remove nonexistent GPIO_PH[0-7] to fix pinctrl registration
Subject: sh: sh7269: remove nonexistent GPIO_PH[0-7] to fix pinctrl registration
Subject: z3fold: fix potential race in z3fold_reclaim_page
Subject: mm, oom_reaper: skip mm structs with mmu notifiers
Subject: mm, memcg: remove hotplug locking from try_charge
Subject: mm/memcg: avoid page count check for zone device
Subject: android: binder: drop lru lock in isolate callback
Subject: mm,compaction: serialize waitqueue_active() checks (for real)
Subject: z3fold: fix stale list handling
Subject: mm: meminit: mark init_reserved_page as __meminit
Subject: rapidio: remove global irq spinlocks from the subsystem
Subject: mm: fix RODATA_TEST failure "rodata_test: test data was not read only"
Subject: zram: fix null dereference of handle
Subject: m32r: define CPU_BIG_ENDIAN
Subject: mm: have filemap_check_and_advance_wb_err clear AS_EIO/AS_ENOSPC
Subject: mm: avoid marking swap cached page as lazyfree
Subject: mm: fix data corruption caused by lazyfree page
Subject: mm/device-public-memory: fix edge case in _vm_normal_page()
Subject: userfaultfd: non-cooperative: fix fork use after free
Subject: exec: load_script: kill the onstack interp[BINPRM_BUF_SIZE] array
Subject: exec: binfmt_misc: don't nullify Node->dentry in kill_node()
Subject: exec: binfmt_misc: shift filp_close(interp_file) from kill_node() to bm_evict_inode()
Subject: exec: binfmt_misc: remove the confusing e->interp_file != NULL checks
Subject: exec: binfmt_misc: fix race between load_misc_binary() and kill_node()
Subject: exec: binfmt_misc: kill the onstack iname[BINPRM_BUF_SIZE] array
Subject: lib/lz4: make arrays static const, reduces object code size
Subject: include/linux/bitfield.h: remove 32bit from FIELD_GET comment block
Subject: kernel/sysctl.c: remove duplicate UINT_MAX check on do_proc_douintvec_conv()
Subject: mm: memcontrol: use vmalloc fallback for large kmem memcg arrays
Subject: lib/idr.c: fix comment for idr_replace()
Subject: mm, memory_hotplug: add scheduling point to __add_pages
Subject: mm, page_alloc: add scheduling point to memmap_init_zone
Subject: memremap: add scheduling point to devm_memremap_pages
Subject: kernel/kcmp.c: drop branch leftover typo
Subject: mm/memory_hotplug: change pfn_to_section_nr/section_nr_to_pfn macro to inline function
Subject: mm/memory_hotplug: define find_{smallest|biggest}_section_pfn as unsigned long
Subject: kernel/params.c: fix the maximum length in param_get_string
Subject: kernel/params.c: fix an overflow in param_attr_show
Subject: kernel/params.c: improve STANDARD_PARAM_DEF readability
Subject: lib/ratelimit.c: use deferred printk() version
Subject: m32r: fix build failure
Subject: checkpatch: fix ignoring cover-letter logic
Subject: include/linux/fs.h: fix comment about struct address_space




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-10-13 22:57 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-10-13 22:57 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

18 fixes, based on 997301a860fca1a05ab8e383a8039b65f8abeb1e:

Subject: mm/migrate: fix indexing bug (off by one) and avoid out of bound access
Subject: lib/Kconfig.debug: kernel hacking menu: runtime testing: keep tests together
Subject: mm/madvise.c: add description for MADV_WIPEONFORK and MADV_KEEPONFORK
Subject: include/linux/of.h: provide of_n_{addr,size}_cells wrappers for !CONFIG_OF
Subject: mm/mempolicy: fix NUMA_INTERLEAVE_HIT counter
Subject: mm: remove unnecessary WARN_ONCE in page_vma_mapped_walk().
Subject: mm: only display online cpus of the numa node
Subject: userfaultfd: selftest: exercise -EEXIST only in background transfer
Subject: scripts/kallsyms.c: ignore symbol type 'n'
Subject: mm/cma.c: take __GFP_NOWARN into account in cma_alloc()
Subject: Revert "vmalloc: back off when the current task is killed"
Subject: tty: fall back to N_NULL if switching to N_TTY fails during hangup
Subject: linux/kernel.h: add/correct kernel-doc notation
Subject: fs/mpage.c: fix mpage_writepage() for pages with buffers
Subject: fs/binfmt_misc.c: node could be NULL when evicting inode
Subject: kmemleak: clear stale pointers from task stacks
Subject: mm: page_vma_mapped: ensure pmd is loaded with READ_ONCE outside of lock
Subject: mm, swap: use page-cluster as max window of VMA based swap readahead




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-11-02 22:59 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-11-02 22:59 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

7 fixes, based on 5cb0512c02ecd7e6214e912e4c150f4219ac78e0:

Subject: userfaultfd: hugetlbfs: prevent UFFDIO_COPY to fill beyond the end of i_size
Subject: mm, /proc/pid/pagemap: fix soft dirty marking for PMD migration entry
Subject: ocfs2: fstrim: Fix start offset of first cluster group during fstrim
Subject: fs/hugetlbfs/inode.c: fix hwpoison reserve accounting
Subject: initramfs: fix initramfs rebuilds w/ compression after disabling
Subject: mm/huge_memory.c: deposit page table when copying a PMD migration entry
Subject: mm, swap: fix race between swap count continuation operations




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-11-09 21:38 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-11-09 21:38 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

2 fixes, based on 3fefc31843cfe2b5f072efe11ed9ccaf6a7a5092:

Subject: sysctl: add register_sysctl() dummy helper
Subject: MAINTAINERS: update TPM driver infrastructure changes



^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-11-16  1:29 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-11-16  1:29 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- a few misc bits

- ocfs2 updates

- almost all of MM

131 patches, based on c9b012e5f4a1d01dfa8abc6318211a67ba7d5db2:

Subject: bloat-o-meter: provide 3 different arguments for data, function and All
Subject: m32r: fix endianness constraints
Subject: ocfs2: remove unused declaration ocfs2_publish_get_mount_state()
Subject: ocfs2: no need flush workqueue before destroying it
Subject: ocfs2: cleanup unused func declaration and assignment
Subject: ocfs2: fix cluster hang after a node dies
Subject: ocfs2: clean up some unused function declarations
Subject: ocfs2: should wait dio before inode lock in ocfs2_setattr()
Subject: ocfs2: ip_alloc_sem should be taken in ocfs2_get_block()
Subject: ocfs2: subsystem.su_mutex is required while accessing the item->ci_parent
Subject: ocfs2/dlm: get mle inuse only when it is initialized
Subject: ocfs2: remove unneeded goto in ocfs2_reserve_cluster_bitmap_bits()
Subject: tools: slabinfo: add "-U" option to show unreclaimable slabs only
Subject: mm: slabinfo: remove CONFIG_SLABINFO
Subject: mm: oom: show unreclaimable slab info when unreclaimable slabs > user memory
Subject: mm/slob.c: remove an unnecessary check for __GFP_ZERO
Subject: mm/slab.c: only set __GFP_RECLAIMABLE once
Subject: slab, slub, slob: add slab_flags_t
Subject: slab, slub, slob: convert slab_flags_t to 32-bit
Subject: slub: fix sysfs duplicate filename creation when slub_debug=O
Subject: include/linux/slab.h: add kmalloc_array_node() and kcalloc_node()
Subject: block/blk-mq.c: use kmalloc_array_node()
Subject: drivers/infiniband/hw/qib/qib_init.c: use kmalloc_array_node()
Subject: drivers/infiniband/sw/rdmavt/qp.c: use kmalloc_array_node()
Subject: mm/mempool.c: use kmalloc_array_node()
Subject: net/rds/ib_fmr.c: use kmalloc_array_node()
Subject: mm: update comments for struct page.mapping
Subject: zram: set BDI_CAP_STABLE_WRITES once
Subject: bdi: introduce BDI_CAP_SYNCHRONOUS_IO
Subject: mm, swap: introduce SWP_SYNCHRONOUS_IO
Subject: mm, swap: skip swapcache for swapin of synchronous device
Subject: mm: swap: SWP_SYNCHRONOUS_IO: skip swapcache only if swapped page has no other reference
Subject: mm, swap: fix false error message in __swp_swapcount()
Subject: mm/page-writeback.c: remove unused parameter from balance_dirty_pages()
Subject: mm: drop migrate type checks from has_unmovable_pages
Subject: mm: distinguish CMA and MOVABLE isolation in has_unmovable_pages()
Subject: mm, page_alloc: fail has_unmovable_pages when seeing reserved pages
Subject: mm, memory_hotplug: do not fail offlining too early
Subject: mm, memory_hotplug: remove timeout from __offline_memory
Subject: mm/memblock.c: make the index explicit argument of for_each_memblock_type
Subject: mm/page-writeback.c: print a warning if the vm dirtiness settings are illogical
Subject: zram: add zstd to the supported algorithms list
Subject: zram: remove zlib from the list of recommended algorithms
Subject: fs/hugetlbfs/inode.c: remove redundant -ENIVAL return from hugetlbfs_setattr()
Subject: mm/hmm: constify hmm_devmem_page_get_drvdata() parameter
Subject: zsmalloc: calling zs_map_object() from irq is a bug
Subject: mm/mmu_notifier: avoid double notification when it is useless
Subject: mm/mmu_notifier: avoid call to invalidate_range() in range_end()
Subject: mm: remove unused pgdat->inactive_ratio
Subject: mm/swap_slots.c: fix race conditions in swap_slots cache init
Subject: mm, arch: remove empty_bad_page*
Subject: mm/cma.c: change pr_info to pr_err for cma_alloc fail log
Subject: mm/page_owner.c: reduce page_owner structure size
Subject: mm: implement find_get_pages_range_tag()
Subject: btrfs: use pagevec_lookup_range_tag()
Subject: ceph: use pagevec_lookup_range_tag()
Subject: ext4: use pagevec_lookup_range_tag()
Subject: f2fs: use pagevec_lookup_range_tag()
Subject: f2fs: simplify page iteration loops
Subject: f2fs: use find_get_pages_tag() for looking up single page
Subject: gfs2: use pagevec_lookup_range_tag()
Subject: nilfs2: use pagevec_lookup_range_tag()
Subject: mm: use pagevec_lookup_range_tag() in __filemap_fdatawait_range()
Subject: mm: use pagevec_lookup_range_tag() in write_cache_pages()
Subject: mm: add variant of pagevec_lookup_range_tag() taking number of pages
Subject: ceph: use pagevec_lookup_range_nr_tag()
Subject: mm: remove nr_pages argument from pagevec_lookup_{,range}_tag()
Subject: afs: use find_get_pages_range_tag()
Subject: cifs: use find_get_pages_range_tag()
Subject: kmemleak: change /sys/kernel/debug/kmemleak permissions from 0444 to 0644
Subject: mm: account pud page tables
Subject: mm: introduce wrappers to access mm->nr_ptes
Subject: mm: consolidate page table accounting
Subject: fs, mm: account filp cache to kmemcg
Subject: mm/rmap.c: remove redundant variable cend
Subject: kmemcheck: remove annotations
Subject: kmemcheck: stop using GFP_NOTRACK and SLAB_NOTRACK
Subject: kmemcheck: remove whats left of NOTRACK flags
Subject: kmemcheck: rip it out
Subject: mm/swap_state.c: declare a few variables as __read_mostly
Subject: mm: deferred_init_memmap improvements
Subject: x86/mm: set fields in deferred pages
Subject: sparc64/mm: set fields in deferred pages
Subject: sparc64: simplify vmemmap_populate
Subject: mm: define memblock_virt_alloc_try_nid_raw
Subject: mm: zero reserved and unavailable struct pages
Subject: x86/mm/kasan: don't use vmemmap_populate() to initialize shadow
Subject: arm64/mm/kasan: don't use vmemmap_populate() to initialize shadow
Subject: mm: stop zeroing memory during allocation in vmemmap
Subject: sparc64: optimize struct page zeroing
Subject: mm/page_alloc: make sure __rmqueue() etc are always inline
Subject: userfaultfd: use mmgrab instead of open-coded increment of mm_count
Subject: mm, soft_offline: improve hugepage soft offlining error log
Subject: mm/page-writeback.c: convert timers to use timer_setup()
Subject: drivers/block/zram/zram_drv.c: make zram_page_end_io() static
Subject: mm: speed up cancel_dirty_page() for clean pages
Subject: mm: refactor truncate_complete_page()
Subject: mm: factor out page cache page freeing into a separate function
Subject: mm: move accounting updates before page_cache_tree_delete()
Subject: mm: move clearing of page->mapping to page_cache_tree_delete()
Subject: mm: factor out checks and accounting from __delete_from_page_cache()
Subject: mm: batch radix tree operations when truncating pages
Subject: mm, page_alloc: enable/disable IRQs once when freeing a list of pages
Subject: mm, truncate: do not check mapping for every page being truncated
Subject: mm, truncate: remove all exceptional entries from pagevec under one lock
Subject: mm: only drain per-cpu pagevecs once per pagevec usage
Subject: mm, pagevec: remove cold parameter for pagevecs
Subject: mm: remove cold parameter for release_pages
Subject: mm: remove cold parameter from free_hot_cold_page*
Subject: mm: remove __GFP_COLD
Subject: mm, page_alloc: simplify list handling in rmqueue_bulk()
Subject: mm, pagevec: rename pagevec drained field
Subject: Unify migrate_pages and move_pages access checks
Subject: shmem: convert shmem_init_inodecache() to void
Subject: mm, sysctl: make NUMA stats configurable
Subject: mm: mlock: remove lru_add_drain_all()
Subject: mm, page_alloc: fix potential false positive in __zone_watermark_ok
Subject: fs: fuse: account fuse_inode slab memory as reclaimable
Subject: mm: don't warn about allocations which stall for too long
Subject: mm/page_alloc.c: broken deferred calculation
Subject: mm/shmem.c: mark expected switch fall-through
Subject: mm/list_lru.c: mark expected switch fall-through
Subject: mm/hmm: remove redundant variable align_end
Subject: mm, sparse: do not swamp log with huge vmemmap allocation failures
Subject: mm: do not rely on preempt_count in print_vma_addr
Subject: writeback: remove unused function parameter
Subject: mm/page_ext.c: check if page_ext is not prepared
Subject: mm,oom_reaper: remove pointless kthread_run() error check
Subject: mm: simplify nodemask printing
Subject: mm: make alloc_node_mem_map a void call if we don't have CONFIG_FLAT_NODE_MEM_MAP
Subject: memory hotplug: fix comments when adding section




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-11-17 23:25 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-11-17 23:25 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- a bit more MM

- procfs updates

- dynamic-debug fixes

- lib/ updates

- checkpatch

- epoll

- nilfs2

- signals

- rapidio

- PID management cleanup and optimization

- kcov updates

- sysvipc updates

- quite a few misc things all over the place


94 patches, based on a3841f94c7ecb3ede0f888d3fcfe8fb6368ddd7a:

Subject: mm: fix nodemask printing
Subject: mm/z3fold.c: use kref to prevent page free/compact race
Subject: lib/dma-debug.c: fix incorrect pfn calculation
Subject: mm: shmem: remove unused info variable
Subject: mm, compaction: kcompactd should not ignore pageblock skip
Subject: mm, compaction: persistently skip hugetlbfs pageblocks
Subject: mm, compaction: extend pageblock_skip_persistent() to all compound pages
Subject: mm, compaction: split off flag for not updating skip hints
Subject: mm, compaction: remove unneeded pageblock_skip_persistent() checks
Subject: proc, coredump: add CoreDumping flag to /proc/pid/status
Subject: proc: : uninline name_to_int()
Subject: proc: use do-while in name_to_int()
Subject: spelling.txt: add "unnecessary" typo variants
Subject: sh/boot: add static stack-protector to pre-kernel
Subject: kernel debug: support resetting WARN*_ONCE
Subject: kernel debug: support resetting WARN_ONCE for all architectures
Subject: parse-maintainers: add ability to specify filenames
Subject: iopoll: avoid -Wint-in-bool-context warning
Subject: lkdtm: include WARN format string
Subject: bug: define the "cut here" string in a single place
Subject: bug: fix "cut here" location for __WARN_TAINT architectures
Subject: include/linux/compiler-clang.h: handle randomizable anonymous structs
Subject: kernel/umh.c: optimize 'proc_cap_handler()'
Subject: dynamic-debug-howto: fix optional/omitted ending line number to be LARGE instead of 0
Subject: dynamic_debug documentation: minor fixes
Subject: get_maintainer: add --self-test for internal consistency tests
Subject: get_maintainer: add more --self-test options
Subject: include/linux/bitfield.h: include <linux/build_bug.h> instead of <linux/bug.h>
Subject: include/linux/radix-tree.h: remove unneeded #include <linux/bug.h>
Subject: lib: add module support to string tests
Subject: lib/test: delete five error messages for failed memory allocations
Subject: lib/int_sqrt: optimize small argument
Subject: lib/int_sqrt: optimize initial value compute
Subject: lib/int_sqrt: adjust comments
Subject: lib/genalloc.c: make the avail variable an atomic_long_t
Subject: lib/nmi_backtrace.c: fix kernel text address leak
Subject: tools/lib/traceevent/parse-filter.c: clean up clang build warning
Subject: lib/rbtree-test: lower default params
Subject: lib: test module for find_*_bit() functions
Subject: checkpatch: support function pointers for unnamed function definition arguments
Subject: scripts/checkpatch.pl: avoid false warning missing break
Subject: checkpatch: printks always need a KERN_<LEVEL>
Subject: checkpatch: allow DEFINE_PER_CPU definitions to exceed line length
Subject: checkpatch: add TP_printk to list of logging functions
Subject: checkpatch: add --strict test for lines ending in [ or (
Subject: checkpatch: do not check missing blank line before builtin_*_driver
Subject: epoll: account epitem and eppoll_entry to kmemcg
Subject: epoll: avoid calling ep_call_nested() from ep_poll_safewake()
Subject: epoll: remove ep_call_nested() from ep_eventpoll_poll()
Subject: init/version.c: include <linux/export.h> instead of <linux/module.h>
Subject: autofs: don't fail mount for transient error
Subject: pipe: match pipe_max_size data type with procfs
Subject: pipe: avoid round_pipe_size() nr_pages overflow on 32-bit
Subject: pipe: add proc_dopipe_max_size() to safely assign pipe_max_size
Subject: sysctl: check for UINT_MAX before unsigned int min/max
Subject: fs/nilfs2: convert timers to use timer_setup()
Subject: nilfs2: fix race condition that causes file system corruption
Subject: fs, nilfs: convert nilfs_root.count from atomic_t to refcount_t
Subject: nilfs2: align block comments of nilfs_sufile_truncate_range() at *
Subject: nilfs2: use octal for unreadable permission macro
Subject: nilfs2: remove inode->i_version initialization
Subject: hfs/hfsplus: clean up unused variables in bnode.c
Subject: fat: remove redundant assignment of 0 to slots
Subject: kernel/signal.c: protect the traced SIGNAL_UNKILLABLE tasks from SIGKILL
Subject: kernel/signal.c: protect the SIGNAL_UNKILLABLE tasks from !sig_kernel_only() signals
Subject: kernel/signal.c: remove the no longer needed SIGNAL_UNKILLABLE check in complete_signal()
Subject: kdump: print a message in case parse_crashkernel_mem resulted in zero bytes
Subject: rapidio: constify rio_device_id
Subject: drivers/rapidio/devices/rio_mport_cdev.c: fix resource leak in error handling path in 'rio_dma_transfer()'
Subject: drivers/rapidio/devices/rio_mport_cdev.c: fix error handling in 'rio_dma_transfer()'
Subject: Documentation/sysctl/vm.txt: fix typo
Subject: kernel/sysctl.c: code cleanups
Subject: pid: replace pid bitmap implementation with IDR API
Subject: pid: remove pidhash
Subject: kernel/panic.c: add TAINT_AUX
Subject: kcov: remove pointless current != NULL check
Subject: kcov: support comparison operands collection
Subject: Makefile: support flag -fsanitizer-coverage=trace-cmp
Subject: kcov: update documentation
Subject: kernel/reboot.c: add devm_register_reboot_notifier()
Subject: drivers/watchdog: make use of devm_register_reboot_notifier()
Subject: initramfs: use time64_t timestamps
Subject: sysvipc: unteach ids->next_id for !CHECKPOINT_RESTORE
Subject: sysvipc: duplicate lock comments wrt ipc_addid()
Subject: sysvipc: properly name ipc_addid() limit parameter
Subject: sysvipc: make get_maxid O(1) again
Subject: mm: add infrastructure for get_user_pages_fast() benchmarking
Subject: drivers/pcmcia/sa1111_badge4.c: avoid unused function warning
Subject: arch/ia64/include/asm/topology.h: remove unused parent_node() macro
Subject: arch/sh/include/asm/topology.h: remove unused parent_node() macro
Subject: arch/sparc/include/asm/topology_64.h: remove unused parent_node() macro
Subject: arch/tile/include/asm/topology.h: remove unused parent_node() macro
Subject: include/asm-generic/topology.h: remove unused parent_node() macro
Subject: EXPERT Kconfig menu: fix broken EXPERT menu


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-11-30  0:09 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-11-30  0:09 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

28 fixes, based on 43570f0383d6d5879ae585e6c3cf027ba321546f:

Subject: mm, memory_hotplug: do not back off draining pcp free pages from kworker context
Subject: mm, oom_reaper: gather each vma to prevent leaking TLB entry
Subject: mm/cma: fix alloc_contig_range ret code/potential leak
Subject: mm: fix device-dax pud write-faults triggered by get_user_pages()
Subject: mm: switch to 'define pmd_write' instead of __HAVE_ARCH_PMD_WRITE
Subject: mm: replace pud_write with pud_access_permitted in fault + gup paths
Subject: mm: replace pmd_write with pmd_access_permitted in fault + gup paths
Subject: mm: replace pte_write with pte_access_permitted in fault + gup paths
Subject: scripts/faddr2line: extend usage on generic arch
Subject: mm, hugetlbfs: introduce ->split() to vm_operations_struct
Subject: device-dax: implement ->split() to catch invalid munmap attempts
Subject: mm: introduce get_user_pages_longterm
Subject: mm: fail get_vaddr_frames() for filesystem-dax mappings
Subject: v4l2: disable filesystem-dax mapping support
Subject: IB/core: disable memory registration of filesystem-dax vmas
Subject: exec: avoid RLIMIT_STACK races with prlimit()
Subject: mm/madvise.c: fix madvise() infinite loop under special circumstances
Subject: Revert "mm/page-writeback.c: print a warning if the vm dirtiness settings are illogical"
Subject: fs/mbcache.c: make count_objects() more robust
Subject: scripts/bloat-o-meter: don't fail with division by 0
Subject: kmemleak: add scheduling point to kmemleak_scan()
Subject: mm: migrate: fix an incorrect call of prep_transhuge_page()
Subject: mm, memcg: fix mem_cgroup_swapout() for THPs
Subject: fs/fat/inode.c: fix sb_rdonly() change
Subject: autofs: revert "autofs: take more care to not update last_used on path walk"
Subject: autofs: revert "autofs: fix AT_NO_AUTOMOUNT not being honored"
Subject: mm/hugetlb: fix NULL-pointer dereference on 5-level paging machine
Subject: fs/hugetlbfs/inode.c: change put_page/unlock_page order in hugetlbfs_fallocate()




^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2017-12-14 23:32 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-12-14 23:32 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

17 fixes, based on 7c5cac1bc7170bfc726a69eb64947c55658d16ad:

Subject: include/linux/idr.h: add #include <linux/bug.h>
Subject: lib/rbtree,drm/mm: add rbtree_replace_node_cached()
Subject: mm/kmemleak.c: make cond_resched() rate-limiting more efficient
Subject: string.h: workaround for increased stack usage
Subject: autofs: fix careless error in recent commit
Subject: exec: avoid gcc-8 warning for get_task_comm
Subject: Documentation/vm/zswap.txt: update with same-value filled page feature
Subject: scripts/faddr2line: fix CROSS_COMPILE unset error
Subject: mm/memory.c: mark wp_huge_pmd() inline to prevent build failure
Subject: mm/page_alloc.c: avoid excessive IRQ disabled times in free_unref_page_list()
Subject: mm/slab.c: do not hash pointers when debugging slab
Subject: kcov: fix comparison callback signature
Subject: tools/slabinfo-gnuplot: force to use bash shell
Subject: mm/frame_vector.c: release a semaphore in 'get_vaddr_frames()'
Subject: kernel: make groups_sort calling a responsibility group_info allocators
Subject: mm, oom_reaper: fix memory corruption
Subject: arch: define weak abort()


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2018-01-05  0:17 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2018-01-05  0:17 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

9 fixes, based on e1915c8195b38393005be9b74bfa6a3a367c83b3:

Subject: mm: check pfn_valid first in zero_resv_unavail
Subject: kernel/acct.c: fix the acct->needcheck check in check_free_space()
Subject: mm/mprotect: add a cond_resched() inside change_pmd_range()
Subject: kernel/exit.c: export abort() to modules
Subject: mm/debug.c: provide useful debugging information for VM_BUG
Subject: mm/zsmalloc.c: include fs.h
Subject: mm/sparse.c: wrong allocation for mem_section
Subject: userfaultfd: clear the vma->vm_userfaultfd_ctx if UFFD_EVENT_FORK fails
Subject: mailmap: update Mark Yao's email address


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2018-01-13  0:52 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2018-01-13  0:52 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

4 fixes, based on 1545dec46db3858bbce84c2065b579e2925706ab:

Subject: MAINTAINERS, nilfs2: change project home URLs
Subject: kmemleak: allow to coexist with fault injection
Subject: kdump: write correct address of mem_section into vmcoreinfo
Subject: tools/objtool/Makefile: don't assume sync-check.sh is executable


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2018-01-19  0:33 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2018-01-19  0:33 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits

6 fixes, based on dda3e15231b35840fe6f0973f803cc70ddb86281:

Subject: mm/memory.c: release locked page in do_swap_page()
Subject: mm/page_owner.c: remove drain_all_pages from init_early_allocated_pages
Subject: scripts/decodecode: fix decoding for AArch64 (arm64) instructions
Subject: scripts/gdb/linux/tasks.py: fix get_thread_info
Subject: proc: fix coredump vs read /proc/*/stat race
Subject: sparse doesn't support struct randomization


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2018-02-01  0:13 Andrew Morton
  2018-02-01  0:25 ` incoming Andrew Morton
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2018-02-01  0:13 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- misc fixes

- ocfs2 updates

- most of MM

119 patches, based on 7b1cd95d65eb3b1e13f8a90eb757e0ea232c7899:

Subject: fs/dax.c: release PMD lock even when there is no PMD support in DAX
Subject: tools: fix cross-compile var clobbering
Subject: scripts/decodecode: make it take multiline Code line
Subject: scripts/tags.sh: change find_other_sources() for include directories
Subject: m32r: remove abort()
Subject: fs/ocfs2/dlm/dlmmaster.c: clean up dead code
Subject: ocfs2/cluster: neaten a member of o2net_msg_handler
Subject: ocfs2: give an obvious tip for mismatched cluster names
Subject: ocfs2/cluster: close a race that fence can't be triggered
Subject: ocfs2: use the OCFS2_XATTR_ROOT_SIZE macro in ocfs2_reflink_xattr_header()
Subject: ocfs2: clean dead code in suballoc.c
Subject: ocfs2: return -EROFS to mount.ocfs2 if inode block is invalid
Subject: ocfs2: try a blocking lock before return AOP_TRUNCATED_PAGE
Subject: ocfs2/xattr: assign errno to 'ret' in ocfs2_calc_xattr_init()
Subject: ocfs2: clean up dead code in alloc.c
Subject: ocfs2/acl: use 'ip_xattr_sem' to protect getting extended attribute
Subject: ocfs2: make metadata estimation accurate and clear
Subject: ocfs2: try to reuse extent block in dealloc without meta_alloc
Subject: ocfs2: add trimfs dlm lock resource
Subject: ocfs2: add trimfs lock to avoid duplicated trims in cluster
Subject: ocfs2: add ocfs2_try_rw_lock() and ocfs2_try_inode_lock()
Subject: ocfs2: add ocfs2_overwrite_io()
Subject: ocfs2: nowait aio support
Subject: ocfs2: unlock bh_state if bg check fails
Subject: ocfs2: return error when we attempt to access a dirty bh in jbd2
Subject: mm/slab_common.c: make calculate_alignment() static
Subject: mm/slab.c: remove redundant assignments for slab_state
Subject: mm/slub.c: fix wrong address during slab padding restoration
Subject: slub: remove obsolete comments of put_cpu_partial()
Subject: include/linux/sched/mm.h: uninline mmdrop_async(), etc
Subject: mm: kmemleak: remove unused hardirq.h
Subject: zswap: same-filled pages handling
Subject: mm: relax deferred struct page requirements
Subject: mm/mempolicy: remove redundant check in get_nodes
Subject: mm/mempolicy: fix the check of nodemask from user
Subject: mm/mempolicy: add nodes_empty check in SYSC_migrate_pages
Subject: mm: drop hotplug lock from lru_add_drain_all()
Subject: mm: show total hugetlb memory consumption in /proc/meminfo
Subject: mm: use sc->priority for slab shrink targets
Subject: mm: split deferred_init_range into initializing and freeing parts
Subject: mm/filemap.c: remove include of hardirq.h
Subject: mm: memcontrol: eliminate raw access to stat and event counters
Subject: mm: memcontrol: implement lruvec stat functions on top of each other
Subject: mm: memcontrol: fix excessive complexity in memory.stat reporting
Subject: mm/page_owner.c: use PTR_ERR_OR_ZERO()
Subject: mm/page_alloc.c: fix comment in __get_free_pages()
Subject: mm: do not stall register_shrinker()
Subject: selftests/vm: move 128TB mmap boundary test to generic directory
Subject: mm/interval_tree.c: use vma_pages() helper
Subject: mm: remove unused pgdat_reclaimable_pages()
Subject: mm, hugetlb: remove hugepages_treat_as_movable sysctl
Subject: mm/memory_hotplug.c: remove unnecesary check from register_page_bootmem_info_section()
Subject: mm: update comment describing tlb_gather_mmu
Subject: fs/proc/task_mmu.c: do not show VmExe bigger than total executable virtual memory
Subject: mm: memory_hotplug: remove second __nr_to_section in register_page_bootmem_info_section()
Subject: mm/huge_memory.c: fix comment in __split_huge_pmd_locked
Subject: mm, userfaultfd, THP: avoid waiting when PMD under THP migration
Subject: mm: add unmap_mapping_pages()
Subject: mm: get 7% more pages in a pagevec
Subject: asm-generic: provide generic_pmdp_establish()
Subject: arc: use generic_pmdp_establish as pmdp_establish
Subject: arm/mm: provide pmdp_establish() helper
Subject: arm64: provide pmdp_establish() helper
Subject: mips: use generic_pmdp_establish as pmdp_establish
Subject: powerpc/mm: update pmdp_invalidate to return old pmd value
Subject: s390/mm: modify pmdp_invalidate to return old value.
Subject: sparc64: update pmdp_invalidate() to return old pmd value
Subject: x86/mm: provide pmdp_establish() helper
Subject: mm: do not lose dirty and accessed bits in pmdp_invalidate()
Subject: mm: use updated pmdp_invalidate() interface to track dirty/accessed bits
Subject: mm/thp: remove pmd_huge_split_prepare()
Subject: mm: thp: use down_read_trylock() in khugepaged to avoid long block
Subject: mm, mmu_notifier: annotate mmu notifiers with blockable invalidate callbacks
Subject: mm, oom: avoid reaping only for mm's with blockable invalidate callbacks
Subject: mm/zsmalloc: simplify shrinker init/destroy
Subject: mm: align struct page more aesthetically
Subject: mm: de-indent struct page
Subject: mm: remove misleading alignment claims
Subject: mm: improve comment on page->mapping
Subject: mm: introduce _slub_counter_t
Subject: mm: store compound_dtor / compound_order as bytes
Subject: mm: document how to use struct page
Subject: mm: remove reference to PG_buddy
Subject: shmem: unexport shmem_add_seals()/shmem_get_seals()
Subject: shmem: rename functions that are memfd-related
Subject: hugetlb: expose hugetlbfs_inode_info in header
Subject: hugetlb: implement memfd sealing
Subject: shmem: add sealing support to hugetlb-backed memfd
Subject: memfd-test: test hugetlbfs sealing
Subject: memfd-test: add 'memfd-hugetlb:' prefix when testing hugetlbfs
Subject: memfd-test: move common code to a shared unit
Subject: memfd-test: run fuse test on hugetlb backend memory
Subject: userfaultfd: convert to use anon_inode_getfd()
Subject: mm: pin address_space before dereferencing it while isolating an LRU page
Subject: mm/fadvise: discard partial page if endbyte is also EOF
Subject: zswap: only save zswap header when necessary
Subject: memcg: refactor mem_cgroup_resize_limit()
Subject: mm/page_alloc.c: fix typos in comments
Subject: mm/page_owner.c: clean up init_pages_in_zone()
Subject: zsmalloc: use U suffix for negative literals being shifted
Subject: mm/page_ext.c: make page_ext_init a noop when CONFIG_PAGE_EXTENSION but nothing uses it
Subject: mm/compaction.c: fix comment for try_to_compact_pages()
Subject: include/linux/mmzone.h: fix explanation of lower bits in the SPARSEMEM mem_map pointer
Subject: mm/hmm: fix uninitialized use of 'entry' in hmm_vma_walk_pmd()
Subject: mm/memcontrol.c: make local symbol static
Subject: mm/memcontrol.c: try harder to decrease [memory,memsw].limit_in_bytes
Subject: mm, hugetlb: unify core page allocation accounting and initialization
Subject: mm, hugetlb: integrate giga hugetlb more naturally to the allocation path
Subject: mm, hugetlb: do not rely on overcommit limit during migration
Subject: mm, hugetlb: get rid of surplus page accounting tricks
Subject: mm, hugetlb: further simplify hugetlb allocation API
Subject: hugetlb, mempolicy: fix the mbind hugetlb migration
Subject: hugetlb, mbind: fall back to default policy if vma is NULL
Subject: mm: numa: do not trap faults on shared data section pages.
Subject: mm: correct comments regarding do_fault_around()
Subject: mm, memory_hotplug: fix memmap initialization
Subject: mm/swap.c: make functions and their kernel-doc agree
Subject: tools, vm: new option to specify kpageflags file
Subject: mm: remove PG_highmem description




^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2018-02-01  0:13 incoming Andrew Morton
@ 2018-02-01  0:25 ` Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2018-02-01  0:25 UTC (permalink / raw)
  To: Linus Torvalds, mm-commits

And... [002/119] seems to have just disappeared.  It was a standalone thing,
I'll resend next time.

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2018-02-06 23:34 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2018-02-06 23:34 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits


- kasan updates

- procfs

- lib/bitmap updates

- other lib/ updates

- checkpatch tweaks

- rapidio

- ubsan

- pipe fixes and cleanups

- lots of other misc bits


114 patches, based on e237f98a9c134c3d600353f21e07db915516875b:

Subject: kasan: don't emit builtin calls when sanitization is off
Subject: kasan: add compiler support for clang
Subject: kasan/Makefile: support LLVM style asan parameters
Subject: kasan: support alloca() poisoning
Subject: kasan: add tests for alloca poisoning
Subject: kasan: add functions for unpoisoning stack variables
Subject: kasan: detect invalid frees for large objects
Subject: kasan: don't use __builtin_return_address(1)
Subject: kasan: detect invalid frees for large mempool objects
Subject: kasan: unify code between kasan_slab_free() and kasan_poison_kfree()
Subject: kasan: detect invalid frees
Subject: kasan: fix prototype author email address
Subject: kasan: clean up KASAN_SHADOW_SCALE_SHIFT usage
Subject: kasan: remove redundant initialization of variable 'real_size'
Subject: proc: use %u for pid printing and slightly less stack
Subject: proc: don't use READ_ONCE/WRITE_ONCE for /proc/*/fail-nth
Subject: proc: fix /proc/*/map_files lookup
Subject: fs/proc/vmcore.c: simpler /proc/vmcore cleanup
Subject: proc: less memory for /proc/*/map_files readdir
Subject: fs/proc/array.c: delete children_seq_release()
Subject: fs/proc/kcore.c: use probe_kernel_read() instead of memcpy()
Subject: fs/proc/internal.h: rearrange struct proc_dir_entry
Subject: fs/proc/internal.h: fix up comment
Subject: fs/proc: use __ro_after_init
Subject: proc: spread likely/unlikely a bit
Subject: proc: rearrange args
Subject: fs/proc/consoles.c: use seq_putc() in show_console_dev()
Subject: Makefile: move stack-protector compiler breakage test earlier
Subject: Makefile: move stack-protector availability out of Kconfig
Subject: Makefile: introduce CONFIG_CC_STACKPROTECTOR_AUTO
Subject: uuid: cleanup <uapi/linux/uuid.h>
Subject: tools/lib/subcmd/pager.c: do not alias select() params
Subject: kernel/async.c: revert "async: simplify lowest_in_progress()"
Subject: MAINTAINERS: update sboyd's email address
Subject: bitmap: new bitmap_copy_safe and bitmap_{from,to}_arr32
Subject: bitmap: replace bitmap_{from,to}_u32array
Subject: lib/test_bitmap.c: add bitmap_zero()/bitmap_clear() test cases
Subject: lib/test_bitmap.c: add bitmap_fill()/bitmap_set() test cases
Subject: lib/test_bitmap.c: clean up test_zero_fill_copy() test case and rename
Subject: include/linux/bitmap.h: make bitmap_fill() and bitmap_zero() consistent
Subject: lib/stackdepot.c: use a non-instrumented version of memcmp()
Subject: lib/test_find_bit.c: rename to find_bit_benchmark.c
Subject: lib/find_bit_benchmark.c: improvements
Subject: lib: optimize cpumask_next_and()
Subject: lib/: make RUNTIME_TESTS a menuconfig to ease disabling it all
Subject: lib/test_sort.c: add module unload support
Subject: checkpatch: allow long lines containing URL
Subject: checkpatch: ignore some octal permissions of 0
Subject: checkpatch: improve quoted string and line continuation test
Subject: checkpatch: add a few DEVICE_ATTR style tests
Subject: checkpatch: improve the TABSTOP test to include declarations
Subject: checkpatch: exclude drivers/staging from if with unnecessary parentheses test
Subject: checkpatch: avoid some false positives for TABSTOP declaration test
Subject: checkpatch: improve OPEN_BRACE test
Subject: elf: fix NT_FILE integer overflow
Subject: kallsyms: let print_ip_sym() print raw addresses
Subject: nilfs2: use time64_t internally
Subject: hfsplus: honor setgid flag on directories
Subject: <asm-generic/siginfo.h>: fix language in comments
Subject: kernel/fork.c: check error and return early
Subject: kernel/fork.c: add comment about usage of CLONE_FS flags and namespaces
Subject: cpumask: make cpumask_size() return "unsigned int"
Subject: rapidio: delete an error message for a failed memory allocation in rio_init_mports()
Subject: rapidio: adjust 12 checks for null pointers
Subject: rapidio: adjust five function calls together with a variable assignment
Subject: rapidio: improve a size determination in five functions
Subject: rapidio: delete an unnecessary variable initialisation in three functions
Subject: rapidio: return an error code only as a constant in two functions
Subject: rapidio: move 12 EXPORT_SYMBOL_GPL() calls to function implementations
Subject: drivers/rapidio/devices/tsi721_dma.c: delete an error message for a failed memory allocation in tsi721_alloc_chan_resources()
Subject: drivers/rapidio/devices/tsi721_dma.c: delete an unnecessary variable initialisation in tsi721_alloc_chan_resources()
Subject: drivers/rapidio/devices/tsi721_dma.c: adjust six checks for null pointers
Subject: pids: introduce find_get_task_by_vpid() helper
Subject: pps: parport: use timespec64 instead of timespec
Subject: kernel/relay.c: revert "kernel/relay.c: fix potential memory leak"
Subject: kcov: detect double association with a single task
Subject: include/linux/genl_magic_func.h: remove own BUILD_BUG_ON*() defines
Subject: build_bug.h: remove BUILD_BUG_ON_NULL()
Subject: lib/ubsan.c: s/missaligned/misaligned/
Subject: lib/ubsan: add type mismatch handler for new GCC/Clang
Subject: lib/ubsan: remove returns-nonnull-attribute checks
Subject: ipc: fix ipc data structures inconsistency
Subject: ipc/mqueue.c: have RT tasks queue in by priority in wq_add()
Subject: arch/score/kernel/setup.c: combine two seq_printf() calls into one call in show_cpuinfo()
Subject: vfs: remove might_sleep() from clear_inode()
Subject: mm/userfaultfd.c: remove duplicate include
Subject: mm: remove unneeded kallsyms include
Subject: hrtimer: remove unneeded kallsyms include
Subject: genirq: remove unneeded kallsyms include
Subject: mm/memblock: memblock_is_map/region_memory can be boolean
Subject: lib/lockref: __lockref_is_dead can be boolean
Subject: kernel/cpuset: current_cpuset_is_being_rebound can be  boolean
Subject: kernel/resource: iomem_is_exclusive can be boolean
Subject: kernel/module: module_is_live can be boolean
Subject: kernel/mutex: mutex_is_locked can be boolean
Subject: crash_dump: is_kdump_kernel can be boolean
Subject: kasan: rework Kconfig settings
Subject: pipe, sysctl: drop 'min' parameter from pipe-max-size converter
Subject: pipe, sysctl: remove pipe_proc_fn()
Subject: pipe: actually allow root to exceed the pipe buffer limits
Subject: pipe: fix off-by-one error when checking buffer limits
Subject: pipe: reject F_SETPIPE_SZ with size over UINT_MAX
Subject: pipe: simplify round_pipe_size()
Subject: pipe: read buffer limits atomically
Subject: mm: docs: fixup punctuation
Subject: mm: docs: fix parameter names mismatch
Subject: mm: docs: add blank lines to silence sphinx "Unexpected indentation" errors
Subject: MAINTAINERS: remove ANDROID ION pattern
Subject: MAINTAINERS: remove ARM/CLKDEV SUPPORT file pattern
Subject: MAINTAINERS: update Cortina/Gemini patterns
Subject: MAINTAINERS: update "ARM/OXNAS platform support" patterns
Subject: MAINTAINERS: update various PALM patterns
Subject: MAINTAINERS: update ARM/QUALCOMM SUPPORT patterns
Subject: Documentation/sysctl/user.txt: fix typo


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-01-14  0:28 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-01-14  0:28 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


11 MM fixes, based on b3a987b0264d3ddbb24293ebff10eddfc472f653:


    Vlastimil Babka <vbabka@suse.cz>:
      mm, thp: tweak reclaim/compaction effort of local-only and all-node allocations

    David Hildenbrand <david@redhat.com>:
      mm/memory_hotplug: don't free usage map when removing a re-added early section

    "Kirill A. Shutemov" <kirill@shutemov.name>:
    Patch series "Fix two above-47bit hint address vs. THP bugs":
      mm/huge_memory.c: thp: fix conflict of above-47bit hint address and PMD alignment
      mm/shmem.c: thp, shmem: fix conflict of above-47bit hint address and PMD alignment

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: fix percpu slab vmstats flushing

    Vlastimil Babka <vbabka@suse.cz>:
      mm, debug_pagealloc: don't rely on static keys too early

    Wen Yang <wenyang@linux.alibaba.com>:
    Patch series "use div64_ul() instead of div_u64() if the divisor is:
      mm/page-writeback.c: avoid potential division by zero in wb_min_max_ratio()
      mm/page-writeback.c: use div64_ul() for u64-by-unsigned-long divide
      mm/page-writeback.c: improve arithmetic divisions

    Adrian Huang <ahuang12@lenovo.com>:
      mm: memcg/slab: call flush_memcg_workqueue() only if memcg workqueue is valid

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm: khugepaged: add trace status description for SCAN_PAGE_HAS_PRIVATE

 include/linux/mm.h                 |   18 +++++++++-
 include/linux/mmzone.h             |    5 +--
 include/trace/events/huge_memory.h |    3 +
 init/main.c                        |    1 
 mm/huge_memory.c                   |   38 ++++++++++++++---------
 mm/memcontrol.c                    |   37 +++++-----------------
 mm/mempolicy.c                     |   10 ++++--
 mm/page-writeback.c                |   10 +++---
 mm/page_alloc.c                    |   61 ++++++++++---------------------------
 mm/shmem.c                         |    7 ++--
 mm/slab.c                          |    4 +-
 mm/slab_common.c                   |    3 +
 mm/slub.c                          |    2 -
 mm/sparse.c                        |    9 ++++-
 mm/vmalloc.c                       |    4 +-
 15 files changed, 102 insertions(+), 110 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-01-31  6:10 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-01-31  6:10 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


Most of -mm and quite a number of other subsystems.

MM is fairly quiet this time.  Holidays, I assume.



119 patches, based on 39bed42de2e7d74686a2d5a45638d6a5d7e7d473:

Subsystems affected by this patch series:

  hotfixes
  scripts
  ocfs2
  mm/slub
  mm/kmemleak
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/memcg
  mm/pagemap
  mm/tracing
  mm/kasan
  mm/initialization
  mm/pagealloc
  mm/vmscan
  mm/tools
  mm/memblock
  mm/oom-kill
  mm/hugetlb
  mm/migration
  mm/mmap
  mm/memory-hotplug
  mm/zswap
  mm/cleanups
  mm/zram
  misc
  lib
  binfmt
  init
  reiserfs
  exec
  dma-mapping
  kcov

Subsystem: hotfixes

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      lib/test_bitmap: correct test data offsets for 32-bit

    "Theodore Ts'o" <tytso@mit.edu>:
      memcg: fix a crash in wb_workfn when a device disappears

    Dan Carpenter <dan.carpenter@oracle.com>:
      mm/mempolicy.c: fix out of bounds write in mpol_parse_str()

    Pingfan Liu <kernelfans@gmail.com>:
      mm/sparse.c: reset section's mem_map when fully deactivated

    Wei Yang <richardw.yang@linux.intel.com>:
      mm/migrate.c: also overwrite error when it is bigger than zero

    Dan Williams <dan.j.williams@intel.com>:
      mm/memory_hotplug: fix remove_memory() lockdep splat

    Wei Yang <richardw.yang@linux.intel.com>:
      mm: thp: don't need care deferred split queue in memcg charge move path

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm: move_pages: report the number of non-attempted pages

Subsystem: scripts

    Xiong <xndchn@gmail.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

    Luca Ceresoli <luca@lucaceresoli.net>:
      scripts/spelling.txt: add "issus" typo

Subsystem: ocfs2

    Aditya Pakki <pakki001@umn.edu>:
      fs: ocfs: remove unnecessary assertion in dlm_migrate_lockres

    zhengbin <zhengbin13@huawei.com>:
      ocfs2: remove unneeded semicolons

    Masahiro Yamada <masahiroy@kernel.org>:
      ocfs2: make local header paths relative to C files

    Colin Ian King <colin.king@canonical.com>:
      ocfs2/dlm: remove redundant assignment to ret

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      ocfs2/dlm: move BITS_TO_BYTES() to bitops.h for wider use

    wangyan <wangyan122@huawei.com>:
      ocfs2: fix a NULL pointer dereference when call ocfs2_update_inode_fsync_trans()
      ocfs2: use ocfs2_update_inode_fsync_trans() to access t_tid in handle->h_transaction

Subsystem: mm/slub

    Yu Zhao <yuzhao@google.com>:
      mm/slub.c: avoid slub allocation while holding list_lock

Subsystem: mm/kmemleak

    He Zhe <zhe.he@windriver.com>:
      mm/kmemleak: turn kmemleak_lock and object->lock to raw_spinlock_t

Subsystem: mm/debug

    Vlastimil Babka <vbabka@suse.cz>:
      mm/debug.c: always print flags in dump_page()

Subsystem: mm/pagecache

    Ira Weiny <ira.weiny@intel.com>:
      mm/filemap.c: clean up filemap_write_and_wait()

Subsystem: mm/gup

    Qiujun Huang <hqjagain@gmail.com>:
      mm: fix gup_pud_range

    Wei Yang <richardw.yang@linux.intel.com>:
      mm/gup.c: use is_vm_hugetlb_page() to check whether to follow huge

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "mm/gup: prereqs to track dma-pinned pages: FOLL_PIN", v12:
      mm/gup: factor out duplicate code from four routines
      mm/gup: move try_get_compound_head() to top, fix minor issues

    Dan Williams <dan.j.williams@intel.com>:
      mm: Cleanup __put_devmap_managed_page() vs ->page_free()

    John Hubbard <jhubbard@nvidia.com>:
      mm: devmap: refactor 1-based refcounting for ZONE_DEVICE pages
      goldish_pipe: rename local pin_user_pages() routine
      mm: fix get_user_pages_remote()'s handling of FOLL_LONGTERM
      vfio: fix FOLL_LONGTERM use, simplify get_user_pages_remote() call
      mm/gup: allow FOLL_FORCE for get_user_pages_fast()
      IB/umem: use get_user_pages_fast() to pin DMA pages
      media/v4l2-core: set pages dirty upon releasing DMA buffers
      mm/gup: introduce pin_user_pages*() and FOLL_PIN
      goldish_pipe: convert to pin_user_pages() and put_user_page()
      IB/{core,hw,umem}: set FOLL_PIN via pin_user_pages*(), fix up ODP
      mm/process_vm_access: set FOLL_PIN via pin_user_pages_remote()
      drm/via: set FOLL_PIN via pin_user_pages_fast()
      fs/io_uring: set FOLL_PIN via pin_user_pages()
      net/xdp: set FOLL_PIN via pin_user_pages()
      media/v4l2-core: pin_user_pages (FOLL_PIN) and put_user_page() conversion
      vfio, mm: pin_user_pages (FOLL_PIN) and put_user_page() conversion
      powerpc: book3s64: convert to pin_user_pages() and put_user_page()
      mm/gup_benchmark: use proper FOLL_WRITE flags instead of hard-coding "1"
      mm, tree-wide: rename put_user_page*() to unpin_user_page*()

Subsystem: mm/swap

    Vasily Averin <vvs@virtuozzo.com>:
      mm/swapfile.c: swap_next should increase position index

Subsystem: mm/memcg

    Kaitao Cheng <pilgrimtao@gmail.com>:
      mm/memcontrol.c: cleanup some useless code

Subsystem: mm/pagemap

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm/page_vma_mapped.c: explicitly compare pfn for normal, hugetlbfs and THP page

Subsystem: mm/tracing

    Junyong Sun <sunjy516@gmail.com>:
      mm, tracing: print symbol name for kmem_alloc_node call_site events

Subsystem: mm/kasan

    "Gustavo A. R. Silva" <gustavo@embeddedor.com>:
      lib/test_kasan.c: fix memory leak in kmalloc_oob_krealloc_more()

Subsystem: mm/initialization

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      mm/early_ioremap.c: use %pa to print resource_size_t variables

Subsystem: mm/pagealloc

    "Kirill A. Shutemov" <kirill@shutemov.name>:
      mm/page_alloc: skip non present sections on zone initialization

    David Hildenbrand <david@redhat.com>:
      mm: remove the memory isolate notifier
      mm: remove "count" parameter from has_unmovable_pages()

Subsystem: mm/vmscan

    Liu Song <liu.song11@zte.com.cn>:
      mm/vmscan.c: remove unused return value of shrink_node

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/vmscan: remove prefetch_prev_lru_page
      mm/vmscan: remove unused RECLAIM_OFF/RECLAIM_ZONE

Subsystem: mm/tools

    Daniel Wagner <dwagner@suse.de>:
      tools/vm/slabinfo: fix sanity checks enabling

Subsystem: mm/memblock

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/memblock: define memblock_physmem_add()
      memblock: Use __func__ in remaining memblock_dbg() call sites

Subsystem: mm/oom-kill

    David Rientjes <rientjes@google.com>:
      mm, oom: dump stack of victim when reaping failed

Subsystem: mm/hugetlb

    Wei Yang <richardw.yang@linux.intel.com>:
      mm/huge_memory.c: use head to check huge zero page
      mm/huge_memory.c: use head to emphasize the purpose of page
      mm/huge_memory.c: reduce critical section protected by split_queue_lock

Subsystem: mm/migration

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/migrate: remove useless mask of start address
      mm/migrate: clean up some minor coding style
      mm/migrate: add stable check in migrate_vma_insert_page()

    David Rientjes <rientjes@google.com>:
      mm, thp: fix defrag setting if newline is not used

Subsystem: mm/mmap

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mmap.c: get rid of odd jump labels in find_mergeable_anon_vma()

Subsystem: mm/memory-hotplug

    David Hildenbrand <david@redhat.com>:
    Patch series "mm/memory_hotplug: pass in nid to online_pages()":
      mm/memory_hotplug: pass in nid to online_pages()

    Qian Cai <cai@lca.pw>:
      mm/hotplug: silence a lockdep splat with printk()
      mm/page_isolation: fix potential warning from user

Subsystem: mm/zswap

    Vitaly Wool <vitaly.wool@konsulko.com>:
      mm/zswap.c: add allocation hysteresis if pool limit is hit

    Dan Carpenter <dan.carpenter@oracle.com>:
      zswap: potential NULL dereference on error in init_zswap()

Subsystem: mm/cleanups

    Yu Zhao <yuzhao@google.com>:
      include/linux/mm.h: clean up obsolete check on space in page->flags

    Wei Yang <richardw.yang@linux.intel.com>:
      include/linux/mm.h: remove dead code totalram_pages_set()

    Anshuman Khandual <anshuman.khandual@arm.com>:
      include/linux/memory.h: drop fields 'hw' and 'phys_callback' from struct memory_block

    Hao Lee <haolee.swjtu@gmail.com>:
      mm: fix comments related to node reclaim

Subsystem: mm/zram

    Taejoon Song <taejoon.song@lge.com>:
      zram: try to avoid worst-case scenario on same element pages

    Colin Ian King <colin.king@canonical.com>:
      drivers/block/zram/zram_drv.c: fix error return codes not being returned in writeback_store

Subsystem: misc

    Akinobu Mita <akinobu.mita@gmail.com>:
    Patch series "add header file for kelvin to/from Celsius conversion:
      include/linux/units.h: add helpers for kelvin to/from Celsius conversion
      ACPI: thermal: switch to use <linux/units.h> helpers
      platform/x86: asus-wmi: switch to use <linux/units.h> helpers
      platform/x86: intel_menlow: switch to use <linux/units.h> helpers
      thermal: int340x: switch to use <linux/units.h> helpers
      thermal: intel_pch: switch to use <linux/units.h> helpers
      nvme: hwmon: switch to use <linux/units.h> helpers
      thermal: remove kelvin to/from Celsius conversion helpers from <linux/thermal.h>
      iwlegacy: use <linux/units.h> helpers
      iwlwifi: use <linux/units.h> helpers
      thermal: armada: remove unused TO_MCELSIUS macro
      iio: adc: qcom-vadc-common: use <linux/units.h> helpers

Subsystem: lib

    Mikhail Zaslonko <zaslonko@linux.ibm.com>:
    Patch series "S390 hardware support for kernel zlib", v3:
      lib/zlib: add s390 hardware support for kernel zlib_deflate
      s390/boot: rename HEAP_SIZE due to name collision
      lib/zlib: add s390 hardware support for kernel zlib_inflate
      s390/boot: add dfltcc= kernel command line parameter
      lib/zlib: add zlib_deflate_dfltcc_enabled() function
      btrfs: use larger zlib buffer for s390 hardware compression

    Nathan Chancellor <natechancellor@gmail.com>:
      lib/scatterlist.c: adjust indentation in __sg_alloc_table

    Yury Norov <yury.norov@gmail.com>:
      uapi: rename ext2_swab() to swab() and share globally in swab.h
      lib/find_bit.c: join _find_next_bit{_le}
      lib/find_bit.c: uninline helper _find_next_bit()

Subsystem: binfmt

    Alexey Dobriyan <adobriyan@gmail.com>:
      fs/binfmt_elf.c: smaller code generation around auxv vector fill
      fs/binfmt_elf.c: fix ->start_code calculation
      fs/binfmt_elf.c: don't copy ELF header around
      fs/binfmt_elf.c: better codegen around current->mm
      fs/binfmt_elf.c: make BAD_ADDR() unlikely
      fs/binfmt_elf.c: coredump: allocate core ELF header on stack
      fs/binfmt_elf.c: coredump: delete duplicated overflow check
      fs/binfmt_elf.c: coredump: allow process with empty address space to coredump

Subsystem: init

    Arvind Sankar <nivedita@alum.mit.edu>:
      init/main.c: log arguments and environment passed to init
      init/main.c: remove unnecessary repair_env_string in do_initcall_level
    Patch series "init/main.c: minor cleanup/bugfix of envvar handling", v2:
      init/main.c: fix quoted value handling in unknown_bootoption

    Christophe Leroy <christophe.leroy@c-s.fr>:
      init/main.c: fix misleading "This architecture does not have kernel memory protection" message

Subsystem: reiserfs

    Yunfeng Ye <yeyunfeng@huawei.com>:
      reiserfs: prevent NULL pointer dereference in reiserfs_insert_item()

Subsystem: exec

    Alexey Dobriyan <adobriyan@gmail.com>:
      execve: warn if process starts with executable stack

Subsystem: dma-mapping

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      include/linux/io-mapping.h-mapping: use PHYS_PFN() macro in io_mapping_map_atomic_wc()

Subsystem: kcov

    Dmitry Vyukov <dvyukov@google.com>:
      kcov: ignore fault-inject and stacktrace

 Documentation/admin-guide/kernel-parameters.txt              |   12 
 Documentation/core-api/index.rst                             |    1 
 Documentation/core-api/pin_user_pages.rst                    |  234 +++++
 Documentation/vm/zswap.rst                                   |   13 
 arch/powerpc/mm/book3s64/iommu_api.c                         |   14 
 arch/s390/boot/compressed/decompressor.c                     |    8 
 arch/s390/boot/ipl_parm.c                                    |   14 
 arch/s390/include/asm/setup.h                                |    7 
 arch/s390/kernel/setup.c                                     |   14 
 drivers/acpi/thermal.c                                       |   34 
 drivers/base/memory.c                                        |   25 
 drivers/block/zram/zram_drv.c                                |   10 
 drivers/gpu/drm/via/via_dmablit.c                            |    6 
 drivers/iio/adc/qcom-vadc-common.c                           |    6 
 drivers/iio/adc/qcom-vadc-common.h                           |    1 
 drivers/infiniband/core/umem.c                               |   21 
 drivers/infiniband/core/umem_odp.c                           |   13 
 drivers/infiniband/hw/hfi1/user_pages.c                      |    4 
 drivers/infiniband/hw/mthca/mthca_memfree.c                  |    8 
 drivers/infiniband/hw/qib/qib_user_pages.c                   |    4 
 drivers/infiniband/hw/qib/qib_user_sdma.c                    |    8 
 drivers/infiniband/hw/usnic/usnic_uiom.c                     |    4 
 drivers/infiniband/sw/siw/siw_mem.c                          |    4 
 drivers/media/v4l2-core/videobuf-dma-sg.c                    |   20 
 drivers/net/ethernet/broadcom/bnx2x/bnx2x_init.h             |    1 
 drivers/net/wireless/intel/iwlegacy/4965-mac.c               |    3 
 drivers/net/wireless/intel/iwlegacy/4965.c                   |   17 
 drivers/net/wireless/intel/iwlegacy/common.h                 |    3 
 drivers/net/wireless/intel/iwlwifi/dvm/dev.h                 |    5 
 drivers/net/wireless/intel/iwlwifi/dvm/devices.c             |    6 
 drivers/nvdimm/pmem.c                                        |    6 
 drivers/nvme/host/hwmon.c                                    |   13 
 drivers/platform/goldfish/goldfish_pipe.c                    |   39 
 drivers/platform/x86/asus-wmi.c                              |    7 
 drivers/platform/x86/intel_menlow.c                          |    9 
 drivers/thermal/armada_thermal.c                             |    2 
 drivers/thermal/intel/int340x_thermal/int340x_thermal_zone.c |    7 
 drivers/thermal/intel/intel_pch_thermal.c                    |    3 
 drivers/vfio/vfio_iommu_type1.c                              |   39 
 fs/binfmt_elf.c                                              |  154 +--
 fs/btrfs/compression.c                                       |    2 
 fs/btrfs/zlib.c                                              |  135 ++
 fs/exec.c                                                    |    5 
 fs/fs-writeback.c                                            |    2 
 fs/io_uring.c                                                |    6 
 fs/ocfs2/cluster/quorum.c                                    |    2 
 fs/ocfs2/dlm/Makefile                                        |    2 
 fs/ocfs2/dlm/dlmast.c                                        |    8 
 fs/ocfs2/dlm/dlmcommon.h                                     |    4 
 fs/ocfs2/dlm/dlmconvert.c                                    |    8 
 fs/ocfs2/dlm/dlmdebug.c                                      |    8 
 fs/ocfs2/dlm/dlmdomain.c                                     |    8 
 fs/ocfs2/dlm/dlmlock.c                                       |    8 
 fs/ocfs2/dlm/dlmmaster.c                                     |   10 
 fs/ocfs2/dlm/dlmrecovery.c                                   |   10 
 fs/ocfs2/dlm/dlmthread.c                                     |    8 
 fs/ocfs2/dlm/dlmunlock.c                                     |    8 
 fs/ocfs2/dlmfs/Makefile                                      |    2 
 fs/ocfs2/dlmfs/dlmfs.c                                       |    4 
 fs/ocfs2/dlmfs/userdlm.c                                     |    6 
 fs/ocfs2/dlmglue.c                                           |    2 
 fs/ocfs2/journal.h                                           |    8 
 fs/ocfs2/namei.c                                             |    3 
 fs/reiserfs/stree.c                                          |    3 
 include/linux/backing-dev.h                                  |   10 
 include/linux/bitops.h                                       |    1 
 include/linux/fs.h                                           |    6 
 include/linux/io-mapping.h                                   |    5 
 include/linux/memblock.h                                     |    7 
 include/linux/memory.h                                       |   29 
 include/linux/memory_hotplug.h                               |    3 
 include/linux/mm.h                                           |  116 +-
 include/linux/mmzone.h                                       |    2 
 include/linux/page-isolation.h                               |    8 
 include/linux/swab.h                                         |    1 
 include/linux/thermal.h                                      |   11 
 include/linux/units.h                                        |   84 +
 include/linux/zlib.h                                         |    6 
 include/trace/events/kmem.h                                  |    4 
 include/trace/events/writeback.h                             |   37 
 include/uapi/linux/swab.h                                    |   10 
 include/uapi/linux/sysctl.h                                  |    2 
 init/main.c                                                  |   36 
 kernel/Makefile                                              |    1 
 lib/Kconfig                                                  |    7 
 lib/Makefile                                                 |    2 
 lib/decompress_inflate.c                                     |   13 
 lib/find_bit.c                                               |   82 -
 lib/scatterlist.c                                            |    2 
 lib/test_bitmap.c                                            |    9 
 lib/test_kasan.c                                             |    1 
 lib/zlib_deflate/deflate.c                                   |   85 +
 lib/zlib_deflate/deflate_syms.c                              |    1 
 lib/zlib_deflate/deftree.c                                   |   54 -
 lib/zlib_deflate/defutil.h                                   |  134 ++
 lib/zlib_dfltcc/Makefile                                     |   13 
 lib/zlib_dfltcc/dfltcc.c                                     |   57 +
 lib/zlib_dfltcc/dfltcc.h                                     |  155 +++
 lib/zlib_dfltcc/dfltcc_deflate.c                             |  280 ++++++
 lib/zlib_dfltcc/dfltcc_inflate.c                             |  149 +++
 lib/zlib_dfltcc/dfltcc_syms.c                                |   17 
 lib/zlib_dfltcc/dfltcc_util.h                                |  123 ++
 lib/zlib_inflate/inflate.c                                   |   32 
 lib/zlib_inflate/inflate.h                                   |    8 
 lib/zlib_inflate/infutil.h                                   |   18 
 mm/Makefile                                                  |    1 
 mm/backing-dev.c                                             |    1 
 mm/debug.c                                                   |   18 
 mm/early_ioremap.c                                           |    8 
 mm/filemap.c                                                 |   34 
 mm/gup.c                                                     |  503 ++++++-----
 mm/gup_benchmark.c                                           |    9 
 mm/huge_memory.c                                             |   44 
 mm/kmemleak.c                                                |  112 +-
 mm/memblock.c                                                |   22 
 mm/memcontrol.c                                              |   25 
 mm/memory_hotplug.c                                          |   24 
 mm/mempolicy.c                                               |    6 
 mm/memremap.c                                                |   95 --
 mm/migrate.c                                                 |   77 +
 mm/mmap.c                                                    |   30 
 mm/oom_kill.c                                                |    2 
 mm/page_alloc.c                                              |   83 +
 mm/page_isolation.c                                          |   69 -
 mm/page_vma_mapped.c                                         |   12 
 mm/process_vm_access.c                                       |   32 
 mm/slub.c                                                    |   88 +
 mm/sparse.c                                                  |    2 
 mm/swap.c                                                    |   27 
 mm/swapfile.c                                                |    2 
 mm/vmscan.c                                                  |   24 
 mm/zswap.c                                                   |   88 +
 net/xdp/xdp_umem.c                                           |    4 
 scripts/spelling.txt                                         |   14 
 tools/testing/selftests/vm/gup_benchmark.c                   |    6 
 tools/vm/slabinfo.c                                          |    4 
 136 files changed, 2790 insertions(+), 1358 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-02-04  1:33 Andrew Morton
       [not found] ` <CAHk-=whog86e4fRY_sxHqAos6spwAi_4aFF49S7h5C4XAZM2qw@mail.gmail.com>
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-02-04  1:33 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


The rest of MM and the rest of everything else.


Subsystems affected by this patch series:

  hotfixes
  mm/pagealloc
  mm/memory-hotplug
  ipc
  misc
  mm/cleanups
  mm/pagemap
  procfs
  lib
  cleanups
  arm

Subsystem: hotfixes

    Gang He <GHe@suse.com>:
      ocfs2: fix oops when writing cloned file

    David Hildenbrand <david@redhat.com>:
    Patch series "mm: fix max_pfn not falling on section boundary", v2:
      mm/page_alloc.c: fix uninitialized memmaps on a partially populated last section
      fs/proc/page.c: allow inspection of last section and fix end detection
      mm/page_alloc.c: initialize memmap of unavailable memory directly

Subsystem: mm/pagealloc

    David Hildenbrand <david@redhat.com>:
      mm/page_alloc: fix and rework pfn handling in memmap_init_zone()
      mm: factor out next_present_section_nr()

Subsystem: mm/memory-hotplug

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
    Patch series "mm/memory_hotplug: Shrink zones before removing memory", v6:
      mm/memmap_init: update variable name in memmap_init_zone

    David Hildenbrand <david@redhat.com>:
      mm/memory_hotplug: poison memmap in remove_pfn_range_from_zone()
      mm/memory_hotplug: we always have a zone in find_(smallest|biggest)_section_pfn
      mm/memory_hotplug: don't check for "all holes" in shrink_zone_span()
      mm/memory_hotplug: drop local variables in shrink_zone_span()
      mm/memory_hotplug: cleanup __remove_pages()
      mm/memory_hotplug: drop valid_start/valid_end from test_pages_in_a_zone()

Subsystem: ipc

    Manfred Spraul <manfred@colorfullife.com>:
      smp_mb__{before,after}_atomic(): update Documentation

    Davidlohr Bueso <dave@stgolabs.net>:
      ipc/mqueue.c: remove duplicated code

    Manfred Spraul <manfred@colorfullife.com>:
      ipc/mqueue.c: update/document memory barriers
      ipc/msg.c: update and document memory barriers
      ipc/sem.c: document and update memory barriers

    Lu Shuaibing <shuaibinglu@126.com>:
      ipc/msg.c: consolidate all xxxctl_down() functions
drivers/block/null_blk_main.c: fix layout

Subsystem: misc

    Andrew Morton <akpm@linux-foundation.org>:
      drivers/block/null_blk_main.c: fix layout
      drivers/block/null_blk_main.c: fix uninitialized var warnings

    Randy Dunlap <rdunlap@infradead.org>:
      pinctrl: fix pxa2xx.c build warnings

Subsystem: mm/cleanups

    Florian Westphal <fw@strlen.de>:
      mm: remove __krealloc

Subsystem: mm/pagemap

    Steven Price <steven.price@arm.com>:
    Patch series "Generic page walk and ptdump", v17:
      mm: add generic p?d_leaf() macros
      arc: mm: add p?d_leaf() definitions
      arm: mm: add p?d_leaf() definitions
      arm64: mm: add p?d_leaf() definitions
      mips: mm: add p?d_leaf() definitions
      powerpc: mm: add p?d_leaf() definitions
      riscv: mm: add p?d_leaf() definitions
      s390: mm: add p?d_leaf() definitions
      sparc: mm: add p?d_leaf() definitions
      x86: mm: add p?d_leaf() definitions
      mm: pagewalk: add p4d_entry() and pgd_entry()
      mm: pagewalk: allow walking without vma
      mm: pagewalk: don't lock PTEs for walk_page_range_novma()
      mm: pagewalk: fix termination condition in walk_pte_range()
      mm: pagewalk: add 'depth' parameter to pte_hole
      x86: mm: point to struct seq_file from struct pg_state
      x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct
      x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct
      mm: add generic ptdump
      x86: mm: convert dump_pagetables to use walk_page_range
      arm64: mm: convert mm/dump.c to use walk_page_range()
      arm64: mm: display non-present entries in ptdump
      mm: ptdump: reduce level numbers by 1 in note_page()
      x86: mm: avoid allocating struct mm_struct on the stack

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
    Patch series "Fixup page directory freeing", v4:
      powerpc/mmu_gather: enable RCU_TABLE_FREE even for !SMP case

    Peter Zijlstra <peterz@infradead.org>:
      mm/mmu_gather: invalidate TLB correctly on batch allocation failure and flush
      asm-generic/tlb: avoid potential double flush
      asm-gemeric/tlb: remove stray function declarations
      asm-generic/tlb: add missing CONFIG symbol
      asm-generic/tlb: rename HAVE_RCU_TABLE_FREE
      asm-generic/tlb: rename HAVE_MMU_GATHER_PAGE_SIZE
      asm-generic/tlb: rename HAVE_MMU_GATHER_NO_GATHER
      asm-generic/tlb: provide MMU_GATHER_TABLE_FREE

Subsystem: procfs

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: decouple proc from VFS with "struct proc_ops"
      proc: convert everything to "struct proc_ops"

Subsystem: lib

    Yury Norov <yury.norov@gmail.com>:
    Patch series "lib: rework bitmap_parse", v5:
      lib/string: add strnchrnul()
      bitops: more BITS_TO_* macros
      lib: add test for bitmap_parse()
      lib: make bitmap_parse_user a wrapper on bitmap_parse
      lib: rework bitmap_parse()
      lib: new testcases for bitmap_parse{_user}
      include/linux/cpumask.h: don't calculate length of the input string

Subsystem: cleanups

    Masahiro Yamada <masahiroy@kernel.org>:
      treewide: remove redundant IS_ERR() before error code check

Subsystem: arm

    Chen-Yu Tsai <wens@csie.org>:
      ARM: dma-api: fix max_pfn off-by-one error in __dma_supported()

 Documentation/memory-barriers.txt                     |   14 
 arch/Kconfig                                          |   17 
 arch/alpha/kernel/srm_env.c                           |   17 
 arch/arc/include/asm/pgtable.h                        |    1 
 arch/arm/Kconfig                                      |    2 
 arch/arm/include/asm/pgtable-2level.h                 |    1 
 arch/arm/include/asm/pgtable-3level.h                 |    1 
 arch/arm/include/asm/tlb.h                            |    6 
 arch/arm/kernel/atags_proc.c                          |    8 
 arch/arm/mm/alignment.c                               |   14 
 arch/arm/mm/dma-mapping.c                             |    2 
 arch/arm64/Kconfig                                    |    3 
 arch/arm64/Kconfig.debug                              |   19 
 arch/arm64/include/asm/pgtable.h                      |    2 
 arch/arm64/include/asm/ptdump.h                       |    8 
 arch/arm64/mm/Makefile                                |    4 
 arch/arm64/mm/dump.c                                  |  152 ++----
 arch/arm64/mm/mmu.c                                   |    4 
 arch/arm64/mm/ptdump_debugfs.c                        |    2 
 arch/ia64/kernel/salinfo.c                            |   24 -
 arch/m68k/kernel/bootinfo_proc.c                      |    8 
 arch/mips/include/asm/pgtable.h                       |    5 
 arch/mips/lasat/picvue_proc.c                         |   31 -
 arch/powerpc/Kconfig                                  |    7 
 arch/powerpc/include/asm/book3s/32/pgalloc.h          |    8 
 arch/powerpc/include/asm/book3s/64/pgalloc.h          |    2 
 arch/powerpc/include/asm/book3s/64/pgtable.h          |    3 
 arch/powerpc/include/asm/nohash/pgalloc.h             |    8 
 arch/powerpc/include/asm/tlb.h                        |   11 
 arch/powerpc/kernel/proc_powerpc.c                    |   10 
 arch/powerpc/kernel/rtas-proc.c                       |   70 +--
 arch/powerpc/kernel/rtas_flash.c                      |   34 -
 arch/powerpc/kernel/rtasd.c                           |   14 
 arch/powerpc/mm/book3s64/pgtable.c                    |    7 
 arch/powerpc/mm/numa.c                                |   12 
 arch/powerpc/platforms/pseries/lpar.c                 |   24 -
 arch/powerpc/platforms/pseries/lparcfg.c              |   14 
 arch/powerpc/platforms/pseries/reconfig.c             |    8 
 arch/powerpc/platforms/pseries/scanlog.c              |   15 
 arch/riscv/include/asm/pgtable-64.h                   |    7 
 arch/riscv/include/asm/pgtable.h                      |    7 
 arch/s390/Kconfig                                     |    4 
 arch/s390/include/asm/pgtable.h                       |    2 
 arch/sh/mm/alignment.c                                |   17 
 arch/sparc/Kconfig                                    |    3 
 arch/sparc/include/asm/pgtable_64.h                   |    2 
 arch/sparc/include/asm/tlb_64.h                       |   11 
 arch/sparc/kernel/led.c                               |   15 
 arch/um/drivers/mconsole_kern.c                       |    9 
 arch/um/kernel/exitcode.c                             |   15 
 arch/um/kernel/process.c                              |   15 
 arch/x86/Kconfig                                      |    3 
 arch/x86/Kconfig.debug                                |   20 
 arch/x86/include/asm/pgtable.h                        |   10 
 arch/x86/include/asm/tlb.h                            |    4 
 arch/x86/kernel/cpu/mtrr/if.c                         |   21 
 arch/x86/mm/Makefile                                  |    4 
 arch/x86/mm/debug_pagetables.c                        |   18 
 arch/x86/mm/dump_pagetables.c                         |  418 +++++-------------
 arch/x86/platform/efi/efi_32.c                        |    2 
 arch/x86/platform/efi/efi_64.c                        |    4 
 arch/x86/platform/uv/tlb_uv.c                         |   14 
 arch/xtensa/platforms/iss/simdisk.c                   |   10 
 crypto/af_alg.c                                       |    2 
 drivers/acpi/battery.c                                |   15 
 drivers/acpi/proc.c                                   |   15 
 drivers/acpi/scan.c                                   |    2 
 drivers/base/memory.c                                 |    9 
 drivers/block/null_blk_main.c                         |   58 +-
 drivers/char/hw_random/bcm2835-rng.c                  |    2 
 drivers/char/hw_random/omap-rng.c                     |    4 
 drivers/clk/clk.c                                     |    2 
 drivers/dma/mv_xor_v2.c                               |    2 
 drivers/firmware/efi/arm-runtime.c                    |    2 
 drivers/gpio/gpiolib-devres.c                         |    2 
 drivers/gpio/gpiolib-of.c                             |    8 
 drivers/gpio/gpiolib.c                                |    2 
 drivers/hwmon/dell-smm-hwmon.c                        |   15 
 drivers/i2c/busses/i2c-mv64xxx.c                      |    5 
 drivers/i2c/busses/i2c-synquacer.c                    |    2 
 drivers/ide/ide-proc.c                                |   19 
 drivers/input/input.c                                 |   28 -
 drivers/isdn/capi/kcapi_proc.c                        |    6 
 drivers/macintosh/via-pmu.c                           |   17 
 drivers/md/md.c                                       |   15 
 drivers/misc/sgi-gru/gruprocfs.c                      |   42 -
 drivers/mtd/ubi/build.c                               |    2 
 drivers/net/wireless/cisco/airo.c                     |  126 ++---
 drivers/net/wireless/intel/ipw2x00/libipw_module.c    |   15 
 drivers/net/wireless/intersil/hostap/hostap_hw.c      |    4 
 drivers/net/wireless/intersil/hostap/hostap_proc.c    |   14 
 drivers/net/wireless/intersil/hostap/hostap_wlan.h    |    2 
 drivers/net/wireless/ray_cs.c                         |   20 
 drivers/of/device.c                                   |    2 
 drivers/parisc/led.c                                  |   17 
 drivers/pci/controller/pci-tegra.c                    |    2 
 drivers/pci/proc.c                                    |   25 -
 drivers/phy/phy-core.c                                |    4 
 drivers/pinctrl/pxa/pinctrl-pxa2xx.c                  |    1 
 drivers/platform/x86/thinkpad_acpi.c                  |   15 
 drivers/platform/x86/toshiba_acpi.c                   |   60 +-
 drivers/pnp/isapnp/proc.c                             |    9 
 drivers/pnp/pnpbios/proc.c                            |   17 
 drivers/s390/block/dasd_proc.c                        |   15 
 drivers/s390/cio/blacklist.c                          |   14 
 drivers/s390/cio/css.c                                |   11 
 drivers/scsi/esas2r/esas2r_main.c                     |    9 
 drivers/scsi/scsi_devinfo.c                           |   15 
 drivers/scsi/scsi_proc.c                              |   29 -
 drivers/scsi/sg.c                                     |   30 -
 drivers/spi/spi-orion.c                               |    3 
 drivers/staging/rtl8192u/ieee80211/ieee80211_module.c |   14 
 drivers/tty/sysrq.c                                   |    8 
 drivers/usb/gadget/function/rndis.c                   |   17 
 drivers/video/fbdev/imxfb.c                           |    2 
 drivers/video/fbdev/via/viafbdev.c                    |  105 ++--
 drivers/zorro/proc.c                                  |    9 
 fs/cifs/cifs_debug.c                                  |  108 ++--
 fs/cifs/dfs_cache.c                                   |   13 
 fs/cifs/dfs_cache.h                                   |    2 
 fs/ext4/super.c                                       |    2 
 fs/f2fs/node.c                                        |    2 
 fs/fscache/internal.h                                 |    2 
 fs/fscache/object-list.c                              |   11 
 fs/fscache/proc.c                                     |    2 
 fs/jbd2/journal.c                                     |   13 
 fs/jfs/jfs_debug.c                                    |   14 
 fs/lockd/procfs.c                                     |   12 
 fs/nfsd/nfsctl.c                                      |   13 
 fs/nfsd/stats.c                                       |   12 
 fs/ocfs2/file.c                                       |   14 
 fs/ocfs2/suballoc.c                                   |    2 
 fs/proc/cpuinfo.c                                     |   12 
 fs/proc/generic.c                                     |   38 -
 fs/proc/inode.c                                       |   76 +--
 fs/proc/internal.h                                    |    5 
 fs/proc/kcore.c                                       |   13 
 fs/proc/kmsg.c                                        |   14 
 fs/proc/page.c                                        |   54 +-
 fs/proc/proc_net.c                                    |   32 -
 fs/proc/proc_sysctl.c                                 |    2 
 fs/proc/root.c                                        |    2 
 fs/proc/stat.c                                        |   12 
 fs/proc/task_mmu.c                                    |    4 
 fs/proc/vmcore.c                                      |   10 
 fs/sysfs/group.c                                      |    2 
 include/asm-generic/pgtable.h                         |   20 
 include/asm-generic/tlb.h                             |  138 +++--
 include/linux/bitmap.h                                |    8 
 include/linux/bitops.h                                |    4 
 include/linux/cpumask.h                               |    4 
 include/linux/memory_hotplug.h                        |    4 
 include/linux/mm.h                                    |    6 
 include/linux/mmzone.h                                |   10 
 include/linux/pagewalk.h                              |   49 +-
 include/linux/proc_fs.h                               |   23 
 include/linux/ptdump.h                                |   24 -
 include/linux/seq_file.h                              |   13 
 include/linux/slab.h                                  |    1 
 include/linux/string.h                                |    1 
 include/linux/sunrpc/stats.h                          |    4 
 ipc/mqueue.c                                          |  123 ++++-
 ipc/msg.c                                             |   62 +-
 ipc/sem.c                                             |   66 +-
 ipc/util.c                                            |   14 
 kernel/configs.c                                      |    9 
 kernel/irq/proc.c                                     |   42 -
 kernel/kallsyms.c                                     |   12 
 kernel/latencytop.c                                   |   14 
 kernel/locking/lockdep_proc.c                         |   15 
 kernel/module.c                                       |   12 
 kernel/profile.c                                      |   24 -
 kernel/sched/psi.c                                    |   48 +-
 lib/bitmap.c                                          |  195 ++++----
 lib/string.c                                          |   17 
 lib/test_bitmap.c                                     |  105 ++++
 mm/Kconfig.debug                                      |   21 
 mm/Makefile                                           |    1 
 mm/gup.c                                              |    2 
 mm/hmm.c                                              |   66 +-
 mm/memory_hotplug.c                                   |  104 +---
 mm/memremap.c                                         |    2 
 mm/migrate.c                                          |    5 
 mm/mincore.c                                          |    1 
 mm/mmu_gather.c                                       |  158 ++++--
 mm/page_alloc.c                                       |   75 +--
 mm/pagewalk.c                                         |  167 +++++--
 mm/ptdump.c                                           |  159 ++++++
 mm/slab_common.c                                      |   37 -
 mm/sparse.c                                           |   10 
 mm/swapfile.c                                         |   14 
 net/atm/mpoa_proc.c                                   |   17 
 net/atm/proc.c                                        |    8 
 net/core/dev.c                                        |    2 
 net/core/filter.c                                     |    2 
 net/core/pktgen.c                                     |   44 -
 net/ipv4/ipconfig.c                                   |   10 
 net/ipv4/netfilter/ipt_CLUSTERIP.c                    |   16 
 net/ipv4/route.c                                      |   24 -
 net/netfilter/xt_recent.c                             |   17 
 net/sunrpc/auth_gss/svcauth_gss.c                     |   10 
 net/sunrpc/cache.c                                    |   45 -
 net/sunrpc/stats.c                                    |   21 
 net/xfrm/xfrm_policy.c                                |    2 
 samples/kfifo/bytestream-example.c                    |   11 
 samples/kfifo/inttype-example.c                       |   11 
 samples/kfifo/record-example.c                        |   11 
 scripts/coccinelle/free/devm_free.cocci               |    4 
 sound/core/info.c                                     |   34 -
 sound/soc/codecs/ak4104.c                             |    3 
 sound/soc/codecs/cs4270.c                             |    3 
 sound/soc/codecs/tlv320aic32x4.c                      |    6 
 sound/soc/sunxi/sun4i-spdif.c                         |    2 
 tools/include/linux/bitops.h                          |    9 
 214 files changed, 2589 insertions(+), 2227 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
       [not found] ` <CAHk-=whog86e4fRY_sxHqAos6spwAi_4aFF49S7h5C4XAZM2qw@mail.gmail.com>
@ 2020-02-04  2:46   ` Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-02-04  2:46 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, Linux-MM

On Tue, 4 Feb 2020 02:27:48 +0000 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, Feb 4, 2020 at 1:33 AM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > The rest of MM and the rest of everything else.
> 
> What's the base? You've changed your scripts or something, and that
> information is no longer in your cover letter..
> 

Crap, sorry, geriatric.

d4e9056daedca3891414fe3c91de3449a5dad0f2

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-02-21  4:00 Andrew Morton
  2020-02-21  4:03 ` incoming Andrew Morton
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-02-21  4:00 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


- A few y2038 fixes which missed the merge window whiole dependencies
  in NFS were being sorted out.

- A bunch of fixes.  Some minor, some not.


Subsystems affected by this patch series:


    Arnd Bergmann <arnd@arndb.de>:
      y2038: remove ktime to/from timespec/timeval conversion
      y2038: remove unused time32 interfaces
      y2038: hide timeval/timespec/itimerval/itimerspec types

    Ioanna Alifieraki <ioanna-maria.alifieraki@canonical.com>:
      Revert "ipc,sem: remove uneeded sem_undo_list lock usage in exit_sem()"

    Christian Borntraeger <borntraeger@de.ibm.com>:
      include/uapi/linux/swab.h: fix userspace breakage, use __BITS_PER_LONG for swap

    SeongJae Park <sjpark@amazon.de>:
      selftests/vm: add missed tests in run_vmtests

    Joe Perches <joe@perches.com>:
      get_maintainer: remove uses of P: for maintainer name

    Douglas Anderson <dianders@chromium.org>:
      scripts/get_maintainer.pl: deprioritize old Fixes: addresses

    Christoph Hellwig <hch@lst.de>:
      mm/swapfile.c: fix a comment in sys_swapon()

    Vasily Averin <vvs@virtuozzo.com>:
      mm/memcontrol.c: lost css_put in memcg_expand_shrinker_maps()

    Alexandru Ardelean <alexandru.ardelean@analog.com>:
      lib/string.c: update match_string() doc-strings with correct behavior

    Gavin Shan <gshan@redhat.com>:
      mm/vmscan.c: don't round up scan size for online memory cgroup

    Wei Yang <richardw.yang@linux.intel.com>:
      mm/sparsemem: pfn_to_page is not valid yet on SPARSEMEM

    Alexander Potapenko <glider@google.com>:
      lib/stackdepot.c: fix global out-of-bounds in stack_slabs

    Randy Dunlap <rdunlap@infradead.org>:
      MAINTAINERS: use tabs for SAFESETID

 MAINTAINERS                            |    8 -
 include/linux/compat.h                 |   29 ------
 include/linux/ktime.h                  |   37 -------
 include/linux/time32.h                 |  154 ---------------------------------
 include/linux/timekeeping32.h          |   32 ------
 include/linux/types.h                  |    5 -
 include/uapi/asm-generic/posix_types.h |    2 
 include/uapi/linux/swab.h              |    4 
 include/uapi/linux/time.h              |   22 ++--
 ipc/sem.c                              |    6 -
 kernel/compat.c                        |   64 -------------
 kernel/time/time.c                     |   43 ---------
 lib/stackdepot.c                       |    8 +
 lib/string.c                           |   16 +++
 mm/memcontrol.c                        |    4 
 mm/sparse.c                            |    2 
 mm/swapfile.c                          |    2 
 mm/vmscan.c                            |    9 +
 scripts/get_maintainer.pl              |   32 ------
 tools/testing/selftests/vm/run_vmtests |   33 +++++++
 20 files changed, 93 insertions(+), 419 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2020-02-21  4:00 incoming Andrew Morton
@ 2020-02-21  4:03 ` Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-02-21  4:03 UTC (permalink / raw)
  To: Linus Torvalds, linux-mm, mm-commits

On Thu, 20 Feb 2020 20:00:30 -0800 Andrew Morton <akpm@linux-foundation.org> wrote:

> - A few y2038 fixes which missed the merge window whiole dependencies
>   in NFS were being sorted out.
> 
> - A bunch of fixes.  Some minor, some not.

15 patches, based on ca7e1fd1026c5af6a533b4b5447e1d2f153e28f2

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-03-06  6:27 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-03-06  6:27 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

7 fixes, based on 9f65ed5fe41ce08ed1cb1f6a950f9ec694c142ad:

    Mel Gorman <mgorman@techsingularity.net>:
      mm, numa: fix bad pmd by atomically check for pmd_trans_huge when marking page tables prot_numa

    Huang Ying <ying.huang@intel.com>:
      mm: fix possible PMD dirty bit lost in set_pmd_migration_entry()

    "Kirill A. Shutemov" <kirill@shutemov.name>:
      mm: avoid data corruption on CoW fault into PFN-mapped VMA

    OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
      fat: fix uninit-memory access for partial initialized inode

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm/z3fold.c: do not include rwlock.h directly

    Vlastimil Babka <vbabka@suse.cz>:
      mm, hotplug: fix page online with DEBUG_PAGEALLOC compiled but not enabled

    Miroslav Benes <mbenes@suse.cz>:
      arch/Kconfig: update HAVE_RELIABLE_STACKTRACE description

 arch/Kconfig        |    5 +++--
 fs/fat/inode.c      |   19 +++++++------------
 include/linux/mm.h  |    4 ++++
 mm/huge_memory.c    |    3 +--
 mm/memory.c         |   35 +++++++++++++++++++++++++++--------
 mm/memory_hotplug.c |    8 +++++++-
 mm/mprotect.c       |   38 ++++++++++++++++++++++++++++++++++++--
 mm/z3fold.c         |    1 -
 8 files changed, 85 insertions(+), 28 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-03-22  1:19 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-03-22  1:19 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

10 fixes, based on c63c50fc2ec9afc4de21ef9ead2eac64b178cce1:


    Chunguang Xu <brookxu@tencent.com>:
      memcg: fix NULL pointer dereference in __mem_cgroup_usage_unregister_event

    Baoquan He <bhe@redhat.com>:
      mm/hotplug: fix hot remove failure in SPARSEMEM|!VMEMMAP case

    Qian Cai <cai@lca.pw>:
      page-flags: fix a crash at SetPageError(THP_SWAP)

    Chris Down <chris@chrisdown.name>:
      mm, memcg: fix corruption on 64-bit divisor in memory.high throttling
      mm, memcg: throttle allocators based on ancestral memory.high

    Michal Hocko <mhocko@suse.com>:
      mm: do not allow MADV_PAGEOUT for CoW pages

    Roman Penyaev <rpenyaev@suse.de>:
      epoll: fix possible lost wakeup on epoll_ctl() path

    Qian Cai <cai@lca.pw>:
      mm/mmu_notifier: silence PROVE_RCU_LIST warnings

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: prevent kmalloc_node crashes and memory leaks

    Joerg Roedel <jroedel@suse.de>:
      x86/mm: split vmalloc_sync_all()

 arch/x86/mm/fault.c        |   26 ++++++++++-
 drivers/acpi/apei/ghes.c   |    2 
 fs/eventpoll.c             |    8 +--
 include/linux/page-flags.h |    2 
 include/linux/vmalloc.h    |    5 +-
 kernel/notifier.c          |    2 
 mm/madvise.c               |   12 +++--
 mm/memcontrol.c            |  105 ++++++++++++++++++++++++++++-----------------
 mm/mmu_notifier.c          |   27 +++++++----
 mm/nommu.c                 |   10 +++-
 mm/slub.c                  |   26 +++++++----
 mm/sparse.c                |    8 ++-
 mm/vmalloc.c               |   11 +++-
 13 files changed, 165 insertions(+), 79 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-03-29  2:14 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-03-29  2:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

5 fixes, based on 83fd69c93340177dcd66fd26ce6441fb581c1dbf:


    Naohiro Aota <naohiro.aota@wdc.com>:
      mm/swapfile.c: move inode_lock out of claim_swapfile

    David Hildenbrand <david@redhat.com>:
      drivers/base/memory.c: indicate all memory blocks as removable

    Mina Almasry <almasrymina@google.com>:
      hugetlb_cgroup: fix illegal access to memory

    Roman Gushchin <guro@fb.com>:
      mm: fork: fix kernel_stack memcg stats for various stack implementations

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/sparse: fix kernel crash with pfn_section_valid check

 drivers/base/memory.c      |   23 +++--------------------
 include/linux/memcontrol.h |   12 ++++++++++++
 kernel/fork.c              |    4 ++--
 mm/hugetlb_cgroup.c        |    3 +--
 mm/memcontrol.c            |   38 ++++++++++++++++++++++++++++++++++++++
 mm/sparse.c                |    6 ++++++
 mm/swapfile.c              |   41 ++++++++++++++++++++---------------------
 7 files changed, 82 insertions(+), 45 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-04-02  4:01 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-04-02  4:01 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


A large amount of MM, plenty more to come.


155 patches, based on GIT 1a323ea5356edbb3073dc59d51b9e6b86908857d

Subsystems affected by this patch series:

  tools
  kthread
  kbuild
  scripts
  ocfs2
  vfs
  mm/slub
  mm/kmemleak
  mm/pagecache
  mm/gup
  mm/swap
  mm/memcg
  mm/pagemap
  mm/mremap
  mm/sparsemem
  mm/kasan
  mm/pagealloc
  mm/vmscan
  mm/compaction
  mm/mempolicy
  mm/hugetlbfs
  mm/hugetlb

Subsystem: tools

    David Ahern <dsahern@kernel.org>:
      tools/accounting/getdelays.c: fix netlink attribute length

Subsystem: kthread

    Petr Mladek <pmladek@suse.com>:
      kthread: mark timer used by delayed kthread works as IRQ safe

Subsystem: kbuild

    Masahiro Yamada <masahiroy@kernel.org>:
      asm-generic: make more kernel-space headers mandatory

Subsystem: scripts

    Jonathan Neuschäfer <j.neuschaefer@gmx.net>:
      scripts/spelling.txt: add syfs/sysfs pattern

    Colin Ian King <colin.king@canonical.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

Subsystem: ocfs2

    Alex Shi <alex.shi@linux.alibaba.com>:
      ocfs2: remove FS_OCFS2_NM
      ocfs2: remove unused macros
      ocfs2: use OCFS2_SEC_BITS in macro
      ocfs2: remove dlm_lock_is_remote

    wangyan <wangyan122@huawei.com>:
      ocfs2: there is no need to log twice in several functions
      ocfs2: correct annotation from "l_next_rec" to "l_next_free_rec"

    Alex Shi <alex.shi@linux.alibaba.com>:
      ocfs2: remove useless err

    Jules Irenge <jbi.octave@gmail.com>:
      ocfs2: Add missing annotations for ocfs2_refcount_cache_lock() and ocfs2_refcount_cache_unlock()

    "Gustavo A. R. Silva" <gustavo@embeddedor.com>:
      ocfs2: replace zero-length array with flexible-array member
      ocfs2: cluster: replace zero-length array with flexible-array member
      ocfs2: dlm: replace zero-length array with flexible-array member
      ocfs2: ocfs2_fs.h: replace zero-length array with flexible-array member

    wangjian <wangjian161@huawei.com>:
      ocfs2: roll back the reference count modification of the parent directory if an error occurs

    Takashi Iwai <tiwai@suse.de>:
      ocfs2: use scnprintf() for avoiding potential buffer overflow

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      ocfs2: use memalloc_nofs_save instead of memalloc_noio_save

Subsystem: vfs

    Kees Cook <keescook@chromium.org>:
      fs_parse: Remove pr_notice() about each validation

Subsystem: mm/slub

    chenqiwu <chenqiwu@xiaomi.com>:
      mm/slub.c: replace cpu_slab->partial with wrapped APIs
      mm/slub.c: replace kmem_cache->cpu_partial with wrapped APIs

    Kees Cook <keescook@chromium.org>:
      slub: improve bit diffusion for freelist ptr obfuscation
      slub: relocate freelist pointer to middle of object

    Vlastimil Babka <vbabka@suse.cz>:
      Revert "topology: add support for node_to_mem_node() to determine the fallback node"

Subsystem: mm/kmemleak

    Nathan Chancellor <natechancellor@gmail.com>:
      mm/kmemleak.c: use address-of operator on section symbols

    Qian Cai <cai@lca.pw>:
      mm/Makefile: disable KCSAN for kmemleak

Subsystem: mm/pagecache

    Jan Kara <jack@suse.cz>:
      mm/filemap.c: don't bother dropping mmap_sem for zero size readahead

    Mauricio Faria de Oliveira <mfo@canonical.com>:
      mm/page-writeback.c: write_cache_pages(): deduplicate identical checks

    Xianting Tian <xianting_tian@126.com>:
      mm/filemap.c: clear page error before actual read

    Souptick Joarder <jrdr.linux@gmail.com>:
      mm/filemap.c: remove unused argument from shrink_readahead_size_eio()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/filemap.c: use vm_fault error code directly
      include/linux/pagemap.h: rename arguments to find_subpage
      mm/page-writeback.c: use VM_BUG_ON_PAGE in clear_page_dirty_for_io
      mm/filemap.c: unexport find_get_entry
      mm/filemap.c: rewrite pagecache_get_page documentation

Subsystem: mm/gup

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "mm/gup: track FOLL_PIN pages", v6:
      mm/gup: split get_user_pages_remote() into two routines
      mm/gup: pass a flags arg to __gup_device_* functions
      mm: introduce page_ref_sub_return()
      mm/gup: pass gup flags to two more routines
      mm/gup: require FOLL_GET for get_user_pages_fast()
      mm/gup: track FOLL_PIN pages
      mm/gup: page->hpage_pinned_refcount: exact pin counts for huge pages
      mm/gup: /proc/vmstat: pin_user_pages (FOLL_PIN) reporting
      mm/gup_benchmark: support pin_user_pages() and related calls
      selftests/vm: run_vmtests: invoke gup_benchmark with basic FOLL_PIN coverage

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: improve dump_page() for compound pages

    John Hubbard <jhubbard@nvidia.com>:
      mm: dump_page(): additional diagnostics for huge pinned pages

    Claudio Imbrenda <imbrenda@linux.ibm.com>:
      mm/gup/writeback: add callbacks for inaccessible pages

    Pingfan Liu <kernelfans@gmail.com>:
      mm/gup: rename nr as nr_pinned in get_user_pages_fast()
      mm/gup: fix omission of check on FOLL_LONGTERM in gup fast path

Subsystem: mm/swap

    Chen Wandun <chenwandun@huawei.com>:
      mm/swapfile.c: fix comments for swapcache_prepare

    Wei Yang <richardw.yang@linux.intel.com>:
      mm/swap.c: not necessary to export __pagevec_lru_add()

    Qian Cai <cai@lca.pw>:
      mm/swapfile: fix data races in try_to_unuse()

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/swap_slots.c: assign|reset cache slot by value directly

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm: swap: make page_evictable() inline
      mm: swap: use smp_mb__after_atomic() to order LRU bit set

    Wei Yang <richard.weiyang@gmail.com>:
      mm/swap_state.c: use the same way to count page in [add_to|delete_from]_swap_cache

Subsystem: mm/memcg

    Yafang Shao <laoar.shao@gmail.com>:
      mm, memcg: fix build error around the usage of kmem_caches

    Kirill Tkhai <ktkhai@virtuozzo.com>:
      mm/memcontrol.c: allocate shrinker_map on appropriate NUMA node

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: use mem_cgroup_from_obj()
    Patch series "mm: memcg: kmem API cleanup", v2:
      mm: kmem: cleanup (__)memcg_kmem_charge_memcg() arguments
      mm: kmem: cleanup memcg_kmem_uncharge_memcg() arguments
      mm: kmem: rename memcg_kmem_(un)charge() into memcg_kmem_(un)charge_page()
      mm: kmem: switch to nr_pages in (__)memcg_kmem_charge_memcg()
      mm: memcg/slab: cache page number in memcg_(un)charge_slab()
      mm: kmem: rename (__)memcg_kmem_(un)charge_memcg() to __memcg_kmem_(un)charge()

    Johannes Weiner <hannes@cmpxchg.org>:
    Patch series "mm: memcontrol: recursive memory.low protection", v3:
      mm: memcontrol: fix memory.low proportional distribution
      mm: memcontrol: clean up and document effective low/min calculations
      mm: memcontrol: recursive memory.low protection

    Shakeel Butt <shakeelb@google.com>:
      memcg: css_tryget_online cleanups

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      mm/memcontrol.c: make mem_cgroup_id_get_many() __maybe_unused

    Chris Down <chris@chrisdown.name>:
      mm, memcg: prevent memory.high load/store tearing
      mm, memcg: prevent memory.max load tearing
      mm, memcg: prevent memory.low load/store tearing
      mm, memcg: prevent memory.min load/store tearing
      mm, memcg: prevent memory.swap.max load tearing
      mm, memcg: prevent mem_cgroup_protected store tearing

    Roman Gushchin <guro@fb.com>:
      mm: memcg: make memory.oom.group tolerable to task migration

Subsystem: mm/pagemap

    Thomas Hellstrom <thellstrom@vmware.com>:
      mm/mapping_dirty_helpers: Update huge page-table entry callbacks

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/vma: some more minor changes", v2:
      mm/vma: move VM_NO_KHUGEPAGED into generic header
      mm/vma: make vma_is_foreign() available for general use
      mm/vma: make is_vma_temporary_stack() available for general use

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: add pagemap.h to the fine documentation

    Peter Xu <peterx@redhat.com>:
    Patch series "mm: Page fault enhancements", v6:
      mm/gup: rename "nonblocking" to "locked" where proper
      mm/gup: fix __get_user_pages() on fault retry of hugetlb
      mm: introduce fault_signal_pending()
      x86/mm: use helper fault_signal_pending()
      arc/mm: use helper fault_signal_pending()
      arm64/mm: use helper fault_signal_pending()
      powerpc/mm: use helper fault_signal_pending()
      sh/mm: use helper fault_signal_pending()
      mm: return faster for non-fatal signals in user mode faults
      userfaultfd: don't retake mmap_sem to emulate NOPAGE
      mm: introduce FAULT_FLAG_DEFAULT
      mm: introduce FAULT_FLAG_INTERRUPTIBLE
      mm: allow VM_FAULT_RETRY for multiple times
      mm/gup: allow VM_FAULT_RETRY for multiple times
      mm/gup: allow to react to fatal signals
      mm/userfaultfd: honor FAULT_FLAG_KILLABLE in fault path

    WANG Wenhu <wenhu.wang@vivo.com>:
      mm: clarify a confusing comment for remap_pfn_range()

    Wang Wenhu <wenhu.wang@vivo.com>:
      mm/memory.c: clarify a confusing comment for vm_iomap_memory

    Jaewon Kim <jaewon31.kim@samsung.com>:
    Patch series "mm: mmap: add mmap trace point", v3:
      mmap: remove inline of vm_unmapped_area
      mm: mmap: add trace point of vm_unmapped_area

Subsystem: mm/mremap

    Brian Geffon <bgeffon@google.com>:
      mm/mremap: add MREMAP_DONTUNMAP to mremap()
      selftests: add MREMAP_DONTUNMAP selftest

Subsystem: mm/sparsemem

    Wei Yang <richardw.yang@linux.intel.com>:
      mm/sparsemem: get address to page struct instead of address to pfn

    Pingfan Liu <kernelfans@gmail.com>:
      mm/sparse: rename pfn_present() to pfn_in_present_section()

    Baoquan He <bhe@redhat.com>:
      mm/sparse.c: use kvmalloc/kvfree to alloc/free memmap for the classic sparse
      mm/sparse.c: allocate memmap preferring the given node

Subsystem: mm/kasan

    Walter Wu <walter-zh.wu@mediatek.com>:
    Patch series "fix the missing underflow in memory operation function", v4:
      kasan: detect negative size in memory operation function
      kasan: add test for invalid size in memmove

Subsystem: mm/pagealloc

    Joel Savitz <jsavitz@redhat.com>:
      mm/page_alloc: increase default min_free_kbytes bound

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm, pagealloc: micro-optimisation: save two branches on hot page allocation path

    chenqiwu <chenqiwu@xiaomi.com>:
      mm/page_alloc.c: use free_area_empty() instead of open-coding

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/page_alloc.c: micro-optimisation Remove unnecessary branch

    chenqiwu <chenqiwu@xiaomi.com>:
      mm/page_alloc: simplify page_is_buddy() for better code readability

Subsystem: mm/vmscan

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm: vmpressure: don't need call kfree if kstrndup fails
      mm: vmpressure: use mem_cgroup_is_root API
      mm: vmscan: replace open codings to NUMA_NO_NODE

    Wei Yang <richardw.yang@linux.intel.com>:
      mm/vmscan.c: remove cpu online notification for now

    Qian Cai <cai@lca.pw>:
      mm/vmscan.c: fix data races using kswapd_classzone_idx

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/vmscan.c: Clean code by removing unnecessary assignment

    Kirill Tkhai <ktkhai@virtuozzo.com>:
      mm/vmscan.c: make may_enter_fs bool in shrink_page_list()

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/vmscan.c: do_try_to_free_pages(): clean code by removing unnecessary assignment

    Michal Hocko <mhocko@suse.com>:
      selftests: vm: drop dependencies on page flags from mlock2 tests

Subsystem: mm/compaction

    Rik van Riel <riel@surriel.com>:
    Patch series "fix THP migration for CMA allocations", v2:
      mm,compaction,cma: add alloc_contig flag to compact_control
      mm,thp,compaction,cma: allow THP migration for CMA allocations

    Vlastimil Babka <vbabka@suse.cz>:
      mm, compaction: fully assume capture is not NULL in compact_zone_order()

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm/compaction: really limit compact_unevictable_allowed to 0 and 1
      mm/compaction: Disable compact_unevictable_allowed on RT

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/compaction.c: clean code by removing unnecessary assignment

Subsystem: mm/mempolicy

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm/mempolicy: support MPOL_MF_STRICT for huge page mapping
      mm/mempolicy: check hugepage migration is supported by arch in vma_migratable()

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm: mempolicy: use VM_BUG_ON_VMA in queue_pages_test_walk()

    Randy Dunlap <rdunlap@infradead.org>:
      mm: mempolicy: require at least one nodeid for MPOL_PREFERRED

    Colin Ian King <colin.king@canonical.com>:
      mm/memblock.c: remove redundant assignment to variable max_addr

Subsystem: mm/hugetlbfs

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "hugetlbfs: use i_mmap_rwsem for more synchronization", v2:
      hugetlbfs: use i_mmap_rwsem for more pmd sharing synchronization
      hugetlbfs: Use i_mmap_rwsem to address page fault/truncate race

Subsystem: mm/hugetlb

    Mina Almasry <almasrymina@google.com>:
      hugetlb_cgroup: add hugetlb_cgroup reservation counter
      hugetlb_cgroup: add interface for charge/uncharge hugetlb reservations
      mm/hugetlb_cgroup: fix hugetlb_cgroup migration
      hugetlb_cgroup: add reservation accounting for private mappings
      hugetlb: disable region_add file_region coalescing
      hugetlb_cgroup: add accounting for shared mappings
      hugetlb_cgroup: support noreserve mappings
      hugetlb: support file_region coalescing again
      hugetlb_cgroup: add hugetlb_cgroup reservation tests
      hugetlb_cgroup: add hugetlb_cgroup reservation docs

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/hugetlb.c: clean code by removing unnecessary initialization

    Vlastimil Babka <vbabka@suse.cz>:
      mm/hugetlb: remove unnecessary memory fetch in PageHeadHuge()

    Christophe Leroy <christophe.leroy@c-s.fr>:
      selftests/vm: fix map_hugetlb length used for testing read and write
      mm/hugetlb: fix build failure with HUGETLB_PAGE but not HUGEBTLBFS

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      include/linux/huge_mm.h: check PageTail in hpage_nr_pages even when !THP

 Documentation/admin-guide/cgroup-v1/hugetlb.rst        |  103 +-
 Documentation/admin-guide/cgroup-v2.rst                |   11 
 Documentation/admin-guide/sysctl/vm.rst                |    3 
 Documentation/core-api/mm-api.rst                      |    3 
 Documentation/core-api/pin_user_pages.rst              |   86 +
 arch/alpha/include/asm/Kbuild                          |   11 
 arch/alpha/mm/fault.c                                  |    6 
 arch/arc/include/asm/Kbuild                            |   21 
 arch/arc/mm/fault.c                                    |   37 
 arch/arm/include/asm/Kbuild                            |   12 
 arch/arm/mm/fault.c                                    |    7 
 arch/arm64/include/asm/Kbuild                          |   18 
 arch/arm64/mm/fault.c                                  |   26 
 arch/c6x/include/asm/Kbuild                            |   37 
 arch/csky/include/asm/Kbuild                           |   36 
 arch/h8300/include/asm/Kbuild                          |   46 
 arch/hexagon/include/asm/Kbuild                        |   33 
 arch/hexagon/mm/vm_fault.c                             |    5 
 arch/ia64/include/asm/Kbuild                           |    7 
 arch/ia64/mm/fault.c                                   |    5 
 arch/m68k/include/asm/Kbuild                           |   24 
 arch/m68k/mm/fault.c                                   |    7 
 arch/microblaze/include/asm/Kbuild                     |   29 
 arch/microblaze/mm/fault.c                             |    5 
 arch/mips/include/asm/Kbuild                           |   13 
 arch/mips/mm/fault.c                                   |    5 
 arch/nds32/include/asm/Kbuild                          |   37 
 arch/nds32/mm/fault.c                                  |    5 
 arch/nios2/include/asm/Kbuild                          |   38 
 arch/nios2/mm/fault.c                                  |    7 
 arch/openrisc/include/asm/Kbuild                       |   36 
 arch/openrisc/mm/fault.c                               |    5 
 arch/parisc/include/asm/Kbuild                         |   18 
 arch/parisc/mm/fault.c                                 |    8 
 arch/powerpc/include/asm/Kbuild                        |    4 
 arch/powerpc/mm/book3s64/pkeys.c                       |   12 
 arch/powerpc/mm/fault.c                                |   20 
 arch/powerpc/platforms/pseries/hotplug-memory.c        |    2 
 arch/riscv/include/asm/Kbuild                          |   28 
 arch/riscv/mm/fault.c                                  |    9 
 arch/s390/include/asm/Kbuild                           |   15 
 arch/s390/mm/fault.c                                   |   10 
 arch/sh/include/asm/Kbuild                             |   16 
 arch/sh/mm/fault.c                                     |   13 
 arch/sparc/include/asm/Kbuild                          |   14 
 arch/sparc/mm/fault_32.c                               |    5 
 arch/sparc/mm/fault_64.c                               |    5 
 arch/um/kernel/trap.c                                  |    3 
 arch/unicore32/include/asm/Kbuild                      |   34 
 arch/unicore32/mm/fault.c                              |    8 
 arch/x86/include/asm/Kbuild                            |    2 
 arch/x86/include/asm/mmu_context.h                     |   15 
 arch/x86/mm/fault.c                                    |   32 
 arch/xtensa/include/asm/Kbuild                         |   26 
 arch/xtensa/mm/fault.c                                 |    5 
 drivers/base/node.c                                    |    2 
 drivers/gpu/drm/ttm/ttm_bo_vm.c                        |   12 
 fs/fs_parser.c                                         |    2 
 fs/hugetlbfs/inode.c                                   |   30 
 fs/ocfs2/alloc.c                                       |    3 
 fs/ocfs2/cluster/heartbeat.c                           |   12 
 fs/ocfs2/cluster/netdebug.c                            |    4 
 fs/ocfs2/cluster/tcp.c                                 |   27 
 fs/ocfs2/cluster/tcp.h                                 |    2 
 fs/ocfs2/dir.c                                         |    4 
 fs/ocfs2/dlm/dlmcommon.h                               |    8 
 fs/ocfs2/dlm/dlmdebug.c                                |  100 -
 fs/ocfs2/dlm/dlmmaster.c                               |    2 
 fs/ocfs2/dlm/dlmthread.c                               |    3 
 fs/ocfs2/dlmglue.c                                     |    2 
 fs/ocfs2/journal.c                                     |    2 
 fs/ocfs2/namei.c                                       |   15 
 fs/ocfs2/ocfs2_fs.h                                    |   18 
 fs/ocfs2/refcounttree.c                                |    2 
 fs/ocfs2/reservations.c                                |    3 
 fs/ocfs2/stackglue.c                                   |    2 
 fs/ocfs2/suballoc.c                                    |    5 
 fs/ocfs2/super.c                                       |   46 
 fs/pipe.c                                              |    2 
 fs/userfaultfd.c                                       |   64 -
 include/asm-generic/Kbuild                             |   52 +
 include/linux/cgroup-defs.h                            |    5 
 include/linux/fs.h                                     |    5 
 include/linux/gfp.h                                    |    6 
 include/linux/huge_mm.h                                |   10 
 include/linux/hugetlb.h                                |   76 +
 include/linux/hugetlb_cgroup.h                         |  175 +++
 include/linux/kasan.h                                  |    2 
 include/linux/kthread.h                                |    3 
 include/linux/memcontrol.h                             |   66 -
 include/linux/mempolicy.h                              |   29 
 include/linux/mm.h                                     |  243 +++-
 include/linux/mm_types.h                               |    7 
 include/linux/mmzone.h                                 |    6 
 include/linux/page_ref.h                               |    9 
 include/linux/pagemap.h                                |   29 
 include/linux/sched/signal.h                           |   18 
 include/linux/swap.h                                   |    1 
 include/linux/topology.h                               |   17 
 include/trace/events/mmap.h                            |   48 
 include/uapi/linux/mman.h                              |    5 
 kernel/cgroup/cgroup.c                                 |   17 
 kernel/fork.c                                          |    9 
 kernel/sysctl.c                                        |   31 
 lib/test_kasan.c                                       |   19 
 mm/Makefile                                            |    1 
 mm/compaction.c                                        |   31 
 mm/debug.c                                             |   54 -
 mm/filemap.c                                           |   77 -
 mm/gup.c                                               |  682 ++++++++++---
 mm/gup_benchmark.c                                     |   71 +
 mm/huge_memory.c                                       |   29 
 mm/hugetlb.c                                           |  866 ++++++++++++-----
 mm/hugetlb_cgroup.c                                    |  347 +++++-
 mm/internal.h                                          |   32 
 mm/kasan/common.c                                      |   26 
 mm/kasan/generic.c                                     |    9 
 mm/kasan/generic_report.c                              |   11 
 mm/kasan/kasan.h                                       |    2 
 mm/kasan/report.c                                      |    5 
 mm/kasan/tags.c                                        |    9 
 mm/kasan/tags_report.c                                 |   11 
 mm/khugepaged.c                                        |    4 
 mm/kmemleak.c                                          |    2 
 mm/list_lru.c                                          |   12 
 mm/mapping_dirty_helpers.c                             |   42 
 mm/memblock.c                                          |    2 
 mm/memcontrol.c                                        |  378 ++++---
 mm/memory-failure.c                                    |   29 
 mm/memory.c                                            |    4 
 mm/mempolicy.c                                         |   73 +
 mm/migrate.c                                           |   25 
 mm/mmap.c                                              |   32 
 mm/mremap.c                                            |   92 +
 mm/page-writeback.c                                    |   19 
 mm/page_alloc.c                                        |   82 -
 mm/page_counter.c                                      |   29 
 mm/page_ext.c                                          |    2 
 mm/rmap.c                                              |   39 
 mm/shuffle.c                                           |    2 
 mm/slab.h                                              |   32 
 mm/slab_common.c                                       |    2 
 mm/slub.c                                              |   27 
 mm/sparse.c                                            |   33 
 mm/swap.c                                              |    5 
 mm/swap_slots.c                                        |   12 
 mm/swap_state.c                                        |    2 
 mm/swapfile.c                                          |   10 
 mm/userfaultfd.c                                       |   11 
 mm/vmpressure.c                                        |    8 
 mm/vmscan.c                                            |  111 --
 mm/vmstat.c                                            |    2 
 scripts/spelling.txt                                   |   21 
 tools/accounting/getdelays.c                           |    2 
 tools/testing/selftests/vm/.gitignore                  |    1 
 tools/testing/selftests/vm/Makefile                    |    2 
 tools/testing/selftests/vm/charge_reserved_hugetlb.sh  |  575 +++++++++++
 tools/testing/selftests/vm/gup_benchmark.c             |   15 
 tools/testing/selftests/vm/hugetlb_reparenting_test.sh |  244 ++++
 tools/testing/selftests/vm/map_hugetlb.c               |   14 
 tools/testing/selftests/vm/mlock2-tests.c              |  233 ----
 tools/testing/selftests/vm/mremap_dontunmap.c          |  313 ++++++
 tools/testing/selftests/vm/run_vmtests                 |   37 
 tools/testing/selftests/vm/write_hugetlb_memory.sh     |   23 
 tools/testing/selftests/vm/write_to_hugetlbfs.c        |  242 ++++
 165 files changed, 5020 insertions(+), 2376 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-04-07  3:02 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-04-07  3:02 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


- a lot more of MM, quite a bit more yet to come.

- various other subsystems



166 patches based on 7e63420847ae5f1036e4f7c42f0b3282e73efbc2.

Subsystems affected by this patch series:

  mm/memcg
  mm/pagemap
  mm/vmalloc
  mm/pagealloc
  mm/migration
  mm/thp
  mm/ksm
  mm/madvise
  mm/virtio
  mm/userfaultfd
  mm/memory-hotplug
  mm/shmem
  mm/rmap
  mm/zswap
  mm/zsmalloc
  mm/cleanups
  procfs
  misc
  MAINTAINERS
  bitops
  lib
  checkpatch
  epoll
  binfmt
  kallsyms
  reiserfs
  kmod
  gcov
  kconfig
  kcov
  ubsan
  fault-injection
  ipc

Subsystem: mm/memcg

    Chris Down <chris@chrisdown.name>:
      mm, memcg: bypass high reclaim iteration for cgroup hierarchy root

Subsystem: mm/pagemap

    Li Xinhai <lixinhai.lxh@gmail.com>:
    Patch series "mm: Fix misuse of parent anon_vma in dup_mmap path":
      mm: don't prepare anon_vma if vma has VM_WIPEONFORK
      Revert "mm/rmap.c: reuse mergeable anon_vma as parent when fork"
      mm: set vm_next and vm_prev to NULL in vm_area_dup()

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/vma: Use all available wrappers when possible", v2:
      mm/vma: add missing VMA flag readable name for VM_SYNC
      mm/vma: make vma_is_accessible() available for general use
      mm/vma: replace all remaining open encodings with is_vm_hugetlb_page()
      mm/vma: replace all remaining open encodings with vma_is_anonymous()
      mm/vma: append unlikely() while testing VMA access permissions

Subsystem: mm/vmalloc

    Qiujun Huang <hqjagain@gmail.com>:
      mm/vmalloc: fix a typo in comment

Subsystem: mm/pagealloc

    Michal Hocko <mhocko@suse.com>:
      mm: make it clear that gfp reclaim modifiers are valid only for sleepable allocations

Subsystem: mm/migration

    Wei Yang <richardw.yang@linux.intel.com>:
    Patch series "cleanup on do_pages_move()", v5:
      mm/migrate.c: no need to check for i > start in do_pages_move()
      mm/migrate.c: wrap do_move_pages_to_node() and store_status()
      mm/migrate.c: check pagelist in move_pages_and_store_status()
      mm/migrate.c: unify "not queued for migration" handling in do_pages_move()

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm/migrate.c: migrate PG_readahead flag

Subsystem: mm/thp

    David Rientjes <rientjes@google.com>:
      mm, shmem: add vmstat for hugepage fallback
      mm, thp: track fallbacks due to failed memcg charges separately

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      include/linux/pagemap.h: optimise find_subpage for !THP
      mm: remove CONFIG_TRANSPARENT_HUGE_PAGECACHE

Subsystem: mm/ksm

    Li Chen <chenli@uniontech.com>:
      mm/ksm.c: update get_user_pages() argument in comment

Subsystem: mm/madvise

    Huang Ying <ying.huang@intel.com>:
      mm: code cleanup for MADV_FREE

Subsystem: mm/virtio

    Alexander Duyck <alexander.h.duyck@linux.intel.com>:
    Patch series "mm / virtio: Provide support for free page reporting", v17:
      mm: adjust shuffle code to allow for future coalescing
      mm: use zone and order instead of free area in free_list manipulators
      mm: add function __putback_isolated_page
      mm: introduce Reported pages
      virtio-balloon: pull page poisoning config out of free page hinting
      virtio-balloon: add support for providing free page reports to host
      mm/page_reporting: rotate reported pages to the tail of the list
      mm/page_reporting: add budget limit on how many pages can be reported per pass
      mm/page_reporting: add free page reporting documentation

    David Hildenbrand <david@redhat.com>:
      virtio-balloon: switch back to OOM handler for VIRTIO_BALLOON_F_DEFLATE_ON_OOM

Subsystem: mm/userfaultfd

    Shaohua Li <shli@fb.com>:
    Patch series "userfaultfd: write protection support", v6:
      userfaultfd: wp: add helper for writeprotect check

    Andrea Arcangeli <aarcange@redhat.com>:
      userfaultfd: wp: hook userfault handler to write protection fault
      userfaultfd: wp: add WP pagetable tracking to x86
      userfaultfd: wp: userfaultfd_pte/huge_pmd_wp() helpers
      userfaultfd: wp: add UFFDIO_COPY_MODE_WP

    Peter Xu <peterx@redhat.com>:
      mm: merge parameters for change_protection()
      userfaultfd: wp: apply _PAGE_UFFD_WP bit
      userfaultfd: wp: drop _PAGE_UFFD_WP properly when fork
      userfaultfd: wp: add pmd_swp_*uffd_wp() helpers
      userfaultfd: wp: support swap and page migration
      khugepaged: skip collapse if uffd-wp detected

    Shaohua Li <shli@fb.com>:
      userfaultfd: wp: support write protection for userfault vma range

    Andrea Arcangeli <aarcange@redhat.com>:
      userfaultfd: wp: add the writeprotect API to userfaultfd ioctl

    Shaohua Li <shli@fb.com>:
      userfaultfd: wp: enabled write protection in userfaultfd API

    Peter Xu <peterx@redhat.com>:
      userfaultfd: wp: don't wake up when doing write protect

    Martin Cracauer <cracauer@cons.org>:
      userfaultfd: wp: UFFDIO_REGISTER_MODE_WP documentation update

    Peter Xu <peterx@redhat.com>:
      userfaultfd: wp: declare _UFFDIO_WRITEPROTECT conditionally
      userfaultfd: selftests: refactor statistics
      userfaultfd: selftests: add write-protect test

Subsystem: mm/memory-hotplug

    David Hildenbrand <david@redhat.com>:
    Patch series "mm: drop superfluous section checks when onlining/offlining":
      drivers/base/memory.c: drop section_count
      drivers/base/memory.c: drop pages_correctly_probed()
      mm/page_ext.c: drop pfn_present() check when onlining

    Baoquan He <bhe@redhat.com>:
      mm/memory_hotplug.c: only respect mem= parameter during boot stage

    David Hildenbrand <david@redhat.com>:
      mm/memory_hotplug.c: simplify calculation of number of pages in __remove_pages()
      mm/memory_hotplug.c: cleanup __add_pages()

    Baoquan He <bhe@redhat.com>:
    Patch series "mm/hotplug: Only use subsection map for VMEMMAP", v4:
      mm/sparse.c: introduce new function fill_subsection_map()
      mm/sparse.c: introduce a new function clear_subsection_map()
      mm/sparse.c: only use subsection map in VMEMMAP case
      mm/sparse.c: add note about only VMEMMAP supporting sub-section hotplug
      mm/sparse.c: move subsection_map related functions together

    David Hildenbrand <david@redhat.com>:
    Patch series "mm/memory_hotplug: allow to specify a default online_type", v3:
      drivers/base/memory: rename MMOP_ONLINE_KEEP to MMOP_ONLINE
      drivers/base/memory: map MMOP_OFFLINE to 0
      drivers/base/memory: store mapping between MMOP_* and string in an array
      powernv/memtrace: always online added memory blocks
      hv_balloon: don't check for memhp_auto_online manually
      mm/memory_hotplug: unexport memhp_auto_online
      mm/memory_hotplug: convert memhp_auto_online to store an online_type
      mm/memory_hotplug: allow to specify a default online_type

    chenqiwu <chenqiwu@xiaomi.com>:
      mm/memory_hotplug.c: use __pfn_to_section() instead of open-coding

Subsystem: mm/shmem

    Kees Cook <keescook@chromium.org>:
      mm/shmem.c: distribute switch variables for initialization

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/shmem.c: clean code by removing unnecessary assignment

    Hugh Dickins <hughd@google.com>:
      mm: huge tmpfs: try to split_huge_page() when punching hole

Subsystem: mm/rmap

    Palmer Dabbelt <palmerdabbelt@google.com>:
      mm: prevent a warning when casting void* -> enum

Subsystem: mm/zswap

    "Maciej S. Szmigiero" <mail@maciej.szmigiero.name>:
      mm/zswap: allow setting default status, compressor and allocator in Kconfig

Subsystem: mm/zsmalloc

Subsystem: mm/cleanups

    Jules Irenge <jbi.octave@gmail.com>:
      mm/compaction: add missing annotation for compact_lock_irqsave
      mm/hugetlb: add missing annotation for gather_surplus_pages()
      mm/mempolicy: add missing annotation for queue_pages_pmd()
      mm/slub: add missing annotation for get_map()
      mm/slub: add missing annotation for put_map()
      mm/zsmalloc: add missing annotation for migrate_read_lock()
      mm/zsmalloc: add missing annotation for migrate_read_unlock()
      mm/zsmalloc: add missing annotation for pin_tag()
      mm/zsmalloc: add missing annotation for unpin_tag()

    chenqiwu <chenqiwu@xiaomi.com>:
      mm: fix ambiguous comments for better code readability

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/mm_init.c: clean code. Use BUILD_BUG_ON when comparing compile time constant

    Joe Perches <joe@perches.com>:
      mm: use fallthrough;

    Steven Price <steven.price@arm.com>:
      include/linux/swapops.h: correct guards for non_swap_entry()

    Ira Weiny <ira.weiny@intel.com>:
      include/linux/memremap.h: remove stale comments

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/dmapool.c: micro-optimisation remove unnecessary branch

    Waiman Long <longman@redhat.com>:
      mm: remove dummy struct bootmem_data/bootmem_data_t

Subsystem: procfs

    Jules Irenge <jbi.octave@gmail.com>:
      fs/proc/inode.c: annotate close_pdeo() for sparse

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: faster open/read/close with "permanent" files
      proc: speed up /proc/*/statm

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      proc: inline vma_stop into m_stop
      proc: remove m_cache_vma
      proc: use ppos instead of m->version
      seq_file: remove m->version
      proc: inline m_next_vma into m_next

Subsystem: misc

    Michal Simek <michal.simek@xilinx.com>:
      asm-generic: fix unistd_32.h generation format

    Nathan Chancellor <natechancellor@gmail.com>:
      kernel/extable.c: use address-of operator on section symbols

    Masahiro Yamada <masahiroy@kernel.org>:
      sparc,x86: vdso: remove meaningless undefining CONFIG_OPTIMIZE_INLINING
      compiler: remove CONFIG_OPTIMIZE_INLINING entirely

    Vegard Nossum <vegard.nossum@oracle.com>:
      compiler.h: fix error in BUILD_BUG_ON() reporting

Subsystem: MAINTAINERS

    Joe Perches <joe@perches.com>:
      MAINTAINERS: list the section entries in the preferred order

Subsystem: bitops

    Josh Poimboeuf <jpoimboe@redhat.com>:
      bitops: always inline sign extension helpers

Subsystem: lib

    Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
      lib/test_lockup: test module to generate lockups

    Colin Ian King <colin.king@canonical.com>:
      lib/test_lockup.c: fix spelling mistake "iteraions" -> "iterations"

    Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
      lib/test_lockup.c: add parameters for locking generic vfs locks

    "Gustavo A. R. Silva" <gustavo@embeddedor.com>:
      lib/bch.c: replace zero-length array with flexible-array member
      lib/ts_bm.c: replace zero-length array with flexible-array member
      lib/ts_fsm.c: replace zero-length array with flexible-array member
      lib/ts_kmp.c: replace zero-length array with flexible-array member

    Geert Uytterhoeven <geert+renesas@glider.be>:
      lib/scatterlist: fix sg_copy_buffer() kerneldoc

    Kees Cook <keescook@chromium.org>:
      lib: test_stackinit.c: XFAIL switch variable init tests

    Alexander Potapenko <glider@google.com>:
      lib/stackdepot.c: check depot_index before accessing the stack slab
lib/stackdepot.c: fix a condition in stack_depot_fetch()
      lib/stackdepot.c: build with -fno-builtin
      kasan: stackdepot: move filter_irq_stacks() to stackdepot.c

    Qian Cai <cai@lca.pw>:
      percpu_counter: fix a data race at vm_committed_as

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      lib/test_bitmap.c: make use of EXP2_IN_BITS

    chenqiwu <chenqiwu@xiaomi.com>:
      lib/rbtree: fix coding style of assignments

    Dan Carpenter <dan.carpenter@oracle.com>:
      lib/test_kmod.c: remove a NULL test

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      linux/bits.h: add compile time sanity check of GENMASK inputs

    Chris Wilson <chris@chris-wilson.co.uk>:
      lib/list: prevent compiler reloads inside 'safe' list iteration

    Nathan Chancellor <natechancellor@gmail.com>:
      lib/dynamic_debug.c: use address-of operator on section symbols

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: remove email address comment from email address comparisons

    Lubomir Rintel <lkundrak@v3.sk>:
      checkpatch: check SPDX tags in YAML files

    John Hubbard <jhubbard@nvidia.com>:
      checkpatch: support "base-commit:" format

    Joe Perches <joe@perches.com>:
      checkpatch: prefer fallthrough; over fallthrough comments

    Antonio Borneo <borneo.antonio@gmail.com>:
      checkpatch: fix minor typo and mixed space+tab in indentation
      checkpatch: fix multiple const * types
      checkpatch: add command-line option for TAB size

    Joe Perches <joe@perches.com>:
      checkpatch: improve Gerrit Change-Id: test

    Lubomir Rintel <lkundrak@v3.sk>:
      checkpatch: check proper licensing of Devicetree bindings

    Joe Perches <joe@perches.com>:
      checkpatch: avoid warning about uninitialized_var()

Subsystem: epoll

    Roman Penyaev <rpenyaev@suse.de>:
      kselftest: introduce new epoll test case

    Jason Baron <jbaron@akamai.com>:
      fs/epoll: make nesting accounting safe for -rt kernel

Subsystem: binfmt

    Alexey Dobriyan <adobriyan@gmail.com>:
      fs/binfmt_elf.c: delete "loc" variable
      fs/binfmt_elf.c: allocate less for static executable
      fs/binfmt_elf.c: don't free interpreter's ELF pheaders on common path

Subsystem: kallsyms

    Will Deacon <will@kernel.org>:
    Patch series "Unexport kallsyms_lookup_name() and kallsyms_on_each_symbol()":
      samples/hw_breakpoint: drop HW_BREAKPOINT_R when reporting writes
      samples/hw_breakpoint: drop use of kallsyms_lookup_name()
      kallsyms: unexport kallsyms_lookup_name() and kallsyms_on_each_symbol()

Subsystem: reiserfs

    Colin Ian King <colin.king@canonical.com>:
      reiserfs: clean up several indentation issues

Subsystem: kmod

    Qiujun Huang <hqjagain@gmail.com>:
      kernel/kmod.c: fix a typo "assuems" -> "assumes"

Subsystem: gcov

    "Gustavo A. R. Silva" <gustavo@embeddedor.com>:
      gcov: gcc_4_7: replace zero-length array with flexible-array member
      gcov: gcc_3_4: replace zero-length array with flexible-array member
      kernel/gcov/fs.c: replace zero-length array with flexible-array member

Subsystem: kconfig

    Krzysztof Kozlowski <krzk@kernel.org>:
      init/Kconfig: clean up ANON_INODES and old IO schedulers options

Subsystem: kcov

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kcov: collect coverage from usb soft interrupts", v4:
      kcov: cleanup debug messages
      kcov: fix potential use-after-free in kcov_remote_start
      kcov: move t->kcov assignments into kcov_start/stop
      kcov: move t->kcov_sequence assignment
      kcov: use t->kcov_mode as enabled indicator
      kcov: collect coverage from interrupts
      usb: core: kcov: collect coverage from usb complete callback

Subsystem: ubsan

    Kees Cook <keescook@chromium.org>:
    Patch series "ubsan: Split out bounds checker", v5:
      ubsan: add trap instrumentation option
      ubsan: split "bounds" checker from other options
      drivers/misc/lkdtm/bugs.c: add arithmetic overflow and array bounds checks
      ubsan: check panic_on_warn
      kasan: unset panic_on_warn before calling panic()
      ubsan: include bug type in report header

Subsystem: fault-injection

    Qiujun Huang <hqjagain@gmail.com>:
      lib/Kconfig.debug: fix a typo "capabilitiy" -> "capability"

Subsystem: ipc

    Somala Swaraj <somalaswaraj@gmail.com>:
      ipc/mqueue.c: fix a brace coding style issue

    Jason Yan <yanaijie@huawei.com>:
      ipc/shm.c: make compat_ksys_shmctl() static

 Documentation/admin-guide/kernel-parameters.txt               |   13 
 Documentation/admin-guide/mm/transhuge.rst                    |   14 
 Documentation/admin-guide/mm/userfaultfd.rst                  |   51 
 Documentation/dev-tools/kcov.rst                              |   17 
 Documentation/vm/free_page_reporting.rst                      |   41 
 Documentation/vm/zswap.rst                                    |   20 
 MAINTAINERS                                                   |   35 
 arch/alpha/include/asm/mmzone.h                               |    2 
 arch/alpha/kernel/syscalls/syscallhdr.sh                      |    2 
 arch/csky/mm/fault.c                                          |    4 
 arch/ia64/kernel/syscalls/syscallhdr.sh                       |    2 
 arch/ia64/kernel/vmlinux.lds.S                                |    2 
 arch/m68k/mm/fault.c                                          |    4 
 arch/microblaze/kernel/syscalls/syscallhdr.sh                 |    2 
 arch/mips/kernel/syscalls/syscallhdr.sh                       |    3 
 arch/mips/mm/fault.c                                          |    4 
 arch/nds32/kernel/vmlinux.lds.S                               |    1 
 arch/parisc/kernel/syscalls/syscallhdr.sh                     |    2 
 arch/powerpc/kernel/syscalls/syscallhdr.sh                    |    3 
 arch/powerpc/kvm/e500_mmu_host.c                              |    2 
 arch/powerpc/mm/fault.c                                       |    2 
 arch/powerpc/platforms/powernv/memtrace.c                     |   14 
 arch/sh/kernel/syscalls/syscallhdr.sh                         |    2 
 arch/sh/mm/fault.c                                            |    2 
 arch/sparc/kernel/syscalls/syscallhdr.sh                      |    2 
 arch/sparc/vdso/vdso32/vclock_gettime.c                       |    4 
 arch/x86/Kconfig                                              |    1 
 arch/x86/configs/i386_defconfig                               |    1 
 arch/x86/configs/x86_64_defconfig                             |    1 
 arch/x86/entry/vdso/vdso32/vclock_gettime.c                   |    4 
 arch/x86/include/asm/pgtable.h                                |   67 +
 arch/x86/include/asm/pgtable_64.h                             |    8 
 arch/x86/include/asm/pgtable_types.h                          |   12 
 arch/x86/mm/fault.c                                           |    2 
 arch/xtensa/kernel/syscalls/syscallhdr.sh                     |    2 
 drivers/base/memory.c                                         |  138 --
 drivers/hv/hv_balloon.c                                       |   25 
 drivers/misc/lkdtm/bugs.c                                     |   75 +
 drivers/misc/lkdtm/core.c                                     |    3 
 drivers/misc/lkdtm/lkdtm.h                                    |    3 
 drivers/usb/core/hcd.c                                        |    3 
 drivers/virtio/Kconfig                                        |    1 
 drivers/virtio/virtio_balloon.c                               |  190 ++-
 fs/binfmt_elf.c                                               |   56 
 fs/eventpoll.c                                                |   64 -
 fs/proc/array.c                                               |   39 
 fs/proc/cpuinfo.c                                             |    1 
 fs/proc/generic.c                                             |   31 
 fs/proc/inode.c                                               |  188 ++-
 fs/proc/internal.h                                            |    6 
 fs/proc/kmsg.c                                                |    1 
 fs/proc/stat.c                                                |    1 
 fs/proc/task_mmu.c                                            |   97 -
 fs/reiserfs/do_balan.c                                        |    2 
 fs/reiserfs/ioctl.c                                           |   11 
 fs/reiserfs/namei.c                                           |   10 
 fs/seq_file.c                                                 |   28 
 fs/userfaultfd.c                                              |  116 +
 include/asm-generic/pgtable.h                                 |    1 
 include/asm-generic/pgtable_uffd.h                            |   66 +
 include/asm-generic/tlb.h                                     |    3 
 include/linux/bitops.h                                        |    4 
 include/linux/bits.h                                          |   22 
 include/linux/compiler.h                                      |    2 
 include/linux/compiler_types.h                                |   11 
 include/linux/gfp.h                                           |    2 
 include/linux/huge_mm.h                                       |    2 
 include/linux/list.h                                          |   50 
 include/linux/memory.h                                        |    1 
 include/linux/memory_hotplug.h                                |   13 
 include/linux/memremap.h                                      |    2 
 include/linux/mm.h                                            |   25 
 include/linux/mm_inline.h                                     |   15 
 include/linux/mm_types.h                                      |    4 
 include/linux/mmzone.h                                        |   47 
 include/linux/page-flags.h                                    |   16 
 include/linux/page_reporting.h                                |   26 
 include/linux/pagemap.h                                       |    4 
 include/linux/percpu_counter.h                                |    4 
 include/linux/proc_fs.h                                       |   17 
 include/linux/sched.h                                         |    3 
 include/linux/seq_file.h                                      |    1 
 include/linux/shmem_fs.h                                      |   10 
 include/linux/stackdepot.h                                    |    2 
 include/linux/swapops.h                                       |    5 
 include/linux/userfaultfd_k.h                                 |   42 
 include/linux/vm_event_item.h                                 |    5 
 include/trace/events/huge_memory.h                            |    1 
 include/trace/events/mmflags.h                                |    1 
 include/trace/events/vmscan.h                                 |    2 
 include/uapi/linux/userfaultfd.h                              |   40 
 include/uapi/linux/virtio_balloon.h                           |    1 
 init/Kconfig                                                  |    8 
 ipc/mqueue.c                                                  |    5 
 ipc/shm.c                                                     |    2 
 ipc/util.c                                                    |    1 
 kernel/configs/tiny.config                                    |    1 
 kernel/events/core.c                                          |    3 
 kernel/extable.c                                              |    3 
 kernel/fork.c                                                 |   10 
 kernel/gcov/fs.c                                              |    2 
 kernel/gcov/gcc_3_4.c                                         |    6 
 kernel/gcov/gcc_4_7.c                                         |    2 
 kernel/kallsyms.c                                             |    2 
 kernel/kcov.c                                                 |  282 +++-
 kernel/kmod.c                                                 |    2 
 kernel/module.c                                               |    1 
 kernel/sched/fair.c                                           |    2 
 lib/Kconfig.debug                                             |   35 
 lib/Kconfig.ubsan                                             |   51 
 lib/Makefile                                                  |    8 
 lib/bch.c                                                     |    2 
 lib/dynamic_debug.c                                           |    2 
 lib/rbtree.c                                                  |    4 
 lib/scatterlist.c                                             |    2 
 lib/stackdepot.c                                              |   39 
 lib/test_bitmap.c                                             |    2 
 lib/test_kmod.c                                               |    2 
 lib/test_lockup.c                                             |  601 +++++++++-
 lib/test_stackinit.c                                          |   28 
 lib/ts_bm.c                                                   |    2 
 lib/ts_fsm.c                                                  |    2 
 lib/ts_kmp.c                                                  |    2 
 lib/ubsan.c                                                   |   47 
 mm/Kconfig                                                    |  135 ++
 mm/Makefile                                                   |    1 
 mm/compaction.c                                               |    3 
 mm/dmapool.c                                                  |    4 
 mm/filemap.c                                                  |   14 
 mm/gup.c                                                      |    9 
 mm/huge_memory.c                                              |   36 
 mm/hugetlb.c                                                  |    1 
 mm/hugetlb_cgroup.c                                           |    6 
 mm/internal.h                                                 |    2 
 mm/kasan/common.c                                             |   23 
 mm/kasan/report.c                                             |   10 
 mm/khugepaged.c                                               |   39 
 mm/ksm.c                                                      |    5 
 mm/list_lru.c                                                 |    2 
 mm/memcontrol.c                                               |    5 
 mm/memory-failure.c                                           |    2 
 mm/memory.c                                                   |   42 
 mm/memory_hotplug.c                                           |   53 
 mm/mempolicy.c                                                |   11 
 mm/migrate.c                                                  |  122 +-
 mm/mm_init.c                                                  |    2 
 mm/mmap.c                                                     |   10 
 mm/mprotect.c                                                 |   76 -
 mm/page_alloc.c                                               |  174 ++
 mm/page_ext.c                                                 |    5 
 mm/page_isolation.c                                           |    6 
 mm/page_reporting.c                                           |  384 ++++++
 mm/page_reporting.h                                           |   54 
 mm/rmap.c                                                     |   23 
 mm/shmem.c                                                    |  168 +-
 mm/shuffle.c                                                  |   12 
 mm/shuffle.h                                                  |    6 
 mm/slab_common.c                                              |    1 
 mm/slub.c                                                     |    3 
 mm/sparse.c                                                   |  236 ++-
 mm/swap.c                                                     |   20 
 mm/swapfile.c                                                 |    1 
 mm/userfaultfd.c                                              |   98 +
 mm/vmalloc.c                                                  |    2 
 mm/vmscan.c                                                   |   12 
 mm/vmstat.c                                                   |    3 
 mm/zsmalloc.c                                                 |   10 
 mm/zswap.c                                                    |   24 
 samples/hw_breakpoint/data_breakpoint.c                       |   11 
 scripts/Makefile.ubsan                                        |   16 
 scripts/checkpatch.pl                                         |  155 +-
 tools/lib/rbtree.c                                            |    4 
 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c |   67 +
 tools/testing/selftests/vm/userfaultfd.c                      |  233 +++
 174 files changed, 3990 insertions(+), 1399 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-04-10 21:30 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-04-10 21:30 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


Almost all of the rest of MM.  Various other things.

35 patches, based on c0cc271173b2e1c2d8d0ceaef14e4dfa79eefc0d.

Subsystems affected by this patch series:

  hfs
  mm/memcg
  mm/slab-generic
  mm/slab
  mm/pagealloc
  mm/gup
  ocfs2
  mm/hugetlb
  mm/pagemap
  mm/memremap
  kmod
  misc
  seqfile

Subsystem: hfs

    Simon Gander <simon@tuxera.com>:
      hfsplus: fix crash and filesystem corruption when deleting files

Subsystem: mm/memcg

    Jakub Kicinski <kuba@kernel.org>:
      mm, memcg: do not high throttle allocators based on wraparound

Subsystem: mm/slab-generic

    Qiujun Huang <hqjagain@gmail.com>:
      mm, slab_common: fix a typo in comment "eariler"->"earlier"

Subsystem: mm/slab

    Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
      docs: mm: slab.h: fix a broken cross-reference

Subsystem: mm/pagealloc

    Randy Dunlap <rdunlap@infradead.org>:
      mm/page_alloc.c: fix kernel-doc warning

    Jason Yan <yanaijie@huawei.com>:
      mm/page_alloc: make pcpu_drain_mutex and pcpu_drain static

Subsystem: mm/gup

    Miles Chen <miles.chen@mediatek.com>:
      mm/gup: fix null pointer dereference detected by coverity

Subsystem: ocfs2

    Changwei Ge <chge@linux.alibaba.com>:
      ocfs2: no need try to truncate file beyond i_size

Subsystem: mm/hugetlb

    Aslan Bakirov <aslan@fb.com>:
      mm: cma: NUMA node interface

    Roman Gushchin <guro@fb.com>:
      mm: hugetlb: optionally allocate gigantic hugepages using cma

Subsystem: mm/pagemap

    Jaewon Kim <jaewon31.kim@samsung.com>:
      mm/mmap.c: initialize align_offset explicitly for vm_unmapped_area

    Arjun Roy <arjunroy@google.com>:
      mm/memory.c: refactor insert_page to prepare for batched-lock insert
      mm: bring sparc pte_index() semantics inline with other platforms
      mm: define pte_index as macro for x86
      mm/memory.c: add vm_insert_pages()

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/vma: define a default value for VM_DATA_DEFAULT_FLAGS
      mm/vma: introduce VM_ACCESS_FLAGS
      mm/special: create generic fallbacks for pte_special() and pte_mkspecial()

Subsystem: mm/memremap

    Logan Gunthorpe <logang@deltatee.com>:
    Patch series "Allow setting caching mode in arch_add_memory() for P2PDMA", v4:
      mm/memory_hotplug: drop the flags field from struct mhp_restrictions
      mm/memory_hotplug: rename mhp_restrictions to mhp_params
      x86/mm: thread pgprot_t through init_memory_mapping()
      x86/mm: introduce __set_memory_prot()
      powerpc/mm: thread pgprot_t through create_section_mapping()
      mm/memory_hotplug: add pgprot_t to mhp_params
      mm/memremap: set caching mode for PCI P2PDMA memory to WC

Subsystem: kmod

    Eric Biggers <ebiggers@google.com>:
    Patch series "module autoloading fixes and cleanups", v5:
      kmod: make request_module() return an error when autoloading is disabled
      fs/filesystems.c: downgrade user-reachable WARN_ONCE() to pr_warn_once()
      docs: admin-guide: document the kernel.modprobe sysctl
      selftests: kmod: fix handling test numbers above 9
      selftests: kmod: test disabling module autoloading

Subsystem: misc

    Pali Rohár <pali@kernel.org>:
      change email address for Pali Rohár

    kbuild test robot <lkp@intel.com>:
      drivers/dma/tegra20-apb-dma.c: fix platform_get_irq.cocci warnings

Subsystem: seqfile

    Vasily Averin <vvs@virtuozzo.com>:
    Patch series "seq_file .next functions should increase position index":
      fs/seq_file.c: seq_read(): add info message about buggy .next functions
      kernel/gcov/fs.c: gcov_seq_next() should increase position index
      ipc/util.c: sysvipc_find_ipc() should increase position index

 Documentation/ABI/testing/sysfs-platform-dell-laptop |    8 
 Documentation/admin-guide/kernel-parameters.txt      |    8 
 Documentation/admin-guide/sysctl/kernel.rst          |   21 ++
 MAINTAINERS                                          |   16 -
 arch/alpha/include/asm/page.h                        |    3 
 arch/alpha/include/asm/pgtable.h                     |    2 
 arch/arc/include/asm/page.h                          |    2 
 arch/arm/include/asm/page.h                          |    4 
 arch/arm/include/asm/pgtable-2level.h                |    2 
 arch/arm/include/asm/pgtable.h                       |   15 -
 arch/arm/mach-omap2/omap-secure.c                    |    2 
 arch/arm/mach-omap2/omap-secure.h                    |    2 
 arch/arm/mach-omap2/omap-smc.S                       |    2 
 arch/arm/mm/fault.c                                  |    2 
 arch/arm/mm/mmu.c                                    |   14 +
 arch/arm64/include/asm/page.h                        |    4 
 arch/arm64/mm/fault.c                                |    2 
 arch/arm64/mm/init.c                                 |    6 
 arch/arm64/mm/mmu.c                                  |    7 
 arch/c6x/include/asm/page.h                          |    5 
 arch/csky/include/asm/page.h                         |    3 
 arch/csky/include/asm/pgtable.h                      |    3 
 arch/h8300/include/asm/page.h                        |    2 
 arch/hexagon/include/asm/page.h                      |    3 
 arch/hexagon/include/asm/pgtable.h                   |    2 
 arch/ia64/include/asm/page.h                         |    5 
 arch/ia64/include/asm/pgtable.h                      |    2 
 arch/ia64/mm/init.c                                  |    7 
 arch/m68k/include/asm/mcf_pgtable.h                  |   10 -
 arch/m68k/include/asm/motorola_pgtable.h             |    2 
 arch/m68k/include/asm/page.h                         |    3 
 arch/m68k/include/asm/sun3_pgtable.h                 |    2 
 arch/microblaze/include/asm/page.h                   |    2 
 arch/microblaze/include/asm/pgtable.h                |    4 
 arch/mips/include/asm/page.h                         |    5 
 arch/mips/include/asm/pgtable.h                      |   44 +++-
 arch/nds32/include/asm/page.h                        |    3 
 arch/nds32/include/asm/pgtable.h                     |    9 -
 arch/nds32/mm/fault.c                                |    2 
 arch/nios2/include/asm/page.h                        |    3 
 arch/nios2/include/asm/pgtable.h                     |    3 
 arch/openrisc/include/asm/page.h                     |    5 
 arch/openrisc/include/asm/pgtable.h                  |    2 
 arch/parisc/include/asm/page.h                       |    3 
 arch/parisc/include/asm/pgtable.h                    |    2 
 arch/powerpc/include/asm/book3s/64/hash.h            |    3 
 arch/powerpc/include/asm/book3s/64/radix.h           |    3 
 arch/powerpc/include/asm/page.h                      |    9 -
 arch/powerpc/include/asm/page_64.h                   |    7 
 arch/powerpc/include/asm/sparsemem.h                 |    3 
 arch/powerpc/mm/book3s64/hash_utils.c                |    5 
 arch/powerpc/mm/book3s64/pgtable.c                   |    7 
 arch/powerpc/mm/book3s64/pkeys.c                     |    2 
 arch/powerpc/mm/book3s64/radix_pgtable.c             |   18 +-
 arch/powerpc/mm/mem.c                                |   12 -
 arch/riscv/include/asm/page.h                        |    3 
 arch/s390/include/asm/page.h                         |    3 
 arch/s390/mm/fault.c                                 |    2 
 arch/s390/mm/init.c                                  |    9 -
 arch/sh/include/asm/page.h                           |    3 
 arch/sh/mm/init.c                                    |    7 
 arch/sparc/include/asm/page_32.h                     |    3 
 arch/sparc/include/asm/page_64.h                     |    3 
 arch/sparc/include/asm/pgtable_32.h                  |    7 
 arch/sparc/include/asm/pgtable_64.h                  |   10 -
 arch/um/include/asm/pgtable.h                        |   10 -
 arch/unicore32/include/asm/page.h                    |    3 
 arch/unicore32/include/asm/pgtable.h                 |    3 
 arch/unicore32/mm/fault.c                            |    2 
 arch/x86/include/asm/page_types.h                    |    7 
 arch/x86/include/asm/pgtable.h                       |    6 
 arch/x86/include/asm/set_memory.h                    |    1 
 arch/x86/kernel/amd_gart_64.c                        |    3 
 arch/x86/kernel/setup.c                              |    4 
 arch/x86/mm/init.c                                   |    9 -
 arch/x86/mm/init_32.c                                |   19 +-
 arch/x86/mm/init_64.c                                |   42 ++--
 arch/x86/mm/mm_internal.h                            |    3 
 arch/x86/mm/pat/set_memory.c                         |   13 +
 arch/x86/mm/pkeys.c                                  |    2 
 arch/x86/platform/uv/bios_uv.c                       |    3 
 arch/x86/um/asm/vm-flags.h                           |   10 -
 arch/xtensa/include/asm/page.h                       |    3 
 arch/xtensa/include/asm/pgtable.h                    |    3 
 drivers/char/hw_random/omap3-rom-rng.c               |    4 
 drivers/dma/tegra20-apb-dma.c                        |    1 
 drivers/hwmon/dell-smm-hwmon.c                       |    4 
 drivers/platform/x86/dell-laptop.c                   |    4 
 drivers/platform/x86/dell-rbtn.c                     |    4 
 drivers/platform/x86/dell-rbtn.h                     |    2 
 drivers/platform/x86/dell-smbios-base.c              |    4 
 drivers/platform/x86/dell-smbios-smm.c               |    2 
 drivers/platform/x86/dell-smbios.h                   |    2 
 drivers/platform/x86/dell-smo8800.c                  |    2 
 drivers/platform/x86/dell-wmi.c                      |    4 
 drivers/power/supply/bq2415x_charger.c               |    4 
 drivers/power/supply/bq27xxx_battery.c               |    2 
 drivers/power/supply/isp1704_charger.c               |    2 
 drivers/power/supply/rx51_battery.c                  |    4 
 drivers/staging/gasket/gasket_core.c                 |    2 
 fs/filesystems.c                                     |    4 
 fs/hfsplus/attributes.c                              |    4 
 fs/ocfs2/alloc.c                                     |    4 
 fs/seq_file.c                                        |    7 
 fs/udf/ecma_167.h                                    |    2 
 fs/udf/osta_udf.h                                    |    2 
 include/linux/cma.h                                  |   14 +
 include/linux/hugetlb.h                              |   12 +
 include/linux/memblock.h                             |    3 
 include/linux/memory_hotplug.h                       |   21 +-
 include/linux/mm.h                                   |   34 +++
 include/linux/power/bq2415x_charger.h                |    2 
 include/linux/slab.h                                 |    2 
 ipc/util.c                                           |    2 
 kernel/gcov/fs.c                                     |    2 
 kernel/kmod.c                                        |    4 
 mm/cma.c                                             |   16 +
 mm/gup.c                                             |    3 
 mm/hugetlb.c                                         |  109 ++++++++++++
 mm/memblock.c                                        |    2 
 mm/memcontrol.c                                      |    3 
 mm/memory.c                                          |  168 +++++++++++++++++--
 mm/memory_hotplug.c                                  |   13 -
 mm/memremap.c                                        |   17 +
 mm/mmap.c                                            |    4 
 mm/mprotect.c                                        |    4 
 mm/page_alloc.c                                      |    5 
 mm/slab_common.c                                     |    2 
 tools/laptop/freefall/freefall.c                     |    2 
 tools/testing/selftests/kmod/kmod.sh                 |   43 ++++
 130 files changed, 710 insertions(+), 370 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-04-12  7:41 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-04-12  7:41 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


A straggler.  This patch caused a lot of build errors on a lot of
architectures for a long time, but Anshuman believes it's all fixed up
now.

1 patch, based on GIT b032227c62939b5481bcd45442b36dfa263f4a7c.

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/debug: add tests validating architecture page table helpers

 Documentation/features/debug/debug-vm-pgtable/arch-support.txt |   34 
 arch/arc/Kconfig                                               |    1 
 arch/arm64/Kconfig                                             |    1 
 arch/powerpc/Kconfig                                           |    1 
 arch/s390/Kconfig                                              |    1 
 arch/x86/Kconfig                                               |    1 
 arch/x86/include/asm/pgtable_64.h                              |    6 
 include/linux/mmdebug.h                                        |    5 
 init/main.c                                                    |    2 
 lib/Kconfig.debug                                              |   26 
 mm/Makefile                                                    |    1 
 mm/debug_vm_pgtable.c                                          |  392 ++++++++++
 12 files changed, 471 insertions(+)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-04-21  1:13 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-04-21  1:13 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


15 fixes, based on ae83d0b416db002fe95601e7f97f64b59514d936:


    Masahiro Yamada <masahiroy@kernel.org>:
      sh: fix build error in mm/init.c

    Kees Cook <keescook@chromium.org>:
      slub: avoid redzone when choosing freepointer location

    Peter Xu <peterx@redhat.com>:
      mm/userfaultfd: disable userfaultfd-wp on x86_32

    Bartosz Golaszewski <bgolaszewski@baylibre.com>:
      MAINTAINERS: add an entry for kfifo

    Longpeng <longpeng2@huawei.com>:
      mm/hugetlb: fix a addressing exception caused by huge_pte_offset

    Michal Hocko <mhocko@suse.com>:
      mm, gup: return EINTR when gup is interrupted by fatal signals

    Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
      checkpatch: fix a typo in the regex for $allocFunctions

    George Burgess IV <gbiv@google.com>:
      tools/build: tweak unused value workaround

    Muchun Song <songmuchun@bytedance.com>:
      mm/ksm: fix NULL pointer dereference when KSM zero page is enabled

    Hugh Dickins <hughd@google.com>:
      mm/shmem: fix build without THP

    Jann Horn <jannh@google.com>:
      vmalloc: fix remap_vmalloc_range() bounds checks

    Hugh Dickins <hughd@google.com>:
      shmem: fix possible deadlocks on shmlock_user_lock

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm: shmem: disable interrupt when acquiring info->lock in userfaultfd_copy path

    Sudip Mukherjee <sudipm.mukherjee@gmail.com>:
      coredump: fix null pointer dereference on coredump

    Lucas Stach <l.stach@pengutronix.de>:
      tools/vm: fix cross-compile build

 MAINTAINERS                                      |    7 +++++++
 arch/sh/mm/init.c                                |    2 +-
 arch/x86/Kconfig                                 |    2 +-
 fs/coredump.c                                    |    2 ++
 fs/proc/vmcore.c                                 |    5 +++--
 include/linux/vmalloc.h                          |    2 +-
 mm/gup.c                                         |    2 +-
 mm/hugetlb.c                                     |   14 ++++++++------
 mm/ksm.c                                         |   12 ++++++++++--
 mm/shmem.c                                       |   13 ++++++++-----
 mm/slub.c                                        |   12 ++++++++++--
 mm/vmalloc.c                                     |   16 +++++++++++++---
 samples/vfio-mdev/mdpy.c                         |    2 +-
 scripts/checkpatch.pl                            |    2 +-
 tools/build/feature/test-sync-compare-and-swap.c |    2 +-
 tools/vm/Makefile                                |    2 ++
 16 files changed, 70 insertions(+), 27 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-05-08  1:35 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-05-08  1:35 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


14 fixes and one selftest to verify the ipc fixes herein.


15 patches, based on a811c1fa0a02c062555b54651065899437bacdbe:


    Oleg Nesterov <oleg@redhat.com>:
      ipc/mqueue.c: change __do_notify() to bypass check_kill_permission()

    Yafang Shao <laoar.shao@gmail.com>:
      mm, memcg: fix error return value of mem_cgroup_css_alloc()

    David Hildenbrand <david@redhat.com>:
      mm/page_alloc: fix watchdog soft lockups during set_zone_contiguous()

    Maciej Grochowski <maciej.grochowski@pm.me>:
      kernel/kcov.c: fix typos in kcov_remote_start documentation

    Ivan Delalande <colona@arista.com>:
      scripts/decodecode: fix trapping instruction formatting

    Janakarajan Natarajan <Janakarajan.Natarajan@amd.com>:
      arch/x86/kvm/svm/sev.c: change flag passed to GUP fast in sev_pin_memory()

    Khazhismel Kumykov <khazhy@google.com>:
      eventpoll: fix missing wakeup for ovflist in ep_poll_callback

    Aymeric Agon-Rambosson <aymeric.agon@yandex.com>:
      scripts/gdb: repair rb_first() and rb_last()

    Waiman Long <longman@redhat.com>:
      mm/slub: fix incorrect interpretation of s->offset

    Filipe Manana <fdmanana@suse.com>:
      percpu: make pcpu_alloc() aware of current gfp context

    Roman Penyaev <rpenyaev@suse.de>:
      kselftests: introduce new epoll60 testcase for catching lost wakeups
      epoll: atomically remove wait entry on wake up

    Qiwu Chen <qiwuchen55@gmail.com>:
      mm/vmscan: remove unnecessary argument description of isolate_lru_pages()

    Kees Cook <keescook@chromium.org>:
      ubsan: disable UBSAN_ALIGNMENT under COMPILE_TEST

    Henry Willard <henry.willard@oracle.com>:
      mm: limit boost_watermark on small zones

 arch/x86/kvm/svm/sev.c                                        |    2 
 fs/eventpoll.c                                                |   61 ++--
 ipc/mqueue.c                                                  |   34 +-
 kernel/kcov.c                                                 |    4 
 lib/Kconfig.ubsan                                             |   15 -
 mm/memcontrol.c                                               |   15 -
 mm/page_alloc.c                                               |    9 
 mm/percpu.c                                                   |   14 
 mm/slub.c                                                     |   45 ++-
 mm/vmscan.c                                                   |    1 
 scripts/decodecode                                            |    2 
 scripts/gdb/linux/rbtree.py                                   |    4 
 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c |  146 ++++++++++
 tools/testing/selftests/wireguard/qemu/debug.config           |    1 
 14 files changed, 275 insertions(+), 78 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-05-14  0:50 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-05-14  0:50 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

7 fixes, based on 24085f70a6e1b0cb647ec92623284641d8270637:

    Yafang Shao <laoar.shao@gmail.com>:
      mm, memcg: fix inconsistent oom event behavior

    Roman Penyaev <rpenyaev@suse.de>:
      epoll: call final ep_events_available() check under the lock

    Peter Xu <peterx@redhat.com>:
      mm/gup: fix fixup_user_fault() on multiple retries

    Brian Geffon <bgeffon@google.com>:
      userfaultfd: fix remap event with MREMAP_DONTUNMAP

    Vasily Averin <vvs@virtuozzo.com>:
      ipc/util.c: sysvipc_find_ipc() incorrectly updates position index

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: consistently disable debugging features
      kasan: add missing functions declarations to kasan.h

 fs/eventpoll.c             |   48 ++++++++++++++++++++++++++-------------------
 include/linux/memcontrol.h |    2 +
 ipc/util.c                 |   12 +++++------
 mm/gup.c                   |   12 ++++++-----
 mm/kasan/Makefile          |   15 +++++++++-----
 mm/kasan/kasan.h           |   34 ++++++++++++++++++++++++++++++-
 mm/mremap.c                |    2 -
 7 files changed, 86 insertions(+), 39 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-05-28  5:20 Andrew Morton
       [not found] ` <CAHk-=whQSWcE1WvKxptHdyc9BUXQyxxyAH954=Jb_YSBrNJYDQ@mail.gmail.com>
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-05-28  5:20 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


5 fixes, based on 444fc5cde64330661bf59944c43844e7d4c2ccd8:


    Qian Cai <cai@lca.pw>:
      mm/z3fold: silence kmemleak false positives of slots

    Hugh Dickins <hughd@google.com>:
      mm,thp: stop leaking unreleased file pages

    Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
      mm: remove VM_BUG_ON(PageSlab()) from page_mapcount()

    Alexander Potapenko <glider@google.com>:
      fs/binfmt_elf.c: allocate initialized memory in fill_thread_core_info()

    Arnd Bergmann <arnd@arndb.de>:
      include/asm-generic/topology.h: guard cpumask_of_node() macro argument

 fs/binfmt_elf.c                |    2 +-
 include/asm-generic/topology.h |    2 +-
 include/linux/mm.h             |   19 +++++++++++++++----
 mm/khugepaged.c                |    1 +
 mm/z3fold.c                    |    3 +++
 5 files changed, 21 insertions(+), 6 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
       [not found] ` <CAHk-=whQSWcE1WvKxptHdyc9BUXQyxxyAH954=Jb_YSBrNJYDQ@mail.gmail.com>
@ 2020-05-29 20:31   ` Andrew Morton
       [not found]     ` <CAHk-=wiU-vQVURz62dzitbh2Pk+m_+ipaJU6=z=ES3cd_wKSLQ@mail.gmail.com>
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-05-29 20:31 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, Linux-MM

On Thu, 28 May 2020 13:10:18 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> Hmm..
> 
> On Wed, May 27, 2020 at 10:20 PM Andrew Morton
> <akpm@linux-foundation.org> wrote:
> >
> >  fs/binfmt_elf.c                |    2 +-
> >  include/asm-generic/topology.h |    2 +-
> >  include/linux/mm.h             |   19 +++++++++++++++----
> >  mm/khugepaged.c                |    1 +
> >  mm/z3fold.c                    |    3 +++
> >  5 files changed, 21 insertions(+), 6 deletions(-)
> 
> I wonder how you generate that diffstat.
> 
> The change to <linux/mm.h> simply doesn't match what you sent me.  The
> patch you sent me that changed mm.h had this:
> 
>  include/linux/mm.h |   15 +++++++++++++--
>  1 file changed, 13 insertions(+), 2 deletions(-)
> 
> (note 15 lines changed: it's +13 and -2) but now suddenly in your
> overall diffstat you have that
> 
>   include/linux/mm.h             |   19 +++++++++++++++----
> 
> with +15/-4.
> 
> So your diffstat simply doesn't match what you are sending. What's going on?
> 

Bah.  I got lazy (didn't want to interrupt an ongoing build) so I
generated the diffstat prior to folding two patches into a single one. 
Evidently diffstat isn't as smart as I had assumed!

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
       [not found]     ` <CAHk-=wiU-vQVURz62dzitbh2Pk+m_+ipaJU6=z=ES3cd_wKSLQ@mail.gmail.com>
@ 2020-05-29 21:12       ` Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-05-29 21:12 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, Linux-MM

On Fri, 29 May 2020 13:38:35 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Fri, May 29, 2020 at 1:31 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > Bah.  I got lazy (didn't want to interrupt an ongoing build) so I
> > generated the diffstat prior to folding two patches into a single one.
> > Evidently diffstat isn't as smart as I had assumed!
> 
> Ahh. Yes - given two patches, diffstat just adds up the line number
> counts for the individual diffs, it doesn't count some kind of
> "combined diff result" line counts.

Stupid diffstat.  Means that basically all my diffstats are very wrong.
Thanks for spotting it.

I can fix that...

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-06-02  4:44 Andrew Morton
  2020-06-02 20:08 ` incoming Andrew Morton
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-06-02  4:44 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


A few little subsystems and a start of a lot of MM patches.

128 patches, based on 9bf9511e3d9f328c03f6f79bfb741c3d18f2f2c0:

Subsystems affected by this patch series:

  squashfs
  ocfs2
  parisc
  vfs
  mm/slab-generic
  mm/slub
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/memcg
  mm/pagemap
  mm/memory-failure
  mm/vmalloc
  mm/kasan

Subsystem: squashfs

    Philippe Liard <pliard@google.com>:
      squashfs: migrate from ll_rw_block usage to BIO

Subsystem: ocfs2

    Jules Irenge <jbi.octave@gmail.com>:
      ocfs2: add missing annotation for dlm_empty_lockres()

    Gang He <ghe@suse.com>:
      ocfs2: mount shared volume without ha stack

Subsystem: parisc

    Andrew Morton <akpm@linux-foundation.org>:
      arch/parisc/include/asm/pgtable.h: remove unused `old_pte'

Subsystem: vfs

    Jeff Layton <jlayton@redhat.com>:
    Patch series "vfs: have syncfs() return error when there are writeback:
      vfs: track per-sb writeback errors and report them to syncfs
      fs/buffer.c: record blockdev write errors in super_block that it backs

Subsystem: mm/slab-generic

    Vlastimil Babka <vbabka@suse.cz>:
      usercopy: mark dma-kmalloc caches as usercopy caches

Subsystem: mm/slub

    Dongli Zhang <dongli.zhang@oracle.com>:
      mm/slub.c: fix corrupted freechain in deactivate_slab()

    Christoph Lameter <cl@linux.com>:
      slub: Remove userspace notifier for cache add/remove

    Christopher Lameter <cl@linux.com>:
      slub: remove kmalloc under list_lock from list_slab_objects() V2

    Qian Cai <cai@lca.pw>:
      mm/slub: fix stack overruns with SLUB_STATS

    Andrew Morton <akpm@linux-foundation.org>:
      Documentation/vm/slub.rst: s/Toggle/Enable/

Subsystem: mm/debug

    Vlastimil Babka <vbabka@suse.cz>:
      mm, dump_page(): do not crash with invalid mapping pointer

Subsystem: mm/pagecache

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Change readahead API", v11:
      mm: move readahead prototypes from mm.h
      mm: return void from various readahead functions
      mm: ignore return value of ->readpages
      mm: move readahead nr_pages check into read_pages
      mm: add new readahead_control API
      mm: use readahead_control to pass arguments
      mm: rename various 'offset' parameters to 'index'
      mm: rename readahead loop variable to 'i'
      mm: remove 'page_offset' from readahead loop
      mm: put readahead pages in cache earlier
      mm: add readahead address space operation
      mm: move end_index check out of readahead loop
      mm: add page_cache_readahead_unbounded
      mm: document why we don't set PageReadahead
      mm: use memalloc_nofs_save in readahead path
      fs: convert mpage_readpages to mpage_readahead
      btrfs: convert from readpages to readahead
      erofs: convert uncompressed files from readpages to readahead
      erofs: convert compressed files from readpages to readahead
      ext4: convert from readpages to readahead
      ext4: pass the inode to ext4_mpage_readpages
      f2fs: convert from readpages to readahead
      f2fs: pass the inode to f2fs_mpage_readpages
      fuse: convert from readpages to readahead
      iomap: convert from readpages to readahead

    Guoqing Jiang <guoqing.jiang@cloud.ionos.com>:
    Patch series "Introduce attach/detach_page_private to cleanup code":
      include/linux/pagemap.h: introduce attach/detach_page_private
      md: remove __clear_page_buffers and use attach/detach_page_private
      btrfs: use attach/detach_page_private
      fs/buffer.c: use attach/detach_page_private
      f2fs: use attach/detach_page_private
      iomap: use attach/detach_page_private
      ntfs: replace attach_page_buffers with attach_page_private
      orangefs: use attach/detach_page_private
      buffer_head.h: remove attach_page_buffers
      mm/migrate.c: call detach_page_private to cleanup code
      mm_types.h: change set_page_private to inline function

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/filemap.c: remove misleading comment

    Chao Yu <yuchao0@huawei.com>:
      mm/page-writeback.c: remove unused variable

    NeilBrown <neilb@suse.de>:
      mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE
      mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead

Subsystem: mm/gup

    Souptick Joarder <jrdr.linux@gmail.com>:
      mm/gup.c: update the documentation

    John Hubbard <jhubbard@nvidia.com>:
      mm/gup: introduce pin_user_pages_unlocked
      ivtv: convert get_user_pages() --> pin_user_pages()

    Miles Chen <miles.chen@mediatek.com>:
      mm/gup.c: further document vma_permits_fault()

Subsystem: mm/swap

    chenqiwu <chenqiwu@xiaomi.com>:
      mm/swapfile: use list_{prev,next}_entry() instead of open-coding

    Qian Cai <cai@lca.pw>:
      mm/swap_state: fix a data race in swapin_nr_pages

    Andrea Righi <andrea.righi@canonical.com>:
      mm: swap: properly update readahead statistics in unuse_pte_range()

    Wei Yang <richard.weiyang@gmail.com>:
      mm/swapfile.c: offset is only used when there is more slots
      mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive
      mm/swapfile.c: remove the unnecessary goto for SSD case
      mm/swapfile.c: simplify the calculation of n_goal
      mm/swapfile.c: remove the extra check in scan_swap_map_slots()
      mm/swapfile.c: found_free could be represented by (tmp < max)
      mm/swapfile.c: tmp is always smaller than max
      mm/swapfile.c: omit a duplicate code by compare tmp and max first

    Huang Ying <ying.huang@intel.com>:
      swap: try to scan more free slots even when fragmented

    Wei Yang <richard.weiyang@gmail.com>:
      mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable
      mm/swapfile.c: __swap_entry_free() always free 1 entry

    Huang Ying <ying.huang@intel.com>:
      mm/swapfile.c: use prandom_u32_max()
      swap: reduce lock contention on swap cache from swap slots allocation

    Randy Dunlap <rdunlap@infradead.org>:
      mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment

    Miaohe Lin <linmiaohe@huawei.com>:
      include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration

Subsystem: mm/memcg

    Yafang Shao <laoar.shao@gmail.com>:
      mm, memcg: add workingset_restore in memory.stat

    Kaixu Xia <kaixuxia@tencent.com>:
      mm: memcontrol: simplify value comparison between count and limit

    Shakeel Butt <shakeelb@google.com>:
      memcg: expose root cgroup's memory.stat

    Jakub Kicinski <kuba@kernel.org>:
    Patch series "memcg: Slow down swap allocation as the available space gets:
      mm/memcg: prepare for swap over-high accounting and penalty calculation
      mm/memcg: move penalty delay clamping out of calculate_high_delay()
      mm/memcg: move cgroup high memory limit setting into struct page_counter
      mm/memcg: automatically penalize tasks with high swap use

    Zefan Li <lizefan@huawei.com>:
      memcg: fix memcg_kmem_bypass() for remote memcg charging

Subsystem: mm/pagemap

    Steven Price <steven.price@arm.com>:
    Patch series "Fix W+X debug feature on x86":
      x86: mm: ptdump: calculate effective permissions correctly
      mm: ptdump: expand type of 'val' in note_page()

    Huang Ying <ying.huang@intel.com>:
      /proc/PID/smaps: Add PMD migration entry parsing

    chenqiwu <chenqiwu@xiaomi.com>:
      mm/memory: remove unnecessary pte_devmap case in copy_one_pte()

Subsystem: mm/memory-failure

    Wetp Zhang <wetp.zy@linux.alibaba.com>:
      mm, memory_failure: don't send BUS_MCEERR_AO for action required error

Subsystem: mm/vmalloc

    Christoph Hellwig <hch@lst.de>:
    Patch series "decruft the vmalloc API", v2:
      x86/hyperv: use vmalloc_exec for the hypercall page
      x86: fix vmap arguments in map_irq_stack
      staging: android: ion: use vmap instead of vm_map_ram
      staging: media: ipu3: use vmap instead of reimplementing it
      dma-mapping: use vmap insted of reimplementing it
      powerpc: add an ioremap_phb helper
      powerpc: remove __ioremap_at and __iounmap_at
      mm: remove __get_vm_area
      mm: unexport unmap_kernel_range_noflush
      mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING
      mm: only allow page table mappings for built-in zsmalloc
      mm: pass addr as unsigned long to vb_free
      mm: remove vmap_page_range_noflush and vunmap_page_range
      mm: rename vmap_page_range to map_kernel_range
      mm: don't return the number of pages from map_kernel_range{,_noflush}
      mm: remove map_vm_range
      mm: remove unmap_vmap_area
      mm: remove the prot argument from vm_map_ram
      mm: enforce that vmap can't map pages executable
      gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc
      mm: remove the pgprot argument to __vmalloc
      mm: remove the prot argument to __vmalloc_node
      mm: remove both instances of __vmalloc_node_flags
      mm: remove __vmalloc_node_flags_caller
      mm: switch the test_vmalloc module to use __vmalloc_node
      mm: remove vmalloc_user_node_flags
      arm64: use __vmalloc_node in arch_alloc_vmap_stack
      powerpc: use __vmalloc_node in alloc_vm_stack
      s390: use __vmalloc_node in stack_alloc

    Joerg Roedel <jroedel@suse.de>:
    Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3:
      mm: add functions to track page directory modifications
      mm/vmalloc: track which page-table levels were modified
      mm/ioremap: track which page-table levels were modified
      x86/mm/64: implement arch_sync_kernel_mappings()
      x86/mm/32: implement arch_sync_kernel_mappings()
      mm: remove vmalloc_sync_(un)mappings()
      x86/mm: remove vmalloc faulting

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix clang compilation warning due to stack protector

    Kees Cook <keescook@chromium.org>:
      ubsan: entirely disable alignment checks under UBSAN_TRAP

    Jing Xia <jing.xia@unisoc.com>:
      mm/mm_init.c: report kasan-tag information stored in page->flags

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: move kasan_report() into report.c

 Documentation/admin-guide/cgroup-v2.rst            |   24 +
 Documentation/core-api/cachetlb.rst                |    2 
 Documentation/filesystems/locking.rst              |    6 
 Documentation/filesystems/proc.rst                 |    4 
 Documentation/filesystems/vfs.rst                  |   15 
 Documentation/vm/slub.rst                          |    2 
 arch/arm/configs/omap2plus_defconfig               |    2 
 arch/arm64/include/asm/pgtable.h                   |    3 
 arch/arm64/include/asm/vmap_stack.h                |    6 
 arch/arm64/mm/dump.c                               |    2 
 arch/parisc/include/asm/pgtable.h                  |    2 
 arch/powerpc/include/asm/io.h                      |   10 
 arch/powerpc/include/asm/pci-bridge.h              |    2 
 arch/powerpc/kernel/irq.c                          |    5 
 arch/powerpc/kernel/isa-bridge.c                   |   28 +
 arch/powerpc/kernel/pci_64.c                       |   56 +-
 arch/powerpc/mm/ioremap_64.c                       |   50 --
 arch/riscv/include/asm/pgtable.h                   |    4 
 arch/riscv/mm/ptdump.c                             |    2 
 arch/s390/kernel/setup.c                           |    9 
 arch/sh/kernel/cpu/sh4/sq.c                        |    3 
 arch/x86/hyperv/hv_init.c                          |    5 
 arch/x86/include/asm/kvm_host.h                    |    3 
 arch/x86/include/asm/pgtable-2level_types.h        |    2 
 arch/x86/include/asm/pgtable-3level_types.h        |    2 
 arch/x86/include/asm/pgtable_64_types.h            |    2 
 arch/x86/include/asm/pgtable_types.h               |    8 
 arch/x86/include/asm/switch_to.h                   |   23 -
 arch/x86/kernel/irq_64.c                           |    2 
 arch/x86/kernel/setup_percpu.c                     |    6 
 arch/x86/kvm/svm/sev.c                             |    3 
 arch/x86/mm/dump_pagetables.c                      |   35 +
 arch/x86/mm/fault.c                                |  196 ----------
 arch/x86/mm/init_64.c                              |    5 
 arch/x86/mm/pti.c                                  |    8 
 arch/x86/mm/tlb.c                                  |   37 -
 block/blk-core.c                                   |    1 
 drivers/acpi/apei/ghes.c                           |    6 
 drivers/base/node.c                                |    2 
 drivers/block/drbd/drbd_bitmap.c                   |    4 
 drivers/block/loop.c                               |    2 
 drivers/dax/device.c                               |    1 
 drivers/gpu/drm/drm_scatter.c                      |   11 
 drivers/gpu/drm/etnaviv/etnaviv_dump.c             |    4 
 drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c   |    2 
 drivers/lightnvm/pblk-init.c                       |    5 
 drivers/md/dm-bufio.c                              |    4 
 drivers/md/md-bitmap.c                             |   12 
 drivers/media/common/videobuf2/videobuf2-dma-sg.c  |    3 
 drivers/media/common/videobuf2/videobuf2-vmalloc.c |    3 
 drivers/media/pci/ivtv/ivtv-udma.c                 |   19 -
 drivers/media/pci/ivtv/ivtv-yuv.c                  |   17 
 drivers/media/pci/ivtv/ivtvfb.c                    |    4 
 drivers/mtd/ubi/io.c                               |    4 
 drivers/pcmcia/electra_cf.c                        |   45 --
 drivers/scsi/sd_zbc.c                              |    3 
 drivers/staging/android/ion/ion_heap.c             |    4 
 drivers/staging/media/ipu3/ipu3-css-pool.h         |    4 
 drivers/staging/media/ipu3/ipu3-dmamap.c           |   30 -
 fs/block_dev.c                                     |    7 
 fs/btrfs/disk-io.c                                 |    4 
 fs/btrfs/extent_io.c                               |   64 ---
 fs/btrfs/extent_io.h                               |    3 
 fs/btrfs/inode.c                                   |   39 --
 fs/buffer.c                                        |   23 -
 fs/erofs/data.c                                    |   41 --
 fs/erofs/decompressor.c                            |    2 
 fs/erofs/zdata.c                                   |   31 -
 fs/exfat/inode.c                                   |    7 
 fs/ext2/inode.c                                    |   10 
 fs/ext4/ext4.h                                     |    5 
 fs/ext4/inode.c                                    |   25 -
 fs/ext4/readpage.c                                 |   25 -
 fs/ext4/verity.c                                   |   35 -
 fs/f2fs/data.c                                     |   56 +-
 fs/f2fs/f2fs.h                                     |   14 
 fs/f2fs/verity.c                                   |   35 -
 fs/fat/inode.c                                     |    7 
 fs/file_table.c                                    |    1 
 fs/fs-writeback.c                                  |    1 
 fs/fuse/file.c                                     |  100 +----
 fs/gfs2/aops.c                                     |   23 -
 fs/gfs2/dir.c                                      |    9 
 fs/gfs2/quota.c                                    |    2 
 fs/hpfs/file.c                                     |    7 
 fs/iomap/buffered-io.c                             |  113 +----
 fs/iomap/trace.h                                   |    2 
 fs/isofs/inode.c                                   |    7 
 fs/jfs/inode.c                                     |    7 
 fs/mpage.c                                         |   38 --
 fs/nfs/blocklayout/extent_tree.c                   |    2 
 fs/nfs/internal.h                                  |   10 
 fs/nfs/write.c                                     |    4 
 fs/nfsd/vfs.c                                      |    9 
 fs/nilfs2/inode.c                                  |   15 
 fs/ntfs/aops.c                                     |    2 
 fs/ntfs/malloc.h                                   |    2 
 fs/ntfs/mft.c                                      |    2 
 fs/ocfs2/aops.c                                    |   34 -
 fs/ocfs2/dlm/dlmmaster.c                           |    1 
 fs/ocfs2/ocfs2.h                                   |    4 
 fs/ocfs2/slot_map.c                                |   46 +-
 fs/ocfs2/super.c                                   |   21 +
 fs/omfs/file.c                                     |    7 
 fs/open.c                                          |    3 
 fs/orangefs/inode.c                                |   32 -
 fs/proc/meminfo.c                                  |    3 
 fs/proc/task_mmu.c                                 |   16 
 fs/qnx6/inode.c                                    |    7 
 fs/reiserfs/inode.c                                |    8 
 fs/squashfs/block.c                                |  273 +++++++-------
 fs/squashfs/decompressor.h                         |    5 
 fs/squashfs/decompressor_multi.c                   |    9 
 fs/squashfs/decompressor_multi_percpu.c            |   17 
 fs/squashfs/decompressor_single.c                  |    9 
 fs/squashfs/lz4_wrapper.c                          |   17 
 fs/squashfs/lzo_wrapper.c                          |   17 
 fs/squashfs/squashfs.h                             |    4 
 fs/squashfs/xz_wrapper.c                           |   51 +-
 fs/squashfs/zlib_wrapper.c                         |   63 +--
 fs/squashfs/zstd_wrapper.c                         |   62 +--
 fs/sync.c                                          |    6 
 fs/ubifs/debug.c                                   |    2 
 fs/ubifs/lprops.c                                  |    2 
 fs/ubifs/lpt_commit.c                              |    4 
 fs/ubifs/orphan.c                                  |    2 
 fs/udf/inode.c                                     |    7 
 fs/xfs/kmem.c                                      |    2 
 fs/xfs/xfs_aops.c                                  |   13 
 fs/xfs/xfs_buf.c                                   |    2 
 fs/zonefs/super.c                                  |    7 
 include/asm-generic/5level-fixup.h                 |    5 
 include/asm-generic/pgtable.h                      |   27 +
 include/linux/buffer_head.h                        |    8 
 include/linux/fs.h                                 |   18 
 include/linux/iomap.h                              |    3 
 include/linux/memcontrol.h                         |    4 
 include/linux/mm.h                                 |   67 ++-
 include/linux/mm_types.h                           |    6 
 include/linux/mmzone.h                             |    1 
 include/linux/mpage.h                              |    4 
 include/linux/page_counter.h                       |    8 
 include/linux/pagemap.h                            |  193 ++++++++++
 include/linux/ptdump.h                             |    3 
 include/linux/sched.h                              |    3 
 include/linux/swap.h                               |   17 
 include/linux/vmalloc.h                            |   49 +-
 include/linux/zsmalloc.h                           |    2 
 include/trace/events/erofs.h                       |    6 
 include/trace/events/f2fs.h                        |    6 
 include/trace/events/writeback.h                   |    5 
 kernel/bpf/core.c                                  |    6 
 kernel/bpf/syscall.c                               |   29 -
 kernel/dma/remap.c                                 |   48 --
 kernel/groups.c                                    |    2 
 kernel/module.c                                    |    3 
 kernel/notifier.c                                  |    1 
 kernel/sys.c                                       |    2 
 kernel/trace/trace.c                               |   12 
 lib/Kconfig.ubsan                                  |    2 
 lib/ioremap.c                                      |   46 +-
 lib/test_vmalloc.c                                 |   26 -
 mm/Kconfig                                         |    4 
 mm/debug.c                                         |   56 ++
 mm/fadvise.c                                       |    6 
 mm/filemap.c                                       |    1 
 mm/gup.c                                           |   77 +++-
 mm/internal.h                                      |   14 
 mm/kasan/Makefile                                  |   21 -
 mm/kasan/common.c                                  |   19 -
 mm/kasan/report.c                                  |   22 +
 mm/memcontrol.c                                    |  198 +++++++---
 mm/memory-failure.c                                |   15 
 mm/memory.c                                        |    2 
 mm/migrate.c                                       |    9 
 mm/mm_init.c                                       |   16 
 mm/nommu.c                                         |   52 +-
 mm/page-writeback.c                                |   62 ++-
 mm/page_alloc.c                                    |    7 
 mm/percpu.c                                        |    2 
 mm/ptdump.c                                        |   17 
 mm/readahead.c                                     |  349 ++++++++++--------
 mm/slab_common.c                                   |    3 
 mm/slub.c                                          |   67 ++-
 mm/swap_state.c                                    |    5 
 mm/swapfile.c                                      |  194 ++++++----
 mm/util.c                                          |    2 
 mm/vmalloc.c                                       |  399 ++++++++-------------
 mm/vmscan.c                                        |    4 
 mm/vmstat.c                                        |   11 
 mm/zsmalloc.c                                      |   12 
 net/bridge/netfilter/ebtables.c                    |    6 
 net/ceph/ceph_common.c                             |    3 
 sound/core/memalloc.c                              |    2 
 sound/core/pcm_memory.c                            |    2 
 195 files changed, 2292 insertions(+), 2288 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2020-06-02  4:44 incoming Andrew Morton
@ 2020-06-02 20:08 ` Andrew Morton
       [not found]   ` <CAHk-=wgRV=SaiMn3L5u5mG0WfvB2VfEQadtudzDV3KRz5HnFrQ@mail.gmail.com>
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-06-02 20:08 UTC (permalink / raw)
  To: Linus Torvalds, mm-commits, linux-mm

The local_lock merge made rather a mess of all of this.  I'm 
cooking up a full resend of the same material.

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-06-02 20:09 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-02 20:09 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


A few little subsystems and a start of a lot of MM patches.

128 patches, based on f359287765c04711ff54fbd11645271d8e5ff763:


Subsystems affected by this patch series:

  squashfs
  ocfs2
  parisc
  vfs
  mm/slab-generic
  mm/slub
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/memcg
  mm/pagemap
  mm/memory-failure
  mm/vmalloc
  mm/kasan

Subsystem: squashfs

    Philippe Liard <pliard@google.com>:
      squashfs: migrate from ll_rw_block usage to BIO

Subsystem: ocfs2

    Jules Irenge <jbi.octave@gmail.com>:
      ocfs2: add missing annotation for dlm_empty_lockres()

    Gang He <ghe@suse.com>:
      ocfs2: mount shared volume without ha stack

Subsystem: parisc

    Andrew Morton <akpm@linux-foundation.org>:
      arch/parisc/include/asm/pgtable.h: remove unused `old_pte'

Subsystem: vfs

    Jeff Layton <jlayton@redhat.com>:
    Patch series "vfs: have syncfs() return error when there are writeback:
      vfs: track per-sb writeback errors and report them to syncfs
      fs/buffer.c: record blockdev write errors in super_block that it backs

Subsystem: mm/slab-generic

    Vlastimil Babka <vbabka@suse.cz>:
      usercopy: mark dma-kmalloc caches as usercopy caches

Subsystem: mm/slub

    Dongli Zhang <dongli.zhang@oracle.com>:
      mm/slub.c: fix corrupted freechain in deactivate_slab()

    Christoph Lameter <cl@linux.com>:
      slub: Remove userspace notifier for cache add/remove

    Christopher Lameter <cl@linux.com>:
      slub: remove kmalloc under list_lock from list_slab_objects() V2

    Qian Cai <cai@lca.pw>:
      mm/slub: fix stack overruns with SLUB_STATS

    Andrew Morton <akpm@linux-foundation.org>:
      Documentation/vm/slub.rst: s/Toggle/Enable/

Subsystem: mm/debug

    Vlastimil Babka <vbabka@suse.cz>:
      mm, dump_page(): do not crash with invalid mapping pointer

Subsystem: mm/pagecache

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Change readahead API", v11:
      mm: move readahead prototypes from mm.h
      mm: return void from various readahead functions
      mm: ignore return value of ->readpages
      mm: move readahead nr_pages check into read_pages
      mm: add new readahead_control API
      mm: use readahead_control to pass arguments
      mm: rename various 'offset' parameters to 'index'
      mm: rename readahead loop variable to 'i'
      mm: remove 'page_offset' from readahead loop
      mm: put readahead pages in cache earlier
      mm: add readahead address space operation
      mm: move end_index check out of readahead loop
      mm: add page_cache_readahead_unbounded
      mm: document why we don't set PageReadahead
      mm: use memalloc_nofs_save in readahead path
      fs: convert mpage_readpages to mpage_readahead
      btrfs: convert from readpages to readahead
      erofs: convert uncompressed files from readpages to readahead
      erofs: convert compressed files from readpages to readahead
      ext4: convert from readpages to readahead
      ext4: pass the inode to ext4_mpage_readpages
      f2fs: convert from readpages to readahead
      f2fs: pass the inode to f2fs_mpage_readpages
      fuse: convert from readpages to readahead
      iomap: convert from readpages to readahead

    Guoqing Jiang <guoqing.jiang@cloud.ionos.com>:
    Patch series "Introduce attach/detach_page_private to cleanup code":
      include/linux/pagemap.h: introduce attach/detach_page_private
      md: remove __clear_page_buffers and use attach/detach_page_private
      btrfs: use attach/detach_page_private
      fs/buffer.c: use attach/detach_page_private
      f2fs: use attach/detach_page_private
      iomap: use attach/detach_page_private
      ntfs: replace attach_page_buffers with attach_page_private
      orangefs: use attach/detach_page_private
      buffer_head.h: remove attach_page_buffers
      mm/migrate.c: call detach_page_private to cleanup code
      mm_types.h: change set_page_private to inline function

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/filemap.c: remove misleading comment

    Chao Yu <yuchao0@huawei.com>:
      mm/page-writeback.c: remove unused variable

    NeilBrown <neilb@suse.de>:
      mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE
      mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead

Subsystem: mm/gup

    Souptick Joarder <jrdr.linux@gmail.com>:
      mm/gup.c: update the documentation

    John Hubbard <jhubbard@nvidia.com>:
      mm/gup: introduce pin_user_pages_unlocked
      ivtv: convert get_user_pages() --> pin_user_pages()

    Miles Chen <miles.chen@mediatek.com>:
      mm/gup.c: further document vma_permits_fault()

Subsystem: mm/swap

    chenqiwu <chenqiwu@xiaomi.com>:
      mm/swapfile: use list_{prev,next}_entry() instead of open-coding

    Qian Cai <cai@lca.pw>:
      mm/swap_state: fix a data race in swapin_nr_pages

    Andrea Righi <andrea.righi@canonical.com>:
      mm: swap: properly update readahead statistics in unuse_pte_range()

    Wei Yang <richard.weiyang@gmail.com>:
      mm/swapfile.c: offset is only used when there is more slots
      mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive
      mm/swapfile.c: remove the unnecessary goto for SSD case
      mm/swapfile.c: simplify the calculation of n_goal
      mm/swapfile.c: remove the extra check in scan_swap_map_slots()
      mm/swapfile.c: found_free could be represented by (tmp < max)
      mm/swapfile.c: tmp is always smaller than max
      mm/swapfile.c: omit a duplicate code by compare tmp and max first

    Huang Ying <ying.huang@intel.com>:
      swap: try to scan more free slots even when fragmented

    Wei Yang <richard.weiyang@gmail.com>:
      mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable
      mm/swapfile.c: __swap_entry_free() always free 1 entry

    Huang Ying <ying.huang@intel.com>:
      mm/swapfile.c: use prandom_u32_max()
      swap: reduce lock contention on swap cache from swap slots allocation

    Randy Dunlap <rdunlap@infradead.org>:
      mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment

    Miaohe Lin <linmiaohe@huawei.com>:
      include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration

Subsystem: mm/memcg

    Yafang Shao <laoar.shao@gmail.com>:
      mm, memcg: add workingset_restore in memory.stat

    Kaixu Xia <kaixuxia@tencent.com>:
      mm: memcontrol: simplify value comparison between count and limit

    Shakeel Butt <shakeelb@google.com>:
      memcg: expose root cgroup's memory.stat

    Jakub Kicinski <kuba@kernel.org>:
    Patch series "memcg: Slow down swap allocation as the available space gets:
      mm/memcg: prepare for swap over-high accounting and penalty calculation
      mm/memcg: move penalty delay clamping out of calculate_high_delay()
      mm/memcg: move cgroup high memory limit setting into struct page_counter
      mm/memcg: automatically penalize tasks with high swap use

    Zefan Li <lizefan@huawei.com>:
      memcg: fix memcg_kmem_bypass() for remote memcg charging

Subsystem: mm/pagemap

    Steven Price <steven.price@arm.com>:
    Patch series "Fix W+X debug feature on x86":
      x86: mm: ptdump: calculate effective permissions correctly
      mm: ptdump: expand type of 'val' in note_page()

    Huang Ying <ying.huang@intel.com>:
      /proc/PID/smaps: Add PMD migration entry parsing

    chenqiwu <chenqiwu@xiaomi.com>:
      mm/memory: remove unnecessary pte_devmap case in copy_one_pte()

Subsystem: mm/memory-failure

    Wetp Zhang <wetp.zy@linux.alibaba.com>:
      mm, memory_failure: don't send BUS_MCEERR_AO for action required error

Subsystem: mm/vmalloc

    Christoph Hellwig <hch@lst.de>:
    Patch series "decruft the vmalloc API", v2:
      x86/hyperv: use vmalloc_exec for the hypercall page
      x86: fix vmap arguments in map_irq_stack
      staging: android: ion: use vmap instead of vm_map_ram
      staging: media: ipu3: use vmap instead of reimplementing it
      dma-mapping: use vmap insted of reimplementing it
      powerpc: add an ioremap_phb helper
      powerpc: remove __ioremap_at and __iounmap_at
      mm: remove __get_vm_area
      mm: unexport unmap_kernel_range_noflush
      mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING
      mm: only allow page table mappings for built-in zsmalloc
      mm: pass addr as unsigned long to vb_free
      mm: remove vmap_page_range_noflush and vunmap_page_range
      mm: rename vmap_page_range to map_kernel_range
      mm: don't return the number of pages from map_kernel_range{,_noflush}
      mm: remove map_vm_range
      mm: remove unmap_vmap_area
      mm: remove the prot argument from vm_map_ram
      mm: enforce that vmap can't map pages executable
      gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc
      mm: remove the pgprot argument to __vmalloc
      mm: remove the prot argument to __vmalloc_node
      mm: remove both instances of __vmalloc_node_flags
      mm: remove __vmalloc_node_flags_caller
      mm: switch the test_vmalloc module to use __vmalloc_node
      mm: remove vmalloc_user_node_flags
      arm64: use __vmalloc_node in arch_alloc_vmap_stack
      powerpc: use __vmalloc_node in alloc_vm_stack
      s390: use __vmalloc_node in stack_alloc

    Joerg Roedel <jroedel@suse.de>:
    Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3:
      mm: add functions to track page directory modifications
      mm/vmalloc: track which page-table levels were modified
      mm/ioremap: track which page-table levels were modified
      x86/mm/64: implement arch_sync_kernel_mappings()
      x86/mm/32: implement arch_sync_kernel_mappings()
      mm: remove vmalloc_sync_(un)mappings()
      x86/mm: remove vmalloc faulting

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix clang compilation warning due to stack protector

    Kees Cook <keescook@chromium.org>:
      ubsan: entirely disable alignment checks under UBSAN_TRAP

    Jing Xia <jing.xia@unisoc.com>:
      mm/mm_init.c: report kasan-tag information stored in page->flags

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: move kasan_report() into report.c

 Documentation/admin-guide/cgroup-v2.rst            |   24 +
 Documentation/core-api/cachetlb.rst                |    2 
 Documentation/filesystems/locking.rst              |    6 
 Documentation/filesystems/proc.rst                 |    4 
 Documentation/filesystems/vfs.rst                  |   15 
 Documentation/vm/slub.rst                          |    2 
 arch/arm/configs/omap2plus_defconfig               |    2 
 arch/arm64/include/asm/pgtable.h                   |    3 
 arch/arm64/include/asm/vmap_stack.h                |    6 
 arch/arm64/mm/dump.c                               |    2 
 arch/parisc/include/asm/pgtable.h                  |    2 
 arch/powerpc/include/asm/io.h                      |   10 
 arch/powerpc/include/asm/pci-bridge.h              |    2 
 arch/powerpc/kernel/irq.c                          |    5 
 arch/powerpc/kernel/isa-bridge.c                   |   28 +
 arch/powerpc/kernel/pci_64.c                       |   56 +-
 arch/powerpc/mm/ioremap_64.c                       |   50 --
 arch/riscv/include/asm/pgtable.h                   |    4 
 arch/riscv/mm/ptdump.c                             |    2 
 arch/s390/kernel/setup.c                           |    9 
 arch/sh/kernel/cpu/sh4/sq.c                        |    3 
 arch/x86/hyperv/hv_init.c                          |    5 
 arch/x86/include/asm/kvm_host.h                    |    3 
 arch/x86/include/asm/pgtable-2level_types.h        |    2 
 arch/x86/include/asm/pgtable-3level_types.h        |    2 
 arch/x86/include/asm/pgtable_64_types.h            |    2 
 arch/x86/include/asm/pgtable_types.h               |    8 
 arch/x86/include/asm/switch_to.h                   |   23 -
 arch/x86/kernel/irq_64.c                           |    2 
 arch/x86/kernel/setup_percpu.c                     |    6 
 arch/x86/kvm/svm/sev.c                             |    3 
 arch/x86/mm/dump_pagetables.c                      |   35 +
 arch/x86/mm/fault.c                                |  196 ----------
 arch/x86/mm/init_64.c                              |    5 
 arch/x86/mm/pti.c                                  |    8 
 arch/x86/mm/tlb.c                                  |   37 -
 block/blk-core.c                                   |    1 
 drivers/acpi/apei/ghes.c                           |    6 
 drivers/base/node.c                                |    2 
 drivers/block/drbd/drbd_bitmap.c                   |    4 
 drivers/block/loop.c                               |    2 
 drivers/dax/device.c                               |    1 
 drivers/gpu/drm/drm_scatter.c                      |   11 
 drivers/gpu/drm/etnaviv/etnaviv_dump.c             |    4 
 drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c   |    2 
 drivers/lightnvm/pblk-init.c                       |    5 
 drivers/md/dm-bufio.c                              |    4 
 drivers/md/md-bitmap.c                             |   12 
 drivers/media/common/videobuf2/videobuf2-dma-sg.c  |    3 
 drivers/media/common/videobuf2/videobuf2-vmalloc.c |    3 
 drivers/media/pci/ivtv/ivtv-udma.c                 |   19 -
 drivers/media/pci/ivtv/ivtv-yuv.c                  |   17 
 drivers/media/pci/ivtv/ivtvfb.c                    |    4 
 drivers/mtd/ubi/io.c                               |    4 
 drivers/pcmcia/electra_cf.c                        |   45 --
 drivers/scsi/sd_zbc.c                              |    3 
 drivers/staging/android/ion/ion_heap.c             |    4 
 drivers/staging/media/ipu3/ipu3-css-pool.h         |    4 
 drivers/staging/media/ipu3/ipu3-dmamap.c           |   30 -
 fs/block_dev.c                                     |    7 
 fs/btrfs/disk-io.c                                 |    4 
 fs/btrfs/extent_io.c                               |   64 ---
 fs/btrfs/extent_io.h                               |    3 
 fs/btrfs/inode.c                                   |   39 --
 fs/buffer.c                                        |   23 -
 fs/erofs/data.c                                    |   41 --
 fs/erofs/decompressor.c                            |    2 
 fs/erofs/zdata.c                                   |   31 -
 fs/exfat/inode.c                                   |    7 
 fs/ext2/inode.c                                    |   10 
 fs/ext4/ext4.h                                     |    5 
 fs/ext4/inode.c                                    |   25 -
 fs/ext4/readpage.c                                 |   25 -
 fs/ext4/verity.c                                   |   35 -
 fs/f2fs/data.c                                     |   56 +-
 fs/f2fs/f2fs.h                                     |   14 
 fs/f2fs/verity.c                                   |   35 -
 fs/fat/inode.c                                     |    7 
 fs/file_table.c                                    |    1 
 fs/fs-writeback.c                                  |    1 
 fs/fuse/file.c                                     |  100 +----
 fs/gfs2/aops.c                                     |   23 -
 fs/gfs2/dir.c                                      |    9 
 fs/gfs2/quota.c                                    |    2 
 fs/hpfs/file.c                                     |    7 
 fs/iomap/buffered-io.c                             |  113 +----
 fs/iomap/trace.h                                   |    2 
 fs/isofs/inode.c                                   |    7 
 fs/jfs/inode.c                                     |    7 
 fs/mpage.c                                         |   38 --
 fs/nfs/blocklayout/extent_tree.c                   |    2 
 fs/nfs/internal.h                                  |   10 
 fs/nfs/write.c                                     |    4 
 fs/nfsd/vfs.c                                      |    9 
 fs/nilfs2/inode.c                                  |   15 
 fs/ntfs/aops.c                                     |    2 
 fs/ntfs/malloc.h                                   |    2 
 fs/ntfs/mft.c                                      |    2 
 fs/ocfs2/aops.c                                    |   34 -
 fs/ocfs2/dlm/dlmmaster.c                           |    1 
 fs/ocfs2/ocfs2.h                                   |    4 
 fs/ocfs2/slot_map.c                                |   46 +-
 fs/ocfs2/super.c                                   |   21 +
 fs/omfs/file.c                                     |    7 
 fs/open.c                                          |    3 
 fs/orangefs/inode.c                                |   32 -
 fs/proc/meminfo.c                                  |    3 
 fs/proc/task_mmu.c                                 |   16 
 fs/qnx6/inode.c                                    |    7 
 fs/reiserfs/inode.c                                |    8 
 fs/squashfs/block.c                                |  273 +++++++-------
 fs/squashfs/decompressor.h                         |    5 
 fs/squashfs/decompressor_multi.c                   |    9 
 fs/squashfs/decompressor_multi_percpu.c            |   17 
 fs/squashfs/decompressor_single.c                  |    9 
 fs/squashfs/lz4_wrapper.c                          |   17 
 fs/squashfs/lzo_wrapper.c                          |   17 
 fs/squashfs/squashfs.h                             |    4 
 fs/squashfs/xz_wrapper.c                           |   51 +-
 fs/squashfs/zlib_wrapper.c                         |   63 +--
 fs/squashfs/zstd_wrapper.c                         |   62 +--
 fs/sync.c                                          |    6 
 fs/ubifs/debug.c                                   |    2 
 fs/ubifs/lprops.c                                  |    2 
 fs/ubifs/lpt_commit.c                              |    4 
 fs/ubifs/orphan.c                                  |    2 
 fs/udf/inode.c                                     |    7 
 fs/xfs/kmem.c                                      |    2 
 fs/xfs/xfs_aops.c                                  |   13 
 fs/xfs/xfs_buf.c                                   |    2 
 fs/zonefs/super.c                                  |    7 
 include/asm-generic/5level-fixup.h                 |    5 
 include/asm-generic/pgtable.h                      |   27 +
 include/linux/buffer_head.h                        |    8 
 include/linux/fs.h                                 |   18 
 include/linux/iomap.h                              |    3 
 include/linux/memcontrol.h                         |    4 
 include/linux/mm.h                                 |   67 ++-
 include/linux/mm_types.h                           |    6 
 include/linux/mmzone.h                             |    1 
 include/linux/mpage.h                              |    4 
 include/linux/page_counter.h                       |    8 
 include/linux/pagemap.h                            |  193 ++++++++++
 include/linux/ptdump.h                             |    3 
 include/linux/sched.h                              |    3 
 include/linux/swap.h                               |   17 
 include/linux/vmalloc.h                            |   49 +-
 include/linux/zsmalloc.h                           |    2 
 include/trace/events/erofs.h                       |    6 
 include/trace/events/f2fs.h                        |    6 
 include/trace/events/writeback.h                   |    5 
 kernel/bpf/core.c                                  |    6 
 kernel/bpf/syscall.c                               |   29 -
 kernel/dma/remap.c                                 |   48 --
 kernel/groups.c                                    |    2 
 kernel/module.c                                    |    3 
 kernel/notifier.c                                  |    1 
 kernel/sys.c                                       |    2 
 kernel/trace/trace.c                               |   12 
 lib/Kconfig.ubsan                                  |    2 
 lib/ioremap.c                                      |   46 +-
 lib/test_vmalloc.c                                 |   26 -
 mm/Kconfig                                         |    4 
 mm/debug.c                                         |   56 ++
 mm/fadvise.c                                       |    6 
 mm/filemap.c                                       |    1 
 mm/gup.c                                           |   77 +++-
 mm/internal.h                                      |   14 
 mm/kasan/Makefile                                  |   21 -
 mm/kasan/common.c                                  |   19 -
 mm/kasan/report.c                                  |   22 +
 mm/memcontrol.c                                    |  198 +++++++---
 mm/memory-failure.c                                |   15 
 mm/memory.c                                        |    2 
 mm/migrate.c                                       |    9 
 mm/mm_init.c                                       |   16 
 mm/nommu.c                                         |   52 +-
 mm/page-writeback.c                                |   62 ++-
 mm/page_alloc.c                                    |    7 
 mm/percpu.c                                        |    2 
 mm/ptdump.c                                        |   17 
 mm/readahead.c                                     |  349 ++++++++++--------
 mm/slab_common.c                                   |    3 
 mm/slub.c                                          |   67 ++-
 mm/swap_state.c                                    |    5 
 mm/swapfile.c                                      |  194 ++++++----
 mm/util.c                                          |    2 
 mm/vmalloc.c                                       |  399 ++++++++-------------
 mm/vmscan.c                                        |    4 
 mm/vmstat.c                                        |   11 
 mm/zsmalloc.c                                      |   12 
 net/bridge/netfilter/ebtables.c                    |    6 
 net/ceph/ceph_common.c                             |    3 
 sound/core/memalloc.c                              |    2 
 sound/core/pcm_memory.c                            |    2 
 195 files changed, 2292 insertions(+), 2288 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
       [not found]   ` <CAHk-=wgRV=SaiMn3L5u5mG0WfvB2VfEQadtudzDV3KRz5HnFrQ@mail.gmail.com>
@ 2020-06-02 21:38     ` Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-02 21:38 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, Linux-MM

On Tue, 2 Jun 2020 13:45:49 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, Jun 2, 2020 at 1:08 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > The local_lock merge made rather a mess of all of this.  I'm
> > cooking up a full resend of the same material.
> 
> Hmm. I have no issues with conflicts, and already took your previous series.

Well that's odd.

> I've pushed it out now - does my tree match what you expect?

Yup, thanks.

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-06-03 22:55 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-03 22:55 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


More mm/ work, plenty more to come.

131 patches, based on d6f9469a03d832dcd17041ed67774ffb5f3e73b3.

Subsystems affected by this patch series:

  mm/slub
  mm/memcg
  mm/gup
  mm/kasan
  mm/pagealloc
  mm/hugetlb
  mm/vmscan
  mm/tools
  mm/mempolicy
  mm/memblock
  mm/hugetlbfs
  mm/thp
  mm/mmap
  mm/kconfig

Subsystem: mm/slub

    Wang Hai <wanghai38@huawei.com>:
      mm/slub: fix a memory leak in sysfs_slab_add()

Subsystem: mm/memcg

    Shakeel Butt <shakeelb@google.com>:
      mm/memcg: optimize memory.numa_stat like memory.stat

Subsystem: mm/gup

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "mm/gup, drm/i915: refactor gup_fast, convert to pin_user_pages()", v2:
      mm/gup: move __get_user_pages_fast() down a few lines in gup.c
      mm/gup: refactor and de-duplicate gup_fast() code
      mm/gup: introduce pin_user_pages_fast_only()
      drm/i915: convert get_user_pages() --> pin_user_pages()
      mm/gup: might_lock_read(mmap_sem) in get_user_pages_fast()

Subsystem: mm/kasan

    Daniel Axtens <dja@axtens.net>:
    Patch series "Fix some incompatibilites between KASAN and FORTIFY_SOURCE", v4:
      kasan: stop tests being eliminated as dead code with FORTIFY_SOURCE
      string.h: fix incompatibility between FORTIFY_SOURCE and KASAN

Subsystem: mm/pagealloc

    Michal Hocko <mhocko@suse.com>:
      mm: clarify __GFP_MEMALLOC usage

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: rework free_area_init*() funcitons":
      mm: memblock: replace dereferences of memblock_region.nid with API calls
      mm: make early_pfn_to_nid() and related defintions close to each other
      mm: remove CONFIG_HAVE_MEMBLOCK_NODE_MAP option
      mm: free_area_init: use maximal zone PFNs rather than zone sizes
      mm: use free_area_init() instead of free_area_init_nodes()
      alpha: simplify detection of memory zone boundaries
      arm: simplify detection of memory zone boundaries
      arm64: simplify detection of memory zone boundaries for UMA configs
      csky: simplify detection of memory zone boundaries
      m68k: mm: simplify detection of memory zone boundaries
      parisc: simplify detection of memory zone boundaries
      sparc32: simplify detection of memory zone boundaries
      unicore32: simplify detection of memory zone boundaries
      xtensa: simplify detection of memory zone boundaries

    Baoquan He <bhe@redhat.com>:
      mm: memmap_init: iterate over memblock regions rather that check each PFN

    Mike Rapoport <rppt@linux.ibm.com>:
      mm: remove early_pfn_in_nid() and CONFIG_NODES_SPAN_OTHER_NODES
      mm: free_area_init: allow defining max_zone_pfn in descending order
      mm: rename free_area_init_node() to free_area_init_memoryless_node()
      mm: clean up free_area_init_node() and its helpers
      mm: simplify find_min_pfn_with_active_regions()
      docs/vm: update memory-models documentation

    Wei Yang <richard.weiyang@gmail.com>:
    Patch series "mm/page_alloc.c: cleanup on check page", v3:
      mm/page_alloc.c: bad_[reason|flags] is not necessary when PageHWPoison
      mm/page_alloc.c: bad_flags is not necessary for bad_page()
      mm/page_alloc.c: rename free_pages_check_bad() to check_free_page_bad()
      mm/page_alloc.c: rename free_pages_check() to check_free_page()
      mm/page_alloc.c: extract check_[new|free]_page_bad() common part to page_bad_reason()

    Roman Gushchin <guro@fb.com>:
      mm,page_alloc,cma: conditionally prefer cma pageblocks for movable allocations

    Baoquan He <bhe@redhat.com>:
      mm/page_alloc.c: remove unused free_bootmem_with_active_regions
    Patch series "improvements about lowmem_reserve and /proc/zoneinfo", v2:
      mm/page_alloc.c: only tune sysctl_lowmem_reserve_ratio value once when changing it
      mm/page_alloc.c: clear out zone->lowmem_reserve[] if the zone is empty
      mm/vmstat.c: do not show lowmem reserve protection information of empty zone

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
    Patch series "integrate classzone_idx and high_zoneidx", v5:
      mm/page_alloc: use ac->high_zoneidx for classzone_idx
      mm/page_alloc: integrate classzone_idx and high_zoneidx

    Wei Yang <richard.weiyang@gmail.com>:
      mm/page_alloc.c: use NODE_MASK_NONE in build_zonelists()
      mm: rename gfpflags_to_migratetype to gfp_migratetype for same convention

    Sandipan Das <sandipan@linux.ibm.com>:
      mm/page_alloc.c: reset numa stats for boot pagesets

    Charan Teja Reddy <charante@codeaurora.org>:
      mm, page_alloc: reset the zone->watermark_boost early

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/page_alloc: restrict and formalize compound_page_dtors[]

    Daniel Jordan <daniel.m.jordan@oracle.com>:
    Patch series "initialize deferred pages with interrupts enabled", v4:
      mm/pagealloc.c: call touch_nmi_watchdog() on max order boundaries in deferred init

    Pavel Tatashin <pasha.tatashin@soleen.com>:
      mm: initialize deferred pages with interrupts enabled
      mm: call cond_resched() from deferred_init_memmap()

    Daniel Jordan <daniel.m.jordan@oracle.com>:
    Patch series "padata: parallelize deferred page init", v3:
      padata: remove exit routine
      padata: initialize earlier
      padata: allocate work structures for parallel jobs from a pool
      padata: add basic support for multithreaded jobs
      mm: don't track number of pages during deferred initialization
      mm: parallelize deferred_init_memmap()
      mm: make deferred init's max threads arch-specific
      padata: document multithreaded jobs

    Chen Tao <chentao107@huawei.com>:
      mm/page_alloc.c: add missing newline

Subsystem: mm/hugetlb

    "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
    Patch series "thp/khugepaged improvements and CoW semantics", v4:
      khugepaged: add self test
      khugepaged: do not stop collapse if less than half PTEs are referenced
      khugepaged: drain all LRU caches before scanning pages
      khugepaged: drain LRU add pagevec after swapin
      khugepaged: allow to collapse a page shared across fork
      khugepaged: allow to collapse PTE-mapped compound pages
      thp: change CoW semantics for anon-THP
      khugepaged: introduce 'max_ptes_shared' tunable

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "Clean up hugetlb boot command line processing", v4:
      hugetlbfs: add arch_hugetlb_valid_size
      hugetlbfs: move hugepagesz= parsing to arch independent code
      hugetlbfs: remove hugetlb_add_hstate() warning for existing hstate
      hugetlbfs: clean up command line processing
      hugetlbfs: fix changes to command line processing

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm/hugetlb: avoid unnecessary check on pud and pmd entry in huge_pte_offset

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/hugetlb: Add some new generic fallbacks", v3:
      arm64/mm: drop __HAVE_ARCH_HUGE_PTEP_GET
      mm/hugetlb: define a generic fallback for is_hugepage_only_range()
      mm/hugetlb: define a generic fallback for arch_clear_hugepage_flags()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: simplify calling a compound page destructor

Subsystem: mm/vmscan

    Wei Yang <richard.weiyang@gmail.com>:
      mm/vmscan.c: use update_lru_size() in update_lru_sizes()

    Jaewon Kim <jaewon31.kim@samsung.com>:
      mm/vmscan: count layzfree pages and fix nr_isolated_* mismatch

    Maninder Singh <maninder1.s@samsung.com>:
      mm/vmscan.c: change prototype for shrink_page_list

    Qiwu Chen <qiwuchen55@gmail.com>:
      mm/vmscan: update the comment of should_continue_reclaim()

    Johannes Weiner <hannes@cmpxchg.org>:
    Patch series "mm: memcontrol: charge swapin pages on instantiation", v2:
      mm: fix NUMA node file count error in replace_page_cache()
      mm: memcontrol: fix stat-corrupting race in charge moving
      mm: memcontrol: drop @compound parameter from memcg charging API
      mm: shmem: remove rare optimization when swapin races with hole punching
      mm: memcontrol: move out cgroup swaprate throttling
      mm: memcontrol: convert page cache to a new mem_cgroup_charge() API
      mm: memcontrol: prepare uncharging for removal of private page type counters
      mm: memcontrol: prepare move_account for removal of private page type counters
      mm: memcontrol: prepare cgroup vmstat infrastructure for native anon counters
      mm: memcontrol: switch to native NR_FILE_PAGES and NR_SHMEM counters
      mm: memcontrol: switch to native NR_ANON_MAPPED counter
      mm: memcontrol: switch to native NR_ANON_THPS counter
      mm: memcontrol: convert anon and file-thp to new mem_cgroup_charge() API
      mm: memcontrol: drop unused try/commit/cancel charge API
      mm: memcontrol: prepare swap controller setup for integration
      mm: memcontrol: make swap tracking an integral part of memory control
      mm: memcontrol: charge swapin pages on instantiation

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm: memcontrol: document the new swap control behavior

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: delete unused lrucare handling
      mm: memcontrol: update page->mem_cgroup stability rules
      mm: fix LRU balancing effect of new transparent huge pages
      mm: keep separate anon and file statistics on page reclaim activity
      mm: allow swappiness that prefers reclaiming anon over the file workingset
      mm: fold and remove lru_cache_add_anon() and lru_cache_add_file()
      mm: workingset: let cache workingset challenge anon
      mm: remove use-once cache bias from LRU balancing
      mm: vmscan: drop unnecessary div0 avoidance rounding in get_scan_count()
      mm: base LRU balancing on an explicit cost model
      mm: deactivations shouldn't bias the LRU balance
      mm: only count actual rotations as LRU reclaim cost
      mm: balance LRU lists based on relative thrashing
      mm: vmscan: determine anon/file pressure balance at the reclaim root
      mm: vmscan: reclaim writepage is IO cost
      mm: vmscan: limit the range of LRU type balancing

    Shakeel Butt <shakeelb@google.com>:
      mm: swap: fix vmstats for huge pages
      mm: swap: memcg: fix memcg stats for huge pages

Subsystem: mm/tools

    Changhee Han <ch0.han@lge.com>:
      tools/vm/page_owner_sort.c: filter out unneeded line

Subsystem: mm/mempolicy

    Michal Hocko <mhocko@suse.com>:
      mm, mempolicy: fix up gup usage in lookup_node

Subsystem: mm/memblock

    chenqiwu <chenqiwu@xiaomi.com>:
      include/linux/memblock.h: fix minor typo and unclear comment

    Mike Rapoport <rppt@linux.ibm.com>:
      sparc32: register memory occupied by kernel as memblock.memory

Subsystem: mm/hugetlbfs

    Shijie Hu <hushijie3@huawei.com>:
      hugetlbfs: get unmapped area below TASK_UNMAPPED_BASE for hugetlbfs

Subsystem: mm/thp

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm: thp: don't need to drain lru cache when splitting and mlocking THP

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/thp: Rename pmd_mknotpresent() as pmd_mknotvalid()", v2:
      powerpc/mm: drop platform defined pmd_mknotpresent()
      mm/thp: rename pmd_mknotpresent() as pmd_mkinvalid()

Subsystem: mm/mmap

    Scott Cheloha <cheloha@linux.vnet.ibm.com>:
      drivers/base/memory.c: cache memory blocks in xarray to accelerate lookup

Subsystem: mm/kconfig

    Zong Li <zong.li@sifive.com>:
    Patch series "Extract DEBUG_WX to shared use":
      mm: add DEBUG_WX support
      riscv: support DEBUG_WX
      x86: mm: use ARCH_HAS_DEBUG_WX instead of arch defined
      arm64: mm: use ARCH_HAS_DEBUG_WX instead of arch defined

 Documentation/admin-guide/cgroup-v1/memory.rst           |   19 
 Documentation/admin-guide/kernel-parameters.txt          |   40 
 Documentation/admin-guide/mm/hugetlbpage.rst             |   35 
 Documentation/admin-guide/mm/transhuge.rst               |    7 
 Documentation/admin-guide/sysctl/vm.rst                  |   23 
 Documentation/core-api/padata.rst                        |   41 
 Documentation/features/vm/numa-memblock/arch-support.txt |   34 
 Documentation/vm/memory-model.rst                        |    9 
 Documentation/vm/page_owner.rst                          |    3 
 arch/alpha/mm/init.c                                     |   16 
 arch/alpha/mm/numa.c                                     |   22 
 arch/arc/include/asm/hugepage.h                          |    2 
 arch/arc/mm/init.c                                       |   41 
 arch/arm/include/asm/hugetlb.h                           |    7 
 arch/arm/include/asm/pgtable-3level.h                    |    2 
 arch/arm/mm/init.c                                       |   66 
 arch/arm64/Kconfig                                       |    2 
 arch/arm64/Kconfig.debug                                 |   29 
 arch/arm64/include/asm/hugetlb.h                         |   13 
 arch/arm64/include/asm/pgtable.h                         |    2 
 arch/arm64/mm/hugetlbpage.c                              |   48 
 arch/arm64/mm/init.c                                     |   56 
 arch/arm64/mm/numa.c                                     |    9 
 arch/c6x/mm/init.c                                       |    8 
 arch/csky/kernel/setup.c                                 |   26 
 arch/h8300/mm/init.c                                     |    6 
 arch/hexagon/mm/init.c                                   |    6 
 arch/ia64/Kconfig                                        |    1 
 arch/ia64/include/asm/hugetlb.h                          |    5 
 arch/ia64/mm/contig.c                                    |    2 
 arch/ia64/mm/discontig.c                                 |    2 
 arch/m68k/mm/init.c                                      |    6 
 arch/m68k/mm/mcfmmu.c                                    |    9 
 arch/m68k/mm/motorola.c                                  |   15 
 arch/m68k/mm/sun3mmu.c                                   |   10 
 arch/microblaze/Kconfig                                  |    1 
 arch/microblaze/mm/init.c                                |    2 
 arch/mips/Kconfig                                        |    1 
 arch/mips/include/asm/hugetlb.h                          |   11 
 arch/mips/include/asm/pgtable.h                          |    2 
 arch/mips/loongson64/numa.c                              |    2 
 arch/mips/mm/init.c                                      |    2 
 arch/mips/sgi-ip27/ip27-memory.c                         |    2 
 arch/nds32/mm/init.c                                     |   11 
 arch/nios2/mm/init.c                                     |    8 
 arch/openrisc/mm/init.c                                  |    9 
 arch/parisc/include/asm/hugetlb.h                        |   10 
 arch/parisc/mm/init.c                                    |   22 
 arch/powerpc/Kconfig                                     |   10 
 arch/powerpc/include/asm/book3s/64/pgtable.h             |    4 
 arch/powerpc/include/asm/hugetlb.h                       |    5 
 arch/powerpc/mm/hugetlbpage.c                            |   38 
 arch/powerpc/mm/mem.c                                    |    2 
 arch/riscv/Kconfig                                       |    2 
 arch/riscv/include/asm/hugetlb.h                         |   10 
 arch/riscv/include/asm/ptdump.h                          |   11 
 arch/riscv/mm/hugetlbpage.c                              |   44 
 arch/riscv/mm/init.c                                     |    5 
 arch/s390/Kconfig                                        |    1 
 arch/s390/include/asm/hugetlb.h                          |    8 
 arch/s390/mm/hugetlbpage.c                               |   34 
 arch/s390/mm/init.c                                      |    2 
 arch/sh/Kconfig                                          |    1 
 arch/sh/include/asm/hugetlb.h                            |    7 
 arch/sh/mm/init.c                                        |    2 
 arch/sparc/Kconfig                                       |   10 
 arch/sparc/include/asm/hugetlb.h                         |   10 
 arch/sparc/mm/init_32.c                                  |    1 
 arch/sparc/mm/init_64.c                                  |   67 
 arch/sparc/mm/srmmu.c                                    |   21 
 arch/um/kernel/mem.c                                     |   12 
 arch/unicore32/include/asm/memory.h                      |    2 
 arch/unicore32/include/mach/memory.h                     |    6 
 arch/unicore32/kernel/pci.c                              |   14 
 arch/unicore32/mm/init.c                                 |   43 
 arch/x86/Kconfig                                         |   11 
 arch/x86/Kconfig.debug                                   |   27 
 arch/x86/include/asm/hugetlb.h                           |   10 
 arch/x86/include/asm/pgtable.h                           |    2 
 arch/x86/mm/hugetlbpage.c                                |   35 
 arch/x86/mm/init.c                                       |    2 
 arch/x86/mm/init_64.c                                    |   12 
 arch/x86/mm/kmmio.c                                      |    2 
 arch/x86/mm/numa.c                                       |   11 
 arch/xtensa/mm/init.c                                    |    8 
 drivers/base/memory.c                                    |   44 
 drivers/gpu/drm/i915/gem/i915_gem_userptr.c              |   22 
 fs/cifs/file.c                                           |   10 
 fs/fuse/dev.c                                            |    2 
 fs/hugetlbfs/inode.c                                     |   67 
 include/asm-generic/hugetlb.h                            |    2 
 include/linux/compaction.h                               |    9 
 include/linux/gfp.h                                      |    7 
 include/linux/hugetlb.h                                  |   16 
 include/linux/memblock.h                                 |   15 
 include/linux/memcontrol.h                               |  102 -
 include/linux/mm.h                                       |   52 
 include/linux/mmzone.h                                   |   46 
 include/linux/padata.h                                   |   43 
 include/linux/string.h                                   |   60 
 include/linux/swap.h                                     |   17 
 include/linux/vm_event_item.h                            |    4 
 include/linux/vmstat.h                                   |    2 
 include/trace/events/compaction.h                        |   22 
 include/trace/events/huge_memory.h                       |    3 
 include/trace/events/vmscan.h                            |   14 
 init/Kconfig                                             |   17 
 init/main.c                                              |    2 
 kernel/events/uprobes.c                                  |   22 
 kernel/padata.c                                          |  293 +++-
 kernel/sysctl.c                                          |    3 
 lib/test_kasan.c                                         |   29 
 mm/Kconfig                                               |    9 
 mm/Kconfig.debug                                         |   32 
 mm/compaction.c                                          |   70 -
 mm/filemap.c                                             |   55 
 mm/gup.c                                                 |  237 ++-
 mm/huge_memory.c                                         |  282 ----
 mm/hugetlb.c                                             |  260 ++-
 mm/internal.h                                            |   25 
 mm/khugepaged.c                                          |  316 ++--
 mm/memblock.c                                            |   19 
 mm/memcontrol.c                                          |  642 +++------
 mm/memory.c                                              |  103 -
 mm/memory_hotplug.c                                      |   10 
 mm/mempolicy.c                                           |    5 
 mm/migrate.c                                             |   30 
 mm/oom_kill.c                                            |    4 
 mm/page_alloc.c                                          |  735 ++++------
 mm/page_owner.c                                          |    7 
 mm/pgtable-generic.c                                     |    2 
 mm/rmap.c                                                |   53 
 mm/shmem.c                                               |  156 --
 mm/slab.c                                                |    4 
 mm/slub.c                                                |    8 
 mm/swap.c                                                |  199 +-
 mm/swap_cgroup.c                                         |   10 
 mm/swap_state.c                                          |  110 -
 mm/swapfile.c                                            |   39 
 mm/userfaultfd.c                                         |   15 
 mm/vmscan.c                                              |  344 ++--
 mm/vmstat.c                                              |   16 
 mm/workingset.c                                          |   23 
 tools/testing/selftests/vm/.gitignore                    |    1 
 tools/testing/selftests/vm/Makefile                      |    1 
 tools/testing/selftests/vm/khugepaged.c                  | 1035 +++++++++++++++
 tools/vm/page_owner_sort.c                               |    5 
 147 files changed, 3876 insertions(+), 3108 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-06-04 23:45 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-04 23:45 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


- More MM work.  100ish more to go.  Mike's "mm: remove
  __ARCH_HAS_5LEVEL_HACK" series should fix the current ppc issue.

- Various other little subsystems

127 patches, based on 6929f71e46bdddbf1c4d67c2728648176c67c555.


Subsystems affected by this patch series:

  kcov
  mm/pagemap
  mm/vmalloc
  mm/kmap
  mm/util
  mm/memory-hotplug
  mm/cleanups
  mm/zram
  procfs
  core-kernel
  get_maintainer
  lib
  bitops
  checkpatch
  binfmt
  init
  fat
  seq_file
  exec
  rapidio
  relay
  selftests
  ubsan

Subsystem: kcov

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kcov: collect coverage from usb soft interrupts", v4:
      kcov: cleanup debug messages
      kcov: fix potential use-after-free in kcov_remote_start
      kcov: move t->kcov assignments into kcov_start/stop
      kcov: move t->kcov_sequence assignment
      kcov: use t->kcov_mode as enabled indicator
      kcov: collect coverage from interrupts
      usb: core: kcov: collect coverage from usb complete callback

Subsystem: mm/pagemap

    Feng Tang <feng.tang@intel.com>:
      mm/util.c: remove the VM_WARN_ONCE for vm_committed_as underflow check

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: remove __ARCH_HAS_5LEVEL_HACK", v4:
      h8300: remove usage of __ARCH_USE_5LEVEL_HACK
      arm: add support for folded p4d page tables
      arm64: add support for folded p4d page tables
      hexagon: remove __ARCH_USE_5LEVEL_HACK
      ia64: add support for folded p4d page tables
      nios2: add support for folded p4d page tables
      openrisc: add support for folded p4d page tables
      powerpc: add support for folded p4d page tables

    Geert Uytterhoeven <geert+renesas@glider.be>:
      sh: fault: modernize printing of kernel messages

    Mike Rapoport <rppt@linux.ibm.com>:
      sh: drop __pXd_offset() macros that duplicate pXd_index() ones
      sh: add support for folded p4d page tables
      unicore32: remove __ARCH_USE_5LEVEL_HACK
      asm-generic: remove pgtable-nop4d-hack.h
      mm: remove __ARCH_HAS_5LEVEL_HACK and include/asm-generic/5level-fixup.h

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/debug: Add tests validating architecture page table:
      x86/mm: define mm_p4d_folded()
      mm/debug: add tests validating architecture page table helpers

Subsystem: mm/vmalloc

    Jeongtae Park <jtp.park@samsung.com>:
      mm/vmalloc: fix a typo in comment

Subsystem: mm/kmap

    Ira Weiny <ira.weiny@intel.com>:
    Patch series "Remove duplicated kmap code", v3:
      arch/kmap: remove BUG_ON()
      arch/xtensa: move kmap build bug out of the way
      arch/kmap: remove redundant arch specific kmaps
      arch/kunmap: remove duplicate kunmap implementations
      {x86,powerpc,microblaze}/kmap: move preempt disable
      arch/kmap_atomic: consolidate duplicate code
      arch/kunmap_atomic: consolidate duplicate code
      arch/kmap: ensure kmap_prot visibility
      arch/kmap: don't hard code kmap_prot values
      arch/kmap: define kmap_atomic_prot() for all arch's
      drm: remove drm specific kmap_atomic code
      kmap: remove kmap_atomic_to_page()
      parisc/kmap: remove duplicate kmap code
      sparc: remove unnecessary includes
      kmap: consolidate kmap_prot definitions

Subsystem: mm/util

    Waiman Long <longman@redhat.com>:
      mm: add kvfree_sensitive() for freeing sensitive data objects

Subsystem: mm/memory-hotplug

    Vishal Verma <vishal.l.verma@intel.com>:
      mm/memory_hotplug: refrain from adding memory into an impossible node

    David Hildenbrand <david@redhat.com>:
      powerpc/pseries/hotplug-memory: stop checking is_mem_section_removable()
      mm/memory_hotplug: remove is_mem_section_removable()
    Patch series "mm/memory_hotplug: handle memblocks only with:
      mm/memory_hotplug: set node_start_pfn of hotadded pgdat to 0
      mm/memory_hotplug: handle memblocks only with CONFIG_ARCH_KEEP_MEMBLOCK
    Patch series "mm/memory_hotplug: Interface to add driver-managed system:
      mm/memory_hotplug: introduce add_memory_driver_managed()
      kexec_file: don't place kexec images on IORESOURCE_MEM_DRIVER_MANAGED
      device-dax: add memory via add_memory_driver_managed()

    Michal Hocko <mhocko@kernel.org>:
      mm/memory_hotplug: disable the functionality for 32b

Subsystem: mm/cleanups

    chenqiwu <chenqiwu@xiaomi.com>:
      mm: replace zero-length array with flexible-array member

    Ethon Paul <ethp@qq.com>:
      mm/memory_hotplug: fix a typo in comment "recoreded"->"recorded"
      mm: ksm: fix a typo in comment "alreaady"->"already"
      mm: mmap: fix a typo in comment "compatbility"->"compatibility"
      mm/hugetlb: fix a typos in comments
      mm/vmsan: fix some typos in comment
      mm/compaction: fix a typo in comment "pessemistic"->"pessimistic"
      mm/memblock: fix a typo in comment "implict"->"implicit"
      mm/list_lru: fix a typo in comment "numbesr"->"numbers"
      mm/filemap: fix a typo in comment "unneccssary"->"unnecessary"
      mm/frontswap: fix some typos in frontswap.c
      mm, memcg: fix some typos in memcontrol.c
      mm: fix a typo in comment "strucure"->"structure"
      mm/slub: fix a typo in comment "disambiguiation"->"disambiguation"
      mm/sparse: fix a typo in comment "convienence"->"convenience"
      mm/page-writeback: fix a typo in comment "effictive"->"effective"
      mm/memory: fix a typo in comment "attampt"->"attempt"

    Zou Wei <zou_wei@huawei.com>:
      mm: use false for bool variable

    Jason Yan <yanaijie@huawei.com>:
      include/linux/mm.h: return true in cpupid_pid_unset()

Subsystem: mm/zram

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      zcomp: Use ARRAY_SIZE() for backends list

Subsystem: procfs

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: rename "catch" function argument

Subsystem: core-kernel

    Jason Yan <yanaijie@huawei.com>:
      user.c: make uidhash_table static

Subsystem: get_maintainer

    Joe Perches <joe@perches.com>:
      get_maintainer: add email addresses from .yaml files
      get_maintainer: fix unexpected behavior for path/to//file (double slashes)

Subsystem: lib

    Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
      lib/math: avoid trailing newline hidden in pr_fmt()

    KP Singh <kpsingh@chromium.org>:
      lib: Add might_fault() to strncpy_from_user.

    Jason Yan <yanaijie@huawei.com>:
      lib/test_lockup.c: make test_inode static

    Jann Horn <jannh@google.com>:
      lib/zlib: remove outdated and incorrect pre-increment optimization

    Joe Perches <joe@perches.com>:
      lib/percpu-refcount.c: use a more common logging style

    Tan Hu <tan.hu@zte.com.cn>:
      lib/flex_proportions.c: cleanup __fprop_inc_percpu_max

    Jesse Brandeburg <jesse.brandeburg@intel.com>:
      lib: make a test module with set/clear bit

Subsystem: bitops

    Arnd Bergmann <arnd@arndb.de>:
      include/linux/bitops.h: avoid clang shift-count-overflow warnings

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: additional MAINTAINER section entry ordering checks
      checkpatch: look for c99 comments in ctx_locate_comment
      checkpatch: disallow --git and --file/--fix

    Geert Uytterhoeven <geert+renesas@glider.be>:
      checkpatch: use patch subject when reading from stdin

Subsystem: binfmt

    Anthony Iliopoulos <ailiop@suse.com>:
      fs/binfmt_elf: remove redundant elf_map ifndef

    Nick Desaulniers <ndesaulniers@google.com>:
      elfnote: mark all .note sections SHF_ALLOC

Subsystem: init

    Chris Down <chris@chrisdown.name>:
      init: allow distribution configuration of default init

Subsystem: fat

    OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
      fat: don't allow to mount if the FAT length == 0
      fat: improve the readahead for FAT entries

Subsystem: seq_file

    Joe Perches <joe@perches.com>:
      fs/seq_file.c: seq_read: Update pr_info_ratelimited

    Kefeng Wang <wangkefeng.wang@huawei.com>:
    Patch series "seq_file: Introduce DEFINE_SEQ_ATTRIBUTE() helper macro":
      include/linux/seq_file.h: introduce DEFINE_SEQ_ATTRIBUTE() helper macro
      mm/vmstat.c: convert to use DEFINE_SEQ_ATTRIBUTE macro
      kernel/kprobes.c: convert to use DEFINE_SEQ_ATTRIBUTE macro

Subsystem: exec

    Christoph Hellwig <hch@lst.de>:
      exec: simplify the copy_strings_kernel calling convention
      exec: open code copy_string_kernel

Subsystem: rapidio

    Madhuparna Bhowmik <madhuparnabhowmik10@gmail.com>:
      rapidio: avoid data race between file operation callbacks and mport_cdev_add().

    John Hubbard <jhubbard@nvidia.com>:
      rapidio: convert get_user_pages() --> pin_user_pages()

Subsystem: relay

    Daniel Axtens <dja@axtens.net>:
      kernel/relay.c: handle alloc_percpu returning NULL in relay_open

    Pengcheng Yang <yangpc@wangsu.com>:
      kernel/relay.c: fix read_pos error when multiple readers

Subsystem: selftests

    Ram Pai <linuxram@us.ibm.com>:
    Patch series "selftests, powerpc, x86: Memory Protection Keys", v19:
      selftests/x86/pkeys: move selftests to arch-neutral directory
      selftests/vm/pkeys: rename all references to pkru to a generic name
      selftests/vm/pkeys: move generic definitions to header file

    Thiago Jung Bauermann <bauerman@linux.ibm.com>:
      selftests/vm/pkeys: move some definitions to arch-specific header
      selftests/vm/pkeys: make gcc check arguments of sigsafe_printf()

    Sandipan Das <sandipan@linux.ibm.com>:
      selftests: vm: pkeys: Use sane types for pkey register
      selftests: vm: pkeys: add helpers for pkey bits

    Ram Pai <linuxram@us.ibm.com>:
      selftests/vm/pkeys: fix pkey_disable_clear()
      selftests/vm/pkeys: fix assertion in pkey_disable_set/clear()
      selftests/vm/pkeys: fix alloc_random_pkey() to make it really random

    Sandipan Das <sandipan@linux.ibm.com>:
      selftests: vm: pkeys: use the correct huge page size

    Ram Pai <linuxram@us.ibm.com>:
      selftests/vm/pkeys: introduce generic pkey abstractions
      selftests/vm/pkeys: introduce powerpc support

    "Desnes A. Nunes do Rosario" <desnesn@linux.vnet.ibm.com>:
      selftests/vm/pkeys: fix number of reserved powerpc pkeys

    Ram Pai <linuxram@us.ibm.com>:
      selftests/vm/pkeys: fix assertion in test_pkey_alloc_exhaust()
      selftests/vm/pkeys: improve checks to determine pkey support
      selftests/vm/pkeys: associate key on a mapped page and detect access violation
      selftests/vm/pkeys: associate key on a mapped page and detect write violation
      selftests/vm/pkeys: detect write violation on a mapped access-denied-key page
      selftests/vm/pkeys: introduce a sub-page allocator
      selftests/vm/pkeys: test correct behaviour of pkey-0
      selftests/vm/pkeys: override access right definitions on powerpc

    Sandipan Das <sandipan@linux.ibm.com>:
      selftests: vm: pkeys: use the correct page size on powerpc
      selftests: vm: pkeys: fix multilib builds for x86

    Jagadeesh Pagadala <jagdsh.linux@gmail.com>:
      tools/testing/selftests/vm: remove duplicate headers

Subsystem: ubsan

    Arnd Bergmann <arnd@arndb.de>:
      lib/ubsan.c: fix gcc-10 warnings

 Documentation/dev-tools/kcov.rst                               |   17 
 Documentation/features/debug/debug-vm-pgtable/arch-support.txt |   34 
 arch/arc/Kconfig                                               |    1 
 arch/arc/include/asm/highmem.h                                 |   20 
 arch/arc/mm/highmem.c                                          |   34 
 arch/arm/include/asm/highmem.h                                 |    9 
 arch/arm/include/asm/pgtable.h                                 |    1 
 arch/arm/lib/uaccess_with_memcpy.c                             |    7 
 arch/arm/mach-sa1100/assabet.c                                 |    2 
 arch/arm/mm/dump.c                                             |   29 
 arch/arm/mm/fault-armv.c                                       |    7 
 arch/arm/mm/fault.c                                            |   22 
 arch/arm/mm/highmem.c                                          |   41 
 arch/arm/mm/idmap.c                                            |    3 
 arch/arm/mm/init.c                                             |    2 
 arch/arm/mm/ioremap.c                                          |   12 
 arch/arm/mm/mm.h                                               |    2 
 arch/arm/mm/mmu.c                                              |   35 
 arch/arm/mm/pgd.c                                              |   40 
 arch/arm64/Kconfig                                             |    1 
 arch/arm64/include/asm/kvm_mmu.h                               |   10 
 arch/arm64/include/asm/pgalloc.h                               |   10 
 arch/arm64/include/asm/pgtable-types.h                         |    5 
 arch/arm64/include/asm/pgtable.h                               |   37 
 arch/arm64/include/asm/stage2_pgtable.h                        |   48 
 arch/arm64/kernel/hibernate.c                                  |   44 
 arch/arm64/kvm/mmu.c                                           |  209 
 arch/arm64/mm/fault.c                                          |    9 
 arch/arm64/mm/hugetlbpage.c                                    |   15 
 arch/arm64/mm/kasan_init.c                                     |   26 
 arch/arm64/mm/mmu.c                                            |   52 
 arch/arm64/mm/pageattr.c                                       |    7 
 arch/csky/include/asm/highmem.h                                |   12 
 arch/csky/mm/highmem.c                                         |   64 
 arch/h8300/include/asm/pgtable.h                               |    1 
 arch/hexagon/include/asm/fixmap.h                              |    4 
 arch/hexagon/include/asm/pgtable.h                             |    1 
 arch/ia64/include/asm/pgalloc.h                                |    4 
 arch/ia64/include/asm/pgtable.h                                |   17 
 arch/ia64/mm/fault.c                                           |    7 
 arch/ia64/mm/hugetlbpage.c                                     |   18 
 arch/ia64/mm/init.c                                            |   28 
 arch/microblaze/include/asm/highmem.h                          |   55 
 arch/microblaze/mm/highmem.c                                   |   21 
 arch/microblaze/mm/init.c                                      |    3 
 arch/mips/include/asm/highmem.h                                |   11 
 arch/mips/mm/cache.c                                           |    6 
 arch/mips/mm/highmem.c                                         |   62 
 arch/nds32/include/asm/highmem.h                               |    9 
 arch/nds32/mm/highmem.c                                        |   49 
 arch/nios2/include/asm/pgtable.h                               |    3 
 arch/nios2/mm/fault.c                                          |    9 
 arch/nios2/mm/ioremap.c                                        |    6 
 arch/openrisc/include/asm/pgtable.h                            |    1 
 arch/openrisc/mm/fault.c                                       |   10 
 arch/openrisc/mm/init.c                                        |    4 
 arch/parisc/include/asm/cacheflush.h                           |   32 
 arch/powerpc/Kconfig                                           |    1 
 arch/powerpc/include/asm/book3s/32/pgtable.h                   |    1 
 arch/powerpc/include/asm/book3s/64/hash.h                      |    4 
 arch/powerpc/include/asm/book3s/64/pgalloc.h                   |    4 
 arch/powerpc/include/asm/book3s/64/pgtable.h                   |   60 
 arch/powerpc/include/asm/book3s/64/radix.h                     |    6 
 arch/powerpc/include/asm/highmem.h                             |   56 
 arch/powerpc/include/asm/nohash/32/pgtable.h                   |    1 
 arch/powerpc/include/asm/nohash/64/pgalloc.h                   |    2 
 arch/powerpc/include/asm/nohash/64/pgtable-4k.h                |   32 
 arch/powerpc/include/asm/nohash/64/pgtable.h                   |    6 
 arch/powerpc/include/asm/pgtable.h                             |   10 
 arch/powerpc/kvm/book3s_64_mmu_radix.c                         |   32 
 arch/powerpc/lib/code-patching.c                               |    7 
 arch/powerpc/mm/book3s64/hash_pgtable.c                        |    4 
 arch/powerpc/mm/book3s64/radix_pgtable.c                       |   26 
 arch/powerpc/mm/book3s64/subpage_prot.c                        |    6 
 arch/powerpc/mm/highmem.c                                      |   26 
 arch/powerpc/mm/hugetlbpage.c                                  |   28 
 arch/powerpc/mm/kasan/kasan_init_32.c                          |    2 
 arch/powerpc/mm/mem.c                                          |    3 
 arch/powerpc/mm/nohash/book3e_pgtable.c                        |   15 
 arch/powerpc/mm/pgtable.c                                      |   30 
 arch/powerpc/mm/pgtable_64.c                                   |   10 
 arch/powerpc/mm/ptdump/hashpagetable.c                         |   20 
 arch/powerpc/mm/ptdump/ptdump.c                                |   12 
 arch/powerpc/platforms/pseries/hotplug-memory.c                |   26 
 arch/powerpc/xmon/xmon.c                                       |   27 
 arch/s390/Kconfig                                              |    1 
 arch/sh/include/asm/pgtable-2level.h                           |    1 
 arch/sh/include/asm/pgtable-3level.h                           |    1 
 arch/sh/include/asm/pgtable_32.h                               |    5 
 arch/sh/include/asm/pgtable_64.h                               |    5 
 arch/sh/kernel/io_trapped.c                                    |    7 
 arch/sh/mm/cache-sh4.c                                         |    4 
 arch/sh/mm/cache-sh5.c                                         |    7 
 arch/sh/mm/fault.c                                             |   64 
 arch/sh/mm/hugetlbpage.c                                       |   28 
 arch/sh/mm/init.c                                              |   15 
 arch/sh/mm/kmap.c                                              |    2 
 arch/sh/mm/tlbex_32.c                                          |    6 
 arch/sh/mm/tlbex_64.c                                          |    7 
 arch/sparc/include/asm/highmem.h                               |   29 
 arch/sparc/mm/highmem.c                                        |   31 
 arch/sparc/mm/io-unit.c                                        |    1 
 arch/sparc/mm/iommu.c                                          |    1 
 arch/unicore32/include/asm/pgtable.h                           |    1 
 arch/unicore32/kernel/hibernate.c                              |    4 
 arch/x86/Kconfig                                               |    1 
 arch/x86/include/asm/fixmap.h                                  |    1 
 arch/x86/include/asm/highmem.h                                 |   37 
 arch/x86/include/asm/pgtable_64.h                              |    6 
 arch/x86/mm/highmem_32.c                                       |   52 
 arch/xtensa/include/asm/highmem.h                              |   31 
 arch/xtensa/mm/highmem.c                                       |   28 
 drivers/block/zram/zcomp.c                                     |    7 
 drivers/dax/dax-private.h                                      |    1 
 drivers/dax/kmem.c                                             |   28 
 drivers/gpu/drm/ttm/ttm_bo_util.c                              |   56 
 drivers/gpu/drm/vmwgfx/vmwgfx_blit.c                           |   17 
 drivers/rapidio/devices/rio_mport_cdev.c                       |   27 
 drivers/usb/core/hcd.c                                         |    3 
 fs/binfmt_elf.c                                                |    4 
 fs/binfmt_em86.c                                               |    6 
 fs/binfmt_misc.c                                               |    4 
 fs/binfmt_script.c                                             |    6 
 fs/exec.c                                                      |   58 
 fs/fat/fatent.c                                                |  103 
 fs/fat/inode.c                                                 |    6 
 fs/proc/array.c                                                |    8 
 fs/seq_file.c                                                  |    7 
 include/asm-generic/5level-fixup.h                             |   59 
 include/asm-generic/pgtable-nop4d-hack.h                       |   64 
 include/asm-generic/pgtable-nopud.h                            |    4 
 include/drm/ttm/ttm_bo_api.h                                   |    4 
 include/linux/binfmts.h                                        |    3 
 include/linux/bitops.h                                         |    2 
 include/linux/elfnote.h                                        |    2 
 include/linux/highmem.h                                        |   89 
 include/linux/ioport.h                                         |    1 
 include/linux/memory_hotplug.h                                 |    9 
 include/linux/mm.h                                             |   12 
 include/linux/sched.h                                          |    3 
 include/linux/seq_file.h                                       |   19 
 init/Kconfig                                                   |   10 
 init/main.c                                                    |   10 
 kernel/kcov.c                                                  |  282 -
 kernel/kexec_file.c                                            |    5 
 kernel/kprobes.c                                               |   34 
 kernel/relay.c                                                 |   22 
 kernel/user.c                                                  |    2 
 lib/Kconfig.debug                                              |   44 
 lib/Makefile                                                   |    2 
 lib/flex_proportions.c                                         |    7 
 lib/math/prime_numbers.c                                       |   10 
 lib/percpu-refcount.c                                          |    6 
 lib/strncpy_from_user.c                                        |    1 
 lib/test_bitops.c                                              |   60 
 lib/test_lockup.c                                              |    2 
 lib/ubsan.c                                                    |   33 
 lib/zlib_inflate/inffast.c                                     |   91 
 mm/Kconfig                                                     |    4 
 mm/Makefile                                                    |    1 
 mm/compaction.c                                                |    2 
 mm/debug_vm_pgtable.c                                          |  382 +
 mm/filemap.c                                                   |    2 
 mm/frontswap.c                                                 |    6 
 mm/huge_memory.c                                               |    2 
 mm/hugetlb.c                                                   |   16 
 mm/internal.h                                                  |    2 
 mm/kasan/init.c                                                |   11 
 mm/ksm.c                                                       |   10 
 mm/list_lru.c                                                  |    2 
 mm/memblock.c                                                  |    2 
 mm/memcontrol.c                                                |    4 
 mm/memory.c                                                    |   10 
 mm/memory_hotplug.c                                            |  179 
 mm/mmap.c                                                      |    2 
 mm/mremap.c                                                    |    2 
 mm/page-writeback.c                                            |    2 
 mm/slub.c                                                      |    2 
 mm/sparse.c                                                    |    2 
 mm/util.c                                                      |   22 
 mm/vmalloc.c                                                   |    2 
 mm/vmscan.c                                                    |    6 
 mm/vmstat.c                                                    |   32 
 mm/zbud.c                                                      |    2 
 scripts/checkpatch.pl                                          |   62 
 scripts/get_maintainer.pl                                      |   46 
 security/keys/internal.h                                       |   11 
 security/keys/keyctl.c                                         |   16 
 tools/testing/selftests/lib/config                             |    1 
 tools/testing/selftests/vm/.gitignore                          |    1 
 tools/testing/selftests/vm/Makefile                            |   75 
 tools/testing/selftests/vm/mremap_dontunmap.c                  |    1 
 tools/testing/selftests/vm/pkey-helpers.h                      |  557 +-
 tools/testing/selftests/vm/pkey-powerpc.h                      |  153 
 tools/testing/selftests/vm/pkey-x86.h                          |  191 
 tools/testing/selftests/vm/protection_keys.c                   | 2370 ++++++++--
 tools/testing/selftests/x86/.gitignore                         |    1 
 tools/testing/selftests/x86/Makefile                           |    2 
 tools/testing/selftests/x86/pkey-helpers.h                     |  219 
 tools/testing/selftests/x86/protection_keys.c                  | 1506 ------
 200 files changed, 5182 insertions(+), 4033 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-06-08  4:35 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-08  4:35 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


Various trees.  Mainly those parts of MM whose linux-next dependents
are now merged.  I'm still sitting on ~160 patches which await merges
from -next.


54 patches, based on 9aa900c8094dba7a60dc805ecec1e9f720744ba1.

Subsystems affected by this patch series:

  mm/proc
  ipc
  dynamic-debug
  panic
  lib
  sysctl
  mm/gup
  mm/pagemap

Subsystem: mm/proc

    SeongJae Park <sjpark@amazon.de>:
      mm/page_idle.c: skip offline pages

Subsystem: ipc

    Jules Irenge <jbi.octave@gmail.com>:
      ipc/msg: add missing annotation for freeque()

    Giuseppe Scrivano <gscrivan@redhat.com>:
      ipc/namespace.c: use a work queue to free_ipc

Subsystem: dynamic-debug

    Orson Zhai <orson.zhai@unisoc.com>:
      dynamic_debug: add an option to enable dynamic debug for modules only

Subsystem: panic

    Rafael Aquini <aquini@redhat.com>:
      kernel: add panic_on_taint

Subsystem: lib

    Manfred Spraul <manfred@colorfullife.com>:
      xarray.h: correct return code documentation for xa_store_{bh,irq}()

Subsystem: sysctl

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "support setting sysctl parameters from kernel command line", v3:
      kernel/sysctl: support setting sysctl parameters from kernel command line
      kernel/sysctl: support handling command line aliases
      kernel/hung_task convert hung_task_panic boot parameter to sysctl
      tools/testing/selftests/sysctl/sysctl.sh: support CONFIG_TEST_SYSCTL=y
      lib/test_sysctl: support testing of sysctl. boot parameter

    "Guilherme G. Piccoli" <gpiccoli@canonical.com>:
      kernel/watchdog.c: convert {soft/hard}lockup boot parameters to sysctl aliases
      kernel/hung_task.c: introduce sysctl to print all traces when a hung task is detected
      panic: add sysctl to dump all CPUs backtraces on oops event

    Rafael Aquini <aquini@redhat.com>:
      kernel/sysctl.c: ignore out-of-range taint bits introduced via kernel.tainted

Subsystem: mm/gup

    Souptick Joarder <jrdr.linux@gmail.com>:
      mm/gup.c: convert to use get_user_{page|pages}_fast_only()

    John Hubbard <jhubbard@nvidia.com>:
      mm/gup: update pin_user_pages.rst for "case 3" (mmu notifiers)
    Patch series "mm/gup: introduce pin_user_pages_locked(), use it in frame_vector.c", v2:
      mm/gup: introduce pin_user_pages_locked()
      mm/gup: frame_vector: convert get_user_pages() --> pin_user_pages()
      mm/gup: documentation fix for pin_user_pages*() APIs
    Patch series "vhost, docs: convert to pin_user_pages(), new "case 5"":
      docs: mm/gup: pin_user_pages.rst: add a "case 5"
      vhost: convert get_user_pages() --> pin_user_pages()

Subsystem: mm/pagemap

    Alexander Gordeev <agordeev@linux.ibm.com>:
      mm/mmap.c: add more sanity checks to get_unmapped_area()
      mm/mmap.c: do not allow mappings outside of allowed limits

    Christoph Hellwig <hch@lst.de>:
    Patch series "sort out the flush_icache_range mess", v2:
      arm: fix the flush_icache_range arguments in set_fiq_handler
      nds32: unexport flush_icache_page
      powerpc: unexport flush_icache_user_range
      unicore32: remove flush_cache_user_range
      asm-generic: fix the inclusion guards for cacheflush.h
      asm-generic: don't include <linux/mm.h> in cacheflush.h
      asm-generic: improve the flush_dcache_page stub
      alpha: use asm-generic/cacheflush.h
      arm64: use asm-generic/cacheflush.h
      c6x: use asm-generic/cacheflush.h
      hexagon: use asm-generic/cacheflush.h
      ia64: use asm-generic/cacheflush.h
      microblaze: use asm-generic/cacheflush.h
      m68knommu: use asm-generic/cacheflush.h
      openrisc: use asm-generic/cacheflush.h
      powerpc: use asm-generic/cacheflush.h
      riscv: use asm-generic/cacheflush.h
      arm,sparc,unicore32: remove flush_icache_user_range
      mm: rename flush_icache_user_range to flush_icache_user_page
      asm-generic: add a flush_icache_user_range stub
      sh: implement flush_icache_user_range
      xtensa: implement flush_icache_user_range
      arm: rename flush_cache_user_range to flush_icache_user_range
      m68k: implement flush_icache_user_range
      exec: only build read_code when needed
      exec: use flush_icache_user_range in read_code
      binfmt_flat: use flush_icache_user_range
      nommu: use flush_icache_user_range in brk and mmap
      module: move the set_fs hack for flush_icache_range to m68k

    Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
      doc: cgroup: update note about conditions when oom killer is invoked

 Documentation/admin-guide/cgroup-v2.rst           |   17 +-
 Documentation/admin-guide/dynamic-debug-howto.rst |    5 
 Documentation/admin-guide/kdump/kdump.rst         |    8 +
 Documentation/admin-guide/kernel-parameters.txt   |   34 +++-
 Documentation/admin-guide/sysctl/kernel.rst       |   37 ++++
 Documentation/core-api/pin_user_pages.rst         |   47 ++++--
 arch/alpha/include/asm/cacheflush.h               |   38 +----
 arch/alpha/kernel/smp.c                           |    2 
 arch/arm/include/asm/cacheflush.h                 |    7 
 arch/arm/kernel/fiq.c                             |    4 
 arch/arm/kernel/traps.c                           |    2 
 arch/arm64/include/asm/cacheflush.h               |   46 ------
 arch/c6x/include/asm/cacheflush.h                 |   19 --
 arch/hexagon/include/asm/cacheflush.h             |   19 --
 arch/ia64/include/asm/cacheflush.h                |   30 ----
 arch/m68k/include/asm/cacheflush_mm.h             |    6 
 arch/m68k/include/asm/cacheflush_no.h             |   19 --
 arch/m68k/mm/cache.c                              |   13 +
 arch/microblaze/include/asm/cacheflush.h          |   29 ---
 arch/nds32/include/asm/cacheflush.h               |    4 
 arch/nds32/mm/cacheflush.c                        |    3 
 arch/openrisc/include/asm/cacheflush.h            |   33 ----
 arch/powerpc/include/asm/cacheflush.h             |   46 +-----
 arch/powerpc/kvm/book3s_64_mmu_hv.c               |    2 
 arch/powerpc/kvm/book3s_64_mmu_radix.c            |    2 
 arch/powerpc/mm/mem.c                             |    3 
 arch/powerpc/perf/callchain_64.c                  |    4 
 arch/riscv/include/asm/cacheflush.h               |   65 --------
 arch/sh/include/asm/cacheflush.h                  |    1 
 arch/sparc/include/asm/cacheflush_32.h            |    2 
 arch/sparc/include/asm/cacheflush_64.h            |    1 
 arch/um/include/asm/tlb.h                         |    2 
 arch/unicore32/include/asm/cacheflush.h           |   11 -
 arch/x86/include/asm/cacheflush.h                 |    2 
 arch/xtensa/include/asm/cacheflush.h              |    2 
 drivers/media/platform/omap3isp/ispvideo.c        |    2 
 drivers/nvdimm/pmem.c                             |    3 
 drivers/vhost/vhost.c                             |    5 
 fs/binfmt_flat.c                                  |    2 
 fs/exec.c                                         |    5 
 fs/proc/proc_sysctl.c                             |  163 ++++++++++++++++++++--
 include/asm-generic/cacheflush.h                  |   25 +--
 include/linux/dev_printk.h                        |    6 
 include/linux/dynamic_debug.h                     |    2 
 include/linux/ipc_namespace.h                     |    2 
 include/linux/kernel.h                            |    9 +
 include/linux/mm.h                                |   12 +
 include/linux/net.h                               |    3 
 include/linux/netdevice.h                         |    6 
 include/linux/printk.h                            |    9 -
 include/linux/sched/sysctl.h                      |    7 
 include/linux/sysctl.h                            |    4 
 include/linux/xarray.h                            |    4 
 include/rdma/ib_verbs.h                           |    6 
 init/main.c                                       |    2 
 ipc/msg.c                                         |    2 
 ipc/namespace.c                                   |   24 ++-
 kernel/events/core.c                              |    4 
 kernel/events/uprobes.c                           |    2 
 kernel/hung_task.c                                |   30 ++--
 kernel/module.c                                   |    8 -
 kernel/panic.c                                    |   45 ++++++
 kernel/sysctl.c                                   |   38 ++++-
 kernel/watchdog.c                                 |   37 +---
 lib/Kconfig.debug                                 |   12 +
 lib/Makefile                                      |    2 
 lib/dynamic_debug.c                               |    9 -
 lib/test_sysctl.c                                 |   13 +
 mm/frame_vector.c                                 |    7 
 mm/gup.c                                          |   74 +++++++--
 mm/mmap.c                                         |   28 ++-
 mm/nommu.c                                        |    4 
 mm/page_alloc.c                                   |    9 -
 mm/page_idle.c                                    |    7 
 tools/testing/selftests/sysctl/sysctl.sh          |   44 +++++
 virt/kvm/kvm_main.c                               |    8 -
 76 files changed, 732 insertions(+), 517 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-06-09  4:29 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-09  4:29 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- a kernel-wide sweep of show_stack()

- pagetable cleanups

- abstract out accesses to mmap_sem - prep for mmap_sem scalability work

- hch's user acess work


93 patches, based on abfbb29297c27e3f101f348dc9e467b0fe70f919:

Subsystems affected by this patch series:

  debug
  mm/pagemap
  mm/maccess
  mm/documentation

Subsystem: debug

    Dmitry Safonov <dima@arista.com>:
    Patch series "Add log level to show_stack()", v3:
      kallsyms/printk: add loglvl to print_ip_sym()
      alpha: add show_stack_loglvl()
      arc: add show_stack_loglvl()
      arm/asm: add loglvl to c_backtrace()
      arm: add loglvl to unwind_backtrace()
      arm: add loglvl to dump_backtrace()
      arm: wire up dump_backtrace_{entry,stm}
      arm: add show_stack_loglvl()
      arm64: add loglvl to dump_backtrace()
      arm64: add show_stack_loglvl()
      c6x: add show_stack_loglvl()
      csky: add show_stack_loglvl()
      h8300: add show_stack_loglvl()
      hexagon: add show_stack_loglvl()
      ia64: pass log level as arg into ia64_do_show_stack()
      ia64: add show_stack_loglvl()
      m68k: add show_stack_loglvl()
      microblaze: add loglvl to microblaze_unwind_inner()
      microblaze: add loglvl to microblaze_unwind()
      microblaze: add show_stack_loglvl()
      mips: add show_stack_loglvl()
      nds32: add show_stack_loglvl()
      nios2: add show_stack_loglvl()
      openrisc: add show_stack_loglvl()
      parisc: add show_stack_loglvl()
      powerpc: add show_stack_loglvl()
      riscv: add show_stack_loglvl()
      s390: add show_stack_loglvl()
      sh: add loglvl to dump_mem()
      sh: remove needless printk()
      sh: add loglvl to printk_address()
      sh: add loglvl to show_trace()
      sh: add show_stack_loglvl()
      sparc: add show_stack_loglvl()
      um/sysrq: remove needless variable sp
      um: add show_stack_loglvl()
      unicore32: remove unused pmode argument in c_backtrace()
      unicore32: add loglvl to c_backtrace()
      unicore32: add show_stack_loglvl()
      x86: add missing const qualifiers for log_lvl
      x86: add show_stack_loglvl()
      xtensa: add loglvl to show_trace()
      xtensa: add show_stack_loglvl()
      sysrq: use show_stack_loglvl()
      x86/amd_gart: print stacktrace for a leak with KERN_ERR
      power: use show_stack_loglvl()
      kdb: don't play with console_loglevel
      sched: print stack trace with KERN_INFO
      kernel: use show_stack_loglvl()
      kernel: rename show_stack_loglvl() => show_stack()

Subsystem: mm/pagemap

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: consolidate definitions of page table accessors", v2:
      mm: don't include asm/pgtable.h if linux/mm.h is already included
      mm: introduce include/linux/pgtable.h
      mm: reorder includes after introduction of linux/pgtable.h
      csky: replace definitions of __pXd_offset() with pXd_index()
      m68k/mm/motorola: move comment about page table allocation funcitons
      m68k/mm: move {cache,nocahe}_page() definitions close to their user
      x86/mm: simplify init_trampoline() and surrounding logic
      mm: pgtable: add shortcuts for accessing kernel PMD and PTE
      mm: consolidate pte_index() and pte_offset_*() definitions

    Michel Lespinasse <walken@google.com>:
      mmap locking API: initial implementation as rwsem wrappers
      MMU notifier: use the new mmap locking API
      DMA reservations: use the new mmap locking API
      mmap locking API: use coccinelle to convert mmap_sem rwsem call sites
      mmap locking API: convert mmap_sem call sites missed by coccinelle
      mmap locking API: convert nested write lock sites
      mmap locking API: add mmap_read_trylock_non_owner()
      mmap locking API: add MMAP_LOCK_INITIALIZER
      mmap locking API: add mmap_assert_locked() and mmap_assert_write_locked()
      mmap locking API: rename mmap_sem to mmap_lock
      mmap locking API: convert mmap_sem API comments
      mmap locking API: convert mmap_sem comments

Subsystem: mm/maccess

    Christoph Hellwig <hch@lst.de>:
    Patch series "clean up and streamline probe_kernel_* and friends", v4:
      maccess: unexport probe_kernel_write()
      maccess: remove various unused weak aliases
      maccess: remove duplicate kerneldoc comments
      maccess: clarify kerneldoc comments
      maccess: update the top of file comment
      maccess: rename strncpy_from_unsafe_user to strncpy_from_user_nofault
      maccess: rename strncpy_from_unsafe_strict to strncpy_from_kernel_nofault
      maccess: rename strnlen_unsafe_user to strnlen_user_nofault
      maccess: remove probe_read_common and probe_write_common
      maccess: unify the probe kernel arch hooks
      bpf: factor out a bpf_trace_copy_string helper
      bpf: handle the compat string in bpf_trace_copy_string better

    Andrew Morton <akpm@linux-foundation.org>:
      bpf:bpf_seq_printf(): handle potentially unsafe format string better

    Christoph Hellwig <hch@lst.de>:
      bpf: rework the compat kernel probe handling
      tracing/kprobes: handle mixed kernel/userspace probes better
      maccess: remove strncpy_from_unsafe
      maccess: always use strict semantics for probe_kernel_read
      maccess: move user access routines together
      maccess: allow architectures to provide kernel probing directly
      x86: use non-set_fs based maccess routines
      maccess: return -ERANGE when probe_kernel_read() fails

Subsystem: mm/documentation

    Luis Chamberlain <mcgrof@kernel.org>:
      include/linux/cache.h: expand documentation over __read_mostly

 Documentation/admin-guide/mm/numa_memory_policy.rst   |   10 
 Documentation/admin-guide/mm/userfaultfd.rst          |    2 
 Documentation/filesystems/locking.rst                 |    2 
 Documentation/vm/hmm.rst                              |    6 
 Documentation/vm/transhuge.rst                        |    4 
 arch/alpha/boot/bootp.c                               |    1 
 arch/alpha/boot/bootpz.c                              |    1 
 arch/alpha/boot/main.c                                |    1 
 arch/alpha/include/asm/io.h                           |    1 
 arch/alpha/include/asm/pgtable.h                      |   16 
 arch/alpha/kernel/process.c                           |    1 
 arch/alpha/kernel/proto.h                             |    4 
 arch/alpha/kernel/ptrace.c                            |    1 
 arch/alpha/kernel/setup.c                             |    1 
 arch/alpha/kernel/smp.c                               |    1 
 arch/alpha/kernel/sys_alcor.c                         |    1 
 arch/alpha/kernel/sys_cabriolet.c                     |    1 
 arch/alpha/kernel/sys_dp264.c                         |    1 
 arch/alpha/kernel/sys_eb64p.c                         |    1 
 arch/alpha/kernel/sys_eiger.c                         |    1 
 arch/alpha/kernel/sys_jensen.c                        |    1 
 arch/alpha/kernel/sys_marvel.c                        |    1 
 arch/alpha/kernel/sys_miata.c                         |    1 
 arch/alpha/kernel/sys_mikasa.c                        |    1 
 arch/alpha/kernel/sys_nautilus.c                      |    1 
 arch/alpha/kernel/sys_noritake.c                      |    1 
 arch/alpha/kernel/sys_rawhide.c                       |    1 
 arch/alpha/kernel/sys_ruffian.c                       |    1 
 arch/alpha/kernel/sys_rx164.c                         |    1 
 arch/alpha/kernel/sys_sable.c                         |    1 
 arch/alpha/kernel/sys_sio.c                           |    1 
 arch/alpha/kernel/sys_sx164.c                         |    1 
 arch/alpha/kernel/sys_takara.c                        |    1 
 arch/alpha/kernel/sys_titan.c                         |    1 
 arch/alpha/kernel/sys_wildfire.c                      |    1 
 arch/alpha/kernel/traps.c                             |   40 
 arch/alpha/mm/fault.c                                 |   12 
 arch/alpha/mm/init.c                                  |    1 
 arch/arc/include/asm/bug.h                            |    3 
 arch/arc/include/asm/pgtable.h                        |   24 
 arch/arc/kernel/process.c                             |    4 
 arch/arc/kernel/stacktrace.c                          |   29 
 arch/arc/kernel/troubleshoot.c                        |    6 
 arch/arc/mm/fault.c                                   |    6 
 arch/arc/mm/highmem.c                                 |   14 
 arch/arc/mm/tlbex.S                                   |    4 
 arch/arm/include/asm/bug.h                            |    3 
 arch/arm/include/asm/efi.h                            |    3 
 arch/arm/include/asm/fixmap.h                         |    4 
 arch/arm/include/asm/idmap.h                          |    2 
 arch/arm/include/asm/pgtable-2level.h                 |    1 
 arch/arm/include/asm/pgtable-3level.h                 |    7 
 arch/arm/include/asm/pgtable-nommu.h                  |    3 
 arch/arm/include/asm/pgtable.h                        |   25 
 arch/arm/include/asm/traps.h                          |    3 
 arch/arm/include/asm/unwind.h                         |    3 
 arch/arm/kernel/head.S                                |    4 
 arch/arm/kernel/machine_kexec.c                       |    1 
 arch/arm/kernel/module.c                              |    1 
 arch/arm/kernel/process.c                             |    4 
 arch/arm/kernel/ptrace.c                              |    1 
 arch/arm/kernel/smp.c                                 |    1 
 arch/arm/kernel/suspend.c                             |    4 
 arch/arm/kernel/swp_emulate.c                         |    4 
 arch/arm/kernel/traps.c                               |   61 
 arch/arm/kernel/unwind.c                              |    7 
 arch/arm/kernel/vdso.c                                |    2 
 arch/arm/kernel/vmlinux.lds.S                         |    4 
 arch/arm/lib/backtrace-clang.S                        |    9 
 arch/arm/lib/backtrace.S                              |   14 
 arch/arm/lib/uaccess_with_memcpy.c                    |   16 
 arch/arm/mach-ebsa110/core.c                          |    1 
 arch/arm/mach-footbridge/common.c                     |    1 
 arch/arm/mach-imx/mm-imx21.c                          |    1 
 arch/arm/mach-imx/mm-imx27.c                          |    1 
 arch/arm/mach-imx/mm-imx3.c                           |    1 
 arch/arm/mach-integrator/core.c                       |    4 
 arch/arm/mach-iop32x/i2c.c                            |    1 
 arch/arm/mach-iop32x/iq31244.c                        |    1 
 arch/arm/mach-iop32x/iq80321.c                        |    1 
 arch/arm/mach-iop32x/n2100.c                          |    1 
 arch/arm/mach-ixp4xx/common.c                         |    1 
 arch/arm/mach-keystone/platsmp.c                      |    4 
 arch/arm/mach-sa1100/assabet.c                        |    3 
 arch/arm/mach-sa1100/hackkit.c                        |    4 
 arch/arm/mach-tegra/iomap.h                           |    2 
 arch/arm/mach-zynq/common.c                           |    4 
 arch/arm/mm/copypage-v4mc.c                           |    1 
 arch/arm/mm/copypage-v6.c                             |    1 
 arch/arm/mm/copypage-xscale.c                         |    1 
 arch/arm/mm/dump.c                                    |    1 
 arch/arm/mm/fault-armv.c                              |    1 
 arch/arm/mm/fault.c                                   |    9 
 arch/arm/mm/highmem.c                                 |    4 
 arch/arm/mm/idmap.c                                   |    4 
 arch/arm/mm/ioremap.c                                 |   31 
 arch/arm/mm/mm.h                                      |    8 
 arch/arm/mm/mmu.c                                     |    7 
 arch/arm/mm/pageattr.c                                |    1 
 arch/arm/mm/proc-arm1020.S                            |    4 
 arch/arm/mm/proc-arm1020e.S                           |    4 
 arch/arm/mm/proc-arm1022.S                            |    4 
 arch/arm/mm/proc-arm1026.S                            |    4 
 arch/arm/mm/proc-arm720.S                             |    4 
 arch/arm/mm/proc-arm740.S                             |    4 
 arch/arm/mm/proc-arm7tdmi.S                           |    4 
 arch/arm/mm/proc-arm920.S                             |    4 
 arch/arm/mm/proc-arm922.S                             |    4 
 arch/arm/mm/proc-arm925.S                             |    4 
 arch/arm/mm/proc-arm926.S                             |    4 
 arch/arm/mm/proc-arm940.S                             |    4 
 arch/arm/mm/proc-arm946.S                             |    4 
 arch/arm/mm/proc-arm9tdmi.S                           |    4 
 arch/arm/mm/proc-fa526.S                              |    4 
 arch/arm/mm/proc-feroceon.S                           |    4 
 arch/arm/mm/proc-mohawk.S                             |    4 
 arch/arm/mm/proc-sa110.S                              |    4 
 arch/arm/mm/proc-sa1100.S                             |    4 
 arch/arm/mm/proc-v6.S                                 |    4 
 arch/arm/mm/proc-v7.S                                 |    4 
 arch/arm/mm/proc-xsc3.S                               |    4 
 arch/arm/mm/proc-xscale.S                             |    4 
 arch/arm/mm/pv-fixup-asm.S                            |    4 
 arch/arm64/include/asm/io.h                           |    4 
 arch/arm64/include/asm/kernel-pgtable.h               |    2 
 arch/arm64/include/asm/kvm_mmu.h                      |    4 
 arch/arm64/include/asm/mmu_context.h                  |    4 
 arch/arm64/include/asm/pgtable.h                      |   40 
 arch/arm64/include/asm/stacktrace.h                   |    3 
 arch/arm64/include/asm/stage2_pgtable.h               |    2 
 arch/arm64/include/asm/vmap_stack.h                   |    4 
 arch/arm64/kernel/acpi.c                              |    4 
 arch/arm64/kernel/head.S                              |    4 
 arch/arm64/kernel/hibernate.c                         |    5 
 arch/arm64/kernel/kaslr.c                             |    4 
 arch/arm64/kernel/process.c                           |    2 
 arch/arm64/kernel/ptrace.c                            |    1 
 arch/arm64/kernel/smp.c                               |    1 
 arch/arm64/kernel/suspend.c                           |    4 
 arch/arm64/kernel/traps.c                             |   37 
 arch/arm64/kernel/vdso.c                              |    8 
 arch/arm64/kernel/vmlinux.lds.S                       |    3 
 arch/arm64/kvm/mmu.c                                  |   14 
 arch/arm64/mm/dump.c                                  |    1 
 arch/arm64/mm/fault.c                                 |    9 
 arch/arm64/mm/kasan_init.c                            |    3 
 arch/arm64/mm/mmu.c                                   |    8 
 arch/arm64/mm/pageattr.c                              |    1 
 arch/arm64/mm/proc.S                                  |    4 
 arch/c6x/include/asm/pgtable.h                        |    3 
 arch/c6x/kernel/traps.c                               |   28 
 arch/csky/include/asm/io.h                            |    2 
 arch/csky/include/asm/pgtable.h                       |   37 
 arch/csky/kernel/module.c                             |    1 
 arch/csky/kernel/ptrace.c                             |    5 
 arch/csky/kernel/stacktrace.c                         |   20 
 arch/csky/kernel/vdso.c                               |    4 
 arch/csky/mm/fault.c                                  |   10 
 arch/csky/mm/highmem.c                                |    2 
 arch/csky/mm/init.c                                   |    7 
 arch/csky/mm/tlb.c                                    |    1 
 arch/h8300/include/asm/pgtable.h                      |    1 
 arch/h8300/kernel/process.c                           |    1 
 arch/h8300/kernel/setup.c                             |    1 
 arch/h8300/kernel/signal.c                            |    1 
 arch/h8300/kernel/traps.c                             |   26 
 arch/h8300/mm/fault.c                                 |    1 
 arch/h8300/mm/init.c                                  |    1 
 arch/h8300/mm/memory.c                                |    1 
 arch/hexagon/include/asm/fixmap.h                     |    4 
 arch/hexagon/include/asm/pgtable.h                    |   55 
 arch/hexagon/kernel/traps.c                           |   39 
 arch/hexagon/kernel/vdso.c                            |    4 
 arch/hexagon/mm/uaccess.c                             |    2 
 arch/hexagon/mm/vm_fault.c                            |    9 
 arch/ia64/include/asm/pgtable.h                       |   34 
 arch/ia64/include/asm/ptrace.h                        |    1 
 arch/ia64/include/asm/uaccess.h                       |    2 
 arch/ia64/kernel/efi.c                                |    1 
 arch/ia64/kernel/entry.S                              |    4 
 arch/ia64/kernel/head.S                               |    5 
 arch/ia64/kernel/irq_ia64.c                           |    4 
 arch/ia64/kernel/ivt.S                                |    4 
 arch/ia64/kernel/kprobes.c                            |    4 
 arch/ia64/kernel/mca.c                                |    2 
 arch/ia64/kernel/mca_asm.S                            |    4 
 arch/ia64/kernel/perfmon.c                            |    8 
 arch/ia64/kernel/process.c                            |   37 
 arch/ia64/kernel/ptrace.c                             |    1 
 arch/ia64/kernel/relocate_kernel.S                    |    6 
 arch/ia64/kernel/setup.c                              |    4 
 arch/ia64/kernel/smp.c                                |    1 
 arch/ia64/kernel/smpboot.c                            |    1 
 arch/ia64/kernel/uncached.c                           |    4 
 arch/ia64/kernel/vmlinux.lds.S                        |    4 
 arch/ia64/mm/contig.c                                 |    1 
 arch/ia64/mm/fault.c                                  |   17 
 arch/ia64/mm/init.c                                   |   12 
 arch/m68k/68000/m68EZ328.c                            |    2 
 arch/m68k/68000/m68VZ328.c                            |    4 
 arch/m68k/68000/timers.c                              |    1 
 arch/m68k/amiga/config.c                              |    1 
 arch/m68k/apollo/config.c                             |    1 
 arch/m68k/atari/atasound.c                            |    1 
 arch/m68k/atari/stram.c                               |    1 
 arch/m68k/bvme6000/config.c                           |    1 
 arch/m68k/include/asm/mcf_pgtable.h                   |   63 
 arch/m68k/include/asm/motorola_pgalloc.h              |    8 
 arch/m68k/include/asm/motorola_pgtable.h              |   84 -
 arch/m68k/include/asm/pgtable_mm.h                    |    1 
 arch/m68k/include/asm/pgtable_no.h                    |    2 
 arch/m68k/include/asm/sun3_pgtable.h                  |   24 
 arch/m68k/include/asm/sun3xflop.h                     |    4 
 arch/m68k/kernel/head.S                               |    4 
 arch/m68k/kernel/process.c                            |    1 
 arch/m68k/kernel/ptrace.c                             |    1 
 arch/m68k/kernel/setup_no.c                           |    1 
 arch/m68k/kernel/signal.c                             |    1 
 arch/m68k/kernel/sys_m68k.c                           |   14 
 arch/m68k/kernel/traps.c                              |   27 
 arch/m68k/kernel/uboot.c                              |    1 
 arch/m68k/mac/config.c                                |    1 
 arch/m68k/mm/fault.c                                  |   10 
 arch/m68k/mm/init.c                                   |    2 
 arch/m68k/mm/mcfmmu.c                                 |    1 
 arch/m68k/mm/motorola.c                               |   65 
 arch/m68k/mm/sun3kmap.c                               |    1 
 arch/m68k/mm/sun3mmu.c                                |    1 
 arch/m68k/mvme147/config.c                            |    1 
 arch/m68k/mvme16x/config.c                            |    1 
 arch/m68k/q40/config.c                                |    1 
 arch/m68k/sun3/config.c                               |    1 
 arch/m68k/sun3/dvma.c                                 |    1 
 arch/m68k/sun3/mmu_emu.c                              |    1 
 arch/m68k/sun3/sun3dvma.c                             |    1 
 arch/m68k/sun3x/dvma.c                                |    1 
 arch/m68k/sun3x/prom.c                                |    1 
 arch/microblaze/include/asm/pgalloc.h                 |    4 
 arch/microblaze/include/asm/pgtable.h                 |   23 
 arch/microblaze/include/asm/uaccess.h                 |    2 
 arch/microblaze/include/asm/unwind.h                  |    3 
 arch/microblaze/kernel/hw_exception_handler.S         |    4 
 arch/microblaze/kernel/module.c                       |    4 
 arch/microblaze/kernel/setup.c                        |    4 
 arch/microblaze/kernel/signal.c                       |    9 
 arch/microblaze/kernel/stacktrace.c                   |    4 
 arch/microblaze/kernel/traps.c                        |   28 
 arch/microblaze/kernel/unwind.c                       |   46 
 arch/microblaze/mm/fault.c                            |   17 
 arch/microblaze/mm/init.c                             |    9 
 arch/microblaze/mm/pgtable.c                          |    4 
 arch/mips/fw/arc/memory.c                             |    1 
 arch/mips/include/asm/fixmap.h                        |    3 
 arch/mips/include/asm/mach-generic/floppy.h           |    1 
 arch/mips/include/asm/mach-jazz/floppy.h              |    1 
 arch/mips/include/asm/pgtable-32.h                    |   22 
 arch/mips/include/asm/pgtable-64.h                    |   32 
 arch/mips/include/asm/pgtable.h                       |    2 
 arch/mips/jazz/irq.c                                  |    4 
 arch/mips/jazz/jazzdma.c                              |    1 
 arch/mips/jazz/setup.c                                |    4 
 arch/mips/kernel/module.c                             |    1 
 arch/mips/kernel/process.c                            |    1 
 arch/mips/kernel/ptrace.c                             |    1 
 arch/mips/kernel/ptrace32.c                           |    1 
 arch/mips/kernel/smp-bmips.c                          |    1 
 arch/mips/kernel/traps.c                              |   58 
 arch/mips/kernel/vdso.c                               |    4 
 arch/mips/kvm/mips.c                                  |    4 
 arch/mips/kvm/mmu.c                                   |   20 
 arch/mips/kvm/tlb.c                                   |    1 
 arch/mips/kvm/trap_emul.c                             |    2 
 arch/mips/lib/dump_tlb.c                              |    1 
 arch/mips/lib/r3k_dump_tlb.c                          |    1 
 arch/mips/mm/c-octeon.c                               |    1 
 arch/mips/mm/c-r3k.c                                  |   11 
 arch/mips/mm/c-r4k.c                                  |   11 
 arch/mips/mm/c-tx39.c                                 |   11 
 arch/mips/mm/fault.c                                  |   12 
 arch/mips/mm/highmem.c                                |    2 
 arch/mips/mm/init.c                                   |    1 
 arch/mips/mm/page.c                                   |    1 
 arch/mips/mm/pgtable-32.c                             |    1 
 arch/mips/mm/pgtable-64.c                             |    1 
 arch/mips/mm/sc-ip22.c                                |    1 
 arch/mips/mm/sc-mips.c                                |    1 
 arch/mips/mm/sc-r5k.c                                 |    1 
 arch/mips/mm/tlb-r3k.c                                |    1 
 arch/mips/mm/tlb-r4k.c                                |    1 
 arch/mips/mm/tlbex.c                                  |    4 
 arch/mips/sgi-ip27/ip27-init.c                        |    1 
 arch/mips/sgi-ip27/ip27-timer.c                       |    1 
 arch/mips/sgi-ip32/ip32-memory.c                      |    1 
 arch/nds32/include/asm/highmem.h                      |    3 
 arch/nds32/include/asm/pgtable.h                      |   22 
 arch/nds32/kernel/head.S                              |    4 
 arch/nds32/kernel/module.c                            |    2 
 arch/nds32/kernel/traps.c                             |   33 
 arch/nds32/kernel/vdso.c                              |    6 
 arch/nds32/mm/fault.c                                 |   17 
 arch/nds32/mm/init.c                                  |   13 
 arch/nds32/mm/proc.c                                  |    7 
 arch/nios2/include/asm/pgtable.h                      |   24 
 arch/nios2/kernel/module.c                            |    1 
 arch/nios2/kernel/nios2_ksyms.c                       |    4 
 arch/nios2/kernel/traps.c                             |   35 
 arch/nios2/mm/fault.c                                 |   14 
 arch/nios2/mm/init.c                                  |    5 
 arch/nios2/mm/pgtable.c                               |    1 
 arch/nios2/mm/tlb.c                                   |    1 
 arch/openrisc/include/asm/io.h                        |    3 
 arch/openrisc/include/asm/pgtable.h                   |   33 
 arch/openrisc/include/asm/tlbflush.h                  |    1 
 arch/openrisc/kernel/asm-offsets.c                    |    1 
 arch/openrisc/kernel/entry.S                          |    4 
 arch/openrisc/kernel/head.S                           |    4 
 arch/openrisc/kernel/or32_ksyms.c                     |    4 
 arch/openrisc/kernel/process.c                        |    1 
 arch/openrisc/kernel/ptrace.c                         |    1 
 arch/openrisc/kernel/setup.c                          |    1 
 arch/openrisc/kernel/traps.c                          |   27 
 arch/openrisc/mm/fault.c                              |   12 
 arch/openrisc/mm/init.c                               |    1 
 arch/openrisc/mm/ioremap.c                            |    4 
 arch/openrisc/mm/tlb.c                                |    1 
 arch/parisc/include/asm/io.h                          |    2 
 arch/parisc/include/asm/mmu_context.h                 |    1 
 arch/parisc/include/asm/pgtable.h                     |   33 
 arch/parisc/kernel/asm-offsets.c                      |    4 
 arch/parisc/kernel/entry.S                            |    4 
 arch/parisc/kernel/head.S                             |    4 
 arch/parisc/kernel/module.c                           |    1 
 arch/parisc/kernel/pacache.S                          |    4 
 arch/parisc/kernel/pci-dma.c                          |    2 
 arch/parisc/kernel/pdt.c                              |    4 
 arch/parisc/kernel/ptrace.c                           |    1 
 arch/parisc/kernel/smp.c                              |    1 
 arch/parisc/kernel/traps.c                            |   42 
 arch/parisc/lib/memcpy.c                              |   14 
 arch/parisc/mm/fault.c                                |   10 
 arch/parisc/mm/fixmap.c                               |    6 
 arch/parisc/mm/init.c                                 |    1 
 arch/powerpc/include/asm/book3s/32/pgtable.h          |   20 
 arch/powerpc/include/asm/book3s/64/pgtable.h          |   43 
 arch/powerpc/include/asm/fixmap.h                     |    4 
 arch/powerpc/include/asm/io.h                         |    1 
 arch/powerpc/include/asm/kup.h                        |    2 
 arch/powerpc/include/asm/nohash/32/pgtable.h          |   17 
 arch/powerpc/include/asm/nohash/64/pgtable-4k.h       |    4 
 arch/powerpc/include/asm/nohash/64/pgtable.h          |   22 
 arch/powerpc/include/asm/nohash/pgtable.h             |    2 
 arch/powerpc/include/asm/pgtable.h                    |   28 
 arch/powerpc/include/asm/pkeys.h                      |    2 
 arch/powerpc/include/asm/tlb.h                        |    2 
 arch/powerpc/kernel/asm-offsets.c                     |    1 
 arch/powerpc/kernel/btext.c                           |    4 
 arch/powerpc/kernel/fpu.S                             |    3 
 arch/powerpc/kernel/head_32.S                         |    4 
 arch/powerpc/kernel/head_40x.S                        |    4 
 arch/powerpc/kernel/head_44x.S                        |    4 
 arch/powerpc/kernel/head_8xx.S                        |    4 
 arch/powerpc/kernel/head_fsl_booke.S                  |    4 
 arch/powerpc/kernel/io-workarounds.c                  |    4 
 arch/powerpc/kernel/irq.c                             |    4 
 arch/powerpc/kernel/mce_power.c                       |    4 
 arch/powerpc/kernel/paca.c                            |    4 
 arch/powerpc/kernel/process.c                         |   30 
 arch/powerpc/kernel/prom.c                            |    4 
 arch/powerpc/kernel/prom_init.c                       |    4 
 arch/powerpc/kernel/rtas_pci.c                        |    4 
 arch/powerpc/kernel/setup-common.c                    |    4 
 arch/powerpc/kernel/setup_32.c                        |    4 
 arch/powerpc/kernel/setup_64.c                        |    4 
 arch/powerpc/kernel/signal_32.c                       |    1 
 arch/powerpc/kernel/signal_64.c                       |    1 
 arch/powerpc/kernel/smp.c                             |    4 
 arch/powerpc/kernel/stacktrace.c                      |    2 
 arch/powerpc/kernel/traps.c                           |    1 
 arch/powerpc/kernel/vdso.c                            |    7 
 arch/powerpc/kvm/book3s_64_mmu_radix.c                |    4 
 arch/powerpc/kvm/book3s_hv.c                          |    6 
 arch/powerpc/kvm/book3s_hv_nested.c                   |    4 
 arch/powerpc/kvm/book3s_hv_rm_xics.c                  |    4 
 arch/powerpc/kvm/book3s_hv_rm_xive.c                  |    4 
 arch/powerpc/kvm/book3s_hv_uvmem.c                    |   18 
 arch/powerpc/kvm/e500_mmu_host.c                      |    4 
 arch/powerpc/kvm/fpu.S                                |    4 
 arch/powerpc/lib/code-patching.c                      |    1 
 arch/powerpc/mm/book3s32/hash_low.S                   |    4 
 arch/powerpc/mm/book3s32/mmu.c                        |    2 
 arch/powerpc/mm/book3s32/tlb.c                        |    6 
 arch/powerpc/mm/book3s64/hash_hugetlbpage.c           |    1 
 arch/powerpc/mm/book3s64/hash_native.c                |    4 
 arch/powerpc/mm/book3s64/hash_pgtable.c               |    5 
 arch/powerpc/mm/book3s64/hash_utils.c                 |    4 
 arch/powerpc/mm/book3s64/iommu_api.c                  |    4 
 arch/powerpc/mm/book3s64/radix_hugetlbpage.c          |    1 
 arch/powerpc/mm/book3s64/radix_pgtable.c              |    1 
 arch/powerpc/mm/book3s64/slb.c                        |    4 
 arch/powerpc/mm/book3s64/subpage_prot.c               |   16 
 arch/powerpc/mm/copro_fault.c                         |    4 
 arch/powerpc/mm/fault.c                               |   23 
 arch/powerpc/mm/hugetlbpage.c                         |    1 
 arch/powerpc/mm/init-common.c                         |    4 
 arch/powerpc/mm/init_32.c                             |    1 
 arch/powerpc/mm/init_64.c                             |    1 
 arch/powerpc/mm/kasan/8xx.c                           |    4 
 arch/powerpc/mm/kasan/book3s_32.c                     |    2 
 arch/powerpc/mm/kasan/kasan_init_32.c                 |    8 
 arch/powerpc/mm/mem.c                                 |    1 
 arch/powerpc/mm/nohash/40x.c                          |    5 
 arch/powerpc/mm/nohash/8xx.c                          |    2 
 arch/powerpc/mm/nohash/fsl_booke.c                    |    1 
 arch/powerpc/mm/nohash/tlb_low_64e.S                  |    4 
 arch/powerpc/mm/pgtable.c                             |    2 
 arch/powerpc/mm/pgtable_32.c                          |    5 
 arch/powerpc/mm/pgtable_64.c                          |    1 
 arch/powerpc/mm/ptdump/8xx.c                          |    2 
 arch/powerpc/mm/ptdump/bats.c                         |    4 
 arch/powerpc/mm/ptdump/book3s64.c                     |    2 
 arch/powerpc/mm/ptdump/hashpagetable.c                |    1 
 arch/powerpc/mm/ptdump/ptdump.c                       |    1 
 arch/powerpc/mm/ptdump/shared.c                       |    2 
 arch/powerpc/oprofile/cell/spu_task_sync.c            |    6 
 arch/powerpc/perf/callchain.c                         |    1 
 arch/powerpc/perf/callchain_32.c                      |    1 
 arch/powerpc/perf/callchain_64.c                      |    1 
 arch/powerpc/platforms/85xx/corenet_generic.c         |    4 
 arch/powerpc/platforms/85xx/mpc85xx_cds.c             |    4 
 arch/powerpc/platforms/85xx/qemu_e500.c               |    4 
 arch/powerpc/platforms/85xx/sbc8548.c                 |    4 
 arch/powerpc/platforms/85xx/smp.c                     |    4 
 arch/powerpc/platforms/86xx/mpc86xx_smp.c             |    4 
 arch/powerpc/platforms/8xx/cpm1.c                     |    1 
 arch/powerpc/platforms/8xx/micropatch.c               |    1 
 arch/powerpc/platforms/cell/cbe_regs.c                |    4 
 arch/powerpc/platforms/cell/interrupt.c               |    4 
 arch/powerpc/platforms/cell/pervasive.c               |    4 
 arch/powerpc/platforms/cell/setup.c                   |    1 
 arch/powerpc/platforms/cell/smp.c                     |    4 
 arch/powerpc/platforms/cell/spider-pic.c              |    4 
 arch/powerpc/platforms/cell/spufs/file.c              |   10 
 arch/powerpc/platforms/chrp/pci.c                     |    4 
 arch/powerpc/platforms/chrp/setup.c                   |    1 
 arch/powerpc/platforms/chrp/smp.c                     |    4 
 arch/powerpc/platforms/maple/setup.c                  |    1 
 arch/powerpc/platforms/maple/time.c                   |    1 
 arch/powerpc/platforms/powermac/setup.c               |    1 
 arch/powerpc/platforms/powermac/smp.c                 |    4 
 arch/powerpc/platforms/powermac/time.c                |    1 
 arch/powerpc/platforms/pseries/lpar.c                 |    4 
 arch/powerpc/platforms/pseries/setup.c                |    1 
 arch/powerpc/platforms/pseries/smp.c                  |    4 
 arch/powerpc/sysdev/cpm2.c                            |    1 
 arch/powerpc/sysdev/fsl_85xx_cache_sram.c             |    2 
 arch/powerpc/sysdev/mpic.c                            |    4 
 arch/powerpc/xmon/xmon.c                              |    1 
 arch/riscv/include/asm/fixmap.h                       |    4 
 arch/riscv/include/asm/io.h                           |    4 
 arch/riscv/include/asm/kasan.h                        |    4 
 arch/riscv/include/asm/pgtable-64.h                   |    7 
 arch/riscv/include/asm/pgtable.h                      |   22 
 arch/riscv/kernel/module.c                            |    2 
 arch/riscv/kernel/setup.c                             |    1 
 arch/riscv/kernel/soc.c                               |    2 
 arch/riscv/kernel/stacktrace.c                        |   23 
 arch/riscv/kernel/vdso.c                              |    4 
 arch/riscv/mm/cacheflush.c                            |    3 
 arch/riscv/mm/fault.c                                 |   14 
 arch/riscv/mm/init.c                                  |   31 
 arch/riscv/mm/kasan_init.c                            |    4 
 arch/riscv/mm/pageattr.c                              |    6 
 arch/riscv/mm/ptdump.c                                |    2 
 arch/s390/boot/ipl_parm.c                             |    4 
 arch/s390/boot/kaslr.c                                |    4 
 arch/s390/include/asm/hugetlb.h                       |    4 
 arch/s390/include/asm/kasan.h                         |    4 
 arch/s390/include/asm/pgtable.h                       |   15 
 arch/s390/include/asm/tlbflush.h                      |    1 
 arch/s390/kernel/asm-offsets.c                        |    4 
 arch/s390/kernel/dumpstack.c                          |   25 
 arch/s390/kernel/machine_kexec.c                      |    1 
 arch/s390/kernel/ptrace.c                             |    1 
 arch/s390/kernel/uv.c                                 |    4 
 arch/s390/kernel/vdso.c                               |    5 
 arch/s390/kvm/gaccess.c                               |    8 
 arch/s390/kvm/interrupt.c                             |    4 
 arch/s390/kvm/kvm-s390.c                              |   32 
 arch/s390/kvm/priv.c                                  |   38 
 arch/s390/mm/dump_pagetables.c                        |    1 
 arch/s390/mm/extmem.c                                 |    4 
 arch/s390/mm/fault.c                                  |   17 
 arch/s390/mm/gmap.c                                   |   80 
 arch/s390/mm/init.c                                   |    1 
 arch/s390/mm/kasan_init.c                             |    4 
 arch/s390/mm/pageattr.c                               |   13 
 arch/s390/mm/pgalloc.c                                |    2 
 arch/s390/mm/pgtable.c                                |    1 
 arch/s390/mm/vmem.c                                   |    1 
 arch/s390/pci/pci_mmio.c                              |    4 
 arch/sh/include/asm/io.h                              |    2 
 arch/sh/include/asm/kdebug.h                          |    6 
 arch/sh/include/asm/pgtable-3level.h                  |    7 
 arch/sh/include/asm/pgtable.h                         |    2 
 arch/sh/include/asm/pgtable_32.h                      |   25 
 arch/sh/include/asm/processor_32.h                    |    2 
 arch/sh/kernel/dumpstack.c                            |   54 
 arch/sh/kernel/machine_kexec.c                        |    1 
 arch/sh/kernel/process_32.c                           |    2 
 arch/sh/kernel/ptrace_32.c                            |    1 
 arch/sh/kernel/signal_32.c                            |    1 
 arch/sh/kernel/sys_sh.c                               |    6 
 arch/sh/kernel/traps.c                                |    4 
 arch/sh/kernel/vsyscall/vsyscall.c                    |    4 
 arch/sh/mm/cache-sh3.c                                |    1 
 arch/sh/mm/cache-sh4.c                                |   11 
 arch/sh/mm/cache-sh7705.c                             |    1 
 arch/sh/mm/fault.c                                    |   16 
 arch/sh/mm/kmap.c                                     |    5 
 arch/sh/mm/nommu.c                                    |    1 
 arch/sh/mm/pmb.c                                      |    4 
 arch/sparc/include/asm/floppy_32.h                    |    4 
 arch/sparc/include/asm/highmem.h                      |    4 
 arch/sparc/include/asm/ide.h                          |    2 
 arch/sparc/include/asm/io-unit.h                      |    4 
 arch/sparc/include/asm/pgalloc_32.h                   |    4 
 arch/sparc/include/asm/pgalloc_64.h                   |    2 
 arch/sparc/include/asm/pgtable_32.h                   |   34 
 arch/sparc/include/asm/pgtable_64.h                   |   32 
 arch/sparc/kernel/cpu.c                               |    4 
 arch/sparc/kernel/entry.S                             |    4 
 arch/sparc/kernel/head_64.S                           |    4 
 arch/sparc/kernel/ktlb.S                              |    4 
 arch/sparc/kernel/leon_smp.c                          |    1 
 arch/sparc/kernel/pci.c                               |    4 
 arch/sparc/kernel/process_32.c                        |   29 
 arch/sparc/kernel/process_64.c                        |    3 
 arch/sparc/kernel/ptrace_32.c                         |    1 
 arch/sparc/kernel/ptrace_64.c                         |    1 
 arch/sparc/kernel/setup_32.c                          |    1 
 arch/sparc/kernel/setup_64.c                          |    1 
 arch/sparc/kernel/signal32.c                          |    1 
 arch/sparc/kernel/signal_32.c                         |    1 
 arch/sparc/kernel/signal_64.c                         |    1 
 arch/sparc/kernel/smp_32.c                            |    1 
 arch/sparc/kernel/smp_64.c                            |    1 
 arch/sparc/kernel/sun4m_irq.c                         |    4 
 arch/sparc/kernel/trampoline_64.S                     |    4 
 arch/sparc/kernel/traps_32.c                          |    4 
 arch/sparc/kernel/traps_64.c                          |   24 
 arch/sparc/lib/clear_page.S                           |    4 
 arch/sparc/lib/copy_page.S                            |    2 
 arch/sparc/mm/fault_32.c                              |   21 
 arch/sparc/mm/fault_64.c                              |   17 
 arch/sparc/mm/highmem.c                               |   12 
 arch/sparc/mm/hugetlbpage.c                           |    1 
 arch/sparc/mm/init_32.c                               |    1 
 arch/sparc/mm/init_64.c                               |    7 
 arch/sparc/mm/io-unit.c                               |   11 
 arch/sparc/mm/iommu.c                                 |    9 
 arch/sparc/mm/tlb.c                                   |    1 
 arch/sparc/mm/tsb.c                                   |    4 
 arch/sparc/mm/ultra.S                                 |    4 
 arch/sparc/vdso/vma.c                                 |    4 
 arch/um/drivers/mconsole_kern.c                       |    2 
 arch/um/include/asm/mmu_context.h                     |    5 
 arch/um/include/asm/pgtable-3level.h                  |    4 
 arch/um/include/asm/pgtable.h                         |   69 
 arch/um/kernel/maccess.c                              |   12 
 arch/um/kernel/mem.c                                  |   10 
 arch/um/kernel/process.c                              |    1 
 arch/um/kernel/skas/mmu.c                             |    3 
 arch/um/kernel/skas/uaccess.c                         |    1 
 arch/um/kernel/sysrq.c                                |   35 
 arch/um/kernel/tlb.c                                  |    5 
 arch/um/kernel/trap.c                                 |   15 
 arch/um/kernel/um_arch.c                              |    1 
 arch/unicore32/include/asm/pgtable.h                  |   19 
 arch/unicore32/kernel/hibernate.c                     |    4 
 arch/unicore32/kernel/hibernate_asm.S                 |    4 
 arch/unicore32/kernel/module.c                        |    1 
 arch/unicore32/kernel/setup.h                         |    4 
 arch/unicore32/kernel/traps.c                         |   50 
 arch/unicore32/lib/backtrace.S                        |   24 
 arch/unicore32/mm/alignment.c                         |    4 
 arch/unicore32/mm/fault.c                             |    9 
 arch/unicore32/mm/mm.h                                |   10 
 arch/unicore32/mm/proc-ucv2.S                         |    4 
 arch/x86/boot/compressed/kaslr_64.c                   |    4 
 arch/x86/entry/vdso/vma.c                             |   14 
 arch/x86/events/core.c                                |    4 
 arch/x86/include/asm/agp.h                            |    2 
 arch/x86/include/asm/asm-prototypes.h                 |    4 
 arch/x86/include/asm/efi.h                            |    4 
 arch/x86/include/asm/iomap.h                          |    1 
 arch/x86/include/asm/kaslr.h                          |    2 
 arch/x86/include/asm/mmu.h                            |    2 
 arch/x86/include/asm/pgtable-3level.h                 |    8 
 arch/x86/include/asm/pgtable.h                        |   89 -
 arch/x86/include/asm/pgtable_32.h                     |   11 
 arch/x86/include/asm/pgtable_64.h                     |    4 
 arch/x86/include/asm/setup.h                          |   12 
 arch/x86/include/asm/stacktrace.h                     |    2 
 arch/x86/include/asm/uaccess.h                        |   16 
 arch/x86/include/asm/xen/hypercall.h                  |    4 
 arch/x86/include/asm/xen/page.h                       |    1 
 arch/x86/kernel/acpi/boot.c                           |    4 
 arch/x86/kernel/acpi/sleep.c                          |    4 
 arch/x86/kernel/alternative.c                         |    1 
 arch/x86/kernel/amd_gart_64.c                         |    5 
 arch/x86/kernel/apic/apic_numachip.c                  |    4 
 arch/x86/kernel/cpu/bugs.c                            |    4 
 arch/x86/kernel/cpu/common.c                          |    4 
 arch/x86/kernel/cpu/intel.c                           |    4 
 arch/x86/kernel/cpu/resctrl/pseudo_lock.c             |    6 
 arch/x86/kernel/cpu/resctrl/rdtgroup.c                |    6 
 arch/x86/kernel/crash_core_32.c                       |    4 
 arch/x86/kernel/crash_core_64.c                       |    4 
 arch/x86/kernel/doublefault_32.c                      |    1 
 arch/x86/kernel/dumpstack.c                           |   21 
 arch/x86/kernel/early_printk.c                        |    4 
 arch/x86/kernel/espfix_64.c                           |    2 
 arch/x86/kernel/head64.c                              |    4 
 arch/x86/kernel/head_64.S                             |    4 
 arch/x86/kernel/i8259.c                               |    4 
 arch/x86/kernel/irqinit.c                             |    4 
 arch/x86/kernel/kprobes/core.c                        |    4 
 arch/x86/kernel/kprobes/opt.c                         |    4 
 arch/x86/kernel/ldt.c                                 |    2 
 arch/x86/kernel/machine_kexec_32.c                    |    1 
 arch/x86/kernel/machine_kexec_64.c                    |    1 
 arch/x86/kernel/module.c                              |    1 
 arch/x86/kernel/paravirt.c                            |    4 
 arch/x86/kernel/process_32.c                          |    1 
 arch/x86/kernel/process_64.c                          |    1 
 arch/x86/kernel/ptrace.c                              |    1 
 arch/x86/kernel/reboot.c                              |    4 
 arch/x86/kernel/smpboot.c                             |    4 
 arch/x86/kernel/tboot.c                               |    3 
 arch/x86/kernel/vm86_32.c                             |    4 
 arch/x86/kvm/mmu/paging_tmpl.h                        |    8 
 arch/x86/mm/cpu_entry_area.c                          |    4 
 arch/x86/mm/debug_pagetables.c                        |    2 
 arch/x86/mm/dump_pagetables.c                         |    1 
 arch/x86/mm/fault.c                                   |   22 
 arch/x86/mm/init.c                                    |   22 
 arch/x86/mm/init_32.c                                 |   27 
 arch/x86/mm/init_64.c                                 |    1 
 arch/x86/mm/ioremap.c                                 |    4 
 arch/x86/mm/kasan_init_64.c                           |    1 
 arch/x86/mm/kaslr.c                                   |   37 
 arch/x86/mm/maccess.c                                 |   44 
 arch/x86/mm/mem_encrypt_boot.S                        |    2 
 arch/x86/mm/mmio-mod.c                                |    4 
 arch/x86/mm/pat/cpa-test.c                            |    1 
 arch/x86/mm/pat/memtype.c                             |    1 
 arch/x86/mm/pat/memtype_interval.c                    |    4 
 arch/x86/mm/pgtable.c                                 |    1 
 arch/x86/mm/pgtable_32.c                              |    1 
 arch/x86/mm/pti.c                                     |    1 
 arch/x86/mm/setup_nx.c                                |    4 
 arch/x86/platform/efi/efi_32.c                        |    4 
 arch/x86/platform/efi/efi_64.c                        |    1 
 arch/x86/platform/olpc/olpc_ofw.c                     |    4 
 arch/x86/power/cpu.c                                  |    4 
 arch/x86/power/hibernate.c                            |    4 
 arch/x86/power/hibernate_32.c                         |    4 
 arch/x86/power/hibernate_64.c                         |    4 
 arch/x86/realmode/init.c                              |    4 
 arch/x86/um/vdso/vma.c                                |    4 
 arch/x86/xen/enlighten_pv.c                           |    1 
 arch/x86/xen/grant-table.c                            |    1 
 arch/x86/xen/mmu_pv.c                                 |    4 
 arch/x86/xen/smp_pv.c                                 |    2 
 arch/xtensa/include/asm/fixmap.h                      |   12 
 arch/xtensa/include/asm/highmem.h                     |    4 
 arch/xtensa/include/asm/initialize_mmu.h              |    2 
 arch/xtensa/include/asm/mmu_context.h                 |    4 
 arch/xtensa/include/asm/pgtable.h                     |   20 
 arch/xtensa/kernel/entry.S                            |    4 
 arch/xtensa/kernel/process.c                          |    1 
 arch/xtensa/kernel/ptrace.c                           |    1 
 arch/xtensa/kernel/setup.c                            |    1 
 arch/xtensa/kernel/traps.c                            |   42 
 arch/xtensa/kernel/vectors.S                          |    4 
 arch/xtensa/mm/cache.c                                |    4 
 arch/xtensa/mm/fault.c                                |   12 
 arch/xtensa/mm/highmem.c                              |    2 
 arch/xtensa/mm/ioremap.c                              |    4 
 arch/xtensa/mm/kasan_init.c                           |   10 
 arch/xtensa/mm/misc.S                                 |    4 
 arch/xtensa/mm/mmu.c                                  |    5 
 drivers/acpi/scan.c                                   |    3 
 drivers/android/binder_alloc.c                        |   14 
 drivers/atm/fore200e.c                                |    4 
 drivers/base/power/main.c                             |    4 
 drivers/block/z2ram.c                                 |    4 
 drivers/char/agp/frontend.c                           |    1 
 drivers/char/agp/generic.c                            |    1 
 drivers/char/bsr.c                                    |    1 
 drivers/char/mspec.c                                  |    3 
 drivers/dma-buf/dma-resv.c                            |    5 
 drivers/firmware/efi/arm-runtime.c                    |    4 
 drivers/firmware/efi/efi.c                            |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h            |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c     |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c     |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gpuvm.c      |    4 
 drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c               |   10 
 drivers/gpu/drm/amd/amdkfd/kfd_events.c               |    4 
 drivers/gpu/drm/drm_vm.c                              |    4 
 drivers/gpu/drm/etnaviv/etnaviv_gem.c                 |    2 
 drivers/gpu/drm/i915/gem/i915_gem_mman.c              |    4 
 drivers/gpu/drm/i915/gem/i915_gem_userptr.c           |   14 
 drivers/gpu/drm/i915/i915_mm.c                        |    1 
 drivers/gpu/drm/i915/i915_perf.c                      |    2 
 drivers/gpu/drm/nouveau/nouveau_svm.c                 |   22 
 drivers/gpu/drm/radeon/radeon_cs.c                    |    4 
 drivers/gpu/drm/radeon/radeon_gem.c                   |    6 
 drivers/gpu/drm/ttm/ttm_bo_vm.c                       |   10 
 drivers/infiniband/core/umem_odp.c                    |    4 
 drivers/infiniband/core/uverbs_main.c                 |    6 
 drivers/infiniband/hw/hfi1/mmu_rb.c                   |    2 
 drivers/infiniband/hw/mlx4/mr.c                       |    4 
 drivers/infiniband/hw/qib/qib_file_ops.c              |    4 
 drivers/infiniband/hw/qib/qib_user_pages.c            |    6 
 drivers/infiniband/hw/usnic/usnic_uiom.c              |    4 
 drivers/infiniband/sw/rdmavt/mmap.c                   |    1 
 drivers/infiniband/sw/rxe/rxe_mmap.c                  |    1 
 drivers/infiniband/sw/siw/siw_mem.c                   |    4 
 drivers/iommu/amd_iommu_v2.c                          |    4 
 drivers/iommu/intel-svm.c                             |    4 
 drivers/macintosh/macio-adb.c                         |    4 
 drivers/macintosh/mediabay.c                          |    4 
 drivers/macintosh/via-pmu.c                           |    4 
 drivers/media/pci/bt8xx/bt878.c                       |    4 
 drivers/media/pci/bt8xx/btcx-risc.c                   |    4 
 drivers/media/pci/bt8xx/bttv-risc.c                   |    4 
 drivers/media/platform/davinci/vpbe_display.c         |    1 
 drivers/media/v4l2-core/v4l2-common.c                 |    1 
 drivers/media/v4l2-core/videobuf-core.c               |    4 
 drivers/media/v4l2-core/videobuf-dma-contig.c         |    4 
 drivers/media/v4l2-core/videobuf-dma-sg.c             |   10 
 drivers/media/v4l2-core/videobuf-vmalloc.c            |    4 
 drivers/misc/cxl/cxllib.c                             |    9 
 drivers/misc/cxl/fault.c                              |    4 
 drivers/misc/genwqe/card_utils.c                      |    2 
 drivers/misc/sgi-gru/grufault.c                       |   25 
 drivers/misc/sgi-gru/grufile.c                        |    4 
 drivers/mtd/ubi/ubi.h                                 |    2 
 drivers/net/ethernet/amd/7990.c                       |    4 
 drivers/net/ethernet/amd/hplance.c                    |    4 
 drivers/net/ethernet/amd/mvme147.c                    |    4 
 drivers/net/ethernet/amd/sun3lance.c                  |    4 
 drivers/net/ethernet/amd/sunlance.c                   |    4 
 drivers/net/ethernet/apple/bmac.c                     |    4 
 drivers/net/ethernet/apple/mace.c                     |    4 
 drivers/net/ethernet/freescale/fs_enet/fs_enet-main.c |    4 
 drivers/net/ethernet/freescale/fs_enet/mac-fcc.c      |    4 
 drivers/net/ethernet/freescale/fs_enet/mii-fec.c      |    4 
 drivers/net/ethernet/i825xx/82596.c                   |    4 
 drivers/net/ethernet/korina.c                         |    4 
 drivers/net/ethernet/marvell/pxa168_eth.c             |    4 
 drivers/net/ethernet/natsemi/jazzsonic.c              |    4 
 drivers/net/ethernet/natsemi/macsonic.c               |    4 
 drivers/net/ethernet/natsemi/xtsonic.c                |    4 
 drivers/net/ethernet/sun/sunbmac.c                    |    4 
 drivers/net/ethernet/sun/sunhme.c                     |    1 
 drivers/net/ethernet/sun/sunqe.c                      |    4 
 drivers/oprofile/buffer_sync.c                        |   12 
 drivers/sbus/char/flash.c                             |    1 
 drivers/sbus/char/uctrl.c                             |    1 
 drivers/scsi/53c700.c                                 |    4 
 drivers/scsi/a2091.c                                  |    1 
 drivers/scsi/a3000.c                                  |    1 
 drivers/scsi/arm/cumana_2.c                           |    4 
 drivers/scsi/arm/eesox.c                              |    4 
 drivers/scsi/arm/powertec.c                           |    4 
 drivers/scsi/dpt_i2o.c                                |    4 
 drivers/scsi/gvp11.c                                  |    1 
 drivers/scsi/lasi700.c                                |    1 
 drivers/scsi/mac53c94.c                               |    4 
 drivers/scsi/mesh.c                                   |    4 
 drivers/scsi/mvme147.c                                |    1 
 drivers/scsi/qlogicpti.c                              |    4 
 drivers/scsi/sni_53c710.c                             |    1 
 drivers/scsi/zorro_esp.c                              |    4 
 drivers/staging/android/ashmem.c                      |    4 
 drivers/staging/comedi/comedi_fops.c                  |    2 
 drivers/staging/kpc2000/kpc_dma/fileops.c             |    4 
 drivers/staging/media/atomisp/pci/hmm/hmm_bo.c        |    4 
 drivers/tee/optee/call.c                              |    4 
 drivers/tty/sysrq.c                                   |    4 
 drivers/tty/vt/consolemap.c                           |    2 
 drivers/vfio/pci/vfio_pci.c                           |   22 
 drivers/vfio/vfio_iommu_type1.c                       |    8 
 drivers/vhost/vdpa.c                                  |    4 
 drivers/video/console/newport_con.c                   |    1 
 drivers/video/fbdev/acornfb.c                         |    1 
 drivers/video/fbdev/atafb.c                           |    1 
 drivers/video/fbdev/cirrusfb.c                        |    1 
 drivers/video/fbdev/cyber2000fb.c                     |    1 
 drivers/video/fbdev/fb-puv3.c                         |    1 
 drivers/video/fbdev/hitfb.c                           |    1 
 drivers/video/fbdev/neofb.c                           |    1 
 drivers/video/fbdev/q40fb.c                           |    1 
 drivers/video/fbdev/savage/savagefb_driver.c          |    1 
 drivers/xen/balloon.c                                 |    1 
 drivers/xen/gntdev.c                                  |    6 
 drivers/xen/grant-table.c                             |    1 
 drivers/xen/privcmd.c                                 |   15 
 drivers/xen/xenbus/xenbus_probe.c                     |    1 
 drivers/xen/xenbus/xenbus_probe_backend.c             |    1 
 drivers/xen/xenbus/xenbus_probe_frontend.c            |    1 
 fs/aio.c                                              |    4 
 fs/coredump.c                                         |    8 
 fs/exec.c                                             |   18 
 fs/ext2/file.c                                        |    2 
 fs/ext4/super.c                                       |    6 
 fs/hugetlbfs/inode.c                                  |    2 
 fs/io_uring.c                                         |    4 
 fs/kernfs/file.c                                      |    4 
 fs/proc/array.c                                       |    1 
 fs/proc/base.c                                        |   24 
 fs/proc/meminfo.c                                     |    1 
 fs/proc/nommu.c                                       |    1 
 fs/proc/task_mmu.c                                    |   34 
 fs/proc/task_nommu.c                                  |   18 
 fs/proc/vmcore.c                                      |    1 
 fs/userfaultfd.c                                      |   46 
 fs/xfs/xfs_file.c                                     |    2 
 fs/xfs/xfs_inode.c                                    |   14 
 fs/xfs/xfs_iops.c                                     |    4 
 include/asm-generic/io.h                              |    2 
 include/asm-generic/pgtable-nopmd.h                   |    1 
 include/asm-generic/pgtable-nopud.h                   |    1 
 include/asm-generic/pgtable.h                         | 1322 ----------------
 include/linux/cache.h                                 |   10 
 include/linux/crash_dump.h                            |    3 
 include/linux/dax.h                                   |    1 
 include/linux/dma-noncoherent.h                       |    2 
 include/linux/fs.h                                    |    4 
 include/linux/hmm.h                                   |    2 
 include/linux/huge_mm.h                               |    2 
 include/linux/hugetlb.h                               |    2 
 include/linux/io-mapping.h                            |    4 
 include/linux/kallsyms.h                              |    4 
 include/linux/kasan.h                                 |    4 
 include/linux/mempolicy.h                             |    2 
 include/linux/mm.h                                    |   15 
 include/linux/mm_types.h                              |    4 
 include/linux/mmap_lock.h                             |  128 +
 include/linux/mmu_notifier.h                          |   13 
 include/linux/pagemap.h                               |    2 
 include/linux/pgtable.h                               | 1444 +++++++++++++++++-
 include/linux/rmap.h                                  |    2 
 include/linux/sched/debug.h                           |    7 
 include/linux/sched/mm.h                              |   10 
 include/linux/uaccess.h                               |   62 
 include/xen/arm/page.h                                |    4 
 init/init_task.c                                      |    1 
 ipc/shm.c                                             |    8 
 kernel/acct.c                                         |    6 
 kernel/bpf/stackmap.c                                 |   21 
 kernel/bpf/syscall.c                                  |    2 
 kernel/cgroup/cpuset.c                                |    4 
 kernel/debug/kdb/kdb_bt.c                             |   17 
 kernel/events/core.c                                  |   10 
 kernel/events/uprobes.c                               |   20 
 kernel/exit.c                                         |   11 
 kernel/fork.c                                         |   15 
 kernel/futex.c                                        |    4 
 kernel/locking/lockdep.c                              |    4 
 kernel/locking/rtmutex-debug.c                        |    4 
 kernel/power/snapshot.c                               |    1 
 kernel/relay.c                                        |    2 
 kernel/sched/core.c                                   |   10 
 kernel/sched/fair.c                                   |    4 
 kernel/sys.c                                          |   22 
 kernel/trace/bpf_trace.c                              |  176 +-
 kernel/trace/ftrace.c                                 |    8 
 kernel/trace/trace_kprobe.c                           |   80 
 kernel/trace/trace_output.c                           |    4 
 lib/dump_stack.c                                      |    4 
 lib/ioremap.c                                         |    1 
 lib/test_hmm.c                                        |   14 
 lib/test_lockup.c                                     |   16 
 mm/debug.c                                            |   10 
 mm/debug_vm_pgtable.c                                 |    1 
 mm/filemap.c                                          |   46 
 mm/frame_vector.c                                     |    6 
 mm/gup.c                                              |   73 
 mm/hmm.c                                              |    2 
 mm/huge_memory.c                                      |    8 
 mm/hugetlb.c                                          |    3 
 mm/init-mm.c                                          |    6 
 mm/internal.h                                         |    6 
 mm/khugepaged.c                                       |   72 
 mm/ksm.c                                              |   48 
 mm/maccess.c                                          |  496 +++---
 mm/madvise.c                                          |   40 
 mm/memcontrol.c                                       |   10 
 mm/memory.c                                           |   61 
 mm/mempolicy.c                                        |   36 
 mm/migrate.c                                          |   16 
 mm/mincore.c                                          |    8 
 mm/mlock.c                                            |   22 
 mm/mmap.c                                             |   74 
 mm/mmu_gather.c                                       |    2 
 mm/mmu_notifier.c                                     |   22 
 mm/mprotect.c                                         |   22 
 mm/mremap.c                                           |   14 
 mm/msync.c                                            |    8 
 mm/nommu.c                                            |   22 
 mm/oom_kill.c                                         |   14 
 mm/page_io.c                                          |    1 
 mm/page_reporting.h                                   |    2 
 mm/pagewalk.c                                         |   12 
 mm/pgtable-generic.c                                  |    6 
 mm/process_vm_access.c                                |    4 
 mm/ptdump.c                                           |    4 
 mm/rmap.c                                             |   12 
 mm/shmem.c                                            |    5 
 mm/sparse-vmemmap.c                                   |    1 
 mm/sparse.c                                           |    1 
 mm/swap_state.c                                       |    5 
 mm/swapfile.c                                         |    5 
 mm/userfaultfd.c                                      |   26 
 mm/util.c                                             |   12 
 mm/vmacache.c                                         |    1 
 mm/zsmalloc.c                                         |    4 
 net/ipv4/tcp.c                                        |    8 
 net/xdp/xdp_umem.c                                    |    4 
 security/keys/keyctl.c                                |    2 
 sound/core/oss/pcm_oss.c                              |    2 
 sound/core/sgbuf.c                                    |    1 
 sound/pci/hda/hda_intel.c                             |    4 
 sound/soc/intel/common/sst-firmware.c                 |    4 
 sound/soc/intel/haswell/sst-haswell-pcm.c             |    4 
 tools/include/linux/kallsyms.h                        |    2 
 virt/kvm/async_pf.c                                   |    4 
 virt/kvm/kvm_main.c                                   |    9 
 942 files changed, 4580 insertions(+), 5662 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-06-11  1:40 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-11  1:40 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- various hotfixes and minor things

- hch's use_mm/unuse_mm clearnups

- new syscall process_madvise(): perform madvise() on a process other
  than self

25 patches, based on 6f630784cc0d92fb58ea326e2bc01aa056279ecb.

Subsystems affected by this patch series:

  mm/hugetlb
  scripts
  kcov
  lib
  nilfs
  checkpatch
  lib
  mm/debug
  ocfs2
  lib
  misc
  mm/madvise

Subsystem: mm/hugetlb

    Dan Carpenter <dan.carpenter@oracle.com>:
      khugepaged: selftests: fix timeout condition in wait_for_scan()

Subsystem: scripts

    SeongJae Park <sjpark@amazon.de>:
      scripts/spelling: add a few more typos

Subsystem: kcov

    Andrey Konovalov <andreyknvl@google.com>:
      kcov: check kcov_softirq in kcov_remote_stop()

Subsystem: lib

    Joe Perches <joe@perches.com>:
      lib/lz4/lz4_decompress.c: document deliberate use of `&'

Subsystem: nilfs

    Ryusuke Konishi <konishi.ryusuke@gmail.com>:
      nilfs2: fix null pointer dereference at nilfs_segctor_do_construct()

Subsystem: checkpatch

    Tim Froidcoeur <tim.froidcoeur@tessares.net>:
      checkpatch: correct check for kernel parameters doc

Subsystem: lib

    Alexander Gordeev <agordeev@linux.ibm.com>:
      lib: fix bitmap_parse() on 64-bit big endian archs

Subsystem: mm/debug

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/debug_vm_pgtable: fix kernel crash by checking for THP support

Subsystem: ocfs2

    Keyur Patel <iamkeyur96@gmail.com>:
      ocfs2: fix spelling mistake and grammar

    Ben Widawsky <ben.widawsky@intel.com>:
      mm: add comments on pglist_data zones

Subsystem: lib

    Wei Yang <richard.weiyang@gmail.com>:
      lib: test get_count_order/long in test_bitops.c

Subsystem: misc

    Walter Wu <walter-zh.wu@mediatek.com>:
      stacktrace: cleanup inconsistent variable type

    Christoph Hellwig <hch@lst.de>:
    Patch series "improve use_mm / unuse_mm", v2:
      kernel: move use_mm/unuse_mm to kthread.c
      kernel: move use_mm/unuse_mm to kthread.c
      kernel: better document the use_mm/unuse_mm API contract
      kernel: set USER_DS in kthread_use_mm

Subsystem: mm/madvise

    Minchan Kim <minchan@kernel.org>:
    Patch series "introduce memory hinting API for external process", v7:
      mm/madvise: pass task and mm to do_madvise
      mm/madvise: introduce process_madvise() syscall: an external memory hinting API
      mm/madvise: check fatal signal pending of target process
      pid: move pidfd_get_pid() to pid.c
      mm/madvise: support both pid and pidfd for process_madvise

    Oleksandr Natalenko <oleksandr@redhat.com>:
      mm/madvise: allow KSM hints for remote API

    Minchan Kim <minchan@kernel.org>:
      mm: support vector address ranges for process_madvise
      mm: use only pidfd for process_madvise syscall

    YueHaibing <yuehaibing@huawei.com>:
      mm/madvise.c: remove duplicated include

 arch/alpha/kernel/syscalls/syscall.tbl              |    1 
 arch/arm/tools/syscall.tbl                          |    1 
 arch/arm64/include/asm/unistd.h                     |    2 
 arch/arm64/include/asm/unistd32.h                   |    4 
 arch/ia64/kernel/syscalls/syscall.tbl               |    1 
 arch/m68k/kernel/syscalls/syscall.tbl               |    1 
 arch/microblaze/kernel/syscalls/syscall.tbl         |    1 
 arch/mips/kernel/syscalls/syscall_n32.tbl           |    3 
 arch/mips/kernel/syscalls/syscall_n64.tbl           |    1 
 arch/mips/kernel/syscalls/syscall_o32.tbl           |    3 
 arch/parisc/kernel/syscalls/syscall.tbl             |    3 
 arch/powerpc/kernel/syscalls/syscall.tbl            |    3 
 arch/powerpc/platforms/powernv/vas-fault.c          |    4 
 arch/s390/kernel/syscalls/syscall.tbl               |    3 
 arch/sh/kernel/syscalls/syscall.tbl                 |    1 
 arch/sparc/kernel/syscalls/syscall.tbl              |    3 
 arch/x86/entry/syscalls/syscall_32.tbl              |    3 
 arch/x86/entry/syscalls/syscall_64.tbl              |    5 
 arch/xtensa/kernel/syscalls/syscall.tbl             |    1 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h          |    5 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_arcturus.c |    1 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v10.c  |    1 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c   |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c   |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v9.c   |    2 
 drivers/gpu/drm/i915/gvt/kvmgt.c                    |    2 
 drivers/usb/gadget/function/f_fs.c                  |   10 
 drivers/usb/gadget/legacy/inode.c                   |    6 
 drivers/vfio/vfio_iommu_type1.c                     |    6 
 drivers/vhost/vhost.c                               |    8 
 fs/aio.c                                            |    1 
 fs/io-wq.c                                          |   15 -
 fs/io_uring.c                                       |   11 
 fs/nilfs2/segment.c                                 |    2 
 fs/ocfs2/mmap.c                                     |    2 
 include/linux/compat.h                              |   10 
 include/linux/kthread.h                             |    9 
 include/linux/mm.h                                  |    3 
 include/linux/mmu_context.h                         |    5 
 include/linux/mmzone.h                              |   14 
 include/linux/pid.h                                 |    1 
 include/linux/stacktrace.h                          |    2 
 include/linux/syscalls.h                            |   16 -
 include/uapi/asm-generic/unistd.h                   |    7 
 kernel/exit.c                                       |   17 -
 kernel/kcov.c                                       |   26 +
 kernel/kthread.c                                    |   95 +++++-
 kernel/pid.c                                        |   17 +
 kernel/sys_ni.c                                     |    2 
 lib/Kconfig.debug                                   |   10 
 lib/bitmap.c                                        |    9 
 lib/lz4/lz4_decompress.c                            |    3 
 lib/test_bitops.c                                   |   53 +++
 mm/Makefile                                         |    2 
 mm/debug_vm_pgtable.c                               |    6 
 mm/madvise.c                                        |  295 ++++++++++++++------
 mm/mmu_context.c                                    |   64 ----
 mm/oom_kill.c                                       |    6 
 mm/vmacache.c                                       |    4 
 scripts/checkpatch.pl                               |    4 
 scripts/spelling.txt                                |    9 
 tools/testing/selftests/vm/khugepaged.c             |    2 
 62 files changed, 526 insertions(+), 285 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-06-12  0:30 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-12  0:30 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


A few fixes and stragglers.


5 patches, based on 623f6dc593eaf98b91916836785278eddddaacf8.

Subsystems affected by this patch series:

  mm/memory-failure
  ocfs2
  lib/lzo
  misc

Subsystem: mm/memory-failure

    Naoya Horiguchi <nao.horiguchi@gmail.com>:
    Patch series "hwpoison: fixes signaling on memory error":
      mm/memory-failure: prioritize prctl(PR_MCE_KILL) over vm.memory_failure_early_kill
      mm/memory-failure: send SIGBUS(BUS_MCEERR_AR) only to current thread

Subsystem: ocfs2

    Tom Seewald <tseewald@gmail.com>:
      ocfs2: fix build failure when TCP/IP is disabled

Subsystem: lib/lzo

    Dave Rodgman <dave.rodgman@arm.com>:
      lib/lzo: fix ambiguous encoding bug in lzo-rle

Subsystem: misc

    Christoph Hellwig <hch@lst.de>:
      amdgpu: a NULL ->mm does not mean a thread is a kthread

 Documentation/lzo.txt                      |    8 ++++-
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h |    2 -
 fs/ocfs2/Kconfig                           |    2 -
 lib/lzo/lzo1x_compress.c                   |   13 ++++++++
 mm/memory-failure.c                        |   43 +++++++++++++++++------------
 5 files changed, 47 insertions(+), 21 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-06-26  3:28 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-26  3:28 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a.

Subsystems affected by this patch series:

  hotfixes
  mm/pagealloc
  kexec
  ocfs2
  lib
  misc
  mm/slab
  mm/slab
  mm/slub
  mm/swap
  mm/pagemap
  mm/vmalloc
  mm/memcg
  mm/gup
  mm/thp
  mm/vmscan
  x86
  mm/memory-hotplug
  MAINTAINERS

Subsystem: hotfixes

    Stafford Horne <shorne@gmail.com>:
      openrisc: fix boot oops when DEBUG_VM is enabled

    Michal Hocko <mhocko@suse.com>:
      mm: do_swap_page(): fix up the error code

Subsystem: mm/pagealloc

    Vlastimil Babka <vbabka@suse.cz>:
      mm, compaction: make capture control handling safe wrt interrupts

Subsystem: kexec

    Lianbo Jiang <lijiang@redhat.com>:
      kexec: do not verify the signature without the lockdown or mandatory signature

Subsystem: ocfs2

    Junxiao Bi <junxiao.bi@oracle.com>:
    Patch series "ocfs2: fix nfsd over ocfs2 issues", v2:
      ocfs2: avoid inode removal while nfsd is accessing it
      ocfs2: load global_inode_alloc
      ocfs2: fix panic on nfs server over ocfs2
      ocfs2: fix value of OCFS2_INVALID_SLOT

Subsystem: lib

    Randy Dunlap <rdunlap@infradead.org>:
      lib: fix test_hmm.c reference after free

Subsystem: misc

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      linux/bits.h: fix unsigned less than zero warnings

Subsystem: mm/slab

    Waiman Long <longman@redhat.com>:
      mm, slab: fix sign conversion problem in memcg_uncharge_slab()

Subsystem: mm/slab

    Waiman Long <longman@redhat.com>:
      mm/slab: use memzero_explicit() in kzfree()

Subsystem: mm/slub

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      slub: cure list_slab_objects() from double fix

Subsystem: mm/swap

    Hugh Dickins <hughd@google.com>:
      mm: fix swap cache node allocation mask

Subsystem: mm/pagemap

    Arjun Roy <arjunroy@google.com>:
      mm/memory.c: properly pte_offset_map_lock/unlock in vm_insert_pages()

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm/debug_vm_pgtable: fix build failure with powerpc 8xx

    Stephen Rothwell <sfr@canb.auug.org.au>:
      make asm-generic/cacheflush.h more standalone

    Nathan Chancellor <natechancellor@gmail.com>:
      media: omap3isp: remove cacheflush.h

Subsystem: mm/vmalloc

    Masanari Iida <standby24x7@gmail.com>:
      mm/vmalloc.c: fix a warning while make xmldocs

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: handle div0 crash race condition in memory.low

    Muchun Song <songmuchun@bytedance.com>:
      mm/memcontrol.c: add missed css_put()

    Chris Down <chris@chrisdown.name>:
      mm/memcontrol.c: prevent missed memory.low load tears

Subsystem: mm/gup

    Souptick Joarder <jrdr.linux@gmail.com>:
      docs: mm/gup: minor documentation update

Subsystem: mm/thp

    Yang Shi <yang.shi@linux.alibaba.com>:
      doc: THP CoW fault no longer allocate THP

Subsystem: mm/vmscan

    Johannes Weiner <hannes@cmpxchg.org>:
    Patch series "fix for "mm: balance LRU lists based on relative thrashing" patchset":
      mm: workingset: age nonresident information alongside anonymous pages

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
      mm/swap: fix for "mm: workingset: age nonresident information alongside anonymous pages"
      mm/memory: fix IO cost for anonymous page

Subsystem: x86

    Christoph Hellwig <hch@lst.de>:
    Patch series "fix a hyperv W^X violation and remove vmalloc_exec":
      x86/hyperv: allocate the hypercall page with only read and execute bits
      arm64: use PAGE_KERNEL_ROX directly in alloc_insn_page
      mm: remove vmalloc_exec

Subsystem: mm/memory-hotplug

    Ben Widawsky <ben.widawsky@intel.com>:
      mm/memory_hotplug.c: fix false softlockup during pfn range removal

Subsystem: MAINTAINERS

    Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
      MAINTAINERS: update info for sparse

 Documentation/admin-guide/cgroup-v2.rst    |    4 +-
 Documentation/admin-guide/mm/transhuge.rst |    3 -
 Documentation/core-api/pin_user_pages.rst  |    2 -
 MAINTAINERS                                |    4 +-
 arch/arm64/kernel/probes/kprobes.c         |   12 +------
 arch/openrisc/kernel/dma.c                 |    5 +++
 arch/x86/hyperv/hv_init.c                  |    4 +-
 arch/x86/include/asm/pgtable_types.h       |    2 +
 drivers/media/platform/omap3isp/isp.c      |    2 -
 drivers/media/platform/omap3isp/ispvideo.c |    1 
 fs/ocfs2/dlmglue.c                         |   17 ++++++++++
 fs/ocfs2/ocfs2.h                           |    1 
 fs/ocfs2/ocfs2_fs.h                        |    4 +-
 fs/ocfs2/suballoc.c                        |    9 +++--
 include/asm-generic/cacheflush.h           |    5 +++
 include/linux/bits.h                       |    3 +
 include/linux/mmzone.h                     |    4 +-
 include/linux/swap.h                       |    1 
 include/linux/vmalloc.h                    |    1 
 kernel/kexec_file.c                        |   36 ++++------------------
 kernel/module.c                            |    4 +-
 lib/test_hmm.c                             |    3 -
 mm/compaction.c                            |   17 ++++++++--
 mm/debug_vm_pgtable.c                      |    4 +-
 mm/memcontrol.c                            |   18 ++++++++---
 mm/memory.c                                |   33 +++++++++++++-------
 mm/memory_hotplug.c                        |   13 ++++++--
 mm/nommu.c                                 |   17 ----------
 mm/slab.h                                  |    4 +-
 mm/slab_common.c                           |    2 -
 mm/slub.c                                  |   19 ++---------
 mm/swap.c                                  |    3 -
 mm/swap_state.c                            |    4 +-
 mm/vmalloc.c                               |   21 -------------
 mm/vmscan.c                                |    3 +
 mm/workingset.c                            |   46 +++++++++++++++++------------
 36 files changed, 168 insertions(+), 163 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-07-03 22:14 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-07-03 22:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

5 patches, based on cdd3bb54332f82295ed90cd0c09c78cd0c0ee822.

Subsystems affected by this patch series:

  mm/hugetlb
  samples
  mm/cma
  mm/vmalloc
  mm/pagealloc

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      mm/hugetlb.c: fix pages per hugetlb calculation

Subsystem: samples

    Kees Cook <keescook@chromium.org>:
      samples/vfs: avoid warning in statx override

Subsystem: mm/cma

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/cma.c: use exact_nid true to fix possible per-numa cma leak

Subsystem: mm/vmalloc

    Christoph Hellwig <hch@lst.de>:
      vmalloc: fix the owner argument for the new __vmalloc_node_range callers

Subsystem: mm/pagealloc

    Joel Savitz <jsavitz@redhat.com>:
      mm/page_alloc: fix documentation error

 arch/arm64/kernel/probes/kprobes.c |    2 +-
 arch/x86/hyperv/hv_init.c          |    3 ++-
 kernel/module.c                    |    2 +-
 mm/cma.c                           |    4 ++--
 mm/hugetlb.c                       |    2 +-
 mm/page_alloc.c                    |    2 +-
 samples/vfs/test-statx.c           |    2 ++
 7 files changed, 10 insertions(+), 7 deletions(-)

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-07-24  4:14 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-07-24  4:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


15 patches, based on f37e99aca03f63aa3f2bd13ceaf769455d12c4b0.

Subsystems affected by this patch series:

  mm/pagemap
  mm/shmem
  mm/hotfixes
  mm/memcg
  mm/hugetlb
  mailmap
  squashfs
  scripts
  io-mapping
  MAINTAINERS
  gdb

Subsystem: mm/pagemap

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm/memory.c: avoid access flag update TLB flush for retried page fault

    "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
      mm/mmap.c: close race between munmap() and expand_upwards()/downwards()

Subsystem: mm/shmem

    Chengguang Xu <cgxu519@mykernel.net>:
      vfs/xattr: mm/shmem: kernfs: release simple xattr entry in a right way

Subsystem: mm/hotfixes

    Tom Rix <trix@redhat.com>:
      mm: initialize return of vm_insert_pages

    Bhupesh Sharma <bhsharma@redhat.com>:
      mm/memcontrol: fix OOPS inside mem_cgroup_get_nr_swap_pages()

Subsystem: mm/memcg

    Hugh Dickins <hughd@google.com>:
      mm/memcg: fix refcount error while moving and swapping

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcg/slab: fix memory leak at non-root kmem_cache destroy

Subsystem: mm/hugetlb

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/hugetlb: avoid hardcoding while checking if cma is enabled

    "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
      khugepaged: fix null-pointer dereference due to race

Subsystem: mailmap

    Mike Rapoport <rppt@linux.ibm.com>:
      mailmap: add entry for Mike Rapoport

Subsystem: squashfs

    Phillip Lougher <phillip@squashfs.org.uk>:
      squashfs: fix length field overlap check in metadata reading

Subsystem: scripts

    Pi-Hsun Shih <pihsun@chromium.org>:
      scripts/decode_stacktrace: strip basepath from all paths

Subsystem: io-mapping

    "Michael J. Ruhl" <michael.j.ruhl@intel.com>:
      io-mapping: indicate mapping failure

Subsystem: MAINTAINERS

    Andrey Konovalov <andreyknvl@google.com>:
      MAINTAINERS: add KCOV section

Subsystem: gdb

    Stefano Garzarella <sgarzare@redhat.com>:
      scripts/gdb: fix lx-symbols 'gdb.error' while loading modules

 .mailmap                     |    3 +++
 MAINTAINERS                  |   11 +++++++++++
 fs/squashfs/block.c          |    2 +-
 include/linux/io-mapping.h   |    5 ++++-
 include/linux/xattr.h        |    3 ++-
 mm/hugetlb.c                 |   15 ++++++++++-----
 mm/khugepaged.c              |    3 +++
 mm/memcontrol.c              |   13 ++++++++++---
 mm/memory.c                  |    9 +++++++--
 mm/mmap.c                    |   16 ++++++++++++++--
 mm/shmem.c                   |    2 +-
 mm/slab_common.c             |   35 ++++++++++++++++++++++++++++-------
 scripts/decode_stacktrace.sh |    4 ++--
 scripts/gdb/linux/symbols.py |    2 +-
 14 files changed, 97 insertions(+), 26 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-08-07  6:16 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-08-07  6:16 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- A few MM hotfixes

- kthread, tools, scripts, ntfs and ocfs2

- Some of MM



163 patches, based on d6efb3ac3e6c19ab722b28bdb9252bae0b9676b6.

Subsystems affected by this patch series:

  mm/pagemap
  mm/hofixes
  mm/pagealloc
  kthread
  tools
  scripts
  ntfs
  ocfs2
  mm/slab-generic
  mm/slab
  mm/slub
  mm/kcsan
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/shmem
  mm/memcg
  mm/pagemap
  mm/mremap
  mm/mincore
  mm/sparsemem
  mm/vmalloc
  mm/kasan
  mm/pagealloc
  mm/hugetlb
  mm/vmscan

Subsystem: mm/pagemap

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm/memory.c: avoid access flag update TLB flush for retried page fault

Subsystem: mm/hofixes

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/migrate: fix migrate_pgmap_owner w/o CONFIG_MMU_NOTIFIER

Subsystem: mm/pagealloc

    David Hildenbrand <david@redhat.com>:
      mm/shuffle: don't move pages between zones and don't read garbage memmaps

Subsystem: kthread

    Peter Zijlstra <peterz@infradead.org>:
      mm: fix kthread_use_mm() vs TLB invalidate

    Ilias Stamatis <stamatis.iliass@gmail.com>:
      kthread: remove incorrect comment in kthread_create_on_cpu()

Subsystem: tools

    "Alexander A. Klimov" <grandmaster@al2klimov.de>:
      tools/: replace HTTP links with HTTPS ones

    Gaurav Singh <gaurav1086@gmail.com>:
      tools/testing/selftests/cgroup/cgroup_util.c: cg_read_strcmp: fix null pointer dereference

Subsystem: scripts

    Jialu Xu <xujialu@vimux.org>:
      scripts/tags.sh: collect compiled source precisely

    Nikolay Borisov <nborisov@suse.com>:
      scripts/bloat-o-meter: Support comparing library archives

    Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
      scripts/decode_stacktrace.sh: skip missing symbols
      scripts/decode_stacktrace.sh: guess basepath if not specified
      scripts/decode_stacktrace.sh: guess path to modules
      scripts/decode_stacktrace.sh: guess path to vmlinux by release name

    Joe Perches <joe@perches.com>:
      const_structs.checkpatch: add regulator_ops

    Colin Ian King <colin.king@canonical.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

Subsystem: ntfs

    Luca Stefani <luca.stefani.ge1@gmail.com>:
      ntfs: fix ntfs_test_inode and ntfs_init_locked_inode function type

Subsystem: ocfs2

    Gang He <ghe@suse.com>:
      ocfs2: fix remounting needed after setfacl command

    Randy Dunlap <rdunlap@infradead.org>:
      ocfs2: suballoc.h: delete a duplicated word

    Junxiao Bi <junxiao.bi@oracle.com>:
      ocfs2: change slot number type s16 to u16

    "Alexander A. Klimov" <grandmaster@al2klimov.de>:
      ocfs2: replace HTTP links with HTTPS ones

    Pavel Machek <pavel@ucw.cz>:
      ocfs2: fix unbalanced locking

Subsystem: mm/slab-generic

    Waiman Long <longman@redhat.com>:
      mm, treewide: rename kzfree() to kfree_sensitive()

    William Kucharski <william.kucharski@oracle.com>:
      mm: ksize() should silently accept a NULL pointer

Subsystem: mm/slab

    Kees Cook <keescook@chromium.org>:
    Patch series "mm: Expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB":
      mm/slab: expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB
      mm/slab: add naive detection of double free

    Long Li <lonuxli.64@gmail.com>:
      mm, slab: check GFP_SLAB_BUG_MASK before alloc_pages in kmalloc_order

    Xiao Yang <yangx.jy@cn.fujitsu.com>:
      mm/slab.c: update outdated kmem_list3 in a comment

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "slub_debug fixes and improvements":
      mm, slub: extend slub_debug syntax for multiple blocks
      mm, slub: make some slub_debug related attributes read-only
      mm, slub: remove runtime allocation order changes
      mm, slub: make remaining slub_debug related attributes read-only
      mm, slub: make reclaim_account attribute read-only
      mm, slub: introduce static key for slub_debug()
      mm, slub: introduce kmem_cache_debug_flags()
      mm, slub: extend checks guarded by slub_debug static key
      mm, slab/slub: move and improve cache_from_obj()
      mm, slab/slub: improve error reporting and overhead of cache_from_obj()

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm/slub.c: drop lockdep_assert_held() from put_map()

Subsystem: mm/kcsan

    Marco Elver <elver@google.com>:
      mm, kcsan: instrument SLAB/SLUB free with "ASSERT_EXCLUSIVE_ACCESS"

Subsystem: mm/debug

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/debug_vm_pgtable: Add some more tests", v5:
      mm/debug_vm_pgtable: add tests validating arch helpers for core MM features
      mm/debug_vm_pgtable: add tests validating advanced arch page table helpers
      mm/debug_vm_pgtable: add debug prints for individual tests
      Documentation/mm: add descriptions for arch page table helpers

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Improvements for dump_page()", v2:
      mm/debug: handle page->mapping better in dump_page
      mm/debug: dump compound page information on a second line
      mm/debug: print head flags in dump_page
      mm/debug: switch dump_page to get_kernel_nofault
      mm/debug: print the inode number in dump_page
      mm/debug: print hashed address of struct page

    John Hubbard <jhubbard@nvidia.com>:
      mm, dump_page: do not crash with bad compound_mapcount()

Subsystem: mm/pagecache

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm: filemap: clear idle flag for writes
      mm: filemap: add missing FGP_ flags in kerneldoc comment for pagecache_get_page

Subsystem: mm/gup

    Tang Yizhou <tangyizhou@huawei.com>:
      mm/gup.c: fix the comment of return value for populate_vma_page_range()

Subsystem: mm/swap

    Zhen Lei <thunder.leizhen@huawei.com>:
    Patch series "clean up some functions in mm/swap_slots.c":
      mm/swap_slots.c: simplify alloc_swap_slot_cache()
      mm/swap_slots.c: simplify enable_swap_slots_cache()
      mm/swap_slots.c: remove redundant check for swap_slot_cache_initialized

    Krzysztof Kozlowski <krzk@kernel.org>:
      mm: swap: fix kerneldoc of swap_vma_readahead()

    Xianting Tian <xianting_tian@126.com>:
      mm/page_io.c: use blk_io_schedule() for avoiding task hung in sync io

Subsystem: mm/shmem

    Chris Down <chris@chrisdown.name>:
    Patch series "tmpfs: inode: Reduce risk of inum overflow", v7:
      tmpfs: per-superblock i_ino support
      tmpfs: support 64-bit inums per-sb

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: kmem: make memcg_kmem_enabled() irreversible
    Patch series "The new cgroup slab memory controller", v7:
      mm: memcg: factor out memcg- and lruvec-level changes out of __mod_lruvec_state()
      mm: memcg: prepare for byte-sized vmstat items
      mm: memcg: convert vmstat slab counters to bytes
      mm: slub: implement SLUB version of obj_to_index()

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: decouple reference counting from page accounting

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: obj_cgroup API
      mm: memcg/slab: allocate obj_cgroups for non-root slab pages
      mm: memcg/slab: save obj_cgroup for non-root slab objects
      mm: memcg/slab: charge individual slab objects instead of pages
      mm: memcg/slab: deprecate memory.kmem.slabinfo
      mm: memcg/slab: move memcg_kmem_bypass() to memcontrol.h
      mm: memcg/slab: use a single set of kmem_caches for all accounted allocations
      mm: memcg/slab: simplify memcg cache creation
      mm: memcg/slab: remove memcg_kmem_get_cache()
      mm: memcg/slab: deprecate slab_root_caches
      mm: memcg/slab: remove redundant check in memcg_accumulate_slabinfo()
      mm: memcg/slab: use a single set of kmem_caches for all allocations
      kselftests: cgroup: add kernel memory accounting tests
      tools/cgroup: add memcg_slabinfo.py tool

    Shakeel Butt <shakeelb@google.com>:
      mm: memcontrol: account kernel stack per node

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: remove unused argument by charge_slab_page()
      mm: slab: rename (un)charge_slab_page() to (un)account_slab_page()
      mm: kmem: switch to static_branch_likely() in memcg_kmem_enabled()
      mm: memcontrol: avoid workload stalls when lowering memory.high

    Chris Down <chris@chrisdown.name>:
    Patch series "mm, memcg: reclaim harder before high throttling", v2:
      mm, memcg: reclaim more aggressively before high allocator throttling
      mm, memcg: unify reclaim retry limits with page allocator

    Yafang Shao <laoar.shao@gmail.com>:
    Patch series "mm, memcg: memory.{low,min} reclaim fix & cleanup", v4:
      mm, memcg: avoid stale protection values when cgroup is above protection

    Chris Down <chris@chrisdown.name>:
      mm, memcg: decouple e{low,min} state mutations from protection checks

    Yafang Shao <laoar.shao@gmail.com>:
      memcg, oom: check memcg margin for parallel oom

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: restore proper dirty throttling when memory.high changes
      mm: memcontrol: don't count limit-setting reclaim as memory pressure

    Michal Koutný <mkoutny@suse.com>:
      mm/page_counter.c: fix protection usage propagation

Subsystem: mm/pagemap

    Ralph Campbell <rcampbell@nvidia.com>:
      mm: remove redundant check non_swap_entry()

    Alex Zhang <zhangalex@google.com>:
      mm/memory.c: make remap_pfn_range() reject unaligned addr

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: cleanup usage of <asm/pgalloc.h>":
      mm: remove unneeded includes of <asm/pgalloc.h>
      opeinrisc: switch to generic version of pte allocation
      xtensa: switch to generic version of pte allocation
      asm-generic: pgalloc: provide generic pmd_alloc_one() and pmd_free_one()
      asm-generic: pgalloc: provide generic pud_alloc_one() and pud_free_one()
      asm-generic: pgalloc: provide generic pgd_free()
      mm: move lib/ioremap.c to mm/

    Joerg Roedel <jroedel@suse.de>:
      mm: move p?d_alloc_track to separate header file

    Zhen Lei <thunder.leizhen@huawei.com>:
      mm/mmap: optimize a branch judgment in ksys_mmap_pgoff()

    Feng Tang <feng.tang@intel.com>:
    Patch series "make vm_committed_as_batch aware of vm overcommit policy", v6:
      proc/meminfo: avoid open coded reading of vm_committed_as
      mm/util.c: make vm_memory_committed() more accurate
      percpu_counter: add percpu_counter_sync()
      mm: adjust vm_committed_as_batch according to vm overcommit policy

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "arm64: Enable vmemmap mapping from device memory", v4:
      mm/sparsemem: enable vmem_altmap support in vmemmap_populate_basepages()
      mm/sparsemem: enable vmem_altmap support in vmemmap_alloc_block_buf()
      arm64/mm: enable vmem_altmap support for vmemmap mappings

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: mmap: merge vma after call_mmap() if possible

    Peter Collingbourne <pcc@google.com>:
      mm: remove unnecessary wrapper function do_mmap_pgoff()

Subsystem: mm/mremap

    Wei Yang <richard.weiyang@linux.alibaba.com>:
    Patch series "mm/mremap: cleanup move_page_tables() a little", v5:
      mm/mremap: it is sure to have enough space when extent meets requirement
      mm/mremap: calculate extent in one place
      mm/mremap: start addresses are properly aligned

Subsystem: mm/mincore

    Ricardo Cañuelo <ricardo.canuelo@collabora.com>:
      selftests: add mincore() tests

Subsystem: mm/sparsemem

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/sparse: never partially remove memmap for early section
      mm/sparse: only sub-section aligned range would be populated

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/sparse: cleanup the code surrounding memory_present()

Subsystem: mm/vmalloc

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      vmalloc: convert to XArray

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: simplify merge_or_add_vmap_area()
      mm/vmalloc: simplify augment_tree_propagate_check()
      mm/vmalloc: switch to "propagate()" callback
      mm/vmalloc: update the header about KVA rework

    Mike Rapoport <rppt@linux.ibm.com>:
      mm: vmalloc: remove redundant assignment in unmap_kernel_range_noflush()

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc.c: remove BUG() from the find_va_links()

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
      kasan: improve and simplify Kconfig.kasan
      kasan: update required compiler versions in documentation

    Walter Wu <walter-zh.wu@mediatek.com>:
    Patch series "kasan: memorize and print call_rcu stack", v8:
      rcu: kasan: record and print call_rcu() call stack
      kasan: record and print the free track
      kasan: add tests for call_rcu stack recording
      kasan: update documentation for generic kasan

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      kasan: remove kasan_unpoison_stack_above_sp_to()

    Walter Wu <walter-zh.wu@mediatek.com>:
      lib/test_kasan.c: fix KASAN unit tests for tag-based KASAN

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: support stack instrumentation for tag-based mode", v2:
      kasan: don't tag stacks allocated with pagealloc
      efi: provide empty efi_enter_virtual_mode implementation
      kasan, arm64: don't instrument functions that enable kasan
      kasan: allow enabling stack tagging for tag-based mode
      kasan: adjust kasan_stack_oob for tag-based mode

Subsystem: mm/pagealloc

    Vlastimil Babka <vbabka@suse.cz>:
      mm, page_alloc: use unlikely() in task_capc()

    Jaewon Kim <jaewon31.kim@samsung.com>:
      page_alloc: consider highatomic reserve in watermark fast

    Charan Teja Reddy <charante@codeaurora.org>:
      mm, page_alloc: skip ->waternark_boost for atomic order-0 allocations

    David Hildenbrand <david@redhat.com>:
      mm: remove vm_total_pages
      mm/page_alloc: remove nr_free_pagecache_pages()
      mm/memory_hotplug: document why shuffle_zone() is relevant
      mm/shuffle: remove dynamic reconfiguration

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/page_alloc.c: replace the definition of NR_MIGRATETYPE_BITS with PB_migratetype_bits
      mm/page_alloc.c: extract the common part in pfn_to_bitidx()
      mm/page_alloc.c: simplify pageblock bitmap access
      mm/page_alloc.c: remove unnecessary end_bitidx for [set|get]_pfnblock_flags_mask()

    Qian Cai <cai@lca.pw>:
      mm/page_alloc: silence a KASAN false positive

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/page_alloc: fallbacks at most has 3 elements

    Muchun Song <songmuchun@bytedance.com>:
      mm/page_alloc.c: skip setting nodemask when we are in interrupt

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
      mm/page_alloc: fix memalloc_nocma_{save/restore} APIs

Subsystem: mm/hugetlb

    "Alexander A. Klimov" <grandmaster@al2klimov.de>:
      mm: thp: replace HTTP links with HTTPS ones

    Peter Xu <peterx@redhat.com>:
      mm/hugetlb: fix calculation of adjust_range_if_pmd_sharing_possible

    Hugh Dickins <hughd@google.com>:
      khugepaged: collapse_pte_mapped_thp() flush the right range
      khugepaged: collapse_pte_mapped_thp() protect the pmd lock
      khugepaged: retract_page_tables() remember to test exit
      khugepaged: khugepaged_test_exit() check mmget_still_valid()

Subsystem: mm/vmscan

    dylan-meiners <spacct.spacct@gmail.com>:
      mm/vmscan.c: fix typo

    Shakeel Butt <shakeelb@google.com>:
      mm: vmscan: consistent update to pgrefill

 Documentation/admin-guide/kernel-parameters.txt        |    2 
 Documentation/dev-tools/kasan.rst                      |   10 
 Documentation/filesystems/dlmfs.rst                    |    2 
 Documentation/filesystems/ocfs2.rst                    |    2 
 Documentation/filesystems/tmpfs.rst                    |   18 
 Documentation/vm/arch_pgtable_helpers.rst              |  258 +++++
 Documentation/vm/memory-model.rst                      |    9 
 Documentation/vm/slub.rst                              |   51 -
 arch/alpha/include/asm/pgalloc.h                       |   21 
 arch/alpha/include/asm/tlbflush.h                      |    1 
 arch/alpha/kernel/core_irongate.c                      |    1 
 arch/alpha/kernel/core_marvel.c                        |    1 
 arch/alpha/kernel/core_titan.c                         |    1 
 arch/alpha/kernel/machvec_impl.h                       |    2 
 arch/alpha/kernel/smp.c                                |    1 
 arch/alpha/mm/numa.c                                   |    1 
 arch/arc/mm/fault.c                                    |    1 
 arch/arc/mm/init.c                                     |    1 
 arch/arm/include/asm/pgalloc.h                         |   12 
 arch/arm/include/asm/tlb.h                             |    1 
 arch/arm/kernel/machine_kexec.c                        |    1 
 arch/arm/kernel/smp.c                                  |    1 
 arch/arm/kernel/suspend.c                              |    1 
 arch/arm/mach-omap2/omap-mpuss-lowpower.c              |    1 
 arch/arm/mm/hugetlbpage.c                              |    1 
 arch/arm/mm/init.c                                     |    9 
 arch/arm/mm/mmu.c                                      |    1 
 arch/arm64/include/asm/pgalloc.h                       |   39 
 arch/arm64/kernel/setup.c                              |    2 
 arch/arm64/kernel/smp.c                                |    1 
 arch/arm64/mm/hugetlbpage.c                            |    1 
 arch/arm64/mm/init.c                                   |    6 
 arch/arm64/mm/ioremap.c                                |    1 
 arch/arm64/mm/mmu.c                                    |   63 -
 arch/csky/include/asm/pgalloc.h                        |    7 
 arch/csky/kernel/smp.c                                 |    1 
 arch/hexagon/include/asm/pgalloc.h                     |    7 
 arch/ia64/include/asm/pgalloc.h                        |   24 
 arch/ia64/include/asm/tlb.h                            |    1 
 arch/ia64/kernel/process.c                             |    1 
 arch/ia64/kernel/smp.c                                 |    1 
 arch/ia64/kernel/smpboot.c                             |    1 
 arch/ia64/mm/contig.c                                  |    1 
 arch/ia64/mm/discontig.c                               |    4 
 arch/ia64/mm/hugetlbpage.c                             |    1 
 arch/ia64/mm/tlb.c                                     |    1 
 arch/m68k/include/asm/mmu_context.h                    |    2 
 arch/m68k/include/asm/sun3_pgalloc.h                   |    7 
 arch/m68k/kernel/dma.c                                 |    2 
 arch/m68k/kernel/traps.c                               |    3 
 arch/m68k/mm/cache.c                                   |    2 
 arch/m68k/mm/fault.c                                   |    1 
 arch/m68k/mm/kmap.c                                    |    2 
 arch/m68k/mm/mcfmmu.c                                  |    1 
 arch/m68k/mm/memory.c                                  |    1 
 arch/m68k/sun3x/dvma.c                                 |    2 
 arch/microblaze/include/asm/pgalloc.h                  |    6 
 arch/microblaze/include/asm/tlbflush.h                 |    1 
 arch/microblaze/kernel/process.c                       |    1 
 arch/microblaze/kernel/signal.c                        |    1 
 arch/microblaze/mm/init.c                              |    3 
 arch/mips/include/asm/pgalloc.h                        |   19 
 arch/mips/kernel/setup.c                               |    8 
 arch/mips/loongson64/numa.c                            |    1 
 arch/mips/sgi-ip27/ip27-memory.c                       |    2 
 arch/mips/sgi-ip32/ip32-memory.c                       |    1 
 arch/nds32/mm/mm-nds32.c                               |    2 
 arch/nios2/include/asm/pgalloc.h                       |    7 
 arch/openrisc/include/asm/pgalloc.h                    |   33 
 arch/openrisc/include/asm/tlbflush.h                   |    1 
 arch/openrisc/kernel/or32_ksyms.c                      |    1 
 arch/parisc/include/asm/mmu_context.h                  |    1 
 arch/parisc/include/asm/pgalloc.h                      |   12 
 arch/parisc/kernel/cache.c                             |    1 
 arch/parisc/kernel/pci-dma.c                           |    1 
 arch/parisc/kernel/process.c                           |    1 
 arch/parisc/kernel/signal.c                            |    1 
 arch/parisc/kernel/smp.c                               |    1 
 arch/parisc/mm/hugetlbpage.c                           |    1 
 arch/parisc/mm/init.c                                  |    5 
 arch/parisc/mm/ioremap.c                               |    2 
 arch/powerpc/include/asm/tlb.h                         |    1 
 arch/powerpc/mm/book3s64/hash_hugetlbpage.c            |    1 
 arch/powerpc/mm/book3s64/hash_pgtable.c                |    1 
 arch/powerpc/mm/book3s64/hash_tlb.c                    |    1 
 arch/powerpc/mm/book3s64/radix_hugetlbpage.c           |    1 
 arch/powerpc/mm/init_32.c                              |    1 
 arch/powerpc/mm/init_64.c                              |    4 
 arch/powerpc/mm/kasan/8xx.c                            |    1 
 arch/powerpc/mm/kasan/book3s_32.c                      |    1 
 arch/powerpc/mm/mem.c                                  |    3 
 arch/powerpc/mm/nohash/40x.c                           |    1 
 arch/powerpc/mm/nohash/8xx.c                           |    1 
 arch/powerpc/mm/nohash/fsl_booke.c                     |    1 
 arch/powerpc/mm/nohash/kaslr_booke.c                   |    1 
 arch/powerpc/mm/nohash/tlb.c                           |    1 
 arch/powerpc/mm/numa.c                                 |    1 
 arch/powerpc/mm/pgtable.c                              |    1 
 arch/powerpc/mm/pgtable_64.c                           |    1 
 arch/powerpc/mm/ptdump/hashpagetable.c                 |    2 
 arch/powerpc/mm/ptdump/ptdump.c                        |    1 
 arch/powerpc/platforms/pseries/cmm.c                   |    1 
 arch/riscv/include/asm/pgalloc.h                       |   18 
 arch/riscv/mm/fault.c                                  |    1 
 arch/riscv/mm/init.c                                   |    3 
 arch/s390/crypto/prng.c                                |    4 
 arch/s390/include/asm/tlb.h                            |    1 
 arch/s390/include/asm/tlbflush.h                       |    1 
 arch/s390/kernel/machine_kexec.c                       |    1 
 arch/s390/kernel/ptrace.c                              |    1 
 arch/s390/kvm/diag.c                                   |    1 
 arch/s390/kvm/priv.c                                   |    1 
 arch/s390/kvm/pv.c                                     |    1 
 arch/s390/mm/cmm.c                                     |    1 
 arch/s390/mm/init.c                                    |    1 
 arch/s390/mm/mmap.c                                    |    1 
 arch/s390/mm/pgtable.c                                 |    1 
 arch/sh/include/asm/pgalloc.h                          |    4 
 arch/sh/kernel/idle.c                                  |    1 
 arch/sh/kernel/machine_kexec.c                         |    1 
 arch/sh/mm/cache-sh3.c                                 |    1 
 arch/sh/mm/cache-sh7705.c                              |    1 
 arch/sh/mm/hugetlbpage.c                               |    1 
 arch/sh/mm/init.c                                      |    7 
 arch/sh/mm/ioremap_fixed.c                             |    1 
 arch/sh/mm/numa.c                                      |    3 
 arch/sh/mm/tlb-sh3.c                                   |    1 
 arch/sparc/include/asm/ide.h                           |    1 
 arch/sparc/include/asm/tlb_64.h                        |    1 
 arch/sparc/kernel/leon_smp.c                           |    1 
 arch/sparc/kernel/process_32.c                         |    1 
 arch/sparc/kernel/signal_32.c                          |    1 
 arch/sparc/kernel/smp_32.c                             |    1 
 arch/sparc/kernel/smp_64.c                             |    1 
 arch/sparc/kernel/sun4m_irq.c                          |    1 
 arch/sparc/mm/highmem.c                                |    1 
 arch/sparc/mm/init_64.c                                |    1 
 arch/sparc/mm/io-unit.c                                |    1 
 arch/sparc/mm/iommu.c                                  |    1 
 arch/sparc/mm/tlb.c                                    |    1 
 arch/um/include/asm/pgalloc.h                          |    9 
 arch/um/include/asm/pgtable-3level.h                   |    3 
 arch/um/kernel/mem.c                                   |   17 
 arch/x86/ia32/ia32_aout.c                              |    1 
 arch/x86/include/asm/mmu_context.h                     |    1 
 arch/x86/include/asm/pgalloc.h                         |   42 
 arch/x86/kernel/alternative.c                          |    1 
 arch/x86/kernel/apic/apic.c                            |    1 
 arch/x86/kernel/mpparse.c                              |    1 
 arch/x86/kernel/traps.c                                |    1 
 arch/x86/mm/fault.c                                    |    1 
 arch/x86/mm/hugetlbpage.c                              |    1 
 arch/x86/mm/init_32.c                                  |    2 
 arch/x86/mm/init_64.c                                  |   12 
 arch/x86/mm/kaslr.c                                    |    1 
 arch/x86/mm/pgtable_32.c                               |    1 
 arch/x86/mm/pti.c                                      |    1 
 arch/x86/platform/uv/bios_uv.c                         |    1 
 arch/x86/power/hibernate.c                             |    2 
 arch/xtensa/include/asm/pgalloc.h                      |   46 
 arch/xtensa/kernel/xtensa_ksyms.c                      |    1 
 arch/xtensa/mm/cache.c                                 |    1 
 arch/xtensa/mm/fault.c                                 |    1 
 crypto/adiantum.c                                      |    2 
 crypto/ahash.c                                         |    4 
 crypto/api.c                                           |    2 
 crypto/asymmetric_keys/verify_pefile.c                 |    4 
 crypto/deflate.c                                       |    2 
 crypto/drbg.c                                          |   10 
 crypto/ecc.c                                           |    8 
 crypto/ecdh.c                                          |    2 
 crypto/gcm.c                                           |    2 
 crypto/gf128mul.c                                      |    4 
 crypto/jitterentropy-kcapi.c                           |    2 
 crypto/rng.c                                           |    2 
 crypto/rsa-pkcs1pad.c                                  |    6 
 crypto/seqiv.c                                         |    2 
 crypto/shash.c                                         |    2 
 crypto/skcipher.c                                      |    2 
 crypto/testmgr.c                                       |    6 
 crypto/zstd.c                                          |    2 
 drivers/base/node.c                                    |   10 
 drivers/block/xen-blkback/common.h                     |    1 
 drivers/crypto/allwinner/sun8i-ce/sun8i-ce-cipher.c    |    2 
 drivers/crypto/allwinner/sun8i-ss/sun8i-ss-cipher.c    |    2 
 drivers/crypto/amlogic/amlogic-gxl-cipher.c            |    4 
 drivers/crypto/atmel-ecc.c                             |    2 
 drivers/crypto/caam/caampkc.c                          |   28 
 drivers/crypto/cavium/cpt/cptvf_main.c                 |    6 
 drivers/crypto/cavium/cpt/cptvf_reqmanager.c           |   12 
 drivers/crypto/cavium/nitrox/nitrox_lib.c              |    4 
 drivers/crypto/cavium/zip/zip_crypto.c                 |    6 
 drivers/crypto/ccp/ccp-crypto-rsa.c                    |    6 
 drivers/crypto/ccree/cc_aead.c                         |    4 
 drivers/crypto/ccree/cc_buffer_mgr.c                   |    4 
 drivers/crypto/ccree/cc_cipher.c                       |    6 
 drivers/crypto/ccree/cc_hash.c                         |    8 
 drivers/crypto/ccree/cc_request_mgr.c                  |    2 
 drivers/crypto/marvell/cesa/hash.c                     |    2 
 drivers/crypto/marvell/octeontx/otx_cptvf_main.c       |    6 
 drivers/crypto/marvell/octeontx/otx_cptvf_reqmgr.h     |    2 
 drivers/crypto/nx/nx.c                                 |    4 
 drivers/crypto/virtio/virtio_crypto_algs.c             |   12 
 drivers/crypto/virtio/virtio_crypto_core.c             |    2 
 drivers/iommu/ipmmu-vmsa.c                             |    1 
 drivers/md/dm-crypt.c                                  |   32 
 drivers/md/dm-integrity.c                              |    6 
 drivers/misc/ibmvmc.c                                  |    6 
 drivers/net/ethernet/hisilicon/hns3/hns3pf/hclge_mbx.c |    2 
 drivers/net/ethernet/intel/ixgbe/ixgbe_ipsec.c         |    6 
 drivers/net/ppp/ppp_mppe.c                             |    6 
 drivers/net/wireguard/noise.c                          |    4 
 drivers/net/wireguard/peer.c                           |    2 
 drivers/net/wireless/intel/iwlwifi/pcie/rx.c           |    2 
 drivers/net/wireless/intel/iwlwifi/pcie/tx-gen2.c      |    6 
 drivers/net/wireless/intel/iwlwifi/pcie/tx.c           |    6 
 drivers/net/wireless/intersil/orinoco/wext.c           |    4 
 drivers/s390/crypto/ap_bus.h                           |    4 
 drivers/staging/ks7010/ks_hostif.c                     |    2 
 drivers/staging/rtl8723bs/core/rtw_security.c          |    2 
 drivers/staging/wlan-ng/p80211netdev.c                 |    2 
 drivers/target/iscsi/iscsi_target_auth.c               |    2 
 drivers/xen/balloon.c                                  |    1 
 drivers/xen/privcmd.c                                  |    1 
 fs/Kconfig                                             |   21 
 fs/aio.c                                               |    6 
 fs/binfmt_elf_fdpic.c                                  |    1 
 fs/cifs/cifsencrypt.c                                  |    2 
 fs/cifs/connect.c                                      |   10 
 fs/cifs/dfs_cache.c                                    |    2 
 fs/cifs/misc.c                                         |    8 
 fs/crypto/inline_crypt.c                               |    5 
 fs/crypto/keyring.c                                    |    6 
 fs/crypto/keysetup_v1.c                                |    4 
 fs/ecryptfs/keystore.c                                 |    4 
 fs/ecryptfs/messaging.c                                |    2 
 fs/hugetlbfs/inode.c                                   |    2 
 fs/ntfs/dir.c                                          |    2 
 fs/ntfs/inode.c                                        |   27 
 fs/ntfs/inode.h                                        |    4 
 fs/ntfs/mft.c                                          |    4 
 fs/ocfs2/Kconfig                                       |    6 
 fs/ocfs2/acl.c                                         |    2 
 fs/ocfs2/blockcheck.c                                  |    2 
 fs/ocfs2/dlmglue.c                                     |    8 
 fs/ocfs2/ocfs2.h                                       |    4 
 fs/ocfs2/suballoc.c                                    |    4 
 fs/ocfs2/suballoc.h                                    |    2 
 fs/ocfs2/super.c                                       |    4 
 fs/proc/meminfo.c                                      |   10 
 include/asm-generic/pgalloc.h                          |   80 +
 include/asm-generic/tlb.h                              |    1 
 include/crypto/aead.h                                  |    2 
 include/crypto/akcipher.h                              |    2 
 include/crypto/gf128mul.h                              |    2 
 include/crypto/hash.h                                  |    2 
 include/crypto/internal/acompress.h                    |    2 
 include/crypto/kpp.h                                   |    2 
 include/crypto/skcipher.h                              |    2 
 include/linux/efi.h                                    |    4 
 include/linux/fs.h                                     |   17 
 include/linux/huge_mm.h                                |    2 
 include/linux/kasan.h                                  |    4 
 include/linux/memcontrol.h                             |  209 +++-
 include/linux/mm.h                                     |   86 -
 include/linux/mm_types.h                               |    5 
 include/linux/mman.h                                   |    4 
 include/linux/mmu_notifier.h                           |   13 
 include/linux/mmzone.h                                 |   54 -
 include/linux/pageblock-flags.h                        |   30 
 include/linux/percpu_counter.h                         |    4 
 include/linux/sched/mm.h                               |    8 
 include/linux/shmem_fs.h                               |    3 
 include/linux/slab.h                                   |   11 
 include/linux/slab_def.h                               |    9 
 include/linux/slub_def.h                               |   31 
 include/linux/swap.h                                   |    2 
 include/linux/vmstat.h                                 |   14 
 init/Kconfig                                           |    9 
 init/main.c                                            |    2 
 ipc/shm.c                                              |    2 
 kernel/fork.c                                          |   54 -
 kernel/kthread.c                                       |    8 
 kernel/power/snapshot.c                                |    2 
 kernel/rcu/tree.c                                      |    2 
 kernel/scs.c                                           |    2 
 kernel/sysctl.c                                        |    2 
 lib/Kconfig.kasan                                      |   39 
 lib/Makefile                                           |    1 
 lib/ioremap.c                                          |  287 -----
 lib/mpi/mpiutil.c                                      |    6 
 lib/percpu_counter.c                                   |   19 
 lib/test_kasan.c                                       |   87 +
 mm/Kconfig                                             |    6 
 mm/Makefile                                            |    2 
 mm/debug.c                                             |  103 +-
 mm/debug_vm_pgtable.c                                  |  666 +++++++++++++
 mm/filemap.c                                           |    9 
 mm/gup.c                                               |    3 
 mm/huge_memory.c                                       |   14 
 mm/hugetlb.c                                           |   25 
 mm/ioremap.c                                           |  289 +++++
 mm/kasan/common.c                                      |   41 
 mm/kasan/generic.c                                     |   43 
 mm/kasan/generic_report.c                              |    1 
 mm/kasan/kasan.h                                       |   25 
 mm/kasan/quarantine.c                                  |    1 
 mm/kasan/report.c                                      |   54 -
 mm/kasan/tags.c                                        |   37 
 mm/khugepaged.c                                        |   75 -
 mm/memcontrol.c                                        |  832 ++++++++++-------
 mm/memory.c                                            |   15 
 mm/memory_hotplug.c                                    |   11 
 mm/migrate.c                                           |    6 
 mm/mm_init.c                                           |   20 
 mm/mmap.c                                              |   45 
 mm/mremap.c                                            |   19 
 mm/nommu.c                                             |    6 
 mm/oom_kill.c                                          |    2 
 mm/page-writeback.c                                    |    6 
 mm/page_alloc.c                                        |  226 ++--
 mm/page_counter.c                                      |    6 
 mm/page_io.c                                           |    2 
 mm/pgalloc-track.h                                     |   51 +
 mm/shmem.c                                             |  133 ++
 mm/shuffle.c                                           |   46 
 mm/shuffle.h                                           |   17 
 mm/slab.c                                              |  129 +-
 mm/slab.h                                              |  755 ++++++---------
 mm/slab_common.c                                       |  829 ++--------------
 mm/slob.c                                              |   12 
 mm/slub.c                                              |  680 ++++---------
 mm/sparse-vmemmap.c                                    |   62 -
 mm/sparse.c                                            |   31 
 mm/swap_slots.c                                        |   45 
 mm/swap_state.c                                        |    2 
 mm/util.c                                              |   52 +
 mm/vmalloc.c                                           |  176 +--
 mm/vmscan.c                                            |   39 
 mm/vmstat.c                                            |   38 
 mm/workingset.c                                        |    6 
 net/atm/mpoa_caches.c                                  |    4 
 net/bluetooth/ecdh_helper.c                            |    6 
 net/bluetooth/smp.c                                    |   24 
 net/core/sock.c                                        |    2 
 net/ipv4/tcp_fastopen.c                                |    2 
 net/mac80211/aead_api.c                                |    4 
 net/mac80211/aes_gmac.c                                |    2 
 net/mac80211/key.c                                     |    2 
 net/mac802154/llsec.c                                  |   20 
 net/sctp/auth.c                                        |    2 
 net/sunrpc/auth_gss/gss_krb5_crypto.c                  |    4 
 net/sunrpc/auth_gss/gss_krb5_keys.c                    |    6 
 net/sunrpc/auth_gss/gss_krb5_mech.c                    |    2 
 net/tipc/crypto.c                                      |   10 
 net/wireless/core.c                                    |    2 
 net/wireless/ibss.c                                    |    4 
 net/wireless/lib80211_crypt_tkip.c                     |    2 
 net/wireless/lib80211_crypt_wep.c                      |    2 
 net/wireless/nl80211.c                                 |   24 
 net/wireless/sme.c                                     |    6 
 net/wireless/util.c                                    |    2 
 net/wireless/wext-sme.c                                |    2 
 scripts/Makefile.kasan                                 |    3 
 scripts/bloat-o-meter                                  |    2 
 scripts/coccinelle/free/devm_free.cocci                |    4 
 scripts/coccinelle/free/ifnullfree.cocci               |    4 
 scripts/coccinelle/free/kfree.cocci                    |    6 
 scripts/coccinelle/free/kfreeaddr.cocci                |    2 
 scripts/const_structs.checkpatch                       |    1 
 scripts/decode_stacktrace.sh                           |   85 +
 scripts/spelling.txt                                   |   19 
 scripts/tags.sh                                        |   18 
 security/apparmor/domain.c                             |    4 
 security/apparmor/include/file.h                       |    2 
 security/apparmor/policy.c                             |   24 
 security/apparmor/policy_ns.c                          |    6 
 security/apparmor/policy_unpack.c                      |   14 
 security/keys/big_key.c                                |    6 
 security/keys/dh.c                                     |   14 
 security/keys/encrypted-keys/encrypted.c               |   14 
 security/keys/trusted-keys/trusted_tpm1.c              |   34 
 security/keys/user_defined.c                           |    6 
 tools/cgroup/memcg_slabinfo.py                         |  226 ++++
 tools/include/linux/jhash.h                            |    2 
 tools/lib/rbtree.c                                     |    2 
 tools/lib/traceevent/event-parse.h                     |    2 
 tools/testing/ktest/examples/README                    |    2 
 tools/testing/ktest/examples/crosstests.conf           |    2 
 tools/testing/selftests/Makefile                       |    1 
 tools/testing/selftests/cgroup/.gitignore              |    1 
 tools/testing/selftests/cgroup/Makefile                |    2 
 tools/testing/selftests/cgroup/cgroup_util.c           |    2 
 tools/testing/selftests/cgroup/test_kmem.c             |  382 +++++++
 tools/testing/selftests/mincore/.gitignore             |    2 
 tools/testing/selftests/mincore/Makefile               |    6 
 tools/testing/selftests/mincore/mincore_selftest.c     |  361 +++++++
 397 files changed, 5547 insertions(+), 4072 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-08-12  1:29 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-08-12  1:29 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- Most of the rest of MM

- various other subsystems


165 patches, based on 00e4db51259a5f936fec1424b884f029479d3981.

Subsystems affected by this patch series:

  mm/memcg
  mm/hugetlb
  mm/vmscan
  mm/proc
  mm/compaction
  mm/mempolicy
  mm/oom-kill
  mm/hugetlbfs
  mm/migration
  mm/thp
  mm/cma
  mm/util
  mm/memory-hotplug
  mm/cleanups
  mm/uaccess
  alpha
  misc
  sparse
  bitmap
  lib
  lz4
  bitops
  checkpatch
  autofs
  minix
  nilfs
  ufs
  fat
  signals
  kmod
  coredump
  exec
  kdump
  rapidio
  panic
  kcov
  kgdb
  ipc
  mm/migration
  mm/gup
  mm/pagemap

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
    Patch series "mm: memcg accounting of percpu memory", v3:
      percpu: return number of released bytes from pcpu_free_area()
      mm: memcg/percpu: account percpu memory to memory cgroups
      mm: memcg/percpu: per-memcg percpu memory statistics
      mm: memcg: charge memcg percpu memory to the parent cgroup
      kselftests: cgroup: add perpcu memory accounting test

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
      mm/hugetlb: add mempolicy check in the reservation routine

Subsystem: mm/vmscan

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
    Patch series "workingset protection/detection on the anonymous LRU list", v7:
      mm/vmscan: make active/inactive ratio as 1:1 for anon lru
      mm/vmscan: protect the workingset on anonymous LRU
      mm/workingset: prepare the workingset detection infrastructure for anon LRU
      mm/swapcache: support to handle the shadow entries
      mm/swap: implement workingset detection for anonymous LRU
      mm/vmscan: restore active/inactive ratio for anonymous LRU

Subsystem: mm/proc

    Michal Koutný <mkoutny@suse.com>:
      /proc/PID/smaps: consistent whitespace output format

Subsystem: mm/compaction

    Nitin Gupta <nigupta@nvidia.com>:
      mm: proactive compaction
      mm: fix compile error due to COMPACTION_HPAGE_ORDER
      mm: use unsigned types for fragmentation score

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/compaction: correct the comments of compact_defer_shift

Subsystem: mm/mempolicy

    Krzysztof Kozlowski <krzk@kernel.org>:
      mm: mempolicy: fix kerneldoc of numa_map_to_online_node()

    Wenchao Hao <haowenchao22@gmail.com>:
      mm/mempolicy.c: check parameters first in kernel_get_mempolicy

    Yanfei Xu <yanfei.xu@windriver.com>:
      include/linux/mempolicy.h: fix typo

Subsystem: mm/oom-kill

    Yafang Shao <laoar.shao@gmail.com>:
      mm, oom: make the calculation of oom badness more accurate

    Michal Hocko <mhocko@suse.com>:
      doc, mm: sync up oom_score_adj documentation
      doc, mm: clarify /proc/<pid>/oom_score value range

    Yafang Shao <laoar.shao@gmail.com>:
      mm, oom: show process exiting information in __oom_kill_process()

Subsystem: mm/hugetlbfs

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlbfs: prevent filesystem stacking of hugetlbfs
      hugetlbfs: remove call to huge_pte_alloc without i_mmap_rwsem

Subsystem: mm/migration

    Ralph Campbell <rcampbell@nvidia.com>:
    Patch series "mm/migrate: optimize migrate_vma_setup() for holes":
      mm/migrate: optimize migrate_vma_setup() for holes
      mm/migrate: add migrate-shared test for migrate_vma_*()

Subsystem: mm/thp

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm: thp: remove debug_cow switch

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/vmstat: add events for THP migration without split

Subsystem: mm/cma

    Jianqun Xu <jay.xu@rock-chips.com>:
      mm/cma.c: fix NULL pointer dereference when cma could not be activated

    Barry Song <song.bao.hua@hisilicon.com>:
    Patch series "mm: fix the names of general cma and hugetlb cma", v2:
      mm: cma: fix the name of CMA areas
      mm: hugetlb: fix the name of hugetlb CMA

    Mike Kravetz <mike.kravetz@oracle.com>:
      cma: don't quit at first error when activating reserved areas

Subsystem: mm/util

    Waiman Long <longman@redhat.com>:
      include/linux/sched/mm.h: optimize current_gfp_context()

    Krzysztof Kozlowski <krzk@kernel.org>:
      mm: mmu_notifier: fix and extend kerneldoc

Subsystem: mm/memory-hotplug

    Daniel Jordan <daniel.m.jordan@oracle.com>:
      x86/mm: use max memory block size on bare metal

    Jia He <justin.he@arm.com>:
      mm/memory_hotplug: introduce default dummy memory_add_physaddr_to_nid()
      mm/memory_hotplug: fix unpaired mem_hotplug_begin/done

    Charan Teja Reddy <charante@codeaurora.org>:
      mm, memory_hotplug: update pcp lists everytime onlining a memory block

Subsystem: mm/cleanups

    Randy Dunlap <rdunlap@infradead.org>:
      mm: drop duplicated words in <linux/pgtable.h>
      mm: drop duplicated words in <linux/mm.h>
      include/linux/highmem.h: fix duplicated words in a comment
      include/linux/frontswap.h:  drop duplicated word in a comment
      include/linux/memcontrol.h: drop duplicate word and fix spello

    Arvind Sankar <nivedita@alum.mit.edu>:
      sh/mm: drop unused MAX_PHYSADDR_BITS
      sparc: drop unused MAX_PHYSADDR_BITS

    Randy Dunlap <rdunlap@infradead.org>:
      mm/compaction.c: delete duplicated word
      mm/filemap.c: delete duplicated word
      mm/hmm.c: delete duplicated word
      mm/hugetlb.c: delete duplicated words
      mm/memcontrol.c: delete duplicated words
      mm/memory.c: delete duplicated words
      mm/migrate.c: delete duplicated word
      mm/nommu.c: delete duplicated words
      mm/page_alloc.c: delete or fix duplicated words
      mm/shmem.c: delete duplicated word
      mm/slab_common.c: delete duplicated word
      mm/usercopy.c: delete duplicated word
      mm/vmscan.c: delete or fix duplicated words
      mm/zpool.c: delete duplicated word and fix grammar
      mm/zsmalloc.c: fix duplicated words

Subsystem: mm/uaccess

    Christoph Hellwig <hch@lst.de>:
    Patch series "clean up address limit helpers", v2:
      syscalls: use uaccess_kernel in addr_limit_user_check
      nds32: use uaccess_kernel in show_regs
      riscv: include <asm/pgtable.h> in <asm/uaccess.h>
      uaccess: remove segment_eq
      uaccess: add force_uaccess_{begin,end} helpers
      exec: use force_uaccess_begin during exec and exit

Subsystem: alpha

    Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
      alpha: fix annotation of io{read,write}{16,32}be()

Subsystem: misc

    Randy Dunlap <rdunlap@infradead.org>:
      include/linux/compiler-clang.h: drop duplicated word in a comment
      include/linux/exportfs.h: drop duplicated word in a comment
      include/linux/async_tx.h: drop duplicated word in a comment
      include/linux/xz.h: drop duplicated word

    Christoph Hellwig <hch@lst.de>:
      kernel: add a kernel_wait helper

    Feng Tang <feng.tang@intel.com>:
      ./Makefile: add debug option to enable function aligned on 32 bytes

    Arvind Sankar <nivedita@alum.mit.edu>:
      kernel.h: remove duplicate include of asm/div64.h

    "Alexander A. Klimov" <grandmaster@al2klimov.de>:
      include/: replace HTTP links with HTTPS ones

    Matthew Wilcox <willy@infradead.org>:
      include/linux/poison.h: remove obsolete comment

Subsystem: sparse

    Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
      sparse: group the defines by functionality

Subsystem: bitmap

    Stefano Brivio <sbrivio@redhat.com>:
    Patch series "lib: Fix bitmap_cut() for overlaps, add test":
      lib/bitmap.c: fix bitmap_cut() for partial overlapping case
      lib/test_bitmap.c: add test for bitmap_cut()

Subsystem: lib

    Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
      lib/generic-radix-tree.c: remove unneeded __rcu

    Geert Uytterhoeven <geert@linux-m68k.org>:
      lib/test_bitops: do the full test during module init

    Wei Yongjun <weiyongjun1@huawei.com>:
      lib/test_lockup.c: make symbol 'test_works' static

    Tiezhu Yang <yangtiezhu@loongson.cn>:
      lib/Kconfig.debug: make TEST_LOCKUP depend on module
      lib/test_lockup.c: fix return value of test_lockup_init()

    "Alexander A. Klimov" <grandmaster@al2klimov.de>:
      lib/: replace HTTP links with HTTPS ones

    "Kars Mulder" <kerneldev@karsmulder.nl>:
      kstrto*: correct documentation references to simple_strto*()
      kstrto*: do not describe simple_strto*() as obsolete/replaced

Subsystem: lz4

    Nick Terrell <terrelln@fb.com>:
      lz4: fix kernel decompression speed

Subsystem: bitops

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      lib/test_bits.c: add tests of GENMASK

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: add test for possible misuse of IS_ENABLED() without CONFIG_
      checkpatch: add --fix option for ASSIGN_IN_IF

    Quentin Monnet <quentin@isovalent.com>:
      checkpatch: fix CONST_STRUCT when const_structs.checkpatch is missing

    Joe Perches <joe@perches.com>:
      checkpatch: add test for repeated words
      checkpatch: remove missing switch/case break test

Subsystem: autofs

    Randy Dunlap <rdunlap@infradead.org>:
      autofs: fix doubled word

Subsystem: minix

    Eric Biggers <ebiggers@google.com>:
    Patch series "fs/minix: fix syzbot bugs and set s_maxbytes":
      fs/minix: check return value of sb_getblk()
      fs/minix: don't allow getting deleted inodes
      fs/minix: reject too-large maximum file size
      fs/minix: set s_maxbytes correctly
      fs/minix: fix block limit check for V1 filesystems
      fs/minix: remove expected error message in block_to_path()

Subsystem: nilfs

    Eric Biggers <ebiggers@google.com>:
    Patch series "nilfs2 updates":
      nilfs2: only call unlock_new_inode() if I_NEW

    Joe Perches <joe@perches.com>:
      nilfs2: convert __nilfs_msg to integrate the level and format
      nilfs2: use a more common logging style

Subsystem: ufs

    Colin Ian King <colin.king@canonical.com>:
      fs/ufs: avoid potential u32 multiplication overflow

Subsystem: fat

    Yubo Feng <fengyubo3@huawei.com>:
      fatfs: switch write_lock to read_lock in fat_ioctl_get_attributes

    "Alexander A. Klimov" <grandmaster@al2klimov.de>:
      VFAT/FAT/MSDOS FILESYSTEM: replace HTTP links with HTTPS ones

    OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
      fat: fix fat_ra_init() for data clusters == 0

Subsystem: signals

    Helge Deller <deller@gmx.de>:
      fs/signalfd.c: fix inconsistent return codes for signalfd4

Subsystem: kmod

    Tiezhu Yang <yangtiezhu@loongson.cn>:
    Patch series "kmod/umh: a few fixes":
      selftests: kmod: use variable NAME in kmod_test_0001()
      kmod: remove redundant "be an" in the comment
      test_kmod: avoid potential double free in trigger_config_run_type()

Subsystem: coredump

    Lepton Wu <ytht.net@gmail.com>:
      coredump: add %f for executable filename

Subsystem: exec

    Kees Cook <keescook@chromium.org>:
    Patch series "Relocate execve() sanity checks", v2:
      exec: change uselib(2) IS_SREG() failure to EACCES
      exec: move S_ISREG() check earlier
      exec: move path_noexec() check earlier

Subsystem: kdump

    Vijay Balakrishna <vijayb@linux.microsoft.com>:
      kdump: append kernel build-id string to VMCOREINFO

Subsystem: rapidio

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      drivers/rapidio/devices/rio_mport_cdev.c: use struct_size() helper
      drivers/rapidio/rio-scan.c: use struct_size() helper
      rapidio/rio_mport_cdev: use array_size() helper in copy_{from,to}_user()

Subsystem: panic

    Tiezhu Yang <yangtiezhu@loongson.cn>:
      kernel/panic.c: make oops_may_print() return bool
      lib/Kconfig.debug: fix typo in the help text of CONFIG_PANIC_TIMEOUT

    Yue Hu <huyue2@yulong.com>:
      panic: make print_oops_end_marker() static

Subsystem: kcov

    Marco Elver <elver@google.com>:
      kcov: unconditionally add -fno-stack-protector to compiler options

    Wei Yongjun <weiyongjun1@huawei.com>:
      kcov: make some symbols static

Subsystem: kgdb

    Nick Desaulniers <ndesaulniers@google.com>:
      scripts/gdb: fix python 3.8 SyntaxWarning

Subsystem: ipc

    Alexey Dobriyan <adobriyan@gmail.com>:
      ipc: uninline functions

    Liao Pingfang <liao.pingfang@zte.com.cn>:
      ipc/shm.c: remove the superfluous break

Subsystem: mm/migration

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
    Patch series "clean-up the migration target allocation functions", v5:
      mm/page_isolation: prefer the node of the source page
      mm/migrate: move migration helper from .h to .c
      mm/hugetlb: unify migration callbacks
      mm/migrate: clear __GFP_RECLAIM to make the migration callback consistent with regular THP allocations
      mm/migrate: introduce a standard migration target allocation function
      mm/mempolicy: use a standard migration target allocation callback
      mm/page_alloc: remove a wrapper for alloc_migration_target()

Subsystem: mm/gup

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
      mm/gup: restrict CMA region by using allocation scope API
      mm/hugetlb: make hugetlb migration callback CMA aware
      mm/gup: use a standard migration target allocation callback

Subsystem: mm/pagemap

    Peter Xu <peterx@redhat.com>:
    Patch series "mm: Page fault accounting cleanups", v5:
      mm: do page fault accounting in handle_mm_fault
      mm/alpha: use general page fault accounting
      mm/arc: use general page fault accounting
      mm/arm: use general page fault accounting
      mm/arm64: use general page fault accounting
      mm/csky: use general page fault accounting
      mm/hexagon: use general page fault accounting
      mm/ia64: use general page fault accounting
      mm/m68k: use general page fault accounting
      mm/microblaze: use general page fault accounting
      mm/mips: use general page fault accounting
      mm/nds32: use general page fault accounting
      mm/nios2: use general page fault accounting
      mm/openrisc: use general page fault accounting
      mm/parisc: use general page fault accounting
      mm/powerpc: use general page fault accounting
      mm/riscv: use general page fault accounting
      mm/s390: use general page fault accounting
      mm/sh: use general page fault accounting
      mm/sparc32: use general page fault accounting
      mm/sparc64: use general page fault accounting
      mm/x86: use general page fault accounting
      mm/xtensa: use general page fault accounting
      mm: clean up the last pieces of page fault accountings
      mm/gup: remove task_struct pointer for all gup code

 Documentation/admin-guide/cgroup-v2.rst         |    4 
 Documentation/admin-guide/sysctl/kernel.rst     |    3 
 Documentation/admin-guide/sysctl/vm.rst         |   15 +
 Documentation/filesystems/proc.rst              |   11 -
 Documentation/vm/page_migration.rst             |   27 +++
 Makefile                                        |    4 
 arch/alpha/include/asm/io.h                     |    8 
 arch/alpha/include/asm/uaccess.h                |    2 
 arch/alpha/mm/fault.c                           |   10 -
 arch/arc/include/asm/segment.h                  |    3 
 arch/arc/kernel/process.c                       |    2 
 arch/arc/mm/fault.c                             |   20 --
 arch/arm/include/asm/uaccess.h                  |    4 
 arch/arm/kernel/signal.c                        |    2 
 arch/arm/mm/fault.c                             |   27 ---
 arch/arm64/include/asm/uaccess.h                |    2 
 arch/arm64/kernel/sdei.c                        |    2 
 arch/arm64/mm/fault.c                           |   31 ---
 arch/arm64/mm/numa.c                            |   10 -
 arch/csky/include/asm/segment.h                 |    2 
 arch/csky/mm/fault.c                            |   15 -
 arch/h8300/include/asm/segment.h                |    2 
 arch/hexagon/mm/vm_fault.c                      |   11 -
 arch/ia64/include/asm/uaccess.h                 |    2 
 arch/ia64/mm/fault.c                            |   11 -
 arch/ia64/mm/numa.c                             |    2 
 arch/m68k/include/asm/segment.h                 |    2 
 arch/m68k/include/asm/tlbflush.h                |    6 
 arch/m68k/mm/fault.c                            |   16 -
 arch/microblaze/include/asm/uaccess.h           |    2 
 arch/microblaze/mm/fault.c                      |   11 -
 arch/mips/include/asm/uaccess.h                 |    2 
 arch/mips/kernel/unaligned.c                    |   27 +--
 arch/mips/mm/fault.c                            |   16 -
 arch/nds32/include/asm/uaccess.h                |    2 
 arch/nds32/kernel/process.c                     |    2 
 arch/nds32/mm/alignment.c                       |    7 
 arch/nds32/mm/fault.c                           |   21 --
 arch/nios2/include/asm/uaccess.h                |    2 
 arch/nios2/mm/fault.c                           |   16 -
 arch/openrisc/include/asm/uaccess.h             |    2 
 arch/openrisc/mm/fault.c                        |   11 -
 arch/parisc/include/asm/uaccess.h               |    2 
 arch/parisc/mm/fault.c                          |   10 -
 arch/powerpc/include/asm/uaccess.h              |    3 
 arch/powerpc/mm/copro_fault.c                   |    7 
 arch/powerpc/mm/fault.c                         |   13 -
 arch/riscv/include/asm/uaccess.h                |    6 
 arch/riscv/mm/fault.c                           |   18 --
 arch/s390/include/asm/uaccess.h                 |    2 
 arch/s390/kvm/interrupt.c                       |    2 
 arch/s390/kvm/kvm-s390.c                        |    2 
 arch/s390/kvm/priv.c                            |    8 
 arch/s390/mm/fault.c                            |   18 --
 arch/s390/mm/gmap.c                             |    4 
 arch/sh/include/asm/segment.h                   |    3 
 arch/sh/include/asm/sparsemem.h                 |    4 
 arch/sh/kernel/traps_32.c                       |   12 -
 arch/sh/mm/fault.c                              |   13 -
 arch/sh/mm/init.c                               |    9 -
 arch/sparc/include/asm/sparsemem.h              |    1 
 arch/sparc/include/asm/uaccess_32.h             |    2 
 arch/sparc/include/asm/uaccess_64.h             |    2 
 arch/sparc/mm/fault_32.c                        |   15 -
 arch/sparc/mm/fault_64.c                        |   13 -
 arch/um/kernel/trap.c                           |    6 
 arch/x86/include/asm/uaccess.h                  |    2 
 arch/x86/mm/fault.c                             |   19 --
 arch/x86/mm/init_64.c                           |    9 +
 arch/x86/mm/numa.c                              |    1 
 arch/xtensa/include/asm/uaccess.h               |    2 
 arch/xtensa/mm/fault.c                          |   17 -
 drivers/firmware/arm_sdei.c                     |    5 
 drivers/gpu/drm/i915/gem/i915_gem_userptr.c     |    2 
 drivers/infiniband/core/umem_odp.c              |    2 
 drivers/iommu/amd/iommu_v2.c                    |    2 
 drivers/iommu/intel/svm.c                       |    3 
 drivers/rapidio/devices/rio_mport_cdev.c        |    7 
 drivers/rapidio/rio-scan.c                      |    8 
 drivers/vfio/vfio_iommu_type1.c                 |    4 
 fs/coredump.c                                   |   17 +
 fs/exec.c                                       |   38 ++--
 fs/fat/Kconfig                                  |    2 
 fs/fat/fatent.c                                 |    3 
 fs/fat/file.c                                   |    4 
 fs/hugetlbfs/inode.c                            |    6 
 fs/minix/inode.c                                |   48 ++++-
 fs/minix/itree_common.c                         |    8 
 fs/minix/itree_v1.c                             |   16 -
 fs/minix/itree_v2.c                             |   15 -
 fs/minix/minix.h                                |    1 
 fs/namei.c                                      |   10 -
 fs/nilfs2/alloc.c                               |   38 ++--
 fs/nilfs2/btree.c                               |   42 ++--
 fs/nilfs2/cpfile.c                              |   10 -
 fs/nilfs2/dat.c                                 |   14 -
 fs/nilfs2/direct.c                              |   14 -
 fs/nilfs2/gcinode.c                             |    2 
 fs/nilfs2/ifile.c                               |    4 
 fs/nilfs2/inode.c                               |   32 +--
 fs/nilfs2/ioctl.c                               |   37 ++--
 fs/nilfs2/mdt.c                                 |    2 
 fs/nilfs2/namei.c                               |    6 
 fs/nilfs2/nilfs.h                               |   18 +-
 fs/nilfs2/page.c                                |   11 -
 fs/nilfs2/recovery.c                            |   32 +--
 fs/nilfs2/segbuf.c                              |    2 
 fs/nilfs2/segment.c                             |   38 ++--
 fs/nilfs2/sufile.c                              |   29 +--
 fs/nilfs2/super.c                               |   73 ++++----
 fs/nilfs2/sysfs.c                               |   29 +--
 fs/nilfs2/the_nilfs.c                           |   85 ++++-----
 fs/open.c                                       |    6 
 fs/proc/base.c                                  |   11 +
 fs/proc/task_mmu.c                              |    4 
 fs/signalfd.c                                   |   10 -
 fs/ufs/super.c                                  |    2 
 include/asm-generic/uaccess.h                   |    4 
 include/clocksource/timer-ti-dm.h               |    2 
 include/linux/async_tx.h                        |    2 
 include/linux/btree.h                           |    2 
 include/linux/compaction.h                      |    6 
 include/linux/compiler-clang.h                  |    2 
 include/linux/compiler_types.h                  |   44 ++---
 include/linux/crash_core.h                      |    6 
 include/linux/delay.h                           |    2 
 include/linux/dma/k3-psil.h                     |    2 
 include/linux/dma/k3-udma-glue.h                |    2 
 include/linux/dma/ti-cppi5.h                    |    2 
 include/linux/exportfs.h                        |    2 
 include/linux/frontswap.h                       |    2 
 include/linux/fs.h                              |   10 +
 include/linux/generic-radix-tree.h              |    2 
 include/linux/highmem.h                         |    2 
 include/linux/huge_mm.h                         |    7 
 include/linux/hugetlb.h                         |   53 ++++--
 include/linux/irqchip/irq-omap-intc.h           |    2 
 include/linux/jhash.h                           |    2 
 include/linux/kernel.h                          |   12 -
 include/linux/leds-ti-lmu-common.h              |    2 
 include/linux/memcontrol.h                      |   12 +
 include/linux/mempolicy.h                       |   18 +-
 include/linux/migrate.h                         |   42 +---
 include/linux/mm.h                              |   20 +-
 include/linux/mmzone.h                          |   17 +
 include/linux/oom.h                             |    4 
 include/linux/pgtable.h                         |   12 -
 include/linux/platform_data/davinci-cpufreq.h   |    2 
 include/linux/platform_data/davinci_asp.h       |    2 
 include/linux/platform_data/elm.h               |    2 
 include/linux/platform_data/gpio-davinci.h      |    2 
 include/linux/platform_data/gpmc-omap.h         |    2 
 include/linux/platform_data/mtd-davinci-aemif.h |    2 
 include/linux/platform_data/omap-twl4030.h      |    2 
 include/linux/platform_data/uio_pruss.h         |    2 
 include/linux/platform_data/usb-omap.h          |    2 
 include/linux/poison.h                          |    4 
 include/linux/sched/mm.h                        |    8 
 include/linux/sched/task.h                      |    1 
 include/linux/soc/ti/k3-ringacc.h               |    2 
 include/linux/soc/ti/knav_qmss.h                |    2 
 include/linux/soc/ti/ti-msgmgr.h                |    2 
 include/linux/swap.h                            |   25 ++
 include/linux/syscalls.h                        |    2 
 include/linux/uaccess.h                         |   20 ++
 include/linux/vm_event_item.h                   |    3 
 include/linux/wkup_m3_ipc.h                     |    2 
 include/linux/xxhash.h                          |    2 
 include/linux/xz.h                              |    4 
 include/linux/zlib.h                            |    2 
 include/soc/arc/aux.h                           |    2 
 include/trace/events/migrate.h                  |   17 +
 include/uapi/linux/auto_dev-ioctl.h             |    2 
 include/uapi/linux/elf.h                        |    2 
 include/uapi/linux/map_to_7segment.h            |    2 
 include/uapi/linux/types.h                      |    2 
 include/uapi/linux/usb/ch9.h                    |    2 
 ipc/sem.c                                       |    3 
 ipc/shm.c                                       |    4 
 kernel/Makefile                                 |    2 
 kernel/crash_core.c                             |   50 +++++
 kernel/events/callchain.c                       |    5 
 kernel/events/core.c                            |    5 
 kernel/events/uprobes.c                         |    8 
 kernel/exit.c                                   |   18 +-
 kernel/futex.c                                  |    2 
 kernel/kcov.c                                   |    6 
 kernel/kmod.c                                   |    5 
 kernel/kthread.c                                |    5 
 kernel/panic.c                                  |    4 
 kernel/stacktrace.c                             |    5 
 kernel/sysctl.c                                 |   11 +
 kernel/umh.c                                    |   29 ---
 lib/Kconfig.debug                               |   27 ++-
 lib/Makefile                                    |    1 
 lib/bitmap.c                                    |    4 
 lib/crc64.c                                     |    2 
 lib/decompress_bunzip2.c                        |    2 
 lib/decompress_unlzma.c                         |    6 
 lib/kstrtox.c                                   |   20 --
 lib/lz4/lz4_compress.c                          |    4 
 lib/lz4/lz4_decompress.c                        |   18 +-
 lib/lz4/lz4defs.h                               |   10 +
 lib/lz4/lz4hc_compress.c                        |    2 
 lib/math/rational.c                             |    2 
 lib/rbtree.c                                    |    2 
 lib/test_bitmap.c                               |   58 ++++++
 lib/test_bitops.c                               |   18 +-
 lib/test_bits.c                                 |   75 ++++++++
 lib/test_kmod.c                                 |    2 
 lib/test_lockup.c                               |    6 
 lib/ts_bm.c                                     |    2 
 lib/xxhash.c                                    |    2 
 lib/xz/xz_crc32.c                               |    2 
 lib/xz/xz_dec_bcj.c                             |    2 
 lib/xz/xz_dec_lzma2.c                           |    2 
 lib/xz/xz_lzma2.h                               |    2 
 lib/xz/xz_stream.h                              |    2 
 mm/cma.c                                        |   40 +---
 mm/cma.h                                        |    4 
 mm/compaction.c                                 |  207 +++++++++++++++++++++--
 mm/filemap.c                                    |    2 
 mm/gup.c                                        |  195 ++++++----------------
 mm/hmm.c                                        |    5 
 mm/huge_memory.c                                |   23 --
 mm/hugetlb.c                                    |   93 ++++------
 mm/internal.h                                   |    9 -
 mm/khugepaged.c                                 |    2 
 mm/ksm.c                                        |    3 
 mm/maccess.c                                    |   22 +-
 mm/memcontrol.c                                 |   42 +++-
 mm/memory-failure.c                             |    7 
 mm/memory.c                                     |  107 +++++++++---
 mm/memory_hotplug.c                             |   30 ++-
 mm/mempolicy.c                                  |   49 +----
 mm/migrate.c                                    |  151 ++++++++++++++---
 mm/mmu_notifier.c                               |    9 -
 mm/nommu.c                                      |    4 
 mm/oom_kill.c                                   |   24 +-
 mm/page_alloc.c                                 |   14 +
 mm/page_isolation.c                             |   21 --
 mm/percpu-internal.h                            |   55 ++++++
 mm/percpu-km.c                                  |    5 
 mm/percpu-stats.c                               |   36 ++--
 mm/percpu-vm.c                                  |    5 
 mm/percpu.c                                     |  208 +++++++++++++++++++++---
 mm/process_vm_access.c                          |    2 
 mm/rmap.c                                       |    2 
 mm/shmem.c                                      |    5 
 mm/slab_common.c                                |    2 
 mm/swap.c                                       |   13 -
 mm/swap_state.c                                 |   80 +++++++--
 mm/swapfile.c                                   |    4 
 mm/usercopy.c                                   |    2 
 mm/userfaultfd.c                                |    2 
 mm/vmscan.c                                     |   36 ++--
 mm/vmstat.c                                     |   32 +++
 mm/workingset.c                                 |   23 +-
 mm/zpool.c                                      |    8 
 mm/zsmalloc.c                                   |    2 
 scripts/checkpatch.pl                           |  116 +++++++++----
 scripts/gdb/linux/rbtree.py                     |    4 
 security/tomoyo/domain.c                        |    2 
 tools/testing/selftests/cgroup/test_kmem.c      |   70 +++++++-
 tools/testing/selftests/kmod/kmod.sh            |    4 
 tools/testing/selftests/vm/hmm-tests.c          |   35 ++++
 virt/kvm/async_pf.c                             |    2 
 virt/kvm/kvm_main.c                             |    2 
 268 files changed, 2481 insertions(+), 1551 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-08-15  0:29 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-08-15  0:29 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


39 patches, based on b923f1247b72fc100b87792fd2129d026bb10e66.

Subsystems affected by this patch series:

  mm/hotfixes
  lz4
  exec
  mailmap
  mm/thp
  autofs
  mm/madvise
  sysctl
  mm/kmemleak
  mm/misc
  lib

Subsystem: mm/hotfixes

    Mike Rapoport <rppt@linux.ibm.com>:
      asm-generic: pgalloc.h: use correct #ifdef to enable pud_alloc_one()

    Baoquan He <bhe@redhat.com>:
      Revert "mm/vmstat.c: do not show lowmem reserve protection information of empty zone"

Subsystem: lz4

    Nick Terrell <terrelln@fb.com>:
      lz4: fix kernel decompression speed

Subsystem: exec

    Kees Cook <keescook@chromium.org>:
    Patch series "Fix S_ISDIR execve() errno":
      exec: restore EACCES of S_ISDIR execve()
      selftests/exec: add file type errno tests

Subsystem: mailmap

    Greg Kurz <groug@kaod.org>:
      mailmap: add entry for Greg Kurz

Subsystem: mm/thp

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "THP prep patches":
      mm: store compound_nr as well as compound_order
      mm: move page-flags include to top of file
      mm: add thp_order
      mm: add thp_size
      mm: replace hpage_nr_pages with thp_nr_pages
      mm: add thp_head
      mm: introduce offset_in_thp

Subsystem: autofs

    Randy Dunlap <rdunlap@infradead.org>:
      fs: autofs: delete repeated words in comments

Subsystem: mm/madvise

    Minchan Kim <minchan@kernel.org>:
    Patch series "introduce memory hinting API for external process", v8:
      mm/madvise: pass task and mm to do_madvise
      pid: move pidfd_get_pid() to pid.c
      mm/madvise: introduce process_madvise() syscall: an external memory hinting API
      mm/madvise: check fatal signal pending of target process

Subsystem: sysctl

    Xiaoming Ni <nixiaoming@huawei.com>:
      all arch: remove system call sys_sysctl

Subsystem: mm/kmemleak

    Qian Cai <cai@lca.pw>:
      mm/kmemleak: silence KCSAN splats in checksum

Subsystem: mm/misc

    Qian Cai <cai@lca.pw>:
      mm/frontswap: mark various intentional data races
      mm/page_io: mark various intentional data races
      mm/swap_state: mark various intentional data races

    Kirill A. Shutemov <kirill@shutemov.name>:
      mm/filemap.c: fix a data race in filemap_fault()

    Qian Cai <cai@lca.pw>:
      mm/swapfile: fix and annotate various data races
      mm/page_counter: fix various data races at memsw
      mm/memcontrol: fix a data race in scan count
      mm/list_lru: fix a data race in list_lru_count_one
      mm/mempool: fix a data race in mempool_free()
      mm/rmap: annotate a data race at tlb_flush_batched
      mm/swap.c: annotate data races for lru_rotate_pvecs
      mm: annotate a data race in page_zonenum()

    Romain Naour <romain.naour@gmail.com>:
      include/asm-generic/vmlinux.lds.h: align ro_after_init

    Kuninori Morimoto <kuninori.morimoto.gx@renesas.com>:
      sh: clkfwk: remove r8/r16/r32
      sh: use generic strncpy()

Subsystem: lib

    Krzysztof Kozlowski <krzk@kernel.org>:
    Patch series "iomap: Constify ioreadX() iomem argument", v3:
      iomap: constify ioreadX() iomem argument (as in generic implementation)
      rtl818x: constify ioreadX() iomem argument (as in generic implementation)
      ntb: intel: constify ioreadX() iomem argument (as in generic implementation)
      virtio: pci: constify ioreadX() iomem argument (as in generic implementation)

 .mailmap                                               |    1 
 arch/alpha/include/asm/core_apecs.h                    |    6 
 arch/alpha/include/asm/core_cia.h                      |    6 
 arch/alpha/include/asm/core_lca.h                      |    6 
 arch/alpha/include/asm/core_marvel.h                   |    4 
 arch/alpha/include/asm/core_mcpcia.h                   |    6 
 arch/alpha/include/asm/core_t2.h                       |    2 
 arch/alpha/include/asm/io.h                            |   12 -
 arch/alpha/include/asm/io_trivial.h                    |   16 -
 arch/alpha/include/asm/jensen.h                        |    2 
 arch/alpha/include/asm/machvec.h                       |    6 
 arch/alpha/kernel/core_marvel.c                        |    2 
 arch/alpha/kernel/io.c                                 |   12 -
 arch/alpha/kernel/syscalls/syscall.tbl                 |    3 
 arch/arm/configs/am200epdkit_defconfig                 |    1 
 arch/arm/tools/syscall.tbl                             |    3 
 arch/arm64/include/asm/unistd.h                        |    2 
 arch/arm64/include/asm/unistd32.h                      |    6 
 arch/ia64/kernel/syscalls/syscall.tbl                  |    3 
 arch/m68k/kernel/syscalls/syscall.tbl                  |    3 
 arch/microblaze/kernel/syscalls/syscall.tbl            |    3 
 arch/mips/configs/cu1000-neo_defconfig                 |    1 
 arch/mips/kernel/syscalls/syscall_n32.tbl              |    3 
 arch/mips/kernel/syscalls/syscall_n64.tbl              |    3 
 arch/mips/kernel/syscalls/syscall_o32.tbl              |    3 
 arch/parisc/include/asm/io.h                           |    4 
 arch/parisc/kernel/syscalls/syscall.tbl                |    3 
 arch/parisc/lib/iomap.c                                |   72 +++---
 arch/powerpc/kernel/iomap.c                            |   28 +-
 arch/powerpc/kernel/syscalls/syscall.tbl               |    3 
 arch/s390/kernel/syscalls/syscall.tbl                  |    3 
 arch/sh/configs/dreamcast_defconfig                    |    1 
 arch/sh/configs/espt_defconfig                         |    1 
 arch/sh/configs/hp6xx_defconfig                        |    1 
 arch/sh/configs/landisk_defconfig                      |    1 
 arch/sh/configs/lboxre2_defconfig                      |    1 
 arch/sh/configs/microdev_defconfig                     |    1 
 arch/sh/configs/migor_defconfig                        |    1 
 arch/sh/configs/r7780mp_defconfig                      |    1 
 arch/sh/configs/r7785rp_defconfig                      |    1 
 arch/sh/configs/rts7751r2d1_defconfig                  |    1 
 arch/sh/configs/rts7751r2dplus_defconfig               |    1 
 arch/sh/configs/se7206_defconfig                       |    1 
 arch/sh/configs/se7343_defconfig                       |    1 
 arch/sh/configs/se7619_defconfig                       |    1 
 arch/sh/configs/se7705_defconfig                       |    1 
 arch/sh/configs/se7750_defconfig                       |    1 
 arch/sh/configs/se7751_defconfig                       |    1 
 arch/sh/configs/secureedge5410_defconfig               |    1 
 arch/sh/configs/sh03_defconfig                         |    1 
 arch/sh/configs/sh7710voipgw_defconfig                 |    1 
 arch/sh/configs/sh7757lcr_defconfig                    |    1 
 arch/sh/configs/sh7763rdp_defconfig                    |    1 
 arch/sh/configs/shmin_defconfig                        |    1 
 arch/sh/configs/titan_defconfig                        |    1 
 arch/sh/include/asm/string_32.h                        |   26 --
 arch/sh/kernel/iomap.c                                 |   22 -
 arch/sh/kernel/syscalls/syscall.tbl                    |    3 
 arch/sparc/kernel/syscalls/syscall.tbl                 |    3 
 arch/x86/entry/syscalls/syscall_32.tbl                 |    3 
 arch/x86/entry/syscalls/syscall_64.tbl                 |    4 
 arch/xtensa/kernel/syscalls/syscall.tbl                |    3 
 drivers/mailbox/bcm-pdc-mailbox.c                      |    2 
 drivers/net/wireless/realtek/rtl818x/rtl8180/rtl8180.h |    6 
 drivers/ntb/hw/intel/ntb_hw_gen1.c                     |    2 
 drivers/ntb/hw/intel/ntb_hw_gen3.h                     |    2 
 drivers/ntb/hw/intel/ntb_hw_intel.h                    |    2 
 drivers/nvdimm/btt.c                                   |    4 
 drivers/nvdimm/pmem.c                                  |    6 
 drivers/sh/clk/cpg.c                                   |   25 --
 drivers/virtio/virtio_pci_modern.c                     |    6 
 fs/autofs/dev-ioctl.c                                  |    4 
 fs/io_uring.c                                          |    2 
 fs/namei.c                                             |    4 
 include/asm-generic/iomap.h                            |   28 +-
 include/asm-generic/pgalloc.h                          |    2 
 include/asm-generic/vmlinux.lds.h                      |    1 
 include/linux/compat.h                                 |    5 
 include/linux/huge_mm.h                                |   58 ++++-
 include/linux/io-64-nonatomic-hi-lo.h                  |    4 
 include/linux/io-64-nonatomic-lo-hi.h                  |    4 
 include/linux/memcontrol.h                             |    2 
 include/linux/mm.h                                     |   16 -
 include/linux/mm_inline.h                              |    6 
 include/linux/mm_types.h                               |    1 
 include/linux/pagemap.h                                |    6 
 include/linux/pid.h                                    |    1 
 include/linux/syscalls.h                               |    4 
 include/linux/sysctl.h                                 |    6 
 include/uapi/asm-generic/unistd.h                      |    4 
 kernel/Makefile                                        |    2 
 kernel/exit.c                                          |   17 -
 kernel/pid.c                                           |   17 +
 kernel/sys_ni.c                                        |    3 
 kernel/sysctl_binary.c                                 |  171 --------------
 lib/iomap.c                                            |   30 +-
 lib/lz4/lz4_compress.c                                 |    4 
 lib/lz4/lz4_decompress.c                               |   18 -
 lib/lz4/lz4defs.h                                      |   10 
 lib/lz4/lz4hc_compress.c                               |    2 
 mm/compaction.c                                        |    2 
 mm/filemap.c                                           |   22 +
 mm/frontswap.c                                         |    8 
 mm/gup.c                                               |    2 
 mm/internal.h                                          |    4 
 mm/kmemleak.c                                          |    2 
 mm/list_lru.c                                          |    2 
 mm/madvise.c                                           |  190 ++++++++++++++--
 mm/memcontrol.c                                        |   10 
 mm/memory.c                                            |    4 
 mm/memory_hotplug.c                                    |    7 
 mm/mempolicy.c                                         |    2 
 mm/mempool.c                                           |    2 
 mm/migrate.c                                           |   18 -
 mm/mlock.c                                             |    9 
 mm/page_alloc.c                                        |    5 
 mm/page_counter.c                                      |   13 -
 mm/page_io.c                                           |   12 -
 mm/page_vma_mapped.c                                   |    6 
 mm/rmap.c                                              |   10 
 mm/swap.c                                              |   21 -
 mm/swap_state.c                                        |   10 
 mm/swapfile.c                                          |   33 +-
 mm/vmscan.c                                            |    6 
 mm/vmstat.c                                            |   12 -
 mm/workingset.c                                        |    6 
 tools/perf/arch/powerpc/entry/syscalls/syscall.tbl     |    2 
 tools/perf/arch/s390/entry/syscalls/syscall.tbl        |    2 
 tools/perf/arch/x86/entry/syscalls/syscall_64.tbl      |    2 
 tools/testing/selftests/exec/.gitignore                |    1 
 tools/testing/selftests/exec/Makefile                  |    5 
 tools/testing/selftests/exec/non-regular.c             |  196 +++++++++++++++++
 132 files changed, 815 insertions(+), 614 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-08-21  0:41 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-08-21  0:41 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

11 patches, based on 7eac66d0456fe12a462e5c14c68e97c7460989da.

Subsystems affected by this patch series:

  misc
  mm/hugetlb
  mm/vmalloc
  mm/misc
  romfs
  relay
  uprobes
  squashfs
  mm/cma
  mm/pagealloc

Subsystem: misc

    Nick Desaulniers <ndesaulniers@google.com>:
      mailmap: add Andi Kleen

Subsystem: mm/hugetlb

    Xu Wang <vulab@iscas.ac.cn>:
      hugetlb_cgroup: convert comma to semicolon

    Hugh Dickins <hughd@google.com>:
      khugepaged: adjust VM_BUG_ON_MM() in __khugepaged_enter()

Subsystem: mm/vmalloc

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/vunmap: add cond_resched() in vunmap_pmd_range

Subsystem: mm/misc

    Leon Romanovsky <leonro@nvidia.com>:
      mm/rodata_test.c: fix missing function declaration

Subsystem: romfs

    Jann Horn <jannh@google.com>:
      romfs: fix uninitialized memory leak in romfs_dev_read()

Subsystem: relay

    Wei Yongjun <weiyongjun1@huawei.com>:
      kernel/relay.c: fix memleak on destroy relay channel

Subsystem: uprobes

    Hugh Dickins <hughd@google.com>:
      uprobes: __replace_page() avoid BUG in munlock_vma_page()

Subsystem: squashfs

    Phillip Lougher <phillip@squashfs.org.uk>:
      squashfs: avoid bio_alloc() failure with 1Mbyte blocks

Subsystem: mm/cma

    Doug Berger <opendmb@gmail.com>:
      mm: include CMA pages in lowmem_reserve at boot

Subsystem: mm/pagealloc

    Charan Teja Reddy <charante@codeaurora.org>:
      mm, page_alloc: fix core hung in free_pcppages_bulk()

 .mailmap                |    1 +
 fs/romfs/storage.c      |    4 +---
 fs/squashfs/block.c     |    6 +++++-
 kernel/events/uprobes.c |    2 +-
 kernel/relay.c          |    1 +
 mm/hugetlb_cgroup.c     |    4 ++--
 mm/khugepaged.c         |    2 +-
 mm/page_alloc.c         |    7 ++++++-
 mm/rodata_test.c        |    1 +
 mm/vmalloc.c            |    2 ++
 10 files changed, 21 insertions(+), 9 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-09-04 23:34 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-09-04 23:34 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

19 patches, based on 59126901f200f5fc907153468b03c64e0081b6e6.

Subsystems affected by this patch series:

  mm/memcg
  mm/slub
  MAINTAINERS
  mm/pagemap
  ipc
  fork
  checkpatch
  mm/madvise
  mm/migration
  mm/hugetlb
  lib

Subsystem: mm/memcg

    Michal Hocko <mhocko@suse.com>:
      memcg: fix use-after-free in uncharge_batch

    Xunlei Pang <xlpang@linux.alibaba.com>:
      mm: memcg: fix memcg reclaim soft lockup

Subsystem: mm/slub

    Eugeniu Rosca <erosca@de.adit-jv.com>:
      mm: slub: fix conversion of freelist_corrupted()

Subsystem: MAINTAINERS

    Robert Richter <rric@kernel.org>:
      MAINTAINERS: update Cavium/Marvell entries

    Nick Desaulniers <ndesaulniers@google.com>:
      MAINTAINERS: add LLVM maintainers

    Randy Dunlap <rdunlap@infradead.org>:
      MAINTAINERS: IA64: mark Status as Odd Fixes only

Subsystem: mm/pagemap

    Joerg Roedel <jroedel@suse.de>:
      mm: track page table modifications in __apply_to_page_range()

Subsystem: ipc

    Tobias Klauser <tklauser@distanz.ch>:
      ipc: adjust proc_ipc_sem_dointvec definition to match prototype

Subsystem: fork

    Tobias Klauser <tklauser@distanz.ch>:
      fork: adjust sysctl_max_threads definition to match prototype

Subsystem: checkpatch

    Mrinal Pandey <mrinalmni@gmail.com>:
      checkpatch: fix the usage of capture group ( ... )

Subsystem: mm/madvise

    Yang Shi <shy828301@gmail.com>:
      mm: madvise: fix vma user-after-free

Subsystem: mm/migration

    Alistair Popple <alistair@popple.id.au>:
      mm/migrate: fixup setting UFFD_WP flag
      mm/rmap: fixup copying of soft dirty and uffd ptes

    Ralph Campbell <rcampbell@nvidia.com>:
    Patch series "mm/migrate: preserve soft dirty in remove_migration_pte()":
      mm/migrate: remove unnecessary is_zone_device_page() check
      mm/migrate: preserve soft dirty in remove_migration_pte()

Subsystem: mm/hugetlb

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm/hugetlb: try preferred node first when alloc gigantic page from cma

    Muchun Song <songmuchun@bytedance.com>:
      mm/hugetlb: fix a race between hugetlb sysctl handlers

    David Howells <dhowells@redhat.com>:
      mm/khugepaged.c: fix khugepaged's request size in collapse_file

Subsystem: lib

    Jason Gunthorpe <jgg@nvidia.com>:
      include/linux/log2.h: add missing () around n in roundup_pow_of_two()

 MAINTAINERS           |   32 ++++++++++++++++----------------
 include/linux/log2.h  |    2 +-
 ipc/ipc_sysctl.c      |    2 +-
 kernel/fork.c         |    2 +-
 mm/hugetlb.c          |   49 +++++++++++++++++++++++++++++++++++++------------
 mm/khugepaged.c       |    2 +-
 mm/madvise.c          |    2 +-
 mm/memcontrol.c       |    6 ++++++
 mm/memory.c           |   37 ++++++++++++++++++++++++-------------
 mm/migrate.c          |   31 +++++++++++++++++++------------
 mm/rmap.c             |    9 +++++++--
 mm/slub.c             |   12 ++++++------
 mm/vmscan.c           |    8 ++++++++
 scripts/checkpatch.pl |    4 ++--
 14 files changed, 130 insertions(+), 68 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-09-19  4:19 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-09-19  4:19 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

15 patches, based on 92ab97adeefccf375de7ebaad9d5b75d4125fe8b.

Subsystems affected by this patch series:

  mailmap
  mm/hotfixes
  mm/thp
  mm/memory-hotplug
  misc
  kcsan

Subsystem: mailmap

    Kees Cook <keescook@chromium.org>:
      mailmap: add older email addresses for Kees Cook

Subsystem: mm/hotfixes

    Hugh Dickins <hughd@google.com>:
    Patch series "mm: fixes to past from future testing":
      ksm: reinstate memcg charge on copied pages
      mm: migration of hugetlbfs page skip memcg
      shmem: shmem_writepage() split unlikely i915 THP
      mm: fix check_move_unevictable_pages() on THP
      mlock: fix unevictable_pgs event counts on THP

    Byron Stanoszek <gandalf@winds.org>:
      tmpfs: restore functionality of nr_inodes=0

    Muchun Song <songmuchun@bytedance.com>:
      kprobes: fix kill kprobe which has been marked as gone

Subsystem: mm/thp

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/thp: fix __split_huge_pmd_locked() for migration PMD

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      selftests/vm: fix display of page size in map_hugetlb

Subsystem: mm/memory-hotplug

    Pavel Tatashin <pasha.tatashin@soleen.com>:
      mm/memory_hotplug: drain per-cpu pages again during memory offline

Subsystem: misc

    Tobias Klauser <tklauser@distanz.ch>:
      ftrace: let ftrace_enable_sysctl take a kernel pointer buffer
      stackleak: let stack_erasing_sysctl take a kernel pointer buffer
      fs/fs-writeback.c: adjust dirtytime_interval_handler definition to match prototype

Subsystem: kcsan

    Changbin Du <changbin.du@gmail.com>:
      kcsan: kconfig: move to menu 'Generic Kernel Debugging Instruments'

 .mailmap                                 |    4 ++
 fs/fs-writeback.c                        |    2 -
 include/linux/ftrace.h                   |    3 --
 include/linux/stackleak.h                |    2 -
 kernel/kprobes.c                         |    9 +++++-
 kernel/stackleak.c                       |    2 -
 kernel/trace/ftrace.c                    |    3 --
 lib/Kconfig.debug                        |    4 --
 mm/huge_memory.c                         |   42 ++++++++++++++++---------------
 mm/ksm.c                                 |    4 ++
 mm/memory_hotplug.c                      |   14 ++++++++++
 mm/migrate.c                             |    3 +-
 mm/mlock.c                               |   24 +++++++++++------
 mm/page_isolation.c                      |    8 +++++
 mm/shmem.c                               |   20 +++++++++++---
 mm/swap.c                                |    6 ++--
 mm/vmscan.c                              |   10 +++++--
 tools/testing/selftests/vm/map_hugetlb.c |    2 -
 18 files changed, 111 insertions(+), 51 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-09-26  4:17 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-09-26  4:17 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

9 patches, based on 7c7ec3226f5f33f9c050d85ec20f18419c622ad6.

Subsystems affected by this patch series:

  mm/thp
  mm/memcg
  mm/gup
  mm/migration
  lib
  x86
  mm/memory-hotplug

Subsystem: mm/thp

    Gao Xiang <hsiangkao@redhat.com>:
      mm, THP, swap: fix allocating cluster for swapfile by mistake

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix missing suffix of workingset_restore

Subsystem: mm/gup

    Vasily Gorbik <gor@linux.ibm.com>:
      mm/gup: fix gup_fast with dynamic page table folding

Subsystem: mm/migration

    Zi Yan <ziy@nvidia.com>:
      mm/migrate: correct thp migration stats

Subsystem: lib

    Nick Desaulniers <ndesaulniers@google.com>:
      lib/string.c: implement stpcpy

    Jason Yan <yanaijie@huawei.com>:
      lib/memregion.c: include memregion.h

Subsystem: x86

    Mikulas Patocka <mpatocka@redhat.com>:
      arch/x86/lib/usercopy_64.c: fix  __copy_user_flushcache() cache writeback

Subsystem: mm/memory-hotplug

    Laurent Dufour <ldufour@linux.ibm.com>:
    Patch series "mm: fix memory to node bad links in sysfs", v3:
      mm: replace memmap_context by meminit_context
      mm: don't rely on system state to detect hot-plug operations

 Documentation/admin-guide/cgroup-v2.rst |   25 ++++++---
 arch/ia64/mm/init.c                     |    6 +-
 arch/s390/include/asm/pgtable.h         |   42 +++++++++++----
 arch/x86/lib/usercopy_64.c              |    2 
 drivers/base/node.c                     |   85 ++++++++++++++++++++------------
 include/linux/mm.h                      |    2 
 include/linux/mmzone.h                  |   11 +++-
 include/linux/node.h                    |   11 ++--
 include/linux/pgtable.h                 |   10 +++
 lib/memregion.c                         |    1 
 lib/string.c                            |   24 +++++++++
 mm/gup.c                                |   18 +++---
 mm/memcontrol.c                         |    4 -
 mm/memory_hotplug.c                     |    5 +
 mm/migrate.c                            |    7 +-
 mm/page_alloc.c                         |   10 +--
 mm/swapfile.c                           |    2 
 17 files changed, 181 insertions(+), 84 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-10-03  5:20 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-10-03  5:20 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

3 patches, based on d3d45f8220d60a0b2aaaacf8fb2be4e6ffd9008e.

Subsystems affected by this patch series:

  mm/slub
  mm/cma
  scripts

Subsystem: mm/slub

    Eric Farman <farman@linux.ibm.com>:
      mm, slub: restore initial kmem_cache flags

Subsystem: mm/cma

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
      mm/page_alloc: handle a missing case for memalloc_nocma_{save/restore} APIs

Subsystem: scripts

    Eric Biggers <ebiggers@google.com>:
      scripts/spelling.txt: fix malformed entry

 mm/page_alloc.c      |   19 ++++++++++++++++---
 mm/slub.c            |    6 +-----
 scripts/spelling.txt |    2 +-
 3 files changed, 18 insertions(+), 9 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-10-11  6:15 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-10-11  6:15 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

5 patches, based on da690031a5d6d50a361e3f19f3eeabd086a6f20d.

Subsystems affected by this patch series:

  MAINTAINERS
  mm/pagemap
  mm/swap
  mm/hugetlb

Subsystem: MAINTAINERS

    Kees Cook <keescook@chromium.org>:
      MAINTAINERS: change hardening mailing list

    Antoine Tenart <atenart@kernel.org>:
      MAINTAINERS: Antoine Tenart's email address

Subsystem: mm/pagemap

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: mmap: Fix general protection fault in unlink_file_vma()

Subsystem: mm/swap

    Minchan Kim <minchan@kernel.org>:
      mm: validate inode in mapping_set_error()

Subsystem: mm/hugetlb

    Vijay Balakrishna <vijayb@linux.microsoft.com>:
      mm: khugepaged: recalculate min_free_kbytes after memory hotplug as expected by khugepaged

 .mailmap                   |    4 +++-
 MAINTAINERS                |    8 ++++----
 include/linux/khugepaged.h |    5 +++++
 include/linux/pagemap.h    |    3 ++-
 mm/khugepaged.c            |   13 +++++++++++--
 mm/mmap.c                  |    6 +++++-
 mm/page_alloc.c            |    3 +++
 7 files changed, 33 insertions(+), 9 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-10-13 23:46 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-10-13 23:46 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

181 patches, based on 029f56db6ac248769f2c260bfaf3c3c0e23e904c.

Subsystems affected by this patch series:

  kbuild
  scripts
  ntfs
  ocfs2
  vfs
  mm/slab
  mm/slub
  mm/kmemleak
  mm/dax
  mm/debug
  mm/pagecache
  mm/fadvise
  mm/gup
  mm/swap
  mm/memremap
  mm/memcg
  mm/selftests
  mm/pagemap
  mm/mincore
  mm/hmm
  mm/dma
  mm/memory-failure
  mm/vmalloc
  mm/documentation
  mm/kasan
  mm/pagealloc
  mm/hugetlb
  mm/vmscan
  mm/z3fold
  mm/zbud
  mm/compaction
  mm/mempolicy
  mm/mempool
  mm/memblock
  mm/oom-kill
  mm/migration

Subsystem: kbuild

    Nick Desaulniers <ndesaulniers@google.com>:
    Patch series "set clang minimum version to 10.0.1", v3:
      compiler-clang: add build check for clang 10.0.1
      Revert "kbuild: disable clang's default use of -fmerge-all-constants"
      Revert "arm64: bti: Require clang >= 10.0.1 for in-kernel BTI support"
      Revert "arm64: vdso: Fix compilation with clang older than 8"
      Partially revert "ARM: 8905/1: Emit __gnu_mcount_nc when using Clang 10.0.0 or newer"

    Marco Elver <elver@google.com>:
      kasan: remove mentions of unsupported Clang versions

    Nick Desaulniers <ndesaulniers@google.com>:
      compiler-gcc: improve version error
      compiler.h: avoid escaped section names
      export.h: fix section name for CONFIG_TRIM_UNUSED_KSYMS for Clang

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      kbuild: doc: describe proper script invocation

Subsystem: scripts

    Wang Qing <wangqing@vivo.com>:
      scripts/spelling.txt: increase error-prone spell checking

    Naoki Hayama <naoki.hayama@lineo.co.jp>:
      scripts/spelling.txt: add "arbitrary" typo

    Borislav Petkov <bp@suse.de>:
      scripts/decodecode: add the capability to supply the program counter

Subsystem: ntfs

    Rustam Kovhaev <rkovhaev@gmail.com>:
      ntfs: add check for mft record size in superblock

Subsystem: ocfs2

    Randy Dunlap <rdunlap@infradead.org>:
      ocfs2: delete repeated words in comments

    Gang He <ghe@suse.com>:
      ocfs2: fix potential soft lockup during fstrim

Subsystem: vfs

    Randy Dunlap <rdunlap@infradead.org>:
      fs/xattr.c: fix kernel-doc warnings for setxattr & removexattr

    Luo Jiaxing <luojiaxing@huawei.com>:
      fs_parse: mark fs_param_bad_value() as static

Subsystem: mm/slab

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/slab.c: clean code by removing redundant if condition

    tangjianqiang <wyqt1985@gmail.com>:
      include/linux/slab.h: fix a typo error in comment

Subsystem: mm/slub

    Abel Wu <wuyun.wu@huawei.com>:
      mm/slub.c: branch optimization in free slowpath
      mm/slub: fix missing ALLOC_SLOWPATH stat when bulk alloc
      mm/slub: make add_full() condition more explicit

Subsystem: mm/kmemleak

    Davidlohr Bueso <dave@stgolabs.net>:
      mm/kmemleak: rely on rcu for task stack scanning

    Hui Su <sh_def@163.com>:
      mm,kmemleak-test.c: move kmemleak-test.c to samples dir

Subsystem: mm/dax

    Dan Williams <dan.j.williams@intel.com>:
    Patch series "device-dax: Support sub-dividing soft-reserved ranges", v5:
      x86/numa: cleanup configuration dependent command-line options
      x86/numa: add 'nohmat' option
      efi/fake_mem: arrange for a resource entry per efi_fake_mem instance
      ACPI: HMAT: refactor hmat_register_target_device to hmem_register_device
      resource: report parent to walk_iomem_res_desc() callback
      mm/memory_hotplug: introduce default phys_to_target_node() implementation
      ACPI: HMAT: attach a device for each soft-reserved range
      device-dax: drop the dax_region.pfn_flags attribute
      device-dax: move instance creation parameters to 'struct dev_dax_data'
      device-dax: make pgmap optional for instance creation
      device-dax/kmem: introduce dax_kmem_range()
      device-dax/kmem: move resource name tracking to drvdata
      device-dax/kmem: replace release_resource() with release_mem_region()
      device-dax: add an allocation interface for device-dax instances
      device-dax: introduce 'struct dev_dax' typed-driver operations
      device-dax: introduce 'seed' devices
      drivers/base: make device_find_child_by_name() compatible with sysfs inputs
      device-dax: add resize support
      mm/memremap_pages: convert to 'struct range'
      mm/memremap_pages: support multiple ranges per invocation
      device-dax: add dis-contiguous resource support
      device-dax: introduce 'mapping' devices

    Joao Martins <joao.m.martins@oracle.com>:
      device-dax: make align a per-device property

    Dan Williams <dan.j.williams@intel.com>:
      device-dax: add an 'align' attribute

    Joao Martins <joao.m.martins@oracle.com>:
      dax/hmem: introduce dax_hmem.region_idle parameter
      device-dax: add a range mapping allocation attribute

Subsystem: mm/debug

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/debug.c: do not dereference i_ino blindly

    John Hubbard <jhubbard@nvidia.com>:
      mm, dump_page: rename head_mapcount() --> head_compound_mapcount()

Subsystem: mm/pagecache

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Return head pages from find_*_entry", v2:
      mm: factor find_get_incore_page out of mincore_page
      mm: use find_get_incore_page in memcontrol
      mm: optimise madvise WILLNEED
      proc: optimise smaps for shmem entries
      i915: use find_lock_page instead of find_lock_entry
      mm: convert find_get_entry to return the head page
      mm/shmem: return head page from find_lock_entry
      mm: add find_lock_head
      mm/filemap: fix filemap_map_pages for THP

Subsystem: mm/fadvise

    Yafang Shao <laoar.shao@gmail.com>:
      mm, fadvise: improve the expensive remote LRU cache draining after FADV_DONTNEED

Subsystem: mm/gup

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/gup_benchmark: update the documentation in Kconfig
      mm/gup_benchmark: use pin_user_pages for FOLL_LONGTERM flag
      mm/gup: don't permit users to call get_user_pages with FOLL_LONGTERM

    John Hubbard <jhubbard@nvidia.com>:
      mm/gup: protect unpin_user_pages() against npages==-ERRNO

Subsystem: mm/swap

    Gao Xiang <hsiangkao@redhat.com>:
      swap: rename SWP_FS to SWAP_FS_OPS to avoid ambiguity

    Yu Zhao <yuzhao@google.com>:
      mm: remove activate_page() from unuse_pte()
      mm: remove superfluous __ClearPageActive()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/swap.c: fix confusing comment in release_pages()
      mm/swap_slots.c: remove always zero and unused return value of enable_swap_slots_cache()
      mm/page_io.c: remove useless out label in __swap_writepage()
      mm/swap.c: fix incomplete comment in lru_cache_add_inactive_or_unevictable()
      mm/swapfile.c: remove unnecessary goto out in _swap_info_get()
      mm/swapfile.c: fix potential memory leak in sys_swapon

Subsystem: mm/memremap

    Ira Weiny <ira.weiny@intel.com>:
      mm/memremap.c: convert devmap static branch to {inc,dec}

Subsystem: mm/memcg

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      mm: memcontrol: use flex_array_size() helper in memcpy()
      mm: memcontrol: use the preferred form for passing the size of a structure type

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: fix racy access to page->mem_cgroup in mem_cgroup_from_obj()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: memcontrol: correct the comment of mem_cgroup_iter()

    Waiman Long <longman@redhat.com>:
    Patch series "mm/memcg: Miscellaneous cleanups and streamlining", v2:
      mm/memcg: clean up obsolete enum charge_type
      mm/memcg: simplify mem_cgroup_get_max()
      mm/memcg: unify swap and memsw page counters

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: add the missing numa_stat interface for cgroup v2

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/page_counter: correct the obsolete func name in the comment of page_counter_try_charge()
      mm: memcontrol: reword obsolete comment of mem_cgroup_unmark_under_oom()

    Bharata B Rao <bharata@linux.ibm.com>:
      mm: memcg/slab: uncharge during kmem_cache_free_bulk()

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/memcg: fix device private memcg accounting

Subsystem: mm/selftests

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "selftests/vm: fix some minor aggravating factors in the Makefile":
      selftests/vm: fix false build success on the second and later attempts
      selftests/vm: fix incorrect gcc invocation in some cases

Subsystem: mm/pagemap

    Matthew Wilcox <willy@infradead.org>:
      mm: account PMD tables like PTE tables

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/memory.c: fix typo in __do_fault() comment
      mm/memory.c: replace vmf->vma with variable vma

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/mmap: rename __vma_unlink_common() to __vma_unlink()
      mm/mmap: leverage vma_rb_erase_ignore() to implement vma_rb_erase()

    Chinwen Chang <chinwen.chang@mediatek.com>:
    Patch series "Try to release mmap_lock temporarily in smaps_rollup", v4:
      mmap locking API: add mmap_lock_is_contended()
      mm: smaps*: extend smap_gather_stats to support specified beginning
      mm: proc: smaps_rollup: do not stall write attempts on mmap_lock

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Fix PageDoubleMap":
      mm: move PageDoubleMap bit
      mm: simplify PageDoubleMap with PF_SECOND policy

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/mmap: leave adjust_next as virtual address instead of page frame number

    Randy Dunlap <rdunlap@infradead.org>:
      mm/memory.c: fix spello of "function"

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/mmap: not necessary to check mapping separately
      mm/mmap: check on file instead of the rb_root_cached of its address_space

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: use helper function mapping_allow_writable()
      mm/mmap.c: use helper function allow_write_access() in __remove_shared_vm_struct()

    Liao Pingfang <liao.pingfang@zte.com.cn>:
      mm/mmap.c: replace do_brk with do_brk_flags in comment of insert_vm_struct()

    Peter Xu <peterx@redhat.com>:
      mm: remove src/dst mm parameter in copy_page_range()

Subsystem: mm/mincore

    yuleixzhang <yulei.kernel@gmail.com>:
      include/linux/huge_mm.h: remove mincore_huge_pmd declaration

Subsystem: mm/hmm

    Ralph Campbell <rcampbell@nvidia.com>:
      tools/testing/selftests/vm/hmm-tests.c: use the new SKIP() macro
      lib/test_hmm.c: remove unused dmirror_zero_page

Subsystem: mm/dma

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      mm/dmapool.c: replace open-coded list_for_each_entry_safe()
      mm/dmapool.c: replace hard coded function name with __func__

Subsystem: mm/memory-failure

    Xianting Tian <tian.xianting@h3c.com>:
      mm/memory-failure: do pgoff calculation before for_each_process()

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memory-failure.c: remove unused macro `writeback'

Subsystem: mm/vmalloc

    Hui Su <sh_def@163.com>:
      mm/vmalloc.c: update the comment in __vmalloc_area_node()
      mm/vmalloc.c: fix the comment of find_vm_area

Subsystem: mm/documentation

    Alexander Gordeev <agordeev@linux.ibm.com>:
      docs/vm: fix 'mm_count' vs 'mm_users' counter confusion

Subsystem: mm/kasan

    Patricia Alfonso <trishalfonso@google.com>:
    Patch series "KASAN-KUnit Integration", v14:
      kasan/kunit: add KUnit Struct to Current Task
      KUnit: KASAN Integration
      KASAN: port KASAN Tests to KUnit
      KASAN: Testing Documentation

    David Gow <davidgow@google.com>:
      mm: kasan: do not panic if both panic_on_warn and kasan_multishot set

Subsystem: mm/pagealloc

    David Hildenbrand <david@redhat.com>:
    Patch series "mm / virtio-mem: support ZONE_MOVABLE", v5:
      mm/page_alloc: tweak comments in has_unmovable_pages()
      mm/page_isolation: exit early when pageblock is isolated in set_migratetype_isolate()
      mm/page_isolation: drop WARN_ON_ONCE() in set_migratetype_isolate()
      mm/page_isolation: cleanup set_migratetype_isolate()
      virtio-mem: don't special-case ZONE_MOVABLE
      mm: document semantics of ZONE_MOVABLE

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm, isolation: avoid checking unmovable pages across pageblock boundary

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/page_alloc.c: clean code by removing unnecessary initialization
      mm/page_alloc.c: micro-optimization remove unnecessary branch
      mm/page_alloc.c: fix early params garbage value accesses
      mm/page_alloc.c: clean code by merging two functions

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/page_alloc.c: __perform_reclaim should return 'unsigned long'

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mmzone: clean code by removing unused macro parameter

    Ralph Campbell <rcampbell@nvidia.com>:
      mm: move call to compound_head() in release_pages()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/page_alloc.c: fix freeing non-compound pages

    Michal Hocko <mhocko@suse.com>:
      include/linux/gfp.h: clarify usage of GFP_ATOMIC in !preemptible contexts

Subsystem: mm/hugetlb

    Baoquan He <bhe@redhat.com>:
    Patch series "mm/hugetlb: Small cleanup and improvement", v2:
      mm/hugetlb.c: make is_hugetlb_entry_hwpoisoned return bool
      mm/hugetlb.c: remove the unnecessary non_swap_entry()
      doc/vm: fix typo in the hugetlb admin documentation

    Wei Yang <richard.weiyang@linux.alibaba.com>:
    Patch series "mm/hugetlb: code refine and simplification", v4:
      mm/hugetlb: not necessary to coalesce regions recursively
      mm/hugetlb: remove VM_BUG_ON(!nrg) in get_file_region_entry_from_cache()
      mm/hugetlb: use list_splice to merge two list at once
      mm/hugetlb: count file_region to be added when regions_needed != NULL
      mm/hugetlb: a page from buddy is not on any list
      mm/hugetlb: narrow the hugetlb_lock protection area during preparing huge page
      mm/hugetlb: take the free hpage during the iteration directly

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: add lockdep check for i_mmap_rwsem held in huge_pmd_share

Subsystem: mm/vmscan

    Chunxin Zang <zangchunxin@bytedance.com>:
      mm/vmscan: fix infinite loop in drop_slab_node

    Hui Su <sh_def@163.com>:
      mm/vmscan: fix comments for isolate_lru_page()

Subsystem: mm/z3fold

    Hui Su <sh_def@163.com>:
      mm/z3fold.c: use xx_zalloc instead xx_alloc and memset

Subsystem: mm/zbud

    Xiang Chen <chenxiang66@hisilicon.com>:
      mm/zbud: remove redundant initialization

Subsystem: mm/compaction

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/compaction.c: micro-optimization remove unnecessary branch
      include/linux/compaction.h: clean code by removing unused enum value

    John Hubbard <jhubbard@nvidia.com>:
      selftests/vm: 8x compaction_test speedup

Subsystem: mm/mempolicy

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/mempolicy: remove or narrow the lock on current
      mm: remove unused alloc_page_vma_node()

Subsystem: mm/mempool

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mempool: add 'else' to split mutually exclusive case

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "memblock: seasonal cleaning^w cleanup", v3:
      KVM: PPC: Book3S HV: simplify kvm_cma_reserve()
      dma-contiguous: simplify cma_early_percent_memory()
      arm, xtensa: simplify initialization of high memory pages
      arm64: numa: simplify dummy_numa_init()
      h8300, nds32, openrisc: simplify detection of memory extents
      riscv: drop unneeded node initialization
      mircoblaze: drop unneeded NUMA and sparsemem initializations
      memblock: make for_each_memblock_type() iterator private
      memblock: make memblock_debug and related functionality private
      memblock: reduce number of parameters in for_each_mem_range()
      arch, mm: replace for_each_memblock() with for_each_mem_pfn_range()
      arch, drivers: replace for_each_membock() with for_each_mem_range()
      x86/setup: simplify initrd relocation and reservation
      x86/setup: simplify reserve_crashkernel()
      memblock: remove unused memblock_mem_size()
      memblock: implement for_each_reserved_mem_region() using __next_mem_region()
      memblock: use separate iterators for memory and reserved regions

Subsystem: mm/oom-kill

    Suren Baghdasaryan <surenb@google.com>:
      mm, oom_adj: don't loop through tasks in __set_oom_adj when not necessary

Subsystem: mm/migration

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/migrate: remove cpages-- in migrate_vma_finalize()
      mm/migrate: remove obsolete comment about device public

 .clang-format                                |    7 
 Documentation/admin-guide/cgroup-v2.rst      |   69 +
 Documentation/admin-guide/mm/hugetlbpage.rst |    2 
 Documentation/dev-tools/kasan.rst            |   74 +
 Documentation/dev-tools/kmemleak.rst         |    2 
 Documentation/kbuild/makefiles.rst           |   20 
 Documentation/vm/active_mm.rst               |    2 
 Documentation/x86/x86_64/boot-options.rst    |    4 
 MAINTAINERS                                  |    2 
 Makefile                                     |    9 
 arch/arm/Kconfig                             |    2 
 arch/arm/include/asm/tlb.h                   |    1 
 arch/arm/kernel/setup.c                      |   18 
 arch/arm/mm/init.c                           |   59 -
 arch/arm/mm/mmu.c                            |   39 
 arch/arm/mm/pmsa-v7.c                        |   23 
 arch/arm/mm/pmsa-v8.c                        |   17 
 arch/arm/xen/mm.c                            |    7 
 arch/arm64/Kconfig                           |    2 
 arch/arm64/kernel/machine_kexec_file.c       |    6 
 arch/arm64/kernel/setup.c                    |    4 
 arch/arm64/kernel/vdso/Makefile              |    7 
 arch/arm64/mm/init.c                         |   11 
 arch/arm64/mm/kasan_init.c                   |   10 
 arch/arm64/mm/mmu.c                          |   11 
 arch/arm64/mm/numa.c                         |   15 
 arch/c6x/kernel/setup.c                      |    9 
 arch/h8300/kernel/setup.c                    |    8 
 arch/microblaze/mm/init.c                    |   23 
 arch/mips/cavium-octeon/dma-octeon.c         |   14 
 arch/mips/kernel/setup.c                     |   31 
 arch/mips/netlogic/xlp/setup.c               |    2 
 arch/nds32/kernel/setup.c                    |    8 
 arch/openrisc/kernel/setup.c                 |    9 
 arch/openrisc/mm/init.c                      |    8 
 arch/powerpc/kernel/fadump.c                 |   61 -
 arch/powerpc/kexec/file_load_64.c            |   16 
 arch/powerpc/kvm/book3s_hv_builtin.c         |   12 
 arch/powerpc/kvm/book3s_hv_uvmem.c           |   14 
 arch/powerpc/mm/book3s64/hash_utils.c        |   16 
 arch/powerpc/mm/book3s64/radix_pgtable.c     |   10 
 arch/powerpc/mm/kasan/kasan_init_32.c        |    8 
 arch/powerpc/mm/mem.c                        |   31 
 arch/powerpc/mm/numa.c                       |    7 
 arch/powerpc/mm/pgtable_32.c                 |    8 
 arch/riscv/mm/init.c                         |   36 
 arch/riscv/mm/kasan_init.c                   |   10 
 arch/s390/kernel/setup.c                     |   27 
 arch/s390/mm/page-states.c                   |    6 
 arch/s390/mm/vmem.c                          |    7 
 arch/sh/mm/init.c                            |    9 
 arch/sparc/mm/init_64.c                      |   12 
 arch/x86/include/asm/numa.h                  |    8 
 arch/x86/kernel/e820.c                       |   16 
 arch/x86/kernel/setup.c                      |   56 -
 arch/x86/mm/numa.c                           |   13 
 arch/x86/mm/numa_emulation.c                 |    3 
 arch/x86/xen/enlighten_pv.c                  |    2 
 arch/xtensa/mm/init.c                        |   55 -
 drivers/acpi/numa/hmat.c                     |   76 -
 drivers/acpi/numa/srat.c                     |    9 
 drivers/base/core.c                          |    2 
 drivers/bus/mvebu-mbus.c                     |   12 
 drivers/dax/Kconfig                          |    6 
 drivers/dax/Makefile                         |    3 
 drivers/dax/bus.c                            | 1237 +++++++++++++++++++++++----
 drivers/dax/bus.h                            |   34 
 drivers/dax/dax-private.h                    |   74 +
 drivers/dax/device.c                         |  164 +--
 drivers/dax/hmem.c                           |   56 -
 drivers/dax/hmem/Makefile                    |    8 
 drivers/dax/hmem/device.c                    |  100 ++
 drivers/dax/hmem/hmem.c                      |   93 +-
 drivers/dax/kmem.c                           |  236 ++---
 drivers/dax/pmem/compat.c                    |    2 
 drivers/dax/pmem/core.c                      |   36 
 drivers/firmware/efi/x86_fake_mem.c          |   12 
 drivers/gpu/drm/i915/gem/i915_gem_shmem.c    |    4 
 drivers/gpu/drm/nouveau/nouveau_dmem.c       |   15 
 drivers/irqchip/irq-gic-v3-its.c             |    2 
 drivers/nvdimm/badrange.c                    |   26 
 drivers/nvdimm/claim.c                       |   13 
 drivers/nvdimm/nd.h                          |    3 
 drivers/nvdimm/pfn_devs.c                    |   13 
 drivers/nvdimm/pmem.c                        |   27 
 drivers/nvdimm/region.c                      |   21 
 drivers/pci/p2pdma.c                         |   12 
 drivers/virtio/virtio_mem.c                  |   47 -
 drivers/xen/unpopulated-alloc.c              |   45 
 fs/fs_parser.c                               |    2 
 fs/ntfs/inode.c                              |    6 
 fs/ocfs2/alloc.c                             |    6 
 fs/ocfs2/localalloc.c                        |    2 
 fs/proc/base.c                               |    3 
 fs/proc/task_mmu.c                           |  104 +-
 fs/xattr.c                                   |   22 
 include/acpi/acpi_numa.h                     |   14 
 include/kunit/test.h                         |    5 
 include/linux/acpi.h                         |    2 
 include/linux/compaction.h                   |    3 
 include/linux/compiler-clang.h               |    8 
 include/linux/compiler-gcc.h                 |    2 
 include/linux/compiler.h                     |    2 
 include/linux/dax.h                          |    8 
 include/linux/export.h                       |    2 
 include/linux/fs.h                           |    4 
 include/linux/gfp.h                          |    6 
 include/linux/huge_mm.h                      |    3 
 include/linux/kasan.h                        |    6 
 include/linux/memblock.h                     |   90 +
 include/linux/memcontrol.h                   |   13 
 include/linux/memory_hotplug.h               |   23 
 include/linux/memremap.h                     |   15 
 include/linux/mm.h                           |   36 
 include/linux/mmap_lock.h                    |    5 
 include/linux/mmzone.h                       |   37 
 include/linux/numa.h                         |   11 
 include/linux/oom.h                          |    1 
 include/linux/page-flags.h                   |   42 
 include/linux/pagemap.h                      |   43 
 include/linux/range.h                        |    6 
 include/linux/sched.h                        |    4 
 include/linux/sched/coredump.h               |    1 
 include/linux/slab.h                         |    2 
 include/linux/swap.h                         |   10 
 include/linux/swap_slots.h                   |    2 
 kernel/dma/contiguous.c                      |   11 
 kernel/fork.c                                |   25 
 kernel/resource.c                            |   11 
 lib/Kconfig.debug                            |    9 
 lib/Kconfig.kasan                            |   31 
 lib/Makefile                                 |    5 
 lib/kunit/test.c                             |   13 
 lib/test_free_pages.c                        |   42 
 lib/test_hmm.c                               |   65 -
 lib/test_kasan.c                             |  732 ++++++---------
 lib/test_kasan_module.c                      |  111 ++
 mm/Kconfig                                   |    4 
 mm/Makefile                                  |    1 
 mm/compaction.c                              |    5 
 mm/debug.c                                   |   18 
 mm/dmapool.c                                 |   46 -
 mm/fadvise.c                                 |    9 
 mm/filemap.c                                 |   78 -
 mm/gup.c                                     |   44 
 mm/gup_benchmark.c                           |   23 
 mm/huge_memory.c                             |    4 
 mm/hugetlb.c                                 |  100 +-
 mm/internal.h                                |    3 
 mm/kasan/report.c                            |   34 
 mm/kmemleak-test.c                           |   99 --
 mm/kmemleak.c                                |    8 
 mm/madvise.c                                 |   21 
 mm/memblock.c                                |  102 --
 mm/memcontrol.c                              |  262 +++--
 mm/memory-failure.c                          |    5 
 mm/memory.c                                  |  147 +--
 mm/memory_hotplug.c                          |   10 
 mm/mempolicy.c                               |    8 
 mm/mempool.c                                 |   18 
 mm/memremap.c                                |  344 ++++---
 mm/migrate.c                                 |    3 
 mm/mincore.c                                 |   28 
 mm/mmap.c                                    |   45 
 mm/oom_kill.c                                |    2 
 mm/page_alloc.c                              |   82 -
 mm/page_counter.c                            |    2 
 mm/page_io.c                                 |   14 
 mm/page_isolation.c                          |   41 
 mm/shmem.c                                   |   19 
 mm/slab.c                                    |    4 
 mm/slab.h                                    |   50 -
 mm/slub.c                                    |   33 
 mm/sparse.c                                  |   10 
 mm/swap.c                                    |   14 
 mm/swap_slots.c                              |    3 
 mm/swap_state.c                              |   38 
 mm/swapfile.c                                |   12 
 mm/truncate.c                                |   58 -
 mm/vmalloc.c                                 |    6 
 mm/vmscan.c                                  |    5 
 mm/z3fold.c                                  |    3 
 mm/zbud.c                                    |    1 
 samples/Makefile                             |    1 
 samples/kmemleak/Makefile                    |    3 
 samples/kmemleak/kmemleak-test.c             |   99 ++
 scripts/decodecode                           |   29 
 scripts/spelling.txt                         |    4 
 tools/testing/nvdimm/dax-dev.c               |   28 
 tools/testing/nvdimm/test/iomap.c            |    2 
 tools/testing/selftests/vm/Makefile          |   17 
 tools/testing/selftests/vm/compaction_test.c |   11 
 tools/testing/selftests/vm/gup_benchmark.c   |   14 
 tools/testing/selftests/vm/hmm-tests.c       |    4 
 194 files changed, 4273 insertions(+), 2777 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-10-16  2:40 Andrew Morton
  2020-10-16  3:03 ` incoming Andrew Morton
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-10-16  2:40 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- most of the rest of mm/

- various other subsystems

156 patches, based on 578a7155c5a1894a789d4ece181abf9d25dc6b0d.

Subsystems affected by this patch series:

  mm/dax
  mm/debug
  mm/thp
  mm/readahead
  mm/page-poison
  mm/util
  mm/memory-hotplug
  mm/zram
  mm/cleanups
  misc
  core-kernel
  get_maintainer
  MAINTAINERS
  lib
  bitops
  checkpatch
  binfmt
  ramfs
  autofs
  nilfs
  rapidio
  panic
  relay
  kgdb
  ubsan
  romfs
  fault-injection

Subsystem: mm/dax

    Dan Williams <dan.j.williams@intel.com>:
      device-dax/kmem: fix resource release

Subsystem: mm/debug

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
    Patch series "mm/debug_vm_pgtable fixes", v4:
      powerpc/mm: add DEBUG_VM WARN for pmd_clear
      powerpc/mm: move setting pte specific flags to pfn_pte
      mm/debug_vm_pgtable/ppc64: avoid setting top bits in radom value
      mm/debug_vm_pgtables/hugevmap: use the arch helper to identify huge vmap support.
      mm/debug_vm_pgtable/savedwrite: enable savedwrite test with CONFIG_NUMA_BALANCING
      mm/debug_vm_pgtable/THP: mark the pte entry huge before using set_pmd/pud_at
      mm/debug_vm_pgtable/set_pte/pmd/pud: don't use set_*_at to update an existing pte entry
      mm/debug_vm_pgtable/locks: move non page table modifying test together
      mm/debug_vm_pgtable/locks: take correct page table lock
      mm/debug_vm_pgtable/thp: use page table depost/withdraw with THP
      mm/debug_vm_pgtable/pmd_clear: don't use pmd/pud_clear on pte entries
      mm/debug_vm_pgtable/hugetlb: disable hugetlb test on ppc64
      mm/debug_vm_pgtable: avoid none pte in pte_clear_test
      mm/debug_vm_pgtable: avoid doing memory allocation with pgtable_t mapped.

Subsystem: mm/thp

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Fix read-only THP for non-tmpfs filesystems":
      XArray: add xa_get_order
      XArray: add xas_split
      mm/filemap: fix storing to a THP shadow entry
    Patch series "Remove assumptions of THP size":
      mm/filemap: fix page cache removal for arbitrary sized THPs
      mm/memory: remove page fault assumption of compound page size
      mm/page_owner: change split_page_owner to take a count

    "Kirill A. Shutemov" <kirill@shutemov.name>:
      mm/huge_memory: fix total_mapcount assumption of page size
      mm/huge_memory: fix split assumption of page size

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/huge_memory: fix page_trans_huge_mapcount assumption of THP size
      mm/huge_memory: fix can_split_huge_page assumption of THP size
      mm/rmap: fix assumptions of THP size
      mm/truncate: fix truncation for pages of arbitrary size
      mm/page-writeback: support tail pages in wait_for_stable_page
      mm/vmscan: allow arbitrary sized pages to be paged out
      fs: add a filesystem flag for THPs
      fs: do not update nr_thps for mappings which support THPs

    Huang Ying <ying.huang@intel.com>:
      mm: fix a race during THP splitting

Subsystem: mm/readahead

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Readahead patches for 5.9/5.10":
      mm/readahead: add DEFINE_READAHEAD
      mm/readahead: make page_cache_ra_unbounded take a readahead_control
      mm/readahead: make do_page_cache_ra take a readahead_control

    David Howells <dhowells@redhat.com>:
      mm/readahead: make ondemand_readahead take a readahead_control
      mm/readahead: pass readahead_control to force_page_cache_ra

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/readahead: add page_cache_sync_ra and page_cache_async_ra

    David Howells <dhowells@redhat.com>:
      mm/filemap: fold ra_submit into do_sync_mmap_readahead
      mm/readahead: pass a file_ra_state into force_page_cache_ra

Subsystem: mm/page-poison

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
    Patch series "HWPOISON: soft offline rework", v7:
      mm,hwpoison: cleanup unused PageHuge() check
      mm, hwpoison: remove recalculating hpage
      mm,hwpoison-inject: don't pin for hwpoison_filter

    Oscar Salvador <osalvador@suse.de>:
      mm,hwpoison: unexport get_hwpoison_page and make it static
      mm,hwpoison: refactor madvise_inject_error
      mm,hwpoison: kill put_hwpoison_page
      mm,hwpoison: unify THP handling for hard and soft offline
      mm,hwpoison: rework soft offline for free pages
      mm,hwpoison: rework soft offline for in-use pages
      mm,hwpoison: refactor soft_offline_huge_page and __soft_offline_page
      mm,hwpoison: return 0 if the page is already poisoned in soft-offline

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm,hwpoison: introduce MF_MSG_UNSPLIT_THP
      mm,hwpoison: double-check page count in __get_any_page()

    Oscar Salvador <osalvador@suse.de>:
      mm,hwpoison: try to narrow window race for free pages

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/page_poison.c: replace bool variable with static key

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/vmstat.c: use helper macro abs()

Subsystem: mm/util

    Bartosz Golaszewski <bgolaszewski@baylibre.com>:
      mm/util.c: update the kerneldoc for kstrdup_const()

    Jann Horn <jannh@google.com>:
      mm/mmu_notifier: fix mmget() assert in __mmu_interval_notifier_insert

Subsystem: mm/memory-hotplug

    David Hildenbrand <david@redhat.com>:
    Patch series "mm/memory_hotplug: online_pages()/offline_pages() cleanups", v2:
      mm/memory_hotplug: inline __offline_pages() into offline_pages()
      mm/memory_hotplug: enforce section granularity when onlining/offlining
      mm/memory_hotplug: simplify page offlining
      mm/page_alloc: simplify __offline_isolated_pages()
      mm/memory_hotplug: drop nr_isolate_pageblock in offline_pages()
      mm/page_isolation: simplify return value of start_isolate_page_range()
      mm/memory_hotplug: simplify page onlining
      mm/page_alloc: drop stale pageblock comment in memmap_init_zone*()
      mm: pass migratetype into memmap_init_zone() and move_pfn_range_to_zone()
      mm/memory_hotplug: mark pageblocks MIGRATE_ISOLATE while onlining memory
    Patch series "selective merging of system ram resources", v4:
      kernel/resource: make release_mem_region_adjustable() never fail
      kernel/resource: move and rename IORESOURCE_MEM_DRIVER_MANAGED
      mm/memory_hotplug: guard more declarations by CONFIG_MEMORY_HOTPLUG
      mm/memory_hotplug: prepare passing flags to add_memory() and friends
      mm/memory_hotplug: MEMHP_MERGE_RESOURCE to specify merging of System RAM resources
      virtio-mem: try to merge system ram resources
      xen/balloon: try to merge system ram resources
      hv_balloon: try to merge system ram resources
      kernel/resource: make iomem_resource implicit in release_mem_region_adjustable()

    Laurent Dufour <ldufour@linux.ibm.com>:
      mm: don't panic when links can't be created in sysfs

    David Hildenbrand <david@redhat.com>:
    Patch series "mm: place pages to the freelist tail when onlining and undoing isolation", v2:
      mm/page_alloc: convert "report" flag of __free_one_page() to a proper flag
      mm/page_alloc: place pages to tail in __putback_isolated_page()
      mm/page_alloc: move pages to tail in move_to_free_list()
      mm/page_alloc: place pages to tail in __free_pages_core()
      mm/memory_hotplug: update comment regarding zone shuffling

Subsystem: mm/zram

    Douglas Anderson <dianders@chromium.org>:
      zram: failing to decompress is WARN_ON worthy

Subsystem: mm/cleanups

    YueHaibing <yuehaibing@huawei.com>:
      mm/slab.h: remove duplicate include

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/page_reporting.c: drop stale list head check in page_reporting_cycle

    Ira Weiny <ira.weiny@intel.com>:
      mm/highmem.c: clean up endif comments

    Yu Zhao <yuzhao@google.com>:
      mm: use self-explanatory macros rather than "2"

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: fix some broken comments

    Chen Tao <chentao3@hotmail.com>:
      mm: fix some comments formatting

    Xiaofei Tan <tanxiaofei@huawei.com>:
      mm/workingset.c: fix some doc warnings

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: use helper function put_write_access()

    Mike Rapoport <rppt@linux.ibm.com>:
      include/linux/mmzone.h: remove unused early_pfn_valid()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: rename page_order() to buddy_order()

Subsystem: misc

    Randy Dunlap <rdunlap@infradead.org>:
      fs: configfs: delete repeated words in comments

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: split out min()/max() et al. helpers

Subsystem: core-kernel

    Liao Pingfang <liao.pingfang@zte.com.cn>:
      kernel/sys.c: replace do_brk with do_brk_flags in comment of prctl_set_mm_map()

    Randy Dunlap <rdunlap@infradead.org>:
      kernel/: fix repeated words in comments
      kernel: acct.c: fix some kernel-doc nits

Subsystem: get_maintainer

    Joe Perches <joe@perches.com>:
      get_maintainer: add test for file in VCS

Subsystem: MAINTAINERS

    Joe Perches <joe@perches.com>:
      get_maintainer: exclude MAINTAINERS file(s) from --git-fallback

    Jarkko Sakkinen <jarkko.sakkinen@linux.intel.com>:
      MAINTAINERS: jarkko.sakkinen@linux.intel.com -> jarkko@kernel.org

Subsystem: lib

    Randy Dunlap <rdunlap@infradead.org>:
      lib: bitmap: delete duplicated words
      lib: libcrc32c: delete duplicated words
      lib: decompress_bunzip2: delete duplicated words
      lib: dynamic_queue_limits: delete duplicated words + fix typo
      lib: earlycpio: delete duplicated words
      lib: radix-tree: delete duplicated words
      lib: syscall: delete duplicated words
      lib: test_sysctl: delete duplicated words
      lib/mpi/mpi-bit.c: fix spello of "functions"

    Stephen Boyd <swboyd@chromium.org>:
      lib/idr.c: document calling context for IDA APIs mustn't use locks
      lib/idr.c: document that ida_simple_{get,remove}() are deprecated

    Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
      lib/scatterlist.c: avoid a double memset

    Miaohe Lin <linmiaohe@huawei.com>:
      lib/percpu_counter.c: use helper macro abs()

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      include/linux/list.h: add a macro to test if entry is pointing to the head

    Dan Carpenter <dan.carpenter@oracle.com>:
      lib/test_hmm.c: fix an error code in dmirror_allocate_chunk()

    Tobias Jordan <kernel@cdqe.de>:
      lib/crc32.c: fix trivial typo in preprocessor condition

Subsystem: bitops

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      bitops: simplify get_count_order_long()
      bitops: use the same mechanism for get_count_order[_long]

Subsystem: checkpatch

    Jerome Forissier <jerome@forissier.org>:
      checkpatch: add --kconfig-prefix

    Joe Perches <joe@perches.com>:
      checkpatch: move repeated word test
      checkpatch: add test for comma use that should be semicolon

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      const_structs.checkpatch: add phy_ops

    Nicolas Boichat <drinkcat@chromium.org>:
      checkpatch: warn if trace_printk and friends are called

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      const_structs.checkpatch: add pinctrl_ops and pinmux_ops

    Joe Perches <joe@perches.com>:
      checkpatch: warn on self-assignments
      checkpatch: allow not using -f with files that are in git

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: extend author Signed-off-by check for split From: header

    Joe Perches <joe@perches.com>:
      checkpatch: emit a warning on embedded filenames

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: fix multi-statement macro checks for while blocks.

    Łukasz Stelmach <l.stelmach@samsung.com>:
      checkpatch: fix false positive on empty block comment lines

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: add new warnings to author signoff checks.

Subsystem: binfmt

    Chris Kennelly <ckennelly@google.com>:
    Patch series "Selecting Load Addresses According to p_align", v3:
      fs/binfmt_elf: use PT_LOAD p_align values for suitable start address
      tools/testing/selftests: add self-test for verifying load alignment

    Jann Horn <jannh@google.com>:
    Patch series "Fix ELF / FDPIC ELF core dumping, and use mmap_lock properly in there", v5:
      binfmt_elf_fdpic: stop using dump_emit() on user pointers on !MMU
      coredump: let dump_emit() bail out on short writes
      coredump: refactor page range dumping into common helper
      coredump: rework elf/elf_fdpic vma_dump_size() into common helper
      binfmt_elf, binfmt_elf_fdpic: use a VMA list snapshot
      mm/gup: take mmap_lock in get_dump_page()
      mm: remove the now-unnecessary mmget_still_valid() hack

Subsystem: ramfs

    Matthew Wilcox (Oracle) <willy@infradead.org>:
      ramfs: fix nommu mmap with gaps in the page cache

Subsystem: autofs

    Matthew Wilcox <willy@infradead.org>:
      autofs: harden ioctl table

Subsystem: nilfs

    Wang Hai <wanghai38@huawei.com>:
      nilfs2: fix some kernel-doc warnings for nilfs2

Subsystem: rapidio

    Souptick Joarder <jrdr.linux@gmail.com>:
      rapidio: fix error handling path

    Jing Xiangfeng <jingxiangfeng@huawei.com>:
      rapidio: fix the missed put_device() for rio_mport_add_riodev

Subsystem: panic

    Alexey Kardashevskiy <aik@ozlabs.ru>:
      panic: dump registers on panic_on_warn

Subsystem: relay

    Sudip Mukherjee <sudipm.mukherjee@gmail.com>:
      kernel/relay.c: drop unneeded initialization

Subsystem: kgdb

    Ritesh Harjani <riteshh@linux.ibm.com>:
      scripts/gdb/proc: add struct mount & struct super_block addr in lx-mounts command
      scripts/gdb/tasks: add headers and improve spacing format

Subsystem: ubsan

    Elena Petrova <lenaptr@google.com>:
      sched.h: drop in_ubsan field when UBSAN is in trap mode

    George Popescu <georgepope@android.com>:
      ubsan: introduce CONFIG_UBSAN_LOCAL_BOUNDS for Clang

Subsystem: romfs

    Libing Zhou <libing.zhou@nokia-sbell.com>:
      ROMFS: support inode blocks calculation

Subsystem: fault-injection

    Albert van der Linde <alinde@google.com>:
    Patch series "add fault injection to user memory access", v3:
      lib, include/linux: add usercopy failure capability
      lib, uaccess: add failure injection to usercopy functions

 .mailmap                                          |    1 
 Documentation/admin-guide/kernel-parameters.txt   |    1 
 Documentation/core-api/xarray.rst                 |   14 
 Documentation/fault-injection/fault-injection.rst |    7 
 MAINTAINERS                                       |    6 
 arch/ia64/mm/init.c                               |    4 
 arch/powerpc/include/asm/book3s/64/pgtable.h      |   29 +
 arch/powerpc/include/asm/nohash/pgtable.h         |    5 
 arch/powerpc/mm/pgtable.c                         |    5 
 arch/powerpc/platforms/powernv/memtrace.c         |    2 
 arch/powerpc/platforms/pseries/hotplug-memory.c   |    2 
 drivers/acpi/acpi_memhotplug.c                    |    3 
 drivers/base/memory.c                             |    3 
 drivers/base/node.c                               |   33 +-
 drivers/block/zram/zram_drv.c                     |    2 
 drivers/dax/kmem.c                                |   50 ++-
 drivers/hv/hv_balloon.c                           |    4 
 drivers/infiniband/core/uverbs_main.c             |    3 
 drivers/rapidio/devices/rio_mport_cdev.c          |   18 -
 drivers/s390/char/sclp_cmd.c                      |    2 
 drivers/vfio/pci/vfio_pci.c                       |   38 +-
 drivers/virtio/virtio_mem.c                       |    5 
 drivers/xen/balloon.c                             |    4 
 fs/autofs/dev-ioctl.c                             |    8 
 fs/binfmt_elf.c                                   |  267 +++-------------
 fs/binfmt_elf_fdpic.c                             |  176 ++--------
 fs/configfs/dir.c                                 |    2 
 fs/configfs/file.c                                |    2 
 fs/coredump.c                                     |  238 +++++++++++++-
 fs/ext4/verity.c                                  |    4 
 fs/f2fs/verity.c                                  |    4 
 fs/inode.c                                        |    2 
 fs/nilfs2/bmap.c                                  |    2 
 fs/nilfs2/cpfile.c                                |    6 
 fs/nilfs2/page.c                                  |    1 
 fs/nilfs2/sufile.c                                |    4 
 fs/proc/task_mmu.c                                |   18 -
 fs/ramfs/file-nommu.c                             |    2 
 fs/romfs/super.c                                  |    1 
 fs/userfaultfd.c                                  |   28 -
 include/linux/bitops.h                            |   13 
 include/linux/blkdev.h                            |    1 
 include/linux/bvec.h                              |    6 
 include/linux/coredump.h                          |   13 
 include/linux/fault-inject-usercopy.h             |   22 +
 include/linux/fs.h                                |   28 -
 include/linux/idr.h                               |   13 
 include/linux/ioport.h                            |   15 
 include/linux/jiffies.h                           |    3 
 include/linux/kernel.h                            |  150 ---------
 include/linux/list.h                              |   29 +
 include/linux/memory_hotplug.h                    |   42 +-
 include/linux/minmax.h                            |  153 +++++++++
 include/linux/mm.h                                |    5 
 include/linux/mmzone.h                            |   17 -
 include/linux/node.h                              |   16 
 include/linux/nodemask.h                          |    2 
 include/linux/page-flags.h                        |    6 
 include/linux/page_owner.h                        |    6 
 include/linux/pagemap.h                           |  111 ++++++
 include/linux/sched.h                             |    2 
 include/linux/sched/mm.h                          |   25 -
 include/linux/uaccess.h                           |   12 
 include/linux/vmstat.h                            |    2 
 include/linux/xarray.h                            |   22 +
 include/ras/ras_event.h                           |    3 
 kernel/acct.c                                     |   10 
 kernel/cgroup/cpuset.c                            |    2 
 kernel/dma/direct.c                               |    2 
 kernel/fork.c                                     |    4 
 kernel/futex.c                                    |    2 
 kernel/irq/timings.c                              |    2 
 kernel/jump_label.c                               |    2 
 kernel/kcsan/encoding.h                           |    2 
 kernel/kexec_core.c                               |    2 
 kernel/kexec_file.c                               |    2 
 kernel/kthread.c                                  |    2 
 kernel/livepatch/state.c                          |    2 
 kernel/panic.c                                    |   12 
 kernel/pid_namespace.c                            |    2 
 kernel/power/snapshot.c                           |    2 
 kernel/range.c                                    |    3 
 kernel/relay.c                                    |    2 
 kernel/resource.c                                 |  114 +++++--
 kernel/smp.c                                      |    2 
 kernel/sys.c                                      |    2 
 kernel/user_namespace.c                           |    2 
 lib/Kconfig.debug                                 |    7 
 lib/Kconfig.ubsan                                 |   14 
 lib/Makefile                                      |    1 
 lib/bitmap.c                                      |    2 
 lib/crc32.c                                       |    2 
 lib/decompress_bunzip2.c                          |    2 
 lib/dynamic_queue_limits.c                        |    4 
 lib/earlycpio.c                                   |    2 
 lib/fault-inject-usercopy.c                       |   39 ++
 lib/find_bit.c                                    |    1 
 lib/hexdump.c                                     |    1 
 lib/idr.c                                         |    9 
 lib/iov_iter.c                                    |    5 
 lib/libcrc32c.c                                   |    2 
 lib/math/rational.c                               |    2 
 lib/math/reciprocal_div.c                         |    1 
 lib/mpi/mpi-bit.c                                 |    2 
 lib/percpu_counter.c                              |    2 
 lib/radix-tree.c                                  |    2 
 lib/scatterlist.c                                 |    2 
 lib/strncpy_from_user.c                           |    3 
 lib/syscall.c                                     |    2 
 lib/test_hmm.c                                    |    2 
 lib/test_sysctl.c                                 |    2 
 lib/test_xarray.c                                 |   65 ++++
 lib/usercopy.c                                    |    5 
 lib/xarray.c                                      |  208 ++++++++++++
 mm/Kconfig                                        |    2 
 mm/compaction.c                                   |    6 
 mm/debug_vm_pgtable.c                             |  267 ++++++++--------
 mm/filemap.c                                      |   58 ++-
 mm/gup.c                                          |   73 ++--
 mm/highmem.c                                      |    4 
 mm/huge_memory.c                                  |   47 +-
 mm/hwpoison-inject.c                              |   18 -
 mm/internal.h                                     |   47 +-
 mm/khugepaged.c                                   |    2 
 mm/madvise.c                                      |   52 ---
 mm/memory-failure.c                               |  357 ++++++++++------------
 mm/memory.c                                       |    7 
 mm/memory_hotplug.c                               |  223 +++++--------
 mm/memremap.c                                     |    3 
 mm/migrate.c                                      |   11 
 mm/mmap.c                                         |    7 
 mm/mmu_notifier.c                                 |    2 
 mm/page-writeback.c                               |    1 
 mm/page_alloc.c                                   |  289 +++++++++++------
 mm/page_isolation.c                               |   16 
 mm/page_owner.c                                   |   10 
 mm/page_poison.c                                  |   20 -
 mm/page_reporting.c                               |    4 
 mm/readahead.c                                    |  174 ++++------
 mm/rmap.c                                         |   10 
 mm/shmem.c                                        |    2 
 mm/shuffle.c                                      |    2 
 mm/slab.c                                         |    2 
 mm/slab.h                                         |    1 
 mm/slub.c                                         |    2 
 mm/sparse.c                                       |    2 
 mm/swap_state.c                                   |    2 
 mm/truncate.c                                     |    6 
 mm/util.c                                         |    3 
 mm/vmscan.c                                       |    5 
 mm/vmstat.c                                       |    8 
 mm/workingset.c                                   |    2 
 scripts/Makefile.ubsan                            |   10 
 scripts/checkpatch.pl                             |  238 ++++++++++----
 scripts/const_structs.checkpatch                  |    3 
 scripts/gdb/linux/proc.py                         |   15 
 scripts/gdb/linux/tasks.py                        |    9 
 scripts/get_maintainer.pl                         |    9 
 tools/testing/selftests/exec/.gitignore           |    1 
 tools/testing/selftests/exec/Makefile             |    9 
 tools/testing/selftests/exec/load_address.c       |   68 ++++
 161 files changed, 2532 insertions(+), 1864 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2020-10-16  2:40 incoming Andrew Morton
@ 2020-10-16  3:03 ` Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-10-16  3:03 UTC (permalink / raw)
  To: Linus Torvalds, mm-commits, linux-mm

And... I forgot to set in-reply-to :(

Shall resend, omitting linux-mm.

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-10-17 23:13 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-10-17 23:13 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


40 patches, based on 9d9af1007bc08971953ae915d88dc9bb21344b53.

Subsystems affected by this patch series:

  ia64
  mm/memcg
  mm/migration
  mm/pagemap
  mm/gup
  mm/madvise
  mm/vmalloc
  misc

Subsystem: ia64

    Krzysztof Kozlowski <krzk@kernel.org>:
      ia64: fix build error with !COREDUMP

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm, memcg: rework remote charging API to support nesting
    Patch series "mm: kmem: kernel memory accounting in an interrupt context":
      mm: kmem: move memcg_kmem_bypass() calls to get_mem/obj_cgroup_from_current()
      mm: kmem: remove redundant checks from get_obj_cgroup_from_current()
      mm: kmem: prepare remote memcg charging infra for interrupt contexts
      mm: kmem: enable kernel memcg accounting from interrupt contexts

Subsystem: mm/migration

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
      mm/memory-failure: remove a wrapper for alloc_migration_target()
      mm/memory_hotplug: remove a wrapper for alloc_migration_target()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/migrate: avoid possible unnecessary process right check in kernel_move_pages()

Subsystem: mm/pagemap

    "Liam R. Howlett" <Liam.Howlett@Oracle.com>:
      mm/mmap: add inline vma_next() for readability of mmap code
      mm/mmap: add inline munmap_vma_range() for code readability

Subsystem: mm/gup

    Jann Horn <jannh@google.com>:
      mm/gup_benchmark: take the mmap lock around GUP
      binfmt_elf: take the mmap lock around find_extend_vma()
      mm/gup: assert that the mmap lock is held in __get_user_pages()

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v2:
      mm/gup_benchmark: rename to mm/gup_test
      selftests/vm: use a common gup_test.h
      selftests/vm: rename run_vmtests --> run_vmtests.sh
      selftests/vm: minor cleanup: Makefile and gup_test.c
      selftests/vm: only some gup_test items are really benchmarks
      selftests/vm: gup_test: introduce the dump_pages() sub-test
      selftests/vm: run_vmtests.sh: update and clean up gup_test invocation
      selftests/vm: hmm-tests: remove the libhugetlbfs dependency
      selftests/vm: 10x speedup for hmm-tests

Subsystem: mm/madvise

    Minchan Kim <minchan@kernel.org>:
    Patch series "introduce memory hinting API for external process", v9:
      mm/madvise: pass mm to do_madvise
      pid: move pidfd_get_pid() to pid.c
      mm/madvise: introduce process_madvise() syscall: an external memory hinting API

Subsystem: mm/vmalloc

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "remove alloc_vm_area", v4:
      mm: update the documentation for vfree

    Christoph Hellwig <hch@lst.de>:
      mm: add a VM_MAP_PUT_PAGES flag for vmap
      mm: add a vmap_pfn function
      mm: allow a NULL fn callback in apply_to_page_range
      zsmalloc: switch from alloc_vm_area to get_vm_area
      drm/i915: use vmap in shmem_pin_map
      drm/i915: stop using kmap in i915_gem_object_map
      drm/i915: use vmap in i915_gem_object_map
      xen/xenbus: use apply_to_page_range directly in xenbus_map_ring_pv
      x86/xen: open code alloc_vm_area in arch_gnttab_valloc
      mm: remove alloc_vm_area
    Patch series "two small vmalloc cleanups":
      mm: cleanup the gfp_mask handling in __vmalloc_area_node
      mm: remove the filename in the top of file comment in vmalloc.c

Subsystem: misc

    Tian Tao <tiantao6@hisilicon.com>:
      mm: remove duplicate include statement in mmu.c

 Documentation/core-api/pin_user_pages.rst   |    8 
 arch/alpha/kernel/syscalls/syscall.tbl      |    1 
 arch/arm/mm/mmu.c                           |    1 
 arch/arm/tools/syscall.tbl                  |    1 
 arch/arm64/include/asm/unistd.h             |    2 
 arch/arm64/include/asm/unistd32.h           |    2 
 arch/ia64/kernel/Makefile                   |    2 
 arch/ia64/kernel/syscalls/syscall.tbl       |    1 
 arch/m68k/kernel/syscalls/syscall.tbl       |    1 
 arch/microblaze/kernel/syscalls/syscall.tbl |    1 
 arch/mips/kernel/syscalls/syscall_n32.tbl   |    1 
 arch/mips/kernel/syscalls/syscall_n64.tbl   |    1 
 arch/mips/kernel/syscalls/syscall_o32.tbl   |    1 
 arch/parisc/kernel/syscalls/syscall.tbl     |    1 
 arch/powerpc/kernel/syscalls/syscall.tbl    |    1 
 arch/s390/configs/debug_defconfig           |    2 
 arch/s390/configs/defconfig                 |    2 
 arch/s390/kernel/syscalls/syscall.tbl       |    1 
 arch/sh/kernel/syscalls/syscall.tbl         |    1 
 arch/sparc/kernel/syscalls/syscall.tbl      |    1 
 arch/x86/entry/syscalls/syscall_32.tbl      |    1 
 arch/x86/entry/syscalls/syscall_64.tbl      |    1 
 arch/x86/xen/grant-table.c                  |   27 +-
 arch/xtensa/kernel/syscalls/syscall.tbl     |    1 
 drivers/gpu/drm/i915/Kconfig                |    1 
 drivers/gpu/drm/i915/gem/i915_gem_pages.c   |  136 ++++------
 drivers/gpu/drm/i915/gt/shmem_utils.c       |   78 +-----
 drivers/xen/xenbus/xenbus_client.c          |   30 +-
 fs/binfmt_elf.c                             |    3 
 fs/buffer.c                                 |    6 
 fs/io_uring.c                               |    2 
 fs/notify/fanotify/fanotify.c               |    5 
 fs/notify/inotify/inotify_fsnotify.c        |    5 
 include/linux/memcontrol.h                  |   12 
 include/linux/mm.h                          |    2 
 include/linux/pid.h                         |    1 
 include/linux/sched/mm.h                    |   43 +--
 include/linux/syscalls.h                    |    2 
 include/linux/vmalloc.h                     |    7 
 include/uapi/asm-generic/unistd.h           |    4 
 kernel/exit.c                               |   19 -
 kernel/pid.c                                |   19 +
 kernel/sys_ni.c                             |    1 
 mm/Kconfig                                  |   24 +
 mm/Makefile                                 |    2 
 mm/gup.c                                    |    2 
 mm/gup_benchmark.c                          |  225 ------------------
 mm/gup_test.c                               |  295 +++++++++++++++++++++--
 mm/gup_test.h                               |   40 ++-
 mm/madvise.c                                |  125 ++++++++--
 mm/memcontrol.c                             |   83 ++++--
 mm/memory-failure.c                         |   18 -
 mm/memory.c                                 |   16 -
 mm/memory_hotplug.c                         |   46 +--
 mm/migrate.c                                |   71 +++--
 mm/mmap.c                                   |   74 ++++-
 mm/nommu.c                                  |    7 
 mm/percpu.c                                 |    3 
 mm/slab.h                                   |    3 
 mm/vmalloc.c                                |  147 +++++------
 mm/zsmalloc.c                               |   10 
 tools/testing/selftests/vm/.gitignore       |    3 
 tools/testing/selftests/vm/Makefile         |   40 ++-
 tools/testing/selftests/vm/check_config.sh  |   31 ++
 tools/testing/selftests/vm/config           |    2 
 tools/testing/selftests/vm/gup_benchmark.c  |  143 -----------
 tools/testing/selftests/vm/gup_test.c       |  260 ++++++++++++++++++--
 tools/testing/selftests/vm/hmm-tests.c      |   12 
 tools/testing/selftests/vm/run_vmtests      |  334 --------------------------
 tools/testing/selftests/vm/run_vmtests.sh   |  350 +++++++++++++++++++++++++++-
 70 files changed, 1580 insertions(+), 1224 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-11-02  1:06 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-11-02  1:06 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

15 patches, based on 3cea11cd5e3b00d91caf0b4730194039b45c5891.

Subsystems affected by this patch series:

  mm/memremap
  mm/memcg
  mm/slab-generic
  mm/kasan
  mm/mempolicy
  signals
  lib
  mm/pagecache
  kthread
  mm/oom-kill
  mm/pagemap
  epoll
  core-kernel

Subsystem: mm/memremap

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/mremap_pages: fix static key devmap_managed_key updates

Subsystem: mm/memcg

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb_cgroup: fix reservation accounting

    zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>:
      mm: memcontrol: correct the NR_ANON_THPS counter of hierarchical memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg: link page counters to root if use_hierarchy is false

Subsystem: mm/slab-generic

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: adopt KUNIT tests to SW_TAGS mode

Subsystem: mm/mempolicy

    Shijie Luo <luoshijie1@huawei.com>:
      mm: mempolicy: fix potential pte_unmap_unlock pte error

Subsystem: signals

    Oleg Nesterov <oleg@redhat.com>:
      ptrace: fix task_join_group_stop() for the case when current is traced

Subsystem: lib

    Vasily Gorbik <gor@linux.ibm.com>:
      lib/crc32test: remove extra local_irq_disable/enable

Subsystem: mm/pagecache

    Jason Yan <yanaijie@huawei.com>:
      mm/truncate.c: make __invalidate_mapping_pages() static

Subsystem: kthread

    Zqiang <qiang.zhang@windriver.com>:
      kthread_worker: prevent queuing delayed work from timer_fn when it is being canceled

Subsystem: mm/oom-kill

    Charles Haithcock <chaithco@redhat.com>:
      mm, oom: keep oom_adj under or at upper limit when printing

Subsystem: mm/pagemap

    Jason Gunthorpe <jgg@nvidia.com>:
      mm: always have io_remap_pfn_range() set pgprot_decrypted()

Subsystem: epoll

    Soheil Hassas Yeganeh <soheil@google.com>:
      epoll: check ep_events_available() upon timeout
      epoll: add a selftest for epoll timeout race

Subsystem: core-kernel

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      kernel/hung_task.c: make type annotations consistent

 fs/eventpoll.c                                                |   16 +
 fs/proc/base.c                                                |    2 
 include/linux/mm.h                                            |    9 
 include/linux/pgtable.h                                       |    4 
 kernel/hung_task.c                                            |    3 
 kernel/kthread.c                                              |    3 
 kernel/signal.c                                               |   19 -
 lib/crc32test.c                                               |    4 
 lib/test_kasan.c                                              |  149 +++++++---
 mm/hugetlb.c                                                  |   20 -
 mm/memcontrol.c                                               |   25 +
 mm/mempolicy.c                                                |    6 
 mm/memremap.c                                                 |   39 +-
 mm/truncate.c                                                 |    2 
 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c |   95 ++++++
 15 files changed, 290 insertions(+), 106 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-11-14  6:51 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-11-14  6:51 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

14 patches, based on 9e6a39eae450b81c8b2c8cbbfbdf8218e9b40c81.

Subsystems affected by this patch series:

  mm/migration
  mm/vmscan
  mailmap
  mm/slub
  mm/gup
  kbuild
  reboot
  kernel/watchdog
  mm/memcg
  mm/hugetlbfs
  panic
  ocfs2

Subsystem: mm/migration

    Zi Yan <ziy@nvidia.com>:
      mm/compaction: count pages and stop correctly during page isolation
      mm/compaction: stop isolation if too many pages are isolated and we have pages to migrate

Subsystem: mm/vmscan

    Nicholas Piggin <npiggin@gmail.com>:
      mm/vmscan: fix NR_ISOLATED_FILE corruption on 64-bit

Subsystem: mailmap

    Dmitry Baryshkov <dbaryshkov@gmail.com>:
      mailmap: fix entry for Dmitry Baryshkov/Eremin-Solenikov

Subsystem: mm/slub

    Laurent Dufour <ldufour@linux.ibm.com>:
      mm/slub: fix panic in slab_alloc_node()

Subsystem: mm/gup

    Jason Gunthorpe <jgg@nvidia.com>:
      mm/gup: use unpin_user_pages() in __gup_longterm_locked()

Subsystem: kbuild

    Arvind Sankar <nivedita@alum.mit.edu>:
      compiler.h: fix barrier_data() on clang

Subsystem: reboot

    Matteo Croce <mcroce@microsoft.com>:
    Patch series "fix parsing of reboot= cmdline", v3:
      Revert "kernel/reboot.c: convert simple_strtoul to kstrtoint"
      reboot: fix overflow parsing reboot cpu number

Subsystem: kernel/watchdog

    Santosh Sivaraj <santosh@fossix.org>:
      kernel/watchdog: fix watchdog_allowed_mask not used warning

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix missing wakeup polling thread

Subsystem: mm/hugetlbfs

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlbfs: fix anon huge page migration race

Subsystem: panic

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      panic: don't dump stack twice on warn

Subsystem: ocfs2

    Wengang Wang <wen.gang.wang@oracle.com>:
      ocfs2: initialize ip_next_orphan

 .mailmap                       |    5 +-
 fs/ocfs2/super.c               |    1 
 include/asm-generic/barrier.h  |    1 
 include/linux/compiler-clang.h |    6 --
 include/linux/compiler-gcc.h   |   19 --------
 include/linux/compiler.h       |   18 +++++++-
 include/linux/memcontrol.h     |   11 ++++-
 kernel/panic.c                 |    3 -
 kernel/reboot.c                |   28 ++++++------
 kernel/watchdog.c              |    4 -
 mm/compaction.c                |   12 +++--
 mm/gup.c                       |   14 ++++--
 mm/hugetlb.c                   |   90 ++---------------------------------------
 mm/memory-failure.c            |   36 +++++++---------
 mm/migrate.c                   |   46 +++++++++++---------
 mm/rmap.c                      |    5 --
 mm/slub.c                      |    2 
 mm/vmscan.c                    |    5 +-
 18 files changed, 119 insertions(+), 187 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-11-22  6:16 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-11-22  6:16 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

8 patches, based on a349e4c659609fd20e4beea89e5c4a4038e33a95.

Subsystems affected by this patch series:

  mm/madvise
  kbuild
  mm/pagemap
  mm/readahead
  mm/memcg
  mm/userfaultfd
  vfs-akpm
  mm/madvise

Subsystem: mm/madvise

    Eric Dumazet <edumazet@google.com>:
      mm/madvise: fix memory leak from process_madvise

Subsystem: kbuild

    Nick Desaulniers <ndesaulniers@google.com>:
      compiler-clang: remove version check for BPF Tracing

Subsystem: mm/pagemap

    Dan Williams <dan.j.williams@intel.com>:
      mm: fix phys_to_target_node() and memory_add_physaddr_to_nid() exports

Subsystem: mm/readahead

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: fix readahead_page_batch for retry entries

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcg/slab: fix root memcg vmstats

Subsystem: mm/userfaultfd

    Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
      mm/userfaultfd: do not access vma->vm_mm after calling handle_userfault()

Subsystem: vfs-akpm

    Yicong Yang <yangyicong@hisilicon.com>:
      libfs: fix error cast of negative value in simple_attr_write()

Subsystem: mm/madvise

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: fix madvise WILLNEED performance problem

 arch/ia64/include/asm/sparsemem.h    |    6 ++++++
 arch/powerpc/include/asm/mmzone.h    |    5 +++++
 arch/powerpc/include/asm/sparsemem.h |    5 ++---
 arch/powerpc/mm/mem.c                |    1 +
 arch/x86/include/asm/sparsemem.h     |   10 ++++++++++
 arch/x86/mm/numa.c                   |    2 ++
 drivers/dax/Kconfig                  |    1 -
 fs/libfs.c                           |    6 ++++--
 include/linux/compiler-clang.h       |    2 ++
 include/linux/memory_hotplug.h       |   14 --------------
 include/linux/numa.h                 |   30 +++++++++++++++++++++++++++++-
 include/linux/pagemap.h              |    2 ++
 mm/huge_memory.c                     |    9 ++++-----
 mm/madvise.c                         |    4 +---
 mm/memcontrol.c                      |    9 +++++++--
 mm/memory_hotplug.c                  |   18 ------------------
 16 files changed, 75 insertions(+), 49 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-12-06  6:14 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-12-06  6:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

12 patches, based on 33256ce194110874d4bc90078b577c59f9076c59.

Subsystems affected by this patch series:

  lib
  coredump
  mm/memcg
  mm/zsmalloc
  mm/swap
  mailmap
  mm/selftests
  mm/pagecache
  mm/hugetlb
  mm/pagemap

Subsystem: lib

    Randy Dunlap <rdunlap@infradead.org>:
      zlib: export S390 symbols for zlib modules

Subsystem: coredump

    Menglong Dong <dong.menglong@zte.com.cn>:
      coredump: fix core_pattern parse error

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: fix obj_cgroup_charge() return value handling

    Yang Shi <shy828301@gmail.com>:
      mm: list_lru: set shrinker map bit when child nr_items is not zero

Subsystem: mm/zsmalloc

    Minchan Kim <minchan@kernel.org>:
      mm/zsmalloc.c: drop ZSMALLOC_PGTABLE_MAPPING

Subsystem: mm/swap

    Qian Cai <qcai@redhat.com>:
      mm/swapfile: do not sleep with a spin lock held

Subsystem: mailmap

    Uwe Kleine-König <u.kleine-koenig@pengutronix.de>:
      mailmap: add two more addresses of Uwe Kleine-König

Subsystem: mm/selftests

    Xingxing Su <suxingxing@loongson.cn>:
      tools/testing/selftests/vm: fix build error

    Axel Rasmussen <axelrasmussen@google.com>:
      userfaultfd: selftests: fix SIGSEGV if huge mmap fails

Subsystem: mm/pagecache

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/filemap: add static for function __add_to_page_cache_locked

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb_cgroup: fix offline of hugetlb cgroup with reservations

Subsystem: mm/pagemap

    Liu Zixian <liuzixian4@huawei.com>:
      mm/mmap.c: fix mmap return value when vma is merged after call_mmap()

 .mailmap                                 |    2 +
 arch/arm/configs/omap2plus_defconfig     |    1 
 fs/coredump.c                            |    3 +
 include/linux/zsmalloc.h                 |    1 
 lib/zlib_dfltcc/dfltcc_inflate.c         |    3 +
 mm/Kconfig                               |   13 -------
 mm/filemap.c                             |    2 -
 mm/hugetlb_cgroup.c                      |    8 +---
 mm/list_lru.c                            |   10 ++---
 mm/mmap.c                                |   26 ++++++--------
 mm/slab.h                                |   40 +++++++++++++---------
 mm/swapfile.c                            |    4 +-
 mm/zsmalloc.c                            |   54 -------------------------------
 tools/testing/selftests/vm/Makefile      |    4 ++
 tools/testing/selftests/vm/userfaultfd.c |   25 +++++++++-----
 15 files changed, 75 insertions(+), 121 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-12-11 21:35 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-12-11 21:35 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

8 patches, based on 33dc9614dc208291d0c4bcdeb5d30d481dcd2c4c.

Subsystems affected by this patch series:

  mm/pagecache
  proc
  selftests
  kbuild
  mm/kasan
  mm/hugetlb

Subsystem: mm/pagecache

    Andrew Morton <akpm@linux-foundation.org>:
      revert "mm/filemap: add static for function __add_to_page_cache_locked"

Subsystem: proc

    Miles Chen <miles.chen@mediatek.com>:
      proc: use untagged_addr() for pagemap_read addresses

Subsystem: selftests

    Arnd Bergmann <arnd@arndb.de>:
      selftest/fpu: avoid clang warning

Subsystem: kbuild

    Arnd Bergmann <arnd@arndb.de>:
      kbuild: avoid static_assert for genksyms
      initramfs: fix clang build failure
      elfcore: fix building with clang

Subsystem: mm/kasan

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
      kasan: fix object remaining in offline per-cpu quarantine

Subsystem: mm/hugetlb

    Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
      mm/hugetlb: clear compound_nr before freeing gigantic pages

 fs/proc/task_mmu.c        |    8 ++++++--
 include/linux/build_bug.h |    5 +++++
 include/linux/elfcore.h   |   22 ++++++++++++++++++++++
 init/initramfs.c          |    2 +-
 kernel/Makefile           |    1 -
 kernel/elfcore.c          |   26 --------------------------
 lib/Makefile              |    3 ++-
 mm/filemap.c              |    2 +-
 mm/hugetlb.c              |    1 +
 mm/kasan/quarantine.c     |   39 +++++++++++++++++++++++++++++++++++++++
 10 files changed, 77 insertions(+), 32 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-12-15  3:02 Andrew Morton
  2020-12-15  3:25 ` incoming Linus Torvalds
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-12-15  3:02 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- a few random little subsystems

- almost all of the MM patches which are staged ahead of linux-next
  material.  I'll trickle to post-linux-next work in as the dependents
  get merged up.


200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442.

Subsystems affected by this patch series:

  kthread
  kbuild
  ide
  ntfs
  ocfs2
  arch
  mm/slab-generic
  mm/slab
  mm/slub
  mm/dax
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/shmem
  mm/memcg
  mm/pagemap
  mm/mremap
  mm/hmm
  mm/vmalloc
  mm/documentation
  mm/kasan
  mm/pagealloc
  mm/memory-failure
  mm/hugetlb
  mm/vmscan
  mm/z3fold
  mm/compaction
  mm/oom-kill
  mm/migration
  mm/cma
  mm/page-poison
  mm/userfaultfd
  mm/zswap
  mm/zsmalloc
  mm/uaccess
  mm/zram
  mm/cleanups

Subsystem: kthread

    Rob Clark <robdclark@chromium.org>:
      kthread: add kthread_work tracepoints

    Petr Mladek <pmladek@suse.com>:
      kthread_worker: document CPU hotplug handling

Subsystem: kbuild

    Petr Vorel <petr.vorel@gmail.com>:
      uapi: move constants from <linux/kernel.h> to <linux/const.h>

Subsystem: ide

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      ide/falcon: remove in_interrupt() usage
      ide: remove BUG_ON(in_interrupt() || irqs_disabled()) from ide_unregister()

Subsystem: ntfs

    Alex Shi <alex.shi@linux.alibaba.com>:
      fs/ntfs: remove unused varibles
      fs/ntfs: remove unused variable attr_len

Subsystem: ocfs2

    Tom Rix <trix@redhat.com>:
      fs/ocfs2/cluster/tcp.c: remove unneeded break

    Mauricio Faria de Oliveira <mfo@canonical.com>:
      ocfs2: ratelimit the 'max lookup times reached' notice

Subsystem: arch

    Colin Ian King <colin.king@canonical.com>:
      arch/Kconfig: fix spelling mistakes

Subsystem: mm/slab-generic

    Hui Su <sh_def@163.com>:
      mm/slab_common.c: use list_for_each_entry in dump_unreclaimable_slab()

    Bartosz Golaszewski <bgolaszewski@baylibre.com>:
    Patch series "slab: provide and use krealloc_array()", v3:
      mm: slab: clarify krealloc()'s behavior with __GFP_ZERO
      mm: slab: provide krealloc_array()
      ALSA: pcm: use krealloc_array()
      vhost: vringh: use krealloc_array()
      pinctrl: use krealloc_array()
      edac: ghes: use krealloc_array()
      drm: atomic: use krealloc_array()
      hwtracing: intel: use krealloc_array()
      dma-buf: use krealloc_array()

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slab, slub: clear the slab_cache field when freeing page

Subsystem: mm/slab

    Alexander Popov <alex.popov@linux.com>:
      mm/slab: rerform init_on_free earlier

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: use kmem_cache_debug_flags() in deactivate_slab()

    Bharata B Rao <bharata@linux.ibm.com>:
      mm/slub: let number of online CPUs determine the slub page order

Subsystem: mm/dax

    Dan Williams <dan.j.williams@intel.com>:
      device-dax/kmem: use struct_size()

Subsystem: mm/debug

    Zhenhua Huang <zhenhuah@codeaurora.org>:
      mm: fix page_owner initializing issue for arm32

    Liam Mark <lmark@codeaurora.org>:
      mm/page_owner: record timestamp and pid

Subsystem: mm/pagecache

    Kent Overstreet <kent.overstreet@gmail.com>:
    Patch series "generic_file_buffered_read() improvements", v2:
      mm/filemap/c: break generic_file_buffered_read up into multiple functions
      mm/filemap.c: generic_file_buffered_read() now uses find_get_pages_contig

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/truncate: add parameter explanation for invalidate_mapping_pagevec

    Hailong Liu <carver4lio@163.com>:
      mm/filemap.c: remove else after a return

Subsystem: mm/gup

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v3:
      mm/gup_benchmark: rename to mm/gup_test
      selftests/vm: use a common gup_test.h
      selftests/vm: rename run_vmtests --> run_vmtests.sh
      selftests/vm: minor cleanup: Makefile and gup_test.c
      selftests/vm: only some gup_test items are really benchmarks
      selftests/vm: gup_test: introduce the dump_pages() sub-test
      selftests/vm: run_vmtests.sh: update and clean up gup_test invocation
      selftests/vm: hmm-tests: remove the libhugetlbfs dependency
      selftests/vm: 2x speedup for run_vmtests.sh

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/gup_test.c: mark gup_test_init as __init function
      mm/gup_test: GUP_TEST depends on DEBUG_FS

    Jason Gunthorpe <jgg@nvidia.com>:
    Patch series "Add a seqcount between gup_fast and copy_page_range()", v4:
      mm/gup: reorganize internal_get_user_pages_fast()
      mm/gup: prevent gup_fast from racing with COW during fork
      mm/gup: remove the vma allocation from gup_longterm_locked()
      mm/gup: combine put_compound_head() and unpin_user_page()

Subsystem: mm/swap

    Ralph Campbell <rcampbell@nvidia.com>:
      mm: handle zone device pages in release_pages()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/swapfile.c: use helper function swap_count() in add_swap_count_continuation()
      mm/swap_state: skip meaningless swap cache readahead when ra_info.win == 0
      mm/swapfile.c: remove unnecessary out label in __swap_duplicate()
      mm/swapfile.c: use memset to fill the swap_map with SWAP_HAS_CACHE

    Jeff Layton <jlayton@kernel.org>:
      mm: remove pagevec_lookup_range_nr_tag()

Subsystem: mm/shmem

    Hui Su <sh_def@163.com>:
      mm/shmem.c: make shmem_mapping() inline

    Randy Dunlap <rdunlap@infradead.org>:
      tmpfs: fix Documentation nits

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: add file_thp, shmem_thp to memory.stat

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: remove unused mod_memcg_obj_state()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: memcontrol: eliminate redundant check in __mem_cgroup_insert_exceeded()

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcg/slab: fix return of child memcg objcg for root memcg
      mm: memcg/slab: fix use after free in obj_cgroup_charge

    Shakeel Butt <shakeelb@google.com>:
      mm/rmap: always do TTU_IGNORE_ACCESS

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: update page struct member in comments

    Roman Gushchin <guro@fb.com>:
      mm: memcg: fix obsolete code comments
    Patch series "mm: memcg: deprecate cgroup v1 non-hierarchical mode", v1:
      mm: memcg: deprecate the non-hierarchical mode
      docs: cgroup-v1: reflect the deprecation of the non-hierarchical mode
      cgroup: remove obsoleted broken_hierarchy and warned_broken_hierarchy

    Hui Su <sh_def@163.com>:
      mm/page_counter: use page_counter_read in page_counter_set_max

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      mm: memcg: remove obsolete memcg_has_children()

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcg/slab: rename *_lruvec_slab_state to *_lruvec_kmem_state

    Kaixu Xia <kaixuxia@tencent.com>:
      mm: memcontrol: sssign boolean values to a bool variable

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: remove incorrect comment

    Shakeel Butt <shakeelb@google.com>:
    Patch series "memcg: add pagetable comsumption to memory.stat", v2:
      mm: move lruvec stats update functions to vmstat.h
      mm: memcontrol: account pagetables per node

Subsystem: mm/pagemap

    Dan Williams <dan.j.williams@intel.com>:
      xen/unpopulated-alloc: consolidate pgmap manipulation

    Kalesh Singh <kaleshsingh@google.com>:
    Patch series "Speed up mremap on large regions", v4:
      kselftests: vm: add mremap tests
      mm: speedup mremap on 1GB or larger regions
      arm64: mremap speedup - enable HAVE_MOVE_PUD
      x86: mremap speedup - Enable HAVE_MOVE_PUD

    John Hubbard <jhubbard@nvidia.com>:
      mm: cleanup: remove unused tsk arg from __access_remote_vm

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/mapping_dirty_helpers: enhance the kernel-doc markups
      mm/page_vma_mapped.c: add colon to fix kernel-doc markups error for check_pte

    Axel Rasmussen <axelrasmussen@google.com>:
      mm: mmap_lock: add tracepoints around lock acquisition

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      sparc: fix handling of page table constructor failure
      mm: move free_unref_page to mm/internal.h

Subsystem: mm/mremap

    Dmitry Safonov <dima@arista.com>:
    Patch series "mremap: move_vma() fixes":
      mm/mremap: account memory on do_munmap() failure
      mm/mremap: for MREMAP_DONTUNMAP check security_vm_enough_memory_mm()
      mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio
      vm_ops: rename .split() callback to .may_split()
      mremap: check if it's possible to split original vma
      mm: forbid splitting special mappings

Subsystem: mm/hmm

    Daniel Vetter <daniel.vetter@ffwll.ch>:
      mm: track mmu notifiers in fs_reclaim_acquire/release
      mm: extract might_alloc() debug check
      locking/selftests: add testcases for fs_reclaim

Subsystem: mm/vmalloc

    Andrew Morton <akpm@linux-foundation.org>:
      mm/vmalloc.c:__vmalloc_area_node(): avoid 32-bit overflow

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: use free_vm_area() if an allocation fails
      mm/vmalloc: rework the drain logic

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/vmalloc: add 'align' parameter explanation for pvm_determine_end_from_reverse

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/vmalloc.c: remove unnecessary return statement

    Waiman Long <longman@redhat.com>:
      mm/vmalloc: Fix unlock order in s_stop()

Subsystem: mm/documentation

    Alex Shi <alex.shi@linux.alibaba.com>:
      docs/vm: remove unused 3 items explanation for /proc/vmstat

Subsystem: mm/kasan

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      mm/vmalloc.c: fix kasan shadow poisoning size

    Walter Wu <walter-zh.wu@mediatek.com>:
    Patch series "kasan: add workqueue stack for generic KASAN", v5:
      workqueue: kasan: record workqueue stack
      kasan: print workqueue stack
      lib/test_kasan.c: add workqueue test case
      kasan: update documentation for generic kasan

    Marco Elver <elver@google.com>:
      lkdtm: disable KASAN for rodata.o

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "arch, mm: deprecate DISCONTIGMEM", v2:
      alpha: switch from DISCONTIGMEM to SPARSEMEM
      ia64: remove custom __early_pfn_to_nid()
      ia64: remove 'ifdef CONFIG_ZONE_DMA32' statements
      ia64: discontig: paging_init(): remove local max_pfn calculation
      ia64: split virtual map initialization out of paging_init()
      ia64: forbid using VIRTUAL_MEM_MAP with FLATMEM
      ia64: make SPARSEMEM default and disable DISCONTIGMEM
      arm: remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL
      arm, arm64: move free_unused_memmap() to generic mm
      arc: use FLATMEM with freeing of unused memory map instead of DISCONTIGMEM
      m68k/mm: make node data and node setup depend on CONFIG_DISCONTIGMEM
      m68k/mm: enable use of generic memory_model.h for !DISCONTIGMEM
      m68k: deprecate DISCONTIGMEM
    Patch series "arch, mm: improve robustness of direct map manipulation", v7:
      mm: introduce debug_pagealloc_{map,unmap}_pages() helpers
      PM: hibernate: make direct map manipulations more explicit
      arch, mm: restore dependency of __kernel_map_pages() on DEBUG_PAGEALLOC
      arch, mm: make kernel_page_present() always available

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "disable pcplists during memory offline", v3:
      mm, page_alloc: clean up pageset high and batch update
      mm, page_alloc: calculate pageset high and batch once per zone
      mm, page_alloc: remove setup_pageset()
      mm, page_alloc: simplify pageset_update()
      mm, page_alloc: cache pageset high and batch in struct zone
      mm, page_alloc: move draining pcplists to page isolation users
      mm, page_alloc: disable pcplists during memory offline

    Miaohe Lin <linmiaohe@huawei.com>:
      include/linux/page-flags.h: remove unused __[Set|Clear]PagePrivate

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/page-flags: fix comment
      mm/page_alloc: add __free_pages() documentation

    Zou Wei <zou_wei@huawei.com>:
      mm/page_alloc: mark some symbols with static keyword

    David Hildenbrand <david@redhat.com>:
      mm/page_alloc: clear all pages in post_alloc_hook() with init_on_alloc=1

    Lin Feng <linf@wangsu.com>:
      init/main: fix broken buffer_init when DEFERRED_STRUCT_PAGE_INIT set

    Lorenzo Stoakes <lstoakes@gmail.com>:
      mm: page_alloc: refactor setup_per_zone_lowmem_reserve()

    Muchun Song <songmuchun@bytedance.com>:
      mm/page_alloc: speed up the iteration of max_order

Subsystem: mm/memory-failure

    Oscar Salvador <osalvador@suse.de>:
    Patch series "HWpoison: further fixes and cleanups", v5:
      mm,hwpoison: drain pcplists before bailing out for non-buddy zero-refcount page
      mm,hwpoison: take free pages off the buddy freelists
      mm,hwpoison: drop unneeded pcplist draining
    Patch series "HWPoison: Refactor get page interface", v2:
      mm,hwpoison: refactor get_any_page
      mm,hwpoison: disable pcplists before grabbing a refcount
      mm,hwpoison: remove drain_all_pages from shake_page
      mm,memory_failure: always pin the page in madvise_inject_error
      mm,hwpoison: return -EBUSY when migration fails

Subsystem: mm/hugetlb

    Hui Su <sh_def@163.com>:
      mm/hugetlb.c: just use put_page_testzero() instead of page_count()

    Ralph Campbell <rcampbell@nvidia.com>:
      include/linux/huge_mm.h: remove extern keyword

    Alex Shi <alex.shi@linux.alibaba.com>:
      khugepaged: add parameter explanations for kernel-doc markup

    Liu Xiang <liu.xiang@zlingsmart.com>:
      mm: hugetlb: fix type of delta parameter and related local variables in gather_surplus_pages()

    Oscar Salvador <osalvador@suse.de>:
      mm,hugetlb: remove unneeded initialization

    Dan Carpenter <dan.carpenter@oracle.com>:
      hugetlb: fix an error code in hugetlb_reserve_pages()

Subsystem: mm/vmscan

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: don't wake kswapd prematurely when watermark boosting is disabled

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      mm/vmscan: drop unneeded assignment in kswapd()

    "logic.yu" <hymmsx.yu@gmail.com>:
      mm/vmscan.c: remove the filename in the top of file comment

    Muchun Song <songmuchun@bytedance.com>:
      mm/page_isolation: do not isolate the max order page

Subsystem: mm/z3fold

    Vitaly Wool <vitaly.wool@konsulko.com>:
    Patch series "z3fold: stability / rt fixes":
      z3fold: simplify freeing slots
      z3fold: stricter locking and more careful reclaim
      z3fold: remove preempt disabled sections for RT

Subsystem: mm/compaction

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/compaction: rename 'start_pfn' to 'iteration_start_pfn' in compact_zone()

    Hui Su <sh_def@163.com>:
      mm/compaction: move compaction_suitable's comment to right place
      mm/compaction: make defer_compaction and compaction_deferred static

Subsystem: mm/oom-kill

    Hui Su <sh_def@163.com>:
      mm/oom_kill: change comment and rename is_dump_unreclaim_slabs()

Subsystem: mm/migration

    Long Li <lonuxli.64@gmail.com>:
      mm/migrate.c: fix comment spelling

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/migrate.c: optimize migrate_vma_pages() mmu notifier

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: support THPs in zero_user_segments

    Yang Shi <shy828301@gmail.com>:
    Patch series "mm: misc migrate cleanup and improvement", v3:
      mm: truncate_complete_page() does not exist any more
      mm: migrate: simplify the logic for handling permanent failure
      mm: migrate: skip shared exec THP for NUMA balancing
      mm: migrate: clean up migrate_prep{_local}
      mm: migrate: return -ENOSYS if THP migration is unsupported

    Stephen Zhang <starzhangzsd@gmail.com>:
      mm: migrate: remove unused parameter in migrate_vma_insert_page()

Subsystem: mm/cma

    Lecopzer Chen <lecopzer.chen@mediatek.com>:
      mm/cma.c: remove redundant cma_mutex lock

    Charan Teja Reddy <charante@codeaurora.org>:
      mm: cma: improve pr_debug log in cma_release()

Subsystem: mm/page-poison

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "cleanup page poisoning", v3:
      mm, page_alloc: do not rely on the order of page_poison and init_on_alloc/free parameters
      mm, page_poison: use static key more efficiently
      kernel/power: allow hibernation with page_poison sanity checking
      mm, page_poison: remove CONFIG_PAGE_POISONING_NO_SANITY
      mm, page_poison: remove CONFIG_PAGE_POISONING_ZERO

Subsystem: mm/userfaultfd

    Lokesh Gidra <lokeshgidra@google.com>:
    Patch series "Control over userfaultfd kernel-fault handling", v6:
      userfaultfd: add UFFD_USER_MODE_ONLY
      userfaultfd: add user-mode only option to unprivileged_userfaultfd sysctl knob

    Axel Rasmussen <axelrasmussen@google.com>:
      userfaultfd: selftests: make __{s,u}64 format specifiers portable

    Peter Xu <peterx@redhat.com>:
    Patch series "userfaultfd: selftests: Small fixes":
      userfaultfd/selftests: always dump something in modes
      userfaultfd/selftests: fix retval check for userfaultfd_open()
      userfaultfd/selftests: hint the test runner on required privilege

Subsystem: mm/zswap

    Joe Perches <joe@perches.com>:
      mm/zswap: make struct kernel_param_ops definitions const

    YueHaibing <yuehaibing@huawei.com>:
      mm/zswap: fix passing zero to 'PTR_ERR' warning

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/zswap: move to use crypto_acomp API for hardware acceleration

Subsystem: mm/zsmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/zsmalloc.c: rework the list_add code in insert_zspage()

Subsystem: mm/uaccess

    Colin Ian King <colin.king@canonical.com>:
      mm/process_vm_access: remove redundant initialization of iov_r

Subsystem: mm/zram

    Minchan Kim <minchan@kernel.org>:
      zram: support page writeback
      zram: add stat to gather incompressible pages since zram set up

    Rui Salvaterra <rsalvaterra@gmail.com>:
      zram: break the strict dependency from lzo

Subsystem: mm/cleanups

    Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
      mm: fix kernel-doc markups

    Joe Perches <joe@perches.com>:
    Patch series "mm: Convert sysfs sprintf family to sysfs_emit", v2:
      mm: use sysfs_emit for struct kobject * uses
      mm: huge_memory: convert remaining use of sprintf to sysfs_emit and neatening
      mm:backing-dev: use sysfs_emit in macro defining functions
      mm: shmem: convert shmem_enabled_show to use sysfs_emit_at
      mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      mm: fix fall-through warnings for Clang

    Alexey Dobriyan <adobriyan@gmail.com>:
      mm: cleanup kstrto*() usage

 /mmap_lock.h                                         |  107 ++
 a/Documentation/admin-guide/blockdev/zram.rst        |    6 
 a/Documentation/admin-guide/cgroup-v1/memcg_test.rst |    8 
 a/Documentation/admin-guide/cgroup-v1/memory.rst     |   42 
 a/Documentation/admin-guide/cgroup-v2.rst            |   11 
 a/Documentation/admin-guide/mm/transhuge.rst         |   15 
 a/Documentation/admin-guide/sysctl/vm.rst            |   15 
 a/Documentation/core-api/memory-allocation.rst       |    4 
 a/Documentation/core-api/pin_user_pages.rst          |    8 
 a/Documentation/dev-tools/kasan.rst                  |    5 
 a/Documentation/filesystems/tmpfs.rst                |    8 
 a/Documentation/vm/memory-model.rst                  |    3 
 a/Documentation/vm/page_owner.rst                    |   12 
 a/arch/Kconfig                                       |   21 
 a/arch/alpha/Kconfig                                 |    8 
 a/arch/alpha/include/asm/mmzone.h                    |   14 
 a/arch/alpha/include/asm/page.h                      |    7 
 a/arch/alpha/include/asm/pgtable.h                   |   12 
 a/arch/alpha/include/asm/sparsemem.h                 |   18 
 a/arch/alpha/kernel/setup.c                          |    1 
 a/arch/arc/Kconfig                                   |    3 
 a/arch/arc/include/asm/page.h                        |   20 
 a/arch/arc/mm/init.c                                 |   29 
 a/arch/arm/Kconfig                                   |   12 
 a/arch/arm/kernel/vdso.c                             |    9 
 a/arch/arm/mach-bcm/Kconfig                          |    1 
 a/arch/arm/mach-davinci/Kconfig                      |    1 
 a/arch/arm/mach-exynos/Kconfig                       |    1 
 a/arch/arm/mach-highbank/Kconfig                     |    1 
 a/arch/arm/mach-omap2/Kconfig                        |    1 
 a/arch/arm/mach-s5pv210/Kconfig                      |    1 
 a/arch/arm/mach-tango/Kconfig                        |    1 
 a/arch/arm/mm/init.c                                 |   78 -
 a/arch/arm64/Kconfig                                 |    9 
 a/arch/arm64/include/asm/cacheflush.h                |    1 
 a/arch/arm64/include/asm/pgtable.h                   |    1 
 a/arch/arm64/kernel/vdso.c                           |   41 
 a/arch/arm64/mm/init.c                               |   68 -
 a/arch/arm64/mm/pageattr.c                           |   12 
 a/arch/ia64/Kconfig                                  |   11 
 a/arch/ia64/include/asm/meminit.h                    |    2 
 a/arch/ia64/mm/contig.c                              |   88 --
 a/arch/ia64/mm/discontig.c                           |   44 -
 a/arch/ia64/mm/init.c                                |   14 
 a/arch/ia64/mm/numa.c                                |   30 
 a/arch/m68k/Kconfig.cpu                              |   31 
 a/arch/m68k/include/asm/page.h                       |    2 
 a/arch/m68k/include/asm/page_mm.h                    |    7 
 a/arch/m68k/include/asm/virtconvert.h                |    7 
 a/arch/m68k/mm/init.c                                |   10 
 a/arch/mips/vdso/genvdso.c                           |    4 
 a/arch/nds32/mm/mm-nds32.c                           |    6 
 a/arch/powerpc/Kconfig                               |    5 
 a/arch/riscv/Kconfig                                 |    4 
 a/arch/riscv/include/asm/pgtable.h                   |    2 
 a/arch/riscv/include/asm/set_memory.h                |    1 
 a/arch/riscv/mm/pageattr.c                           |   31 
 a/arch/s390/Kconfig                                  |    4 
 a/arch/s390/configs/debug_defconfig                  |    2 
 a/arch/s390/configs/defconfig                        |    2 
 a/arch/s390/kernel/vdso.c                            |   11 
 a/arch/sparc/Kconfig                                 |    4 
 a/arch/sparc/mm/init_64.c                            |    2 
 a/arch/x86/Kconfig                                   |    5 
 a/arch/x86/entry/vdso/vma.c                          |   17 
 a/arch/x86/include/asm/set_memory.h                  |    1 
 a/arch/x86/kernel/cpu/resctrl/pseudo_lock.c          |    2 
 a/arch/x86/kernel/tboot.c                            |    1 
 a/arch/x86/mm/pat/set_memory.c                       |    6 
 a/drivers/base/node.c                                |    2 
 a/drivers/block/zram/Kconfig                         |   42 
 a/drivers/block/zram/zcomp.c                         |    2 
 a/drivers/block/zram/zram_drv.c                      |   29 
 a/drivers/block/zram/zram_drv.h                      |    1 
 a/drivers/dax/device.c                               |    4 
 a/drivers/dax/kmem.c                                 |    2 
 a/drivers/dma-buf/sync_file.c                        |    3 
 a/drivers/edac/ghes_edac.c                           |    4 
 a/drivers/firmware/efi/efi.c                         |    1 
 a/drivers/gpu/drm/drm_atomic.c                       |    3 
 a/drivers/hwtracing/intel_th/msu.c                   |    2 
 a/drivers/ide/falconide.c                            |    2 
 a/drivers/ide/ide-probe.c                            |    3 
 a/drivers/misc/lkdtm/Makefile                        |    1 
 a/drivers/pinctrl/pinctrl-utils.c                    |    2 
 a/drivers/vhost/vringh.c                             |    3 
 a/drivers/virtio/virtio_balloon.c                    |    6 
 a/drivers/xen/unpopulated-alloc.c                    |   14 
 a/fs/aio.c                                           |    5 
 a/fs/ntfs/file.c                                     |    5 
 a/fs/ntfs/inode.c                                    |    2 
 a/fs/ntfs/logfile.c                                  |    3 
 a/fs/ocfs2/cluster/tcp.c                             |    1 
 a/fs/ocfs2/namei.c                                   |    4 
 a/fs/proc/kcore.c                                    |    2 
 a/fs/proc/meminfo.c                                  |    2 
 a/fs/userfaultfd.c                                   |   20 
 a/include/linux/cgroup-defs.h                        |   15 
 a/include/linux/compaction.h                         |   12 
 a/include/linux/fs.h                                 |    2 
 a/include/linux/gfp.h                                |    2 
 a/include/linux/highmem.h                            |   19 
 a/include/linux/huge_mm.h                            |   93 --
 a/include/linux/memcontrol.h                         |  148 ---
 a/include/linux/migrate.h                            |    4 
 a/include/linux/mm.h                                 |  118 +-
 a/include/linux/mm_types.h                           |    8 
 a/include/linux/mmap_lock.h                          |   94 ++
 a/include/linux/mmzone.h                             |   50 -
 a/include/linux/page-flags.h                         |    6 
 a/include/linux/page_ext.h                           |    8 
 a/include/linux/pagevec.h                            |    3 
 a/include/linux/poison.h                             |    4 
 a/include/linux/rmap.h                               |    1 
 a/include/linux/sched/mm.h                           |   16 
 a/include/linux/set_memory.h                         |    5 
 a/include/linux/shmem_fs.h                           |    6 
 a/include/linux/slab.h                               |   18 
 a/include/linux/vmalloc.h                            |    8 
 a/include/linux/vmstat.h                             |  104 ++
 a/include/trace/events/sched.h                       |   84 +
 a/include/uapi/linux/const.h                         |    5 
 a/include/uapi/linux/ethtool.h                       |    2 
 a/include/uapi/linux/kernel.h                        |    9 
 a/include/uapi/linux/lightnvm.h                      |    2 
 a/include/uapi/linux/mroute6.h                       |    2 
 a/include/uapi/linux/netfilter/x_tables.h            |    2 
 a/include/uapi/linux/netlink.h                       |    2 
 a/include/uapi/linux/sysctl.h                        |    2 
 a/include/uapi/linux/userfaultfd.h                   |    9 
 a/init/main.c                                        |    6 
 a/ipc/shm.c                                          |    8 
 a/kernel/cgroup/cgroup.c                             |   12 
 a/kernel/fork.c                                      |    3 
 a/kernel/kthread.c                                   |   29 
 a/kernel/power/hibernate.c                           |    2 
 a/kernel/power/power.h                               |    2 
 a/kernel/power/snapshot.c                            |   52 +
 a/kernel/ptrace.c                                    |    2 
 a/kernel/workqueue.c                                 |    3 
 a/lib/locking-selftest.c                             |   47 +
 a/lib/test_kasan_module.c                            |   29 
 a/mm/Kconfig                                         |   25 
 a/mm/Kconfig.debug                                   |   28 
 a/mm/Makefile                                        |    4 
 a/mm/backing-dev.c                                   |    8 
 a/mm/cma.c                                           |    6 
 a/mm/compaction.c                                    |   29 
 a/mm/filemap.c                                       |  823 ++++++++++---------
 a/mm/gup.c                                           |  329 ++-----
 a/mm/gup_benchmark.c                                 |  210 ----
 a/mm/gup_test.c                                      |  299 ++++++
 a/mm/gup_test.h                                      |   40 
 a/mm/highmem.c                                       |   52 +
 a/mm/huge_memory.c                                   |   86 +
 a/mm/hugetlb.c                                       |   28 
 a/mm/init-mm.c                                       |    1 
 a/mm/internal.h                                      |    5 
 a/mm/kasan/generic.c                                 |    3 
 a/mm/kasan/report.c                                  |    4 
 a/mm/khugepaged.c                                    |   58 -
 a/mm/ksm.c                                           |   50 -
 a/mm/madvise.c                                       |   14 
 a/mm/mapping_dirty_helpers.c                         |    6 
 a/mm/memblock.c                                      |   80 +
 a/mm/memcontrol.c                                    |  170 +--
 a/mm/memory-failure.c                                |  322 +++----
 a/mm/memory.c                                        |   24 
 a/mm/memory_hotplug.c                                |   44 -
 a/mm/mempolicy.c                                     |    8 
 a/mm/migrate.c                                       |  183 ++--
 a/mm/mm_init.c                                       |    1 
 a/mm/mmap.c                                          |   22 
 a/mm/mmap_lock.c                                     |  230 +++++
 a/mm/mmu_notifier.c                                  |    7 
 a/mm/mmzone.c                                        |   14 
 a/mm/mremap.c                                        |  282 ++++--
 a/mm/nommu.c                                         |    8 
 a/mm/oom_kill.c                                      |   14 
 a/mm/page_alloc.c                                    |  517 ++++++-----
 a/mm/page_counter.c                                  |    4 
 a/mm/page_ext.c                                      |   10 
 a/mm/page_isolation.c                                |   18 
 a/mm/page_owner.c                                    |   17 
 a/mm/page_poison.c                                   |   56 -
 a/mm/page_vma_mapped.c                               |    9 
 a/mm/process_vm_access.c                             |    2 
 a/mm/rmap.c                                          |    9 
 a/mm/shmem.c                                         |   39 
 a/mm/slab.c                                          |   10 
 a/mm/slab.h                                          |    9 
 a/mm/slab_common.c                                   |   10 
 a/mm/slob.c                                          |    6 
 a/mm/slub.c                                          |  156 +--
 a/mm/swap.c                                          |   12 
 a/mm/swap_state.c                                    |    7 
 a/mm/swapfile.c                                      |   14 
 a/mm/truncate.c                                      |   18 
 a/mm/vmalloc.c                                       |  105 +-
 a/mm/vmscan.c                                        |   21 
 a/mm/vmstat.c                                        |    6 
 a/mm/workingset.c                                    |    8 
 a/mm/z3fold.c                                        |  215 ++--
 a/mm/zsmalloc.c                                      |   11 
 a/mm/zswap.c                                         |  193 +++-
 a/sound/core/pcm_lib.c                               |    4 
 a/tools/include/linux/poison.h                       |    6 
 a/tools/testing/selftests/vm/.gitignore              |    4 
 a/tools/testing/selftests/vm/Makefile                |   41 
 a/tools/testing/selftests/vm/check_config.sh         |   31 
 a/tools/testing/selftests/vm/config                  |    2 
 a/tools/testing/selftests/vm/gup_benchmark.c         |  143 ---
 a/tools/testing/selftests/vm/gup_test.c              |  258 +++++
 a/tools/testing/selftests/vm/hmm-tests.c             |   10 
 a/tools/testing/selftests/vm/mremap_test.c           |  344 +++++++
 a/tools/testing/selftests/vm/run_vmtests             |   51 -
 a/tools/testing/selftests/vm/userfaultfd.c           |   94 --
 217 files changed, 4817 insertions(+), 3369 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2020-12-15  3:02 incoming Andrew Morton
@ 2020-12-15  3:25 ` Linus Torvalds
  2020-12-15  3:30   ` incoming Linus Torvalds
  0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2020-12-15  3:25 UTC (permalink / raw)
  To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM

On Mon, Dec 14, 2020 at 7:02 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442.

I haven't actually processed the patches yet, but I have a question
for Konstantin wrt b4.

All the patches except for _one_ get a nice little green check-mark
next to them when I use 'git am' on this series.

The one that did not was [patch 192/200].

I have no idea why - and it doesn't matter a lot to me, it just stood
out as being different. I'm assuming Andrew has started doing patch
attestation, and that patch failed. But if so, maybe Konstantin wants
to know what went wrong.

Konstantin?

            Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2020-12-15  3:25 ` incoming Linus Torvalds
@ 2020-12-15  3:30   ` Linus Torvalds
  2020-12-15 14:04     ` incoming Konstantin Ryabitsev
  0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2020-12-15  3:30 UTC (permalink / raw)
  To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM

On Mon, Dec 14, 2020 at 7:25 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> All the patches except for _one_ get a nice little green check-mark
> next to them when I use 'git am' on this series.
>
> The one that did not was [patch 192/200].
>
> I have no idea why

Hmm. It looks like that patch is the only one in the series with the
">From" marker in the commit message, from the silly "clarify that
this isn't the first line in a new message in mbox format".

And "b4 am" has turned the single ">" into two, making the stupid
marker worse, and actually corrupting the end result.

Coincidence? Or cause?

            Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2020-12-15  3:30   ` incoming Linus Torvalds
@ 2020-12-15 14:04     ` Konstantin Ryabitsev
  0 siblings, 0 replies; 232+ messages in thread
From: Konstantin Ryabitsev @ 2020-12-15 14:04 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Andrew Morton, mm-commits, Linux-MM

On Mon, Dec 14, 2020 at 07:30:54PM -0800, Linus Torvalds wrote:
> > All the patches except for _one_ get a nice little green check-mark
> > next to them when I use 'git am' on this series.
> >
> > The one that did not was [patch 192/200].
> >
> > I have no idea why
> 
> Hmm. It looks like that patch is the only one in the series with the
> ">From" marker in the commit message, from the silly "clarify that
> this isn't the first line in a new message in mbox format".
> 
> And "b4 am" has turned the single ">" into two, making the stupid
> marker worse, and actually corrupting the end result.

It's a bug in b4 that I overlooked. Public-inbox emits mboxrd-formatted 
.mbox files, while Python's mailbox.mbox consumes mboxo only. The main 
distinction between the two is precisely that mboxrd will convert 
">From " into ">>From " in an attempt to avoid corruption during
escape/unescape (it didn't end up fixing the problem 100% and mostly 
introduced incompatibilities like this one).

I have a fix in master/stable-0.6.y and I'll release a 0.6.2 before the 
end of the week.

Thanks for the report.

-K

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-12-15 20:32 Andrew Morton
  2020-12-15 21:00 ` incoming Linus Torvalds
  2020-12-15 22:48 ` incoming Linus Torvalds
  0 siblings, 2 replies; 232+ messages in thread
From: Andrew Morton @ 2020-12-15 20:32 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


- more MM work: a memcg scalability improvememt

19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.

Subsystems affected by this patch series:


    Alex Shi <alex.shi@linux.alibaba.com>:
    Patch series "per memcg lru lock", v21:
      mm/thp: move lru_add_page_tail() to huge_memory.c
      mm/thp: use head for head page in lru_add_page_tail()
      mm/thp: simplify lru_add_page_tail()
      mm/thp: narrow lru locking
      mm/vmscan: remove unnecessary lruvec adding
      mm/rmap: stop store reordering issue on page->mapping

    Hugh Dickins <hughd@google.com>:
      mm: page_idle_get_page() does not need lru_lock

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: add debug checking in lock_page_memcg
      mm/swap.c: fold vm event PGROTATED into pagevec_move_tail_fn
      mm/lru: move lock into lru_note_cost
      mm/vmscan: remove lruvec reget in move_pages_to_lru
      mm/mlock: remove lru_lock on TestClearPageMlocked
      mm/mlock: remove __munlock_isolate_lru_page()
      mm/lru: introduce TestClearPageLRU()
      mm/compaction: do page isolation first in compaction
      mm/swap.c: serialize memcg changes in pagevec_lru_move_fn
      mm/lru: replace pgdat lru_lock with lruvec lock

    Alexander Duyck <alexander.h.duyck@linux.intel.com>:
      mm/lru: introduce relock_page_lruvec()

    Hugh Dickins <hughd@google.com>:
      mm/lru: revise the comments of lru_lock

 Documentation/admin-guide/cgroup-v1/memcg_test.rst |   15 -
 Documentation/admin-guide/cgroup-v1/memory.rst     |   23 -
 Documentation/trace/events-kmem.rst                |    2 
 Documentation/vm/unevictable-lru.rst               |   22 -
 include/linux/memcontrol.h                         |  110 +++++++
 include/linux/mm_types.h                           |    2 
 include/linux/mmzone.h                             |    6 
 include/linux/page-flags.h                         |    1 
 include/linux/swap.h                               |    4 
 mm/compaction.c                                    |   98 ++++---
 mm/filemap.c                                       |    4 
 mm/huge_memory.c                                   |  109 ++++---
 mm/memcontrol.c                                    |   84 +++++-
 mm/mlock.c                                         |   93 ++----
 mm/mmzone.c                                        |    1 
 mm/page_alloc.c                                    |    1 
 mm/page_idle.c                                     |    4 
 mm/rmap.c                                          |   12 
 mm/swap.c                                          |  292 ++++++++-------------
 mm/vmscan.c                                        |  239 ++++++++---------
 mm/workingset.c                                    |    2 
 21 files changed, 644 insertions(+), 480 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2020-12-15 20:32 incoming Andrew Morton
@ 2020-12-15 21:00 ` Linus Torvalds
  2020-12-15 22:48 ` incoming Linus Torvalds
  1 sibling, 0 replies; 232+ messages in thread
From: Linus Torvalds @ 2020-12-15 21:00 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> - more MM work: a memcg scalability improvememt
>
> 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.

I'm not seeing patch 10/19 at all.

And patch 19/19 is corrupted and has an attachment with a '^P'
character in it. I could fix it up, but with the missing patch in the
middle I'm not going to even try. 'b4' is also very unhappy about that
patch 19/19.

I don't know what went wrong, but I'll ignore this send - please
re-send the series at your leisure, ok?

            Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2020-12-15 20:32 incoming Andrew Morton
  2020-12-15 21:00 ` incoming Linus Torvalds
@ 2020-12-15 22:48 ` Linus Torvalds
  2020-12-15 22:49   ` incoming Linus Torvalds
  1 sibling, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2020-12-15 22:48 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> - more MM work: a memcg scalability improvememt
>
> 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.

With your re-send, I get all patches, but they don't actually apply cleanly.

Is that base correct?

I get

  error: patch failed: mm/huge_memory.c:2750
  error: mm/huge_memory.c: patch does not apply
  Patch failed at 0004 mm/thp: narrow lru locking

for that patch "[patch 04/19] mm/thp: narrow lru locking", and that's
definitely true: the patch fragment has

@@ -2750,7 +2751,7 @@ int split_huge_page_to_list(struct page
                                __dec_lruvec_page_state(head, NR_FILE_THPS);
                }

-               __split_huge_page(page, list, end, flags);
+               __split_huge_page(page, list, end);
                ret = 0;
        } else {
                if (IS_ENABLED(CONFIG_DEBUG_VM) && mapcount) {

but that __dec_lruvec_page_state() conversion was done by your
previous commit series.

So I have the feeling that what you actually mean by "base" isn't
actually really the base for that series at all..

I will try to apply it on top of my merge of your previous series instead.

              Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2020-12-15 22:48 ` incoming Linus Torvalds
@ 2020-12-15 22:49   ` Linus Torvalds
  2020-12-15 22:55     ` incoming Andrew Morton
  0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2020-12-15 22:49 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> I will try to apply it on top of my merge of your previous series instead.

Yes, then it applies cleanly. So apparently we just have different
concepts of what really constitutes a "base" for applying your series.

              Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2020-12-15 22:49   ` incoming Linus Torvalds
@ 2020-12-15 22:55     ` Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-12-15 22:55 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Linux-MM, mm-commits

On Tue, 15 Dec 2020 14:49:24 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > I will try to apply it on top of my merge of your previous series instead.
> 
> Yes, then it applies cleanly. So apparently we just have different
> concepts of what really constitutes a "base" for applying your series.
> 

oop, sorry, yes, the "based on" thing was wrong because I had two
series in flight simultaneously.  I've never tried that before..

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-12-16  4:41 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-12-16  4:41 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- lots of little subsystems

- a few post-linux-next MM material.  Most of this awaits more merging
  of other trees.


95 patches, based on 489e9fea66f31086f85d9a18e61e4791d94a56a4.

Subsystems affected by this patch series:

  mm/swap
  mm/memory-hotplug
  alpha
  procfs
  misc
  core-kernel
  bitmap
  lib
  lz4
  bitops
  checkpatch
  nilfs
  kdump
  rapidio
  gcov
  bfs
  relay
  resource
  ubsan
  reboot
  fault-injection
  lzo
  apparmor
  mm/pagemap
  mm/cleanups
  mm/gup

Subsystem: mm/swap

    Zhaoyang Huang <huangzhaoyang@gmail.com>:
      mm: fix a race on nr_swap_pages

Subsystem: mm/memory-hotplug

    Laurent Dufour <ldufour@linux.ibm.com>:
      mm/memory_hotplug: quieting offline operation

Subsystem: alpha

    Thomas Gleixner <tglx@linutronix.de>:
      alpha: replace bogus in_interrupt()

Subsystem: procfs

    Randy Dunlap <rdunlap@infradead.org>:
      procfs: delete duplicated words + other fixes

    Anand K Mistry <amistry@google.com>:
      proc: provide details on indirect branch speculation

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: fix lookup in /proc/net subdirectories after setns(2)

    Hui Su <sh_def@163.com>:
      fs/proc: make pde_get() return nothing

Subsystem: misc

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      asm-generic: force inlining of get_order() to work around gcc10 poor decision

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: split out mathematical helpers

Subsystem: core-kernel

    Hui Su <sh_def@163.com>:
      kernel/acct.c: use #elif instead of #end and #elif

Subsystem: bitmap

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      include/linux/bitmap.h: convert bitmap_empty() / bitmap_full() to return boolean

    "Ma, Jianpeng" <jianpeng.ma@intel.com>:
      bitmap: remove unused function declaration

Subsystem: lib

    Geert Uytterhoeven <geert@linux-m68k.org>:
      lib/test_free_pages.c: add basic progress indicators

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
    Patch series "] lib/stackdepot.c: Replace one-element array with flexible-array member":
      lib/stackdepot.c: replace one-element array with flexible-array member
      lib/stackdepot.c: use flex_array_size() helper in memcpy()
      lib/stackdepot.c: use array_size() helper in jhash2()

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      lib/test_lockup.c: minimum fix to get it compiled on PREEMPT_RT

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      lib/list_kunit: follow new file name convention for KUnit tests
      lib/linear_ranges_kunit: follow new file name convention for KUnit tests
      lib/bits_kunit: follow new file name convention for KUnit tests
      lib/cmdline: fix get_option() for strings starting with hyphen
      lib/cmdline: allow NULL to be an output for get_option()
      lib/cmdline_kunit: add a new test suite for cmdline API

    Jakub Jelinek <jakub@redhat.com>:
      ilog2: improve ilog2 for constant arguments

    Nick Desaulniers <ndesaulniers@google.com>:
      lib/string: remove unnecessary #undefs

    Daniel Axtens <dja@axtens.net>:
    Patch series "Fortify strscpy()", v7:
      lib: string.h: detect intra-object overflow in fortified string functions
      lkdtm: tests for FORTIFY_SOURCE

    Francis Laniel <laniel_francis@privacyrequired.com>:
      string.h: add FORTIFY coverage for strscpy()
      drivers/misc/lkdtm: add new file in LKDTM to test fortified strscpy
      drivers/misc/lkdtm/lkdtm.h: correct wrong filenames in comment

    Alexey Dobriyan <adobriyan@gmail.com>:
      lib: cleanup kstrto*() usage

Subsystem: lz4

    Gao Xiang <hsiangkao@redhat.com>:
      lib/lz4: explicitly support in-place decompression

Subsystem: bitops

    Syed Nayyar Waris <syednwaris@gmail.com>:
    Patch series "Introduce the for_each_set_clump macro", v12:
      bitops: introduce the for_each_set_clump macro
      lib/test_bitmap.c: add for_each_set_clump test cases
      gpio: thunderx: utilize for_each_set_clump macro
      gpio: xilinx: utilize generic bitmap_get_value and _set_value

Subsystem: checkpatch

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: add new exception to repeated word check

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: fix false positives in REPEATED_WORD warning

    Łukasz Stelmach <l.stelmach@samsung.com>:
      checkpatch: ignore generated CamelCase defines and enum values

    Joe Perches <joe@perches.com>:
      checkpatch: prefer static const declarations
      checkpatch: allow --fix removal of unnecessary break statements

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: extend attributes check to handle more patterns

    Tom Rix <trix@redhat.com>:
      checkpatch: add a fixer for missing newline at eof

    Joe Perches <joe@perches.com>:
      checkpatch: update __attribute__((section("name"))) quote removal

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: add fix option for GERRIT_CHANGE_ID

    Joe Perches <joe@perches.com>:
      checkpatch: add __alias and __weak to suggested __attribute__ conversions

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: improve email parsing
      checkpatch: fix spelling errors and remove repeated word

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: avoid COMMIT_LOG_LONG_LINE warning for signature tags

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: fix unescaped left brace

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: add fix option for ASSIGNMENT_CONTINUATIONS
      checkpatch: add fix option for LOGICAL_CONTINUATIONS
      checkpatch: add fix and improve warning msg for non-standard signature

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: add warning for unnecessary use of %h[xudi] and %hh[xudi]
      checkpatch: add warning for lines starting with a '#' in commit log
      checkpatch: fix TYPO_SPELLING check for words with apostrophe

    Joe Perches <joe@perches.com>:
      checkpatch: add printk_once and printk_ratelimit to prefer pr_<level> warning

Subsystem: nilfs

    Alex Shi <alex.shi@linux.alibaba.com>:
      fs/nilfs2: remove some unused macros to tame gcc

Subsystem: kdump

    Alexander Egorenkov <egorenar@linux.ibm.com>:
      kdump: append uts_namespace.name offset to VMCOREINFO

Subsystem: rapidio

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      rapidio: remove unused rio_get_asm() and rio_get_device()

Subsystem: gcov

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: remove support for GCC < 4.9

    Alex Shi <alex.shi@linux.alibaba.com>:
      gcov: fix kernel-doc markup issue

Subsystem: bfs

    Randy Dunlap <rdunlap@infradead.org>:
      bfs: don't use WARNING: string when it's just info.

Subsystem: relay

    Jani Nikula <jani.nikula@intel.com>:
    Patch series "relay: cleanup and const callbacks", v2:
      relay: remove unused buf_mapped and buf_unmapped callbacks
      relay: require non-NULL callbacks in relay_open()
      relay: make create_buf_file and remove_buf_file callbacks mandatory
      relay: allow the use of const callback structs
      drm/i915: make relay callbacks const
      ath10k: make relay callbacks const
      ath11k: make relay callbacks const
      ath9k: make relay callbacks const
      blktrace: make relay callbacks const

Subsystem: resource

    Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
      kernel/resource.c: fix kernel-doc markups

Subsystem: ubsan

    Kees Cook <keescook@chromium.org>:
    Patch series "Clean up UBSAN Makefile", v2:
      ubsan: remove redundant -Wno-maybe-uninitialized
      ubsan: move cc-option tests into Kconfig
      ubsan: disable object-size sanitizer under GCC
      ubsan: disable UBSAN_TRAP for all*config
      ubsan: enable for all*config builds
      ubsan: remove UBSAN_MISC in favor of individual options
      ubsan: expand tests and reporting

    Dmitry Vyukov <dvyukov@google.com>:
      kcov: don't instrument with UBSAN

    Zou Wei <zou_wei@huawei.com>:
      lib/ubsan.c: mark type_check_kinds with static keyword

Subsystem: reboot

    Matteo Croce <mcroce@microsoft.com>:
      reboot: refactor and comment the cpu selection code
      reboot: allow to specify reboot mode via sysfs
      reboot: remove cf9_safe from allowed types and rename cf9_force
    Patch series "reboot: sysfs improvements":
      reboot: allow to override reboot type if quirks are found
      reboot: hide from sysfs not applicable settings

Subsystem: fault-injection

    Barnabás Pőcze <pobrn@protonmail.com>:
      fault-injection: handle EI_ETYPE_TRUE

Subsystem: lzo

    Jason Yan <yanaijie@huawei.com>:
      lib/lzo/lzo1x_compress.c: make lzogeneric1x_1_compress() static

Subsystem: apparmor

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      apparmor: remove duplicate macro list_entry_is_head()

Subsystem: mm/pagemap

    Christoph Hellwig <hch@lst.de>:
    Patch series "simplify follow_pte a bit":
      mm: unexport follow_pte_pmd
      mm: simplify follow_pte{,pmd}

Subsystem: mm/cleanups

    Haitao Shi <shihaitao1@huawei.com>:
      mm: fix some spelling mistakes in comments

Subsystem: mm/gup

    Jann Horn <jannh@google.com>:
      mmap locking API: don't check locking if the mm isn't live yet
      mm/gup: assert that the mmap lock is held in __get_user_pages()

 Documentation/ABI/testing/sysfs-kernel-reboot    |   32 
 Documentation/admin-guide/kdump/vmcoreinfo.rst   |    6 
 Documentation/dev-tools/ubsan.rst                |    1 
 Documentation/filesystems/proc.rst               |    2 
 MAINTAINERS                                      |    5 
 arch/alpha/kernel/process.c                      |    2 
 arch/powerpc/kernel/vmlinux.lds.S                |    4 
 arch/s390/pci/pci_mmio.c                         |    4 
 drivers/gpio/gpio-thunderx.c                     |   11 
 drivers/gpio/gpio-xilinx.c                       |   61 -
 drivers/gpu/drm/i915/gt/uc/intel_guc_log.c       |    2 
 drivers/misc/lkdtm/Makefile                      |    1 
 drivers/misc/lkdtm/bugs.c                        |   50 +
 drivers/misc/lkdtm/core.c                        |    3 
 drivers/misc/lkdtm/fortify.c                     |   82 ++
 drivers/misc/lkdtm/lkdtm.h                       |   19 
 drivers/net/wireless/ath/ath10k/spectral.c       |    2 
 drivers/net/wireless/ath/ath11k/spectral.c       |    2 
 drivers/net/wireless/ath/ath9k/common-spectral.c |    2 
 drivers/rapidio/rio.c                            |   81 --
 fs/bfs/inode.c                                   |    2 
 fs/dax.c                                         |    9 
 fs/exec.c                                        |    8 
 fs/nfs/callback_proc.c                           |    5 
 fs/nilfs2/segment.c                              |    5 
 fs/proc/array.c                                  |   28 
 fs/proc/base.c                                   |    2 
 fs/proc/generic.c                                |   24 
 fs/proc/internal.h                               |   10 
 fs/proc/proc_net.c                               |   20 
 include/asm-generic/bitops/find.h                |   19 
 include/asm-generic/getorder.h                   |    2 
 include/linux/bitmap.h                           |   67 +-
 include/linux/bitops.h                           |   24 
 include/linux/dcache.h                           |    1 
 include/linux/iommu-helper.h                     |    4 
 include/linux/kernel.h                           |  173 -----
 include/linux/log2.h                             |    3 
 include/linux/math.h                             |  177 +++++
 include/linux/mm.h                               |    6 
 include/linux/mm_types.h                         |   10 
 include/linux/mmap_lock.h                        |   16 
 include/linux/proc_fs.h                          |    8 
 include/linux/rcu_node_tree.h                    |    2 
 include/linux/relay.h                            |   29 
 include/linux/rio_drv.h                          |    3 
 include/linux/string.h                           |   75 +-
 include/linux/units.h                            |    2 
 kernel/Makefile                                  |    3 
 kernel/acct.c                                    |    7 
 kernel/crash_core.c                              |    1 
 kernel/fail_function.c                           |    6 
 kernel/gcov/gcc_4_7.c                            |   10 
 kernel/reboot.c                                  |  308 ++++++++-
 kernel/relay.c                                   |  111 ---
 kernel/resource.c                                |   24 
 kernel/trace/blktrace.c                          |    2 
 lib/Kconfig.debug                                |   11 
 lib/Kconfig.ubsan                                |  154 +++-
 lib/Makefile                                     |    7 
 lib/bits_kunit.c                                 |   75 ++
 lib/cmdline.c                                    |   20 
 lib/cmdline_kunit.c                              |  100 +++
 lib/errname.c                                    |    1 
 lib/error-inject.c                               |    2 
 lib/errseq.c                                     |    1 
 lib/find_bit.c                                   |   17 
 lib/linear_ranges_kunit.c                        |  228 +++++++
 lib/list-test.c                                  |  748 -----------------------
 lib/list_kunit.c                                 |  748 +++++++++++++++++++++++
 lib/lz4/lz4_decompress.c                         |    6 
 lib/lz4/lz4defs.h                                |    1 
 lib/lzo/lzo1x_compress.c                         |    2 
 lib/math/div64.c                                 |    4 
 lib/math/int_pow.c                               |    2 
 lib/math/int_sqrt.c                              |    3 
 lib/math/reciprocal_div.c                        |    9 
 lib/stackdepot.c                                 |   11 
 lib/string.c                                     |    4 
 lib/test_bitmap.c                                |  143 ++++
 lib/test_bits.c                                  |   75 --
 lib/test_firmware.c                              |    9 
 lib/test_free_pages.c                            |    5 
 lib/test_kmod.c                                  |   26 
 lib/test_linear_ranges.c                         |  228 -------
 lib/test_lockup.c                                |   16 
 lib/test_ubsan.c                                 |   74 ++
 lib/ubsan.c                                      |    2 
 mm/filemap.c                                     |    2 
 mm/gup.c                                         |    2 
 mm/huge_memory.c                                 |    2 
 mm/khugepaged.c                                  |    2 
 mm/memblock.c                                    |    2 
 mm/memory.c                                      |   36 -
 mm/memory_hotplug.c                              |    2 
 mm/migrate.c                                     |    2 
 mm/page_ext.c                                    |    2 
 mm/swapfile.c                                    |   11 
 scripts/Makefile.ubsan                           |   49 -
 scripts/checkpatch.pl                            |  495 +++++++++++----
 security/apparmor/apparmorfs.c                   |    3 
 tools/testing/selftests/lkdtm/tests.txt          |    1 
 102 files changed, 3022 insertions(+), 1899 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-12-18 22:00 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-12-18 22:00 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


78 patches, based on a409ed156a90093a03fe6a93721ddf4c591eac87.

Subsystems affected by this patch series:

  mm/memcg
  epoll
  mm/kasan
  mm/cleanups
  epoll

Subsystem: mm/memcg

    Alex Shi <alex.shi@linux.alibaba.com>:
    Patch series "bail out early for memcg disable":
      mm/memcg: bail early from swap accounting if memcg disabled
      mm/memcg: warning on !memcg after readahead page charged

    Wei Yang <richard.weiyang@gmail.com>:
      mm/memcg: remove unused definitions

    Shakeel Butt <shakeelb@google.com>:
      mm, kvm: account kvm_vcpu_mmap to kmemcg

    Hui Su <sh_def@163.com>:
      mm/memcontrol:rewrite mem_cgroup_page_lruvec()

Subsystem: epoll

    Soheil Hassas Yeganeh <soheil@google.com>:
    Patch series "simplify ep_poll":
      epoll: check for events when removing a timed out thread from the wait queue
      epoll: simplify signal handling
      epoll: pull fatal signal checks into ep_send_events()
      epoll: move eavail next to the list_empty_careful check
      epoll: simplify and optimize busy loop logic
      epoll: pull all code between fetch_events and send_event into the loop
      epoll: replace gotos with a proper loop
      epoll: eliminate unnecessary lock for zero timeout

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: add hardware tag-based mode for arm64", v11:
      kasan: drop unnecessary GPL text from comment headers
      kasan: KASAN_VMALLOC depends on KASAN_GENERIC
      kasan: group vmalloc code
      kasan: shadow declarations only for software modes
      kasan: rename (un)poison_shadow to (un)poison_range
      kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_*
      kasan: only build init.c for software modes
      kasan: split out shadow.c from common.c
      kasan: define KASAN_MEMORY_PER_SHADOW_PAGE
      kasan: rename report and tags files
      kasan: don't duplicate config dependencies
      kasan: hide invalid free check implementation
      kasan: decode stack frame only with KASAN_STACK_ENABLE
      kasan, arm64: only init shadow for software modes
      kasan, arm64: only use kasan_depth for software modes
      kasan, arm64: move initialization message
      kasan, arm64: rename kasan_init_tags and mark as __init
      kasan: rename addr_has_shadow to addr_has_metadata
      kasan: rename print_shadow_for_address to print_memory_metadata
      kasan: rename SHADOW layout macros to META
      kasan: separate metadata_fetch_row for each mode
      kasan: introduce CONFIG_KASAN_HW_TAGS

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      arm64: enable armv8.5-a asm-arch option
      arm64: mte: add in-kernel MTE helpers
      arm64: mte: reset the page tag in page->flags
      arm64: mte: add in-kernel tag fault handler
      arm64: kasan: allow enabling in-kernel MTE
      arm64: mte: convert gcr_user into an exclude mask
      arm64: mte: switch GCR_EL1 in kernel entry and exit
      kasan, mm: untag page address in free_reserved_area

    Andrey Konovalov <andreyknvl@google.com>:
      arm64: kasan: align allocations for HW_TAGS
      arm64: kasan: add arch layer for memory tagging helpers
      kasan: define KASAN_GRANULE_SIZE for HW_TAGS
      kasan, x86, s390: update undef CONFIG_KASAN
      kasan, arm64: expand CONFIG_KASAN checks
      kasan, arm64: implement HW_TAGS runtime
      kasan, arm64: print report from tag fault handler
      kasan, mm: reset tags when accessing metadata
      kasan, arm64: enable CONFIG_KASAN_HW_TAGS
      kasan: add documentation for hardware tag-based mode

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      kselftest/arm64: check GCR_EL1 after context switch

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: boot parameters for hardware tag-based mode", v4:
      kasan: simplify quarantine_put call site
      kasan: rename get_alloc/free_info
      kasan: introduce set_alloc_info
      kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK
      kasan: allow VMAP_STACK for HW_TAGS mode
      kasan: remove __kasan_unpoison_stack
      kasan: inline kasan_reset_tag for tag-based modes
      kasan: inline random_tag for HW_TAGS
      kasan: open-code kasan_unpoison_slab
      kasan: inline (un)poison_range and check_invalid_free
      kasan: add and integrate kasan boot parameters
      kasan, mm: check kasan_enabled in annotations
      kasan, mm: rename kasan_poison_kfree
      kasan: don't round_up too much
      kasan: simplify assign_tag and set_tag calls
      kasan: clarify comment in __kasan_kfree_large
      kasan: sanitize objects when metadata doesn't fit
      kasan, mm: allow cache merging with no metadata
      kasan: update documentation

Subsystem: mm/cleanups

    Colin Ian King <colin.king@canonical.com>:
      mm/Kconfig: fix spelling mistake "whats" -> "what's"

Subsystem: epoll

    Willem de Bruijn <willemb@google.com>:
    Patch series "add epoll_pwait2 syscall", v4:
      epoll: convert internal api to timespec64
      epoll: add syscall epoll_pwait2
      epoll: wire up syscall epoll_pwait2
      selftests/filesystems: expand epoll with epoll_pwait2

 Documentation/dev-tools/kasan.rst                             |  274 +-
 arch/Kconfig                                                  |    8 
 arch/alpha/kernel/syscalls/syscall.tbl                        |    1 
 arch/arm/tools/syscall.tbl                                    |    1 
 arch/arm64/Kconfig                                            |    9 
 arch/arm64/Makefile                                           |    7 
 arch/arm64/include/asm/assembler.h                            |    2 
 arch/arm64/include/asm/cache.h                                |    3 
 arch/arm64/include/asm/esr.h                                  |    1 
 arch/arm64/include/asm/kasan.h                                |   17 
 arch/arm64/include/asm/memory.h                               |   15 
 arch/arm64/include/asm/mte-def.h                              |   16 
 arch/arm64/include/asm/mte-kasan.h                            |   67 
 arch/arm64/include/asm/mte.h                                  |   22 
 arch/arm64/include/asm/processor.h                            |    2 
 arch/arm64/include/asm/string.h                               |    5 
 arch/arm64/include/asm/uaccess.h                              |   23 
 arch/arm64/include/asm/unistd.h                               |    2 
 arch/arm64/include/asm/unistd32.h                             |    2 
 arch/arm64/kernel/asm-offsets.c                               |    3 
 arch/arm64/kernel/cpufeature.c                                |    3 
 arch/arm64/kernel/entry.S                                     |   41 
 arch/arm64/kernel/head.S                                      |    2 
 arch/arm64/kernel/hibernate.c                                 |    5 
 arch/arm64/kernel/image-vars.h                                |    2 
 arch/arm64/kernel/kaslr.c                                     |    3 
 arch/arm64/kernel/module.c                                    |    6 
 arch/arm64/kernel/mte.c                                       |  124 +
 arch/arm64/kernel/setup.c                                     |    2 
 arch/arm64/kernel/sleep.S                                     |    2 
 arch/arm64/kernel/smp.c                                       |    2 
 arch/arm64/lib/mte.S                                          |   16 
 arch/arm64/mm/copypage.c                                      |    9 
 arch/arm64/mm/fault.c                                         |   59 
 arch/arm64/mm/kasan_init.c                                    |   41 
 arch/arm64/mm/mteswap.c                                       |    9 
 arch/arm64/mm/proc.S                                          |   23 
 arch/arm64/mm/ptdump.c                                        |    6 
 arch/ia64/kernel/syscalls/syscall.tbl                         |    1 
 arch/m68k/kernel/syscalls/syscall.tbl                         |    1 
 arch/microblaze/kernel/syscalls/syscall.tbl                   |    1 
 arch/mips/kernel/syscalls/syscall_n32.tbl                     |    1 
 arch/mips/kernel/syscalls/syscall_n64.tbl                     |    1 
 arch/mips/kernel/syscalls/syscall_o32.tbl                     |    1 
 arch/parisc/kernel/syscalls/syscall.tbl                       |    1 
 arch/powerpc/kernel/syscalls/syscall.tbl                      |    1 
 arch/s390/boot/string.c                                       |    1 
 arch/s390/kernel/syscalls/syscall.tbl                         |    1 
 arch/sh/kernel/syscalls/syscall.tbl                           |    1 
 arch/sparc/kernel/syscalls/syscall.tbl                        |    1 
 arch/x86/boot/compressed/misc.h                               |    1 
 arch/x86/entry/syscalls/syscall_32.tbl                        |    1 
 arch/x86/entry/syscalls/syscall_64.tbl                        |    1 
 arch/x86/kernel/acpi/wakeup_64.S                              |    2 
 arch/x86/kvm/x86.c                                            |    2 
 arch/xtensa/kernel/syscalls/syscall.tbl                       |    1 
 fs/eventpoll.c                                                |  359 ++-
 include/linux/compat.h                                        |    6 
 include/linux/kasan-checks.h                                  |    2 
 include/linux/kasan.h                                         |  423 ++--
 include/linux/memcontrol.h                                    |  137 -
 include/linux/mm.h                                            |   24 
 include/linux/mmdebug.h                                       |   13 
 include/linux/moduleloader.h                                  |    3 
 include/linux/page-flags-layout.h                             |    2 
 include/linux/sched.h                                         |    2 
 include/linux/string.h                                        |    2 
 include/linux/syscalls.h                                      |    5 
 include/uapi/asm-generic/unistd.h                             |    4 
 init/init_task.c                                              |    2 
 kernel/fork.c                                                 |    4 
 kernel/sys_ni.c                                               |    2 
 lib/Kconfig.kasan                                             |   71 
 lib/test_kasan.c                                              |    2 
 lib/test_kasan_module.c                                       |    2 
 mm/Kconfig                                                    |    2 
 mm/kasan/Makefile                                             |   33 
 mm/kasan/common.c                                             | 1006 ++--------
 mm/kasan/generic.c                                            |   72 
 mm/kasan/generic_report.c                                     |   13 
 mm/kasan/hw_tags.c                                            |  294 ++
 mm/kasan/init.c                                               |   25 
 mm/kasan/kasan.h                                              |  204 +-
 mm/kasan/quarantine.c                                         |   35 
 mm/kasan/report.c                                             |  363 +--
 mm/kasan/report_generic.c                                     |  169 +
 mm/kasan/report_hw_tags.c                                     |   44 
 mm/kasan/report_sw_tags.c                                     |   22 
 mm/kasan/shadow.c                                             |  541 +++++
 mm/kasan/sw_tags.c                                            |   34 
 mm/kasan/tags.c                                               |    7 
 mm/kasan/tags_report.c                                        |    7 
 mm/memcontrol.c                                               |   53 
 mm/mempool.c                                                  |    4 
 mm/page_alloc.c                                               |    9 
 mm/page_poison.c                                              |    2 
 mm/ptdump.c                                                   |   13 
 mm/slab_common.c                                              |    5 
 mm/slub.c                                                     |   29 
 scripts/Makefile.lib                                          |    2 
 tools/testing/selftests/arm64/mte/Makefile                    |    2 
 tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c     |  155 +
 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c |   72 
 virt/kvm/coalesced_mmio.c                                     |    2 
 virt/kvm/kvm_main.c                                           |    2 
 105 files changed, 3268 insertions(+), 1873 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-12-22 19:58 Andrew Morton
  2020-12-22 21:43 ` incoming Linus Torvalds
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-12-22 19:58 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e.

Subsystems affected by this patch series:

  mm/kasan

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: add hardware tag-based mode for arm64", v11:
      kasan: drop unnecessary GPL text from comment headers
      kasan: KASAN_VMALLOC depends on KASAN_GENERIC
      kasan: group vmalloc code
      kasan: shadow declarations only for software modes
      kasan: rename (un)poison_shadow to (un)poison_range
      kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_*
      kasan: only build init.c for software modes
      kasan: split out shadow.c from common.c
      kasan: define KASAN_MEMORY_PER_SHADOW_PAGE
      kasan: rename report and tags files
      kasan: don't duplicate config dependencies
      kasan: hide invalid free check implementation
      kasan: decode stack frame only with KASAN_STACK_ENABLE
      kasan, arm64: only init shadow for software modes
      kasan, arm64: only use kasan_depth for software modes
      kasan, arm64: move initialization message
      kasan, arm64: rename kasan_init_tags and mark as __init
      kasan: rename addr_has_shadow to addr_has_metadata
      kasan: rename print_shadow_for_address to print_memory_metadata
      kasan: rename SHADOW layout macros to META
      kasan: separate metadata_fetch_row for each mode
      kasan: introduce CONFIG_KASAN_HW_TAGS

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      arm64: enable armv8.5-a asm-arch option
      arm64: mte: add in-kernel MTE helpers
      arm64: mte: reset the page tag in page->flags
      arm64: mte: add in-kernel tag fault handler
      arm64: kasan: allow enabling in-kernel MTE
      arm64: mte: convert gcr_user into an exclude mask
      arm64: mte: switch GCR_EL1 in kernel entry and exit
      kasan, mm: untag page address in free_reserved_area

    Andrey Konovalov <andreyknvl@google.com>:
      arm64: kasan: align allocations for HW_TAGS
      arm64: kasan: add arch layer for memory tagging helpers
      kasan: define KASAN_GRANULE_SIZE for HW_TAGS
      kasan, x86, s390: update undef CONFIG_KASAN
      kasan, arm64: expand CONFIG_KASAN checks
      kasan, arm64: implement HW_TAGS runtime
      kasan, arm64: print report from tag fault handler
      kasan, mm: reset tags when accessing metadata
      kasan, arm64: enable CONFIG_KASAN_HW_TAGS
      kasan: add documentation for hardware tag-based mode

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      kselftest/arm64: check GCR_EL1 after context switch

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: boot parameters for hardware tag-based mode", v4:
      kasan: simplify quarantine_put call site
      kasan: rename get_alloc/free_info
      kasan: introduce set_alloc_info
      kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK
      kasan: allow VMAP_STACK for HW_TAGS mode
      kasan: remove __kasan_unpoison_stack
      kasan: inline kasan_reset_tag for tag-based modes
      kasan: inline random_tag for HW_TAGS
      kasan: open-code kasan_unpoison_slab
      kasan: inline (un)poison_range and check_invalid_free
      kasan: add and integrate kasan boot parameters
      kasan, mm: check kasan_enabled in annotations
      kasan, mm: rename kasan_poison_kfree
      kasan: don't round_up too much
      kasan: simplify assign_tag and set_tag calls
      kasan: clarify comment in __kasan_kfree_large
      kasan: sanitize objects when metadata doesn't fit
      kasan, mm: allow cache merging with no metadata
      kasan: update documentation

 Documentation/dev-tools/kasan.rst                         |  274 ++-
 arch/Kconfig                                              |    8 
 arch/arm64/Kconfig                                        |    9 
 arch/arm64/Makefile                                       |    7 
 arch/arm64/include/asm/assembler.h                        |    2 
 arch/arm64/include/asm/cache.h                            |    3 
 arch/arm64/include/asm/esr.h                              |    1 
 arch/arm64/include/asm/kasan.h                            |   17 
 arch/arm64/include/asm/memory.h                           |   15 
 arch/arm64/include/asm/mte-def.h                          |   16 
 arch/arm64/include/asm/mte-kasan.h                        |   67 
 arch/arm64/include/asm/mte.h                              |   22 
 arch/arm64/include/asm/processor.h                        |    2 
 arch/arm64/include/asm/string.h                           |    5 
 arch/arm64/include/asm/uaccess.h                          |   23 
 arch/arm64/kernel/asm-offsets.c                           |    3 
 arch/arm64/kernel/cpufeature.c                            |    3 
 arch/arm64/kernel/entry.S                                 |   41 
 arch/arm64/kernel/head.S                                  |    2 
 arch/arm64/kernel/hibernate.c                             |    5 
 arch/arm64/kernel/image-vars.h                            |    2 
 arch/arm64/kernel/kaslr.c                                 |    3 
 arch/arm64/kernel/module.c                                |    6 
 arch/arm64/kernel/mte.c                                   |  124 +
 arch/arm64/kernel/setup.c                                 |    2 
 arch/arm64/kernel/sleep.S                                 |    2 
 arch/arm64/kernel/smp.c                                   |    2 
 arch/arm64/lib/mte.S                                      |   16 
 arch/arm64/mm/copypage.c                                  |    9 
 arch/arm64/mm/fault.c                                     |   59 
 arch/arm64/mm/kasan_init.c                                |   41 
 arch/arm64/mm/mteswap.c                                   |    9 
 arch/arm64/mm/proc.S                                      |   23 
 arch/arm64/mm/ptdump.c                                    |    6 
 arch/s390/boot/string.c                                   |    1 
 arch/x86/boot/compressed/misc.h                           |    1 
 arch/x86/kernel/acpi/wakeup_64.S                          |    2 
 include/linux/kasan-checks.h                              |    2 
 include/linux/kasan.h                                     |  423 ++++-
 include/linux/mm.h                                        |   24 
 include/linux/moduleloader.h                              |    3 
 include/linux/page-flags-layout.h                         |    2 
 include/linux/sched.h                                     |    2 
 include/linux/string.h                                    |    2 
 init/init_task.c                                          |    2 
 kernel/fork.c                                             |    4 
 lib/Kconfig.kasan                                         |   71 
 lib/test_kasan.c                                          |    2 
 lib/test_kasan_module.c                                   |    2 
 mm/kasan/Makefile                                         |   33 
 mm/kasan/common.c                                         | 1006 +++-----------
 mm/kasan/generic.c                                        |   72 -
 mm/kasan/generic_report.c                                 |   13 
 mm/kasan/hw_tags.c                                        |  276 +++
 mm/kasan/init.c                                           |   25 
 mm/kasan/kasan.h                                          |  195 ++
 mm/kasan/quarantine.c                                     |   35 
 mm/kasan/report.c                                         |  363 +----
 mm/kasan/report_generic.c                                 |  169 ++
 mm/kasan/report_hw_tags.c                                 |   44 
 mm/kasan/report_sw_tags.c                                 |   22 
 mm/kasan/shadow.c                                         |  528 +++++++
 mm/kasan/sw_tags.c                                        |   34 
 mm/kasan/tags.c                                           |    7 
 mm/kasan/tags_report.c                                    |    7 
 mm/mempool.c                                              |    4 
 mm/page_alloc.c                                           |    9 
 mm/page_poison.c                                          |    2 
 mm/ptdump.c                                               |   13 
 mm/slab_common.c                                          |    5 
 mm/slub.c                                                 |   29 
 scripts/Makefile.lib                                      |    2 
 tools/testing/selftests/arm64/mte/Makefile                |    2 
 tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c |  155 ++
 74 files changed, 2869 insertions(+), 1553 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2020-12-22 19:58 incoming Andrew Morton
@ 2020-12-22 21:43 ` Linus Torvalds
  0 siblings, 0 replies; 232+ messages in thread
From: Linus Torvalds @ 2020-12-22 21:43 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, Dec 22, 2020 at 11:58 AM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> 60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e.

I see that you enabled renaming in the patches. Lovely.

Can you also enable it in the diffstat?

>  74 files changed, 2869 insertions(+), 1553 deletions(-)

With -M in the diffstat, you should have seen

 72 files changed, 2775 insertions(+), 1460 deletions(-)

and if you add "--summary", you'll also see the rename part ofthe file
create/delete summary:

 rename mm/kasan/{tags_report.c => report_sw_tags.c} (78%)

which is often nice to see in addition to the line stats..

           Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2020-12-29 23:13 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-12-29 23:13 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

16 patches, based on dea8dcf2a9fa8cc540136a6cd885c3beece16ec3.

Subsystems affected by this patch series:

  mm/selftests
  mm/hugetlb
  kbuild
  checkpatch
  mm/pagecache
  mm/mremap
  mm/kasan
  misc
  lib
  mm/slub

Subsystem: mm/selftests

    Harish <harish@linux.ibm.com>:
      selftests/vm: fix building protection keys test

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      mm/hugetlb: fix deadlock in hugetlb_cow error path

Subsystem: kbuild

    Masahiro Yamada <masahiroy@kernel.org>:
      Revert "kbuild: avoid static_assert for genksyms"

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: prefer strscpy to strlcpy

Subsystem: mm/pagecache

    Souptick Joarder <jrdr.linux@gmail.com>:
      mm: add prototype for __add_to_page_cache_locked()

    Baoquan He <bhe@redhat.com>:
      mm: memmap defer init doesn't work as expected

Subsystem: mm/mremap

    Kalesh Singh <kaleshsingh@google.com>:
      mm/mremap.c: fix extent calculation

    Nicholas Piggin <npiggin@gmail.com>:
      mm: generalise COW SMC TLB flushing race comment

Subsystem: mm/kasan

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: fix null pointer dereference in kasan_record_aux_stack

Subsystem: misc

    Randy Dunlap <rdunlap@infradead.org>:
      local64.h: make <asm/local64.h> mandatory

    Huang Shijie <sjhuang@iluvatar.ai>:
      sizes.h: add SZ_8G/SZ_16G/SZ_32G macros

    Josh Poimboeuf <jpoimboe@redhat.com>:
      kdev_t: always inline major/minor helper functions

Subsystem: lib

    Huang Shijie <sjhuang@iluvatar.ai>:
      lib/genalloc: fix the overflow when size is too big

    Ilya Leoshkevich <iii@linux.ibm.com>:
      lib/zlib: fix inflating zlib streams on s390

    Randy Dunlap <rdunlap@infradead.org>:
      zlib: move EXPORT_SYMBOL() and MODULE_LICENSE() out of dfltcc_syms.c

Subsystem: mm/slub

    Roman Gushchin <guro@fb.com>:
      mm: slub: call account_slab_page() after slab page initialization

 arch/alpha/include/asm/local64.h    |    1 -
 arch/arc/include/asm/Kbuild         |    1 -
 arch/arm/include/asm/Kbuild         |    1 -
 arch/arm64/include/asm/Kbuild       |    1 -
 arch/csky/include/asm/Kbuild        |    1 -
 arch/h8300/include/asm/Kbuild       |    1 -
 arch/hexagon/include/asm/Kbuild     |    1 -
 arch/ia64/include/asm/local64.h     |    1 -
 arch/ia64/mm/init.c                 |    4 ++--
 arch/m68k/include/asm/Kbuild        |    1 -
 arch/microblaze/include/asm/Kbuild  |    1 -
 arch/mips/include/asm/Kbuild        |    1 -
 arch/nds32/include/asm/Kbuild       |    1 -
 arch/openrisc/include/asm/Kbuild    |    1 -
 arch/parisc/include/asm/Kbuild      |    1 -
 arch/powerpc/include/asm/Kbuild     |    1 -
 arch/riscv/include/asm/Kbuild       |    1 -
 arch/s390/include/asm/Kbuild        |    1 -
 arch/sh/include/asm/Kbuild          |    1 -
 arch/sparc/include/asm/Kbuild       |    1 -
 arch/x86/include/asm/local64.h      |    1 -
 arch/xtensa/include/asm/Kbuild      |    1 -
 include/asm-generic/Kbuild          |    1 +
 include/linux/build_bug.h           |    5 -----
 include/linux/kdev_t.h              |   22 +++++++++++-----------
 include/linux/mm.h                  |   12 ++++++++++--
 include/linux/sizes.h               |    3 +++
 lib/genalloc.c                      |   25 +++++++++++++------------
 lib/zlib_dfltcc/Makefile            |    2 +-
 lib/zlib_dfltcc/dfltcc.c            |    6 +++++-
 lib/zlib_dfltcc/dfltcc_deflate.c    |    3 +++
 lib/zlib_dfltcc/dfltcc_inflate.c    |    4 ++--
 lib/zlib_dfltcc/dfltcc_syms.c       |   17 -----------------
 mm/hugetlb.c                        |   22 +++++++++++++++++++++-
 mm/kasan/generic.c                  |    2 ++
 mm/memory.c                         |    8 +++++---
 mm/memory_hotplug.c                 |    2 +-
 mm/mremap.c                         |    4 +++-
 mm/page_alloc.c                     |    8 +++++---
 mm/slub.c                           |    5 ++---
 scripts/checkpatch.pl               |    6 ++++++
 tools/testing/selftests/vm/Makefile |   10 +++++-----
 42 files changed, 101 insertions(+), 91 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-01-12 23:48 Andrew Morton
  2021-01-15 23:32 ` incoming Linus Torvalds
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-01-12 23:48 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c.

Subsystems affected by this patch series:

  mm/slub
  mm/pagealloc
  mm/memcg
  mm/kasan
  mm/vmalloc
  mm/migration
  mm/hugetlb
  MAINTAINERS
  mm/memory-failure
  mm/process_vm_access

Subsystem: mm/slub

    Jann Horn <jannh@google.com>:
      mm, slub: consider rest of partial list if acquire_slab() fails

Subsystem: mm/pagealloc

    Hailong liu <liu.hailong6@zte.com.cn>:
      mm/page_alloc: add a missing mm_page_alloc_zone_locked() tracepoint

Subsystem: mm/memcg

    Hugh Dickins <hughd@google.com>:
      mm/memcontrol: fix warning in mem_cgroup_page_lruvec()

Subsystem: mm/kasan

    Hailong Liu <liu.hailong6@zte.com.cn>:
      arm/kasan: fix the array size of kasan_early_shadow_pte[]

Subsystem: mm/vmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/vmalloc.c: fix potential memory leak

Subsystem: mm/migration

    Jan Stancek <jstancek@redhat.com>:
      mm: migrate: initialize err in do_migrate_pages

Subsystem: mm/hugetlb

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: fix potential missing huge page size info

Subsystem: MAINTAINERS

    Vlastimil Babka <vbabka@suse.cz>:
      MAINTAINERS: add Vlastimil as slab allocators maintainer

Subsystem: mm/memory-failure

    Oscar Salvador <osalvador@suse.de>:
      mm,hwpoison: fix printing of page flags

Subsystem: mm/process_vm_access

    Andrew Morton <akpm@linux-foundation.org>:
      mm/process_vm_access.c: include compat.h

 MAINTAINERS                |    1 +
 include/linux/kasan.h      |    6 +++++-
 include/linux/memcontrol.h |    2 +-
 mm/hugetlb.c               |    2 +-
 mm/kasan/init.c            |    3 ++-
 mm/memory-failure.c        |    2 +-
 mm/mempolicy.c             |    2 +-
 mm/page_alloc.c            |   31 ++++++++++++++++---------------
 mm/process_vm_access.c     |    1 +
 mm/slub.c                  |    2 +-
 mm/vmalloc.c               |    4 +++-
 11 files changed, 33 insertions(+), 23 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-01-12 23:48 incoming Andrew Morton
@ 2021-01-15 23:32 ` Linus Torvalds
  0 siblings, 0 replies; 232+ messages in thread
From: Linus Torvalds @ 2021-01-15 23:32 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, Jan 12, 2021 at 3:48 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c.

Whee. I had completely dropped the ball on this - I had built my usual
"akpm" branch with the patches, but then had completely forgotten
about it after doing my basic build tests.

I tend to leave it for a while to see if people send belated ACK/NAK's
for the patches, but that "for a while" is typically "overnight", not
several days.

So if you ever notice that I haven't merged your patch submission, and
you haven't seen me comment on them, feel free to ping me to remind
me.

Because it might just have gotten lost in the shuffle for some random
reason. Admittedly it's rare - I think this is the first time I just
randomly noticed three days later that I'd never done the actual merge
of the patch-series).

               Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-01-24  5:00 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-01-24  5:00 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

19 patches, based on e1ae4b0be15891faf46d390e9f3dc9bd71a8cae1.

Subsystems affected by this patch series:

  mm/pagealloc
  mm/memcg
  mm/kasan
  ubsan
  mm/memory-failure
  mm/highmem
  proc
  MAINTAINERS

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: fix initialization of struct page for holes in memory layout", v3:
      x86/setup: don't remove E820_TYPE_RAM for pfn 0
      mm: fix initialization of struct page for holes in memory layout

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: optimize objcg stock draining

    Shakeel Butt <shakeelb@google.com>:
      mm: memcg: fix memcg file_dirty numa stat
      mm: fix numa stats for thp migration

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: prevent starvation when writing memory.high

Subsystem: mm/kasan

    Lecopzer Chen <lecopzer@gmail.com>:
      kasan: fix unaligned address is unhandled in kasan_remove_zero_shadow
      kasan: fix incorrect arguments passing in kasan_add_zero_shadow

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix HW_TAGS boot parameters
      kasan, mm: fix conflicts with init_on_alloc/free
      kasan, mm: fix resetting page_alloc tags for HW_TAGS

Subsystem: ubsan

    Arnd Bergmann <arnd@arndb.de>:
      ubsan: disable unsigned-overflow check for i386

Subsystem: mm/memory-failure

    Dan Williams <dan.j.williams@intel.com>:
      mm: fix page reference leak in soft_offline_page()

Subsystem: mm/highmem

    Thomas Gleixner <tglx@linutronix.de>:
    Patch series "mm/highmem: Fix fallout from generic kmap_local conversions":
      sparc/mm/highmem: flush cache and TLB
      mm/highmem: prepare for overriding set_pte_at()
      mips/mm/highmem: use set_pte() for kmap_local()
      powerpc/mm/highmem: use __set_pte_at() for kmap_local()

Subsystem: proc

    Xiaoming Ni <nixiaoming@huawei.com>:
      proc_sysctl: fix oops caused by incorrect command parameters

Subsystem: MAINTAINERS

    Nathan Chancellor <natechancellor@gmail.com>:
      MAINTAINERS: add a couple more files to the Clang/LLVM section

 Documentation/dev-tools/kasan.rst  |   27 ++---------
 MAINTAINERS                        |    2 
 arch/mips/include/asm/highmem.h    |    1 
 arch/powerpc/include/asm/highmem.h |    2 
 arch/sparc/include/asm/highmem.h   |    9 ++-
 arch/x86/kernel/setup.c            |   20 +++-----
 fs/proc/proc_sysctl.c              |    7 ++-
 lib/Kconfig.ubsan                  |    1 
 mm/highmem.c                       |    7 ++-
 mm/kasan/hw_tags.c                 |   77 +++++++++++++--------------------
 mm/kasan/init.c                    |   23 +++++----
 mm/memcontrol.c                    |   11 +---
 mm/memory-failure.c                |   20 ++++++--
 mm/migrate.c                       |   27 ++++++-----
 mm/page_alloc.c                    |   86 ++++++++++++++++++++++---------------
 mm/slub.c                          |    7 +--
 16 files changed, 173 insertions(+), 154 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-02-05  2:31 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-02-05  2:31 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

18 patches, based on 5c279c4cf206e03995e04fd3404fa95ffd243a97.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/compaction
  mm/vmalloc
  gcov
  mm/shmem
  mm/memblock
  mailmap
  mm/pagecache
  mm/kasan
  ubsan
  mm/hugetlb
  MAINTAINERS

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
      mm: hugetlbfs: fix cannot migrate the fallocated HugeTLB page
      mm: hugetlb: fix a race between freeing and dissolving the page
      mm: hugetlb: fix a race between isolating and freeing page
      mm: hugetlb: remove VM_BUG_ON_PAGE from page_huge_active
      mm: migrate: do not migrate HugeTLB page whose refcount is one

Subsystem: mm/compaction

    Rokudo Yan <wu-yan@tcl.com>:
      mm, compaction: move high_pfn to the for loop scope

Subsystem: mm/vmalloc

    Rick Edgecombe <rick.p.edgecombe@intel.com>:
      mm/vmalloc: separate put pages and flush VM flags

Subsystem: gcov

    Johannes Berg <johannes.berg@intel.com>:
      init/gcov: allow CONFIG_CONSTRUCTORS on UML to fix module gcov

Subsystem: mm/shmem

    Hugh Dickins <hughd@google.com>:
      mm: thp: fix MADV_REMOVE deadlock on shmem THP

Subsystem: mm/memblock

    Roman Gushchin <guro@fb.com>:
      memblock: do not start bottom-up allocations with kernel_end

Subsystem: mailmap

    Viresh Kumar <viresh.kumar@linaro.org>:
      mailmap: fix name/email for Viresh Kumar

    Manivannan Sadhasivam <manivannan.sadhasivam@linaro.org>:
      mailmap: add entries for Manivannan Sadhasivam

Subsystem: mm/pagecache

    Waiman Long <longman@redhat.com>:
      mm/filemap: add missing mem_cgroup_uncharge() to __add_to_page_cache_locked()

Subsystem: mm/kasan

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
    Patch series "kasan: Fix metadata detection for KASAN_HW_TAGS", v5:
      kasan: add explicit preconditions to kasan_report()
      kasan: make addr_has_metadata() return true for valid addresses

Subsystem: ubsan

    Nathan Chancellor <nathan@kernel.org>:
      ubsan: implement __ubsan_handle_alignment_assumption

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
      mm: hugetlb: fix missing put_page in gather_surplus_pages()

Subsystem: MAINTAINERS

    Nathan Chancellor <nathan@kernel.org>:
      MAINTAINERS/.mailmap: use my @kernel.org address

 .mailmap                |    5 ++++
 MAINTAINERS             |    2 -
 fs/hugetlbfs/inode.c    |    3 +-
 include/linux/hugetlb.h |    2 +
 include/linux/kasan.h   |    7 ++++++
 include/linux/vmalloc.h |    9 +-------
 init/Kconfig            |    1 
 init/main.c             |    8 ++++++-
 kernel/gcov/Kconfig     |    2 -
 lib/ubsan.c             |   31 ++++++++++++++++++++++++++++
 lib/ubsan.h             |    6 +++++
 mm/compaction.c         |    3 +-
 mm/filemap.c            |    4 +++
 mm/huge_memory.c        |   37 ++++++++++++++++++++-------------
 mm/hugetlb.c            |   53 ++++++++++++++++++++++++++++++++++++++++++------
 mm/kasan/kasan.h        |    2 -
 mm/memblock.c           |   49 +++++---------------------------------------
 mm/migrate.c            |    6 +++++
 18 files changed, 153 insertions(+), 77 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-02-09 21:41 Andrew Morton
  2021-02-10 19:30 ` incoming Linus Torvalds
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-02-09 21:41 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

14 patches, based on e0756cfc7d7cd08c98a53b6009c091a3f6a50be6.

Subsystems affected by this patch series:

  squashfs
  mm/kasan
  firmware
  mm/mremap
  mm/tmpfs
  mm/selftests
  MAINTAINERS
  mm/memcg
  mm/slub
  nilfs2

Subsystem: squashfs

    Phillip Lougher <phillip@squashfs.org.uk>:
    Patch series "Squashfs: fix BIO migration regression and add sanity checks":
      squashfs: avoid out of bounds writes in decompressors
      squashfs: add more sanity checks in id lookup
      squashfs: add more sanity checks in inode lookup
      squashfs: add more sanity checks in xattr id lookup

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix stack traces dependency for HW_TAGS

Subsystem: firmware

    Fangrui Song <maskray@google.com>:
      firmware_loader: align .builtin_fw to 8

Subsystem: mm/mremap

    Arnd Bergmann <arnd@arndb.de>:
      mm/mremap: fix BUILD_BUG_ON() error in get_extent

Subsystem: mm/tmpfs

    Seth Forshee <seth.forshee@canonical.com>:
      tmpfs: disallow CONFIG_TMPFS_INODE64 on s390
      tmpfs: disallow CONFIG_TMPFS_INODE64 on alpha

Subsystem: mm/selftests

    Rong Chen <rong.a.chen@intel.com>:
      selftests/vm: rename file run_vmtests to run_vmtests.sh

Subsystem: MAINTAINERS

    Andrey Ryabinin <ryabinin.a.a@gmail.com>:
      MAINTAINERS: update Andrey Ryabinin's email address

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      Revert "mm: memcontrol: avoid workload stalls when lowering memory.high"

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: better heuristic for number of cpus when calculating slab order

Subsystem: nilfs2

    Joachim Henke <joachim.henke@t-systems.com>:
      nilfs2: make splice write available again

 .mailmap                          |    1 
 Documentation/dev-tools/kasan.rst |    3 -
 MAINTAINERS                       |    2 -
 fs/Kconfig                        |    4 +-
 fs/nilfs2/file.c                  |    1 
 fs/squashfs/block.c               |    8 ++++
 fs/squashfs/export.c              |   41 +++++++++++++++++++----
 fs/squashfs/id.c                  |   40 ++++++++++++++++++-----
 fs/squashfs/squashfs_fs_sb.h      |    1 
 fs/squashfs/super.c               |    6 +--
 fs/squashfs/xattr.h               |   10 +++++
 fs/squashfs/xattr_id.c            |   66 ++++++++++++++++++++++++++++++++------
 include/asm-generic/vmlinux.lds.h |    2 -
 mm/kasan/hw_tags.c                |    8 +---
 mm/memcontrol.c                   |    5 +-
 mm/mremap.c                       |    5 +-
 mm/slub.c                         |   18 +++++++++-
 17 files changed, 172 insertions(+), 49 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-02-09 21:41 incoming Andrew Morton
@ 2021-02-10 19:30 ` Linus Torvalds
  0 siblings, 0 replies; 232+ messages in thread
From: Linus Torvalds @ 2021-02-10 19:30 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

Hah. This series shows a small deficiency in your scripting wrt the diffstat:

On Tue, Feb 9, 2021 at 1:41 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
>  .mailmap                          |    1
...
>  mm/slub.c                         |   18 +++++++++-
>  17 files changed, 172 insertions(+), 49 deletions(-)

It actually has 18 files changed, but one of them is a pure rename (no
change to the content), and apparently your diffstat tool can't handle
that case.

It *should* have ended with

 ...
 mm/slub.c                                          | 18 +++++-
 .../selftests/vm/{run_vmtests => run_vmtests.sh}   |  0
 18 files changed, 172 insertions(+), 49 deletions(-)
 rename tools/testing/selftests/vm/{run_vmtests => run_vmtests.sh} (100%)

if you'd done a proper "git diff -M --stat --summary" of the series.

[ Ok, by default git would actually have said

    18 files changed, 171 insertions(+), 48 deletions(-)

  but it looks like you use the patience diff option, which gives that
extra insertion/deletion line because it generates the diff a bit
differently ]

Not a big deal,, but it made me briefly wonder "why doesn't my
diffstat match yours".

           Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-02-13  4:52 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-02-13  4:52 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

6 patches, based on dcc0b49040c70ad827a7f3d58a21b01fdb14e749.

Subsystems affected by this patch series:

  mm/pagemap
  scripts
  MAINTAINERS
  h8300

Subsystem: mm/pagemap

    Mike Rapoport <rppt@linux.ibm.com>:
      m68k: make __pfn_to_phys() and __phys_to_pfn() available for !MMU

Subsystem: scripts

    Rong Chen <rong.a.chen@intel.com>:
      scripts/recordmcount.pl: support big endian for ARCH sh

Subsystem: MAINTAINERS

    Andrey Konovalov <andreyknvl@google.com>:
      MAINTAINERS: update KASAN file list
      MAINTAINERS: update Andrey Konovalov's email address
      MAINTAINERS: add Andrey Konovalov to KASAN reviewers

Subsystem: h8300

    Randy Dunlap <rdunlap@infradead.org>:
      h8300: fix PREEMPTION build, TI_PRE_COUNT undefined

 MAINTAINERS                     |    8 +++++---
 arch/h8300/kernel/asm-offsets.c |    3 +++
 arch/m68k/include/asm/page.h    |    2 +-
 scripts/recordmcount.pl         |    6 +++++-
 4 files changed, 14 insertions(+), 5 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-02-24 19:58 Andrew Morton
  2021-02-24 21:30 ` incoming Linus Torvalds
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-02-24 19:58 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


A few small subsystems and some of MM.


173 patches, based on c03c21ba6f4e95e406a1a7b4c34ef334b977c194.

Subsystems affected by this patch series:

  hexagon
  scripts
  ntfs
  ocfs2
  vfs
  mm/slab-generic
  mm/slab
  mm/slub
  mm/debug
  mm/pagecache
  mm/swap
  mm/memcg
  mm/pagemap
  mm/mprotect
  mm/mremap
  mm/page-reporting
  mm/vmalloc
  mm/kasan
  mm/pagealloc
  mm/memory-failure
  mm/hugetlb
  mm/vmscan
  mm/z3fold
  mm/compaction
  mm/mempolicy
  mm/oom-kill
  mm/hugetlbfs
  mm/migration

Subsystem: hexagon

    Randy Dunlap <rdunlap@infradead.org>:
      hexagon: remove CONFIG_EXPERIMENTAL from defconfigs

Subsystem: scripts

    tangchunyou <tangchunyou@yulong.com>:
      scripts/spelling.txt: increase error-prone spell checking

    zuoqilin <zuoqilin@yulong.com>:
      scripts/spelling.txt: check for "exeeds"

    dingsenjie <dingsenjie@yulong.com>:
      scripts/spelling.txt: add "allocted" and "exeeds" typo

    Colin Ian King <colin.king@canonical.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

Subsystem: ntfs

    Randy Dunlap <rdunlap@infradead.org>:
      ntfs: layout.h: delete duplicated words

    Rustam Kovhaev <rkovhaev@gmail.com>:
      ntfs: check for valid standard information attribute

Subsystem: ocfs2

    Yi Li <yili@winhong.com>:
      ocfs2: remove redundant conditional before iput

    guozh <guozh88@chinatelecom.cn>:
      ocfs2: clean up some definitions which are not used any more

    Dan Carpenter <dan.carpenter@oracle.com>:
      ocfs2: fix a use after free on error

    Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
      ocfs2: simplify the calculation of variables

Subsystem: vfs

    Randy Dunlap <rdunlap@infradead.org>:
      fs: delete repeated words in comments

    Alexey Dobriyan <adobriyan@gmail.com>:
      ramfs: support O_TMPFILE

Subsystem: mm/slab-generic

    Jacob Wen <jian.w.wen@oracle.com>:
      mm, tracing: record slab name for kmem_cache_free()

    Nikolay Borisov <nborisov@suse.com>:
      mm/sl?b.c: remove ctor argument from kmem_cache_flags

Subsystem: mm/slab

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/slab: minor coding style tweaks

Subsystem: mm/slub

    Johannes Berg <johannes.berg@intel.com>:
      mm/slub: disable user tracing for kmemleak caches by default

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "mm, slab, slub: remove cpu and memory hotplug locks":
      mm, slub: stop freeing kmem_cache_node structures on node offline
      mm, slab, slub: stop taking memory hotplug lock
      mm, slab, slub: stop taking cpu hotplug lock
      mm, slub: splice cpu and page freelists in deactivate_slab()
      mm, slub: remove slub_memcg_sysfs boot param and CONFIG_SLUB_MEMCG_SYSFS_ON

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/slub: minor coding style tweaks

Subsystem: mm/debug

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/debug: improve memcg debugging

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/debug_vm_pgtable: Some minor updates", v3:
      mm/debug_vm_pgtable/basic: add validation for dirtiness after write protect
      mm/debug_vm_pgtable/basic: iterate over entire protection_map[]

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/page_owner: use helper function zone_end_pfn() to get end_pfn

Subsystem: mm/pagecache

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/filemap: remove unused parameter and change to void type for replace_page_cache_page()

    Pavel Begunkov <asml.silence@gmail.com>:
      mm/filemap: don't revert iter on -EIOCBQUEUED

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Refactor generic_file_buffered_read", v5:
      mm/filemap: rename generic_file_buffered_read subfunctions
      mm/filemap: remove dynamically allocated array from filemap_read
      mm/filemap: convert filemap_get_pages to take a pagevec
      mm/filemap: use head pages in generic_file_buffered_read
      mm/filemap: pass a sleep state to put_and_wait_on_page_locked
      mm/filemap: support readpage splitting a page
      mm/filemap: inline __wait_on_page_locked_async into caller
      mm/filemap: don't call ->readpage if IOCB_WAITQ is set
      mm/filemap: change filemap_read_page calling conventions
      mm/filemap: change filemap_create_page calling conventions
      mm/filemap: convert filemap_update_page to return an errno
      mm/filemap: move the iocb checks into filemap_update_page
      mm/filemap: add filemap_range_uptodate
      mm/filemap: split filemap_readahead out of filemap_get_pages
      mm/filemap: restructure filemap_get_pages
      mm/filemap: don't relock the page after calling readpage

    Christoph Hellwig <hch@lst.de>:
      mm/filemap: rename generic_file_buffered_read to filemap_read
      mm/filemap: simplify generic_file_read_iter

    Yang Guo <guoyang2@huawei.com>:
      fs/buffer.c: add checking buffer head stat before clear

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: backing-dev: Remove duplicated macro definition

Subsystem: mm/swap

    Yang Li <abaci-bugfix@linux.alibaba.com>:
      mm/swap_slots.c: remove redundant NULL check

    Stephen Zhang <stephenzhangzsd@gmail.com>:
      mm/swapfile.c: fix debugging information problem

    Georgi Djakov <georgi.djakov@linaro.org>:
      mm/page_io: use pr_alert_ratelimited for swap read/write errors

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      mm/swap_state: constify static struct attribute_group

    Yu Zhao <yuzhao@google.com>:
      mm/swap: don't SetPageWorkingset unconditionally during swapin

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: pre-allocate obj_cgroups for slab caches with SLAB_ACCOUNT

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: optimize per-lruvec stats counter memory usage
    Patch series "Convert all THP vmstat counters to pages", v6:
      mm: memcontrol: fix NR_ANON_THPS accounting in charge moving
      mm: memcontrol: convert NR_ANON_THPS account to pages
      mm: memcontrol: convert NR_FILE_THPS account to pages
      mm: memcontrol: convert NR_SHMEM_THPS account to pages
      mm: memcontrol: convert NR_SHMEM_PMDMAPPED account to pages
      mm: memcontrol: convert NR_FILE_PMDMAPPED account to pages
      mm: memcontrol: make the slab calculation consistent

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: revise the using condition of lock_page_lruvec function series
      mm/memcg: remove rcu locking for lock_page_lruvec function series

    Shakeel Butt <shakeelb@google.com>:
      mm: memcg: add swapcache stat for memcg v2

    Roman Gushchin <guro@fb.com>:
      mm: kmem: make __memcg_kmem_(un)charge static

    Feng Tang <feng.tang@intel.com>:
      mm: page_counter: re-layout structure to reduce false sharing

    Yang Li <abaci-bugfix@linux.alibaba.com>:
      mm/memcontrol: remove redundant NULL check

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: replace the loop with a list_for_each_entry()

    Shakeel Butt <shakeelb@google.com>:
      mm/list_lru.c: remove kvfree_rcu_local()

    Johannes Weiner <hannes@cmpxchg.org>:
      fs: buffer: use raw page_memcg() on locked page

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix swap undercounting in cgroup2
      mm: memcontrol: fix get_active_memcg return value
      mm: memcontrol: fix slub memory accounting

Subsystem: mm/pagemap

    Adrian Huang <ahuang12@lenovo.com>:
      mm/mmap.c: remove unnecessary local variable

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memory.c: fix potential pte_unmap_unlock pte error
      mm/pgtable-generic.c: simplify the VM_BUG_ON condition in pmdp_huge_clear_flush()
      mm/pgtable-generic.c: optimize the VM_BUG_ON condition in pmdp_huge_clear_flush()
      mm/memory.c: fix potential pte_unmap_unlock pte error

Subsystem: mm/mprotect

    Tianjia Zhang <tianjia.zhang@linux.alibaba.com>:
      mm/mprotect.c: optimize error detection in do_mprotect_pkey()

Subsystem: mm/mremap

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm: rmap: explicitly reset vma->anon_vma in unlink_anon_vmas()
      mm: mremap: unlink anon_vmas when mremap with MREMAP_DONTUNMAP success

Subsystem: mm/page-reporting

    sh <sh_def@163.com>:
      mm/page_reporting: use list_entry_is_head() in page_reporting_cycle()

Subsystem: mm/vmalloc

    Yang Li <abaci-bugfix@linux.alibaba.com>:
      vmalloc: remove redundant NULL check

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: HW_TAGS tests support and fixes", v4:
      kasan: prefix global functions with kasan_
      kasan: clarify HW_TAGS impact on TBI
      kasan: clean up comments in tests
      kasan: add macros to simplify checking test constraints
      kasan: add match-all tag tests
      kasan, arm64: allow using KUnit tests with HW_TAGS mode
      kasan: rename CONFIG_TEST_KASAN_MODULE
      kasan: add compiler barriers to KUNIT_EXPECT_KASAN_FAIL
      kasan: adapt kmalloc_uaf2 test to HW_TAGS mode
      kasan: fix memory corruption in kasan_bitops_tags test
      kasan: move _RET_IP_ to inline wrappers
      kasan: fix bug detection via ksize for HW_TAGS mode
      kasan: add proper page allocator tests
      kasan: add a test for kmem_cache_alloc/free_bulk
      kasan: don't run tests when KASAN is not enabled

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: remove redundant config option

Subsystem: mm/pagealloc

    Baoquan He <bhe@redhat.com>:
    Patch series "mm: clean up names and parameters of memmap_init_xxxx functions", v5:
      mm: fix prototype warning from kernel test robot
      mm: rename memmap_init() and memmap_init_zone()
      mm: simplify parater of function memmap_init_zone()
      mm: simplify parameter of setup_usemap()
      mm: remove unneeded local variable in free_area_init_core

    David Hildenbrand <david@redhat.com>:
    Patch series "mm: simplify free_highmem_page() and free_reserved_page()":
      video: fbdev: acornfb: remove free_unused_pages()
      mm: simplify free_highmem_page() and free_reserved_page()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/gfp: add kernel-doc for gfp_t

Subsystem: mm/memory-failure

    Aili Yao <yaoaili@kingsoft.com>:
      mm,hwpoison: send SIGBUS to PF_MCE_EARLY processes on action required events

Subsystem: mm/hugetlb

    Bibo Mao <maobibo@loongson.cn>:
      mm/huge_memory.c: update tlb entry if pmd is changed
      MIPS: do not call flush_tlb_all when setting pmd entry

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: fix potential double free in hugetlb_register_node() error path

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm/hugetlb.c: fix unnecessary address expansion of pmd sharing

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: avoid unnecessary hugetlb_acct_memory() call
      mm/hugetlb: use helper huge_page_order and pages_per_huge_page
      mm/hugetlb: fix use after free when subpool max_hpages accounting is not enabled

    Jiapeng Zhong <abaci-bugfix@linux.alibaba.com>:
      mm/hugetlb: simplify the calculation of variables

    Joao Martins <joao.m.martins@oracle.com>:
    Patch series "mm/hugetlb: follow_hugetlb_page() improvements", v2:
      mm/hugetlb: grab head page refcount once for group of subpages
      mm/hugetlb: refactor subpage recording

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: fix some comment typos

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/hugetlb: remove redundant check in preparing and destroying gigantic page

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/hugetlb.c: fix typos in comments

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/huge_memory.c: remove unused return value of set_huge_zero_page()

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/pmem: avoid inserting hugepage PTE entry with fsdax if hugepage support is disabled

    Miaohe Lin <linmiaohe@huawei.com>:
      hugetlb_cgroup: use helper pages_per_huge_page() in hugetlb_cgroup
      mm/hugetlb: use helper function range_in_vma() in page_table_shareable()
      mm/hugetlb: remove unnecessary VM_BUG_ON_PAGE on putback_active_hugepage()
      mm/hugetlb: use helper huge_page_size() to get hugepage size

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: fix update_and_free_page contig page struct assumption
      hugetlb: fix copy_huge_page_from_user contig page struct assumption

    Chen Wandun <chenwandun@huawei.com>:
      mm/hugetlb: suppress wrong warning info when alloc gigantic page

Subsystem: mm/vmscan

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/vmscan: __isolate_lru_page_prepare() cleanup

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/workingset.c: avoid unnecessary max_nodes estimation in count_shadow_nodes()

    Yu Zhao <yuzhao@google.com>:
    Patch series "mm: lru related cleanups", v2:
      mm/vmscan.c: use add_page_to_lru_list()
      include/linux/mm_inline.h: shuffle lru list addition and deletion functions
      mm: don't pass "enum lru_list" to lru list addition functions
      mm/swap.c: don't pass "enum lru_list" to trace_mm_lru_insertion()
      mm/swap.c: don't pass "enum lru_list" to del_page_from_lru_list()
      mm: add __clear_page_lru_flags() to replace page_off_lru()
      mm: VM_BUG_ON lru page flags
      include/linux/mm_inline.h: fold page_lru_base_type() into its sole caller
      include/linux/mm_inline.h: fold __update_lru_size() into its sole caller
      mm/vmscan.c: make lruvec_lru_size() static

    Oscar Salvador <osalvador@suse.de>:
      mm: workingset: clarify eviction order and distance calculation

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "create hugetlb flags to consolidate state", v3:
      hugetlb: use page.private for hugetlb specific page flags
      hugetlb: convert page_huge_active() HPageMigratable flag
      hugetlb: convert PageHugeTemporary() to HPageTemporary flag
      hugetlb: convert PageHugeFreed to HPageFreed flag
      include/linux/hugetlb.h: add synchronization information for new hugetlb specific flags
      hugetlb: fix uninitialized subpool pointer

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: restore zone_reclaim_mode ABI

Subsystem: mm/z3fold

    Miaohe Lin <linmiaohe@huawei.com>:
      z3fold: remove unused attribute for release_z3fold_page
      z3fold: simplify the zhdr initialization code in init_z3fold_page()

Subsystem: mm/compaction

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/compaction: remove rcu_read_lock during page compaction

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/compaction: remove duplicated VM_BUG_ON_PAGE !PageLocked

    Charan Teja Reddy <charante@codeaurora.org>:
      mm/compaction: correct deferral logic for proactive compaction

    Wonhyuk Yang <vvghjk1234@gmail.com>:
      mm/compaction: fix misbehaviors of fast_find_migrateblock()

    Vlastimil Babka <vbabka@suse.cz>:
      mm, compaction: make fast_isolate_freepages() stay within zone

Subsystem: mm/mempolicy

    Huang Ying <ying.huang@intel.com>:
      numa balancing: migrate on fault among multiple bound nodes

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mempolicy: use helper range_in_vma() in queue_pages_test_walk()

Subsystem: mm/oom-kill

    Tang Yizhou <tangyizhou@huawei.com>:
      mm, oom: fix a comment in dump_task()

Subsystem: mm/hugetlbfs

    Mike Kravetz <mike.kravetz@oracle.com>:
      mm/hugetlb: change hugetlb_reserve_pages() to type bool
      hugetlbfs: remove special hugetlbfs_set_page_dirty()

    Miaohe Lin <linmiaohe@huawei.com>:
      hugetlbfs: remove useless BUG_ON(!inode) in hugetlbfs_setattr()
      hugetlbfs: use helper macro default_hstate in init_hugetlbfs_fs
      hugetlbfs: correct obsolete function name in hugetlbfs_read_iter()
      hugetlbfs: remove meaningless variable avoid_reserve
      hugetlbfs: make hugepage size conversion more readable
      hugetlbfs: correct some obsolete comments about inode i_mutex
      hugetlbfs: fix some comment typos
      hugetlbfs: remove unneeded return value of hugetlb_vmtruncate()

Subsystem: mm/migration

    Chengyang Fan <cy.fan@huawei.com>:
      mm/migrate: remove unneeded semicolons

 Documentation/admin-guide/cgroup-v2.rst         |    4 
 Documentation/admin-guide/kernel-parameters.txt |    8 
 Documentation/admin-guide/sysctl/vm.rst         |   10 
 Documentation/core-api/mm-api.rst               |    7 
 Documentation/dev-tools/kasan.rst               |   24 
 Documentation/vm/arch_pgtable_helpers.rst       |    8 
 arch/arm64/include/asm/memory.h                 |    1 
 arch/arm64/include/asm/mte-kasan.h              |   12 
 arch/arm64/kernel/mte.c                         |   12 
 arch/arm64/kernel/sleep.S                       |    2 
 arch/arm64/mm/fault.c                           |   20 
 arch/hexagon/configs/comet_defconfig            |    1 
 arch/ia64/include/asm/pgtable.h                 |    6 
 arch/ia64/mm/init.c                             |   18 
 arch/mips/mm/pgtable-32.c                       |    1 
 arch/mips/mm/pgtable-64.c                       |    1 
 arch/x86/kernel/acpi/wakeup_64.S                |    2 
 drivers/base/node.c                             |   33 
 drivers/video/fbdev/acornfb.c                   |   34 
 fs/block_dev.c                                  |    2 
 fs/btrfs/file.c                                 |    2 
 fs/buffer.c                                     |    7 
 fs/dcache.c                                     |    4 
 fs/direct-io.c                                  |    4 
 fs/exec.c                                       |    4 
 fs/fhandle.c                                    |    2 
 fs/fuse/dev.c                                   |    6 
 fs/hugetlbfs/inode.c                            |   72 --
 fs/ntfs/inode.c                                 |    6 
 fs/ntfs/layout.h                                |    4 
 fs/ocfs2/cluster/heartbeat.c                    |    8 
 fs/ocfs2/dlm/dlmast.c                           |   10 
 fs/ocfs2/dlm/dlmcommon.h                        |    4 
 fs/ocfs2/refcounttree.c                         |    2 
 fs/ocfs2/super.c                                |    2 
 fs/pipe.c                                       |    2 
 fs/proc/meminfo.c                               |   10 
 fs/proc/vmcore.c                                |    7 
 fs/ramfs/inode.c                                |   13 
 include/linux/fs.h                              |    4 
 include/linux/gfp.h                             |   14 
 include/linux/highmem-internal.h                |    5 
 include/linux/huge_mm.h                         |   15 
 include/linux/hugetlb.h                         |   98 ++
 include/linux/kasan-checks.h                    |    6 
 include/linux/kasan.h                           |   39 -
 include/linux/memcontrol.h                      |   43 -
 include/linux/migrate.h                         |    2 
 include/linux/mm.h                              |   28 
 include/linux/mm_inline.h                       |  123 +--
 include/linux/mmzone.h                          |   30 
 include/linux/page-flags.h                      |    6 
 include/linux/page_counter.h                    |    9 
 include/linux/pagemap.h                         |    5 
 include/linux/swap.h                            |    8 
 include/trace/events/kmem.h                     |   24 
 include/trace/events/pagemap.h                  |   11 
 include/uapi/linux/mempolicy.h                  |    4 
 init/Kconfig                                    |   14 
 lib/Kconfig.kasan                               |   14 
 lib/Makefile                                    |    2 
 lib/test_kasan.c                                |  446 ++++++++----
 lib/test_kasan_module.c                         |    5 
 mm/backing-dev.c                                |    6 
 mm/compaction.c                                 |   73 +-
 mm/debug.c                                      |   10 
 mm/debug_vm_pgtable.c                           |   86 ++
 mm/filemap.c                                    |  859 +++++++++++-------------
 mm/gup.c                                        |    5 
 mm/huge_memory.c                                |   28 
 mm/hugetlb.c                                    |  376 ++++------
 mm/hugetlb_cgroup.c                             |    6 
 mm/kasan/common.c                               |   60 -
 mm/kasan/generic.c                              |   40 -
 mm/kasan/hw_tags.c                              |   16 
 mm/kasan/kasan.h                                |   87 +-
 mm/kasan/quarantine.c                           |   22 
 mm/kasan/report.c                               |   15 
 mm/kasan/report_generic.c                       |   10 
 mm/kasan/report_hw_tags.c                       |    8 
 mm/kasan/report_sw_tags.c                       |    8 
 mm/kasan/shadow.c                               |   27 
 mm/kasan/sw_tags.c                              |   22 
 mm/khugepaged.c                                 |    6 
 mm/list_lru.c                                   |   12 
 mm/memcontrol.c                                 |  309 ++++----
 mm/memory-failure.c                             |   34 
 mm/memory.c                                     |   24 
 mm/memory_hotplug.c                             |   11 
 mm/mempolicy.c                                  |   18 
 mm/mempool.c                                    |    2 
 mm/migrate.c                                    |   10 
 mm/mlock.c                                      |    3 
 mm/mmap.c                                       |    4 
 mm/mprotect.c                                   |    7 
 mm/mremap.c                                     |    8 
 mm/oom_kill.c                                   |    5 
 mm/page_alloc.c                                 |   70 -
 mm/page_io.c                                    |   12 
 mm/page_owner.c                                 |    4 
 mm/page_reporting.c                             |    2 
 mm/pgtable-generic.c                            |    9 
 mm/rmap.c                                       |   35 
 mm/shmem.c                                      |    2 
 mm/slab.c                                       |   21 
 mm/slab.h                                       |   20 
 mm/slab_common.c                                |   40 -
 mm/slob.c                                       |    2 
 mm/slub.c                                       |  169 ++--
 mm/swap.c                                       |   54 -
 mm/swap_slots.c                                 |    3 
 mm/swap_state.c                                 |   31 
 mm/swapfile.c                                   |    8 
 mm/vmscan.c                                     |  100 +-
 mm/vmstat.c                                     |   14 
 mm/workingset.c                                 |    7 
 mm/z3fold.c                                     |   11 
 scripts/Makefile.kasan                          |   10 
 scripts/spelling.txt                            |   30 
 tools/objtool/check.c                           |    2 
 120 files changed, 2249 insertions(+), 1954 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-02-24 19:58 incoming Andrew Morton
@ 2021-02-24 21:30 ` Linus Torvalds
  2021-02-24 21:37   ` incoming Linus Torvalds
  0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2021-02-24 21:30 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Wed, Feb 24, 2021 at 11:58 AM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> A few small subsystems and some of MM.

Hmm. I haven't bisected things yet, but I suspect it's something with
the KASAN patches. With this all applied, I get:

  lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
  lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]

and

  lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
  lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
larger than 2048 bytes [-Wframe-larger-than=]

which is obviously not really acceptable. A 11kB stack frame _will_
cause issues.

              Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-02-24 21:30 ` incoming Linus Torvalds
@ 2021-02-24 21:37   ` Linus Torvalds
  2021-02-25  8:53     ` incoming Arnd Bergmann
  0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2021-02-24 21:37 UTC (permalink / raw)
  To: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor,
	Arnd Bergmann, Andrey Konovalov
  Cc: Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko

On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Hmm. I haven't bisected things yet, but I suspect it's something with
> the KASAN patches. With this all applied, I get:
>
>   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
>   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
>
> and
>
>   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
>   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> larger than 2048 bytes [-Wframe-larger-than=]
>
> which is obviously not really acceptable. A 11kB stack frame _will_
> cause issues.

A quick bisect shoes that this was introduced by "[patch 101/173]
kasan: remove redundant config option".

I didn't check what part of that patch screws up, but it's definitely
doing something bad.

I will drop that patch.

               Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-02-24 21:37   ` incoming Linus Torvalds
@ 2021-02-25  8:53     ` Arnd Bergmann
  2021-02-25  9:12       ` incoming Andrey Ryabinin
  0 siblings, 1 reply; 232+ messages in thread
From: Arnd Bergmann @ 2021-02-25  8:53 UTC (permalink / raw)
  To: Linus Torvalds
  Cc: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor,
	Arnd Bergmann, Andrey Konovalov, Linux-MM, mm-commits,
	Andrey Ryabinin, Alexander Potapenko

On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > Hmm. I haven't bisected things yet, but I suspect it's something with
> > the KASAN patches. With this all applied, I get:
> >
> >   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> >   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> >
> > and
> >
> >   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> >   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > larger than 2048 bytes [-Wframe-larger-than=]
> >
> > which is obviously not really acceptable. A 11kB stack frame _will_
> > cause issues.
>
> A quick bisect shoes that this was introduced by "[patch 101/173]
> kasan: remove redundant config option".
>
> I didn't check what part of that patch screws up, but it's definitely
> doing something bad.

I'm not sure why that patch surfaced the bug, but it's worth pointing
out that the underlying problem is asan-stack in combination
with the structleak plugin. This will happen for every user of kunit.

I sent a series[1] out earlier this year to turn off the structleak
plugin as an alternative workaround, but need to follow up on
the remaining patches. Someone suggested adding a more
generic way to turn off the plugin for a file instead of open-coding
the CLFAGS_REMOVE_*.o Makefile bit, which would help.

I am also still hoping that someone can come up with a way
to make kunit work better with the structleak plugin, as there
shouldn't be a fundamental reason why it can't work, just that
it the code pattern triggers a particularly bad case in the compiler.

      Arnd

[1] https://lore.kernel.org/lkml/20210125124533.101339-1-arnd@kernel.org/

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-02-25  8:53     ` incoming Arnd Bergmann
@ 2021-02-25  9:12       ` Andrey Ryabinin
  2021-02-25 11:07         ` incoming Walter Wu
  0 siblings, 1 reply; 232+ messages in thread
From: Andrey Ryabinin @ 2021-02-25  9:12 UTC (permalink / raw)
  To: Arnd Bergmann
  Cc: Linus Torvalds, Andrew Morton, Walter Wu, Dmitry Vyukov,
	Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM,
	mm-commits, Andrey Ryabinin, Alexander Potapenko

On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote:
>
> On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> > <torvalds@linux-foundation.org> wrote:
> > >
> > > Hmm. I haven't bisected things yet, but I suspect it's something with
> > > the KASAN patches. With this all applied, I get:
> > >
> > >   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > >   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> > >
> > > and
> > >
> > >   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > >   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > > larger than 2048 bytes [-Wframe-larger-than=]
> > >
> > > which is obviously not really acceptable. A 11kB stack frame _will_
> > > cause issues.
> >
> > A quick bisect shoes that this was introduced by "[patch 101/173]
> > kasan: remove redundant config option".
> >
> > I didn't check what part of that patch screws up, but it's definitely
> > doing something bad.
>
> I'm not sure why that patch surfaced the bug, but it's worth pointing
> out that the underlying problem is asan-stack in combination
> with the structleak plugin. This will happen for every user of kunit.
>

The patch didn't update KASAN_STACK dependency in kconfig:
        config GCC_PLUGIN_STRUCTLEAK_BYREF
....
               depends on !(KASAN && KASAN_STACK=1)

This 'depends on'  stopped working with the patch

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-02-25  9:12       ` incoming Andrey Ryabinin
@ 2021-02-25 11:07         ` Walter Wu
  0 siblings, 0 replies; 232+ messages in thread
From: Walter Wu @ 2021-02-25 11:07 UTC (permalink / raw)
  To: Andrey Ryabinin
  Cc: Arnd Bergmann, Linus Torvalds, Andrew Morton, Dmitry Vyukov,
	Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM,
	mm-commits, Andrey Ryabinin, Alexander Potapenko

Hi Andrey,

On Thu, 2021-02-25 at 12:12 +0300, Andrey Ryabinin wrote:
> On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote:
> >
> > On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
> > <torvalds@linux-foundation.org> wrote:
> > >
> > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> > > <torvalds@linux-foundation.org> wrote:
> > > >
> > > > Hmm. I haven't bisected things yet, but I suspect it's something with
> > > > the KASAN patches. With this all applied, I get:
> > > >
> > > >   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > > >   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> > > >
> > > > and
> > > >
> > > >   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > > >   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > > > larger than 2048 bytes [-Wframe-larger-than=]
> > > >
> > > > which is obviously not really acceptable. A 11kB stack frame _will_
> > > > cause issues.
> > >
> > > A quick bisect shoes that this was introduced by "[patch 101/173]
> > > kasan: remove redundant config option".
> > >
> > > I didn't check what part of that patch screws up, but it's definitely
> > > doing something bad.
> >
> > I'm not sure why that patch surfaced the bug, but it's worth pointing
> > out that the underlying problem is asan-stack in combination
> > with the structleak plugin. This will happen for every user of kunit.
> >
> 
> The patch didn't update KASAN_STACK dependency in kconfig:
>         config GCC_PLUGIN_STRUCTLEAK_BYREF
> ....
>                depends on !(KASAN && KASAN_STACK=1)
> 
> This 'depends on'  stopped working with the patch

Thanks for pointing out this problem. I will re-send that patch.


Walter

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-02-26  1:14 Andrew Morton
  2021-02-26 17:55 ` incoming Linus Torvalds
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-02-26  1:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- The rest of MM.

  Includes kfence - another runtime memory validator.  Not as
  thorough as KASAN, but it has unmeasurable overhead and is intended
  to be usable in production builds.

- Everything else


118 patches, based on 6fbd6cf85a3be127454a1ad58525a3adcf8612ab.

Subsystems affected by this patch series:

  mm/thp
  mm/cma
  mm/vmstat
  mm/memory-hotplug
  mm/mlock
  mm/rmap
  mm/zswap
  mm/zsmalloc
  mm/cleanups
  mm/kfence
  mm/kasan2
  alpha
  procfs
  sysctl
  misc
  core-kernel
  MAINTAINERS
  lib
  bitops
  checkpatch
  init
  coredump
  seq_file
  gdb
  ubsan
  initramfs
  mm/pagemap2

Subsystem: mm/thp

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Overhaul multi-page lookups for THP", v4:
      mm: make pagecache tagged lookups return only head pages
      mm/shmem: use pagevec_lookup in shmem_unlock_mapping
      mm/swap: optimise get_shadow_from_swap_cache
      mm: add FGP_ENTRY
      mm/filemap: rename find_get_entry to mapping_get_entry
      mm/filemap: add helper for finding pages
      mm/filemap: add mapping_seek_hole_data
      iomap: use mapping_seek_hole_data
      mm: add and use find_lock_entries
      mm: add an 'end' parameter to find_get_entries
      mm: add an 'end' parameter to pagevec_lookup_entries
      mm: remove nr_entries parameter from pagevec_lookup_entries
      mm: pass pvec directly to find_get_entries
      mm: remove pagevec_lookup_entries

    Rik van Riel <riel@surriel.com>:
    Patch series "mm,thp,shm: limit shmem THP alloc gfp_mask", v6:
      mm,thp,shmem: limit shmem THP alloc gfp_mask
      mm,thp,shm: limit gfp mask to no more than specified
      mm,thp,shmem: make khugepaged obey tmpfs mount flags
      mm,shmem,thp: limit shmem THP allocations to requested zones

Subsystem: mm/cma

    Roman Gushchin <guro@fb.com>:
      mm: cma: allocate cma areas bottom-up

    David Hildenbrand <david@redhat.com>:
      mm/cma: expose all pages to the buddy if activation of an area fails
      mm/page_alloc: count CMA pages per zone and print them in /proc/zoneinfo

    Patrick Daly <pdaly@codeaurora.org>:
      mm: cma: print region name on failure

Subsystem: mm/vmstat

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: vmstat: fix NOHZ wakeups for node stat changes
      mm: vmstat: add some comments on internal storage of byte items

    Jiang Biao <benbjiang@tencent.com>:
      mm/vmstat.c: erase latency in vmstat_shepherd

Subsystem: mm/memory-hotplug

    Dan Williams <dan.j.williams@intel.com>:
    Patch series "mm: Fix pfn_to_online_page() with respect to ZONE_DEVICE", v4:
      mm: move pfn_to_online_page() out of line
      mm: teach pfn_to_online_page() to consider subsection validity
      mm: teach pfn_to_online_page() about ZONE_DEVICE section collisions
      mm: fix memory_failure() handling of dax-namespace metadata

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/memory_hotplug: rename all existing 'memhp' into 'mhp'

    David Hildenbrand <david@redhat.com>:
      mm/memory_hotplug: MEMHP_MERGE_RESOURCE -> MHP_MERGE_RESOURCE

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memory_hotplug: use helper function zone_end_pfn() to get end_pfn

    David Hildenbrand <david@redhat.com>:
      drivers/base/memory: don't store phys_device in memory blocks
      Documentation: sysfs/memory: clarify some memory block device properties

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/memory_hotplug: Pre-validate the address range with platform", v5:
      mm/memory_hotplug: prevalidate the address range being added with platform
      arm64/mm: define arch_get_mappable_range()
      s390/mm: define arch_get_mappable_range()

    David Hildenbrand <david@redhat.com>:
      virtio-mem: check against mhp_get_pluggable_range() which memory we can hotplug

Subsystem: mm/mlock

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mlock: stop counting mlocked pages when none vma is found

Subsystem: mm/rmap

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/rmap: correct some obsolete comments of anon_vma
      mm/rmap: remove unneeded semicolon in page_not_mapped()
      mm/rmap: fix obsolete comment in __page_check_anon_rmap()
      mm/rmap: use page_not_mapped in try_to_unmap()
      mm/rmap: correct obsolete comment of page_get_anon_vma()
      mm/rmap: fix potential pte_unmap on an not mapped pte

Subsystem: mm/zswap

    Randy Dunlap <rdunlap@infradead.org>:
      mm: zswap: clean up confusing comment

    Tian Tao <tiantao6@hisilicon.com>:
    Patch series "Fix the compatibility of zsmalloc and zswap":
      mm/zswap: add the flag can_sleep_mapped
      mm: set the sleep_mapped to true for zbud and z3fold

Subsystem: mm/zsmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/zsmalloc.c: convert to use kmem_cache_zalloc in cache_alloc_zspage()

    Rokudo Yan <wu-yan@tcl.com>:
      zsmalloc: account the number of compacted pages correctly

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/zsmalloc.c: use page_private() to access page->private

Subsystem: mm/cleanups

    Guo Ren <guoren@linux.alibaba.com>:
      mm: page-flags.h: Typo fix (It -> If)

    Daniel Vetter <daniel.vetter@ffwll.ch>:
      mm/dmapool: use might_alloc()
      mm/backing-dev.c: use might_alloc()

    Stephen Zhang <stephenzhangzsd@gmail.com>:
      mm/early_ioremap.c: use __func__ instead of function name

Subsystem: mm/kfence

    Alexander Potapenko <glider@google.com>:
    Patch series "KFENCE: A low-overhead sampling-based memory safety error detector", v7:
      mm: add Kernel Electric-Fence infrastructure
      x86, kfence: enable KFENCE for x86

    Marco Elver <elver@google.com>:
      arm64, kfence: enable KFENCE for ARM64
      kfence: use pt_regs to generate stack trace on faults

    Alexander Potapenko <glider@google.com>:
      mm, kfence: insert KFENCE hooks for SLAB
      mm, kfence: insert KFENCE hooks for SLUB
      kfence, kasan: make KFENCE compatible with KASAN

    Marco Elver <elver@google.com>:
      kfence, Documentation: add KFENCE documentation
      kfence: add test suite
      MAINTAINERS: add entry for KFENCE
      kfence: report sensitive information based on no_hash_pointers

    Alexander Potapenko <glider@google.com>:
    Patch series "Add error_report_end tracepoint to KFENCE and KASAN", v3:
      tracing: add error_report_end trace point
      kfence: use error_report_end tracepoint
      kasan: use error_report_end tracepoint

Subsystem: mm/kasan2

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: optimizations and fixes for HW_TAGS", v4:
      kasan, mm: don't save alloc stacks twice
      kasan, mm: optimize kmalloc poisoning
      kasan: optimize large kmalloc poisoning
      kasan: clean up setting free info in kasan_slab_free
      kasan: unify large kfree checks
      kasan: rework krealloc tests
      kasan, mm: fail krealloc on freed objects
      kasan, mm: optimize krealloc poisoning
      kasan: ensure poisoning size alignment
      arm64: kasan: simplify and inline MTE functions
      kasan: inline HW_TAGS helper functions
      kasan: clarify that only first bug is reported in HW_TAGS

Subsystem: alpha

    Randy Dunlap <rdunlap@infradead.org>:
      alpha: remove CONFIG_EXPERIMENTAL from defconfigs

Subsystem: procfs

    Helge Deller <deller@gmx.de>:
      proc/wchan: use printk format instead of lookup_symbol_name()

    Josef Bacik <josef@toxicpanda.com>:
      proc: use kvzalloc for our kernel buffer

Subsystem: sysctl

    Lin Feng <linf@wangsu.com>:
      sysctl.c: fix underflow value setting risk in vm_table

Subsystem: misc

    Randy Dunlap <rdunlap@infradead.org>:
      include/linux: remove repeated words

    Miguel Ojeda <ojeda@kernel.org>:
      treewide: Miguel has moved

Subsystem: core-kernel

    Hubert Jasudowicz <hubert.jasudowicz@gmail.com>:
      groups: use flexible-array member in struct group_info
      groups: simplify struct group_info allocation

    Randy Dunlap <rdunlap@infradead.org>:
      kernel: delete repeated words in comments

Subsystem: MAINTAINERS

    Vlastimil Babka <vbabka@suse.cz>:
      MAINTAINERS: add uapi directories to API/ABI section

Subsystem: lib

    Huang Shijie <sjhuang@iluvatar.ai>:
      lib/genalloc.c: change return type to unsigned long for bitmap_set_ll

    Francis Laniel <laniel_francis@privacyrequired.com>:
      string.h: move fortified functions definitions in a dedicated header.

    Yogesh Lal <ylal@codeaurora.org>:
      lib: stackdepot: add support to configure STACK_HASH_SIZE

    Vijayanand Jitta <vjitta@codeaurora.org>:
      lib: stackdepot: add support to disable stack depot
      lib: stackdepot: fix ignoring return value warning

    Masahiro Yamada <masahiroy@kernel.org>:
      lib/cmdline: remove an unneeded local variable in next_arg()

Subsystem: bitops

    Geert Uytterhoeven <geert+renesas@glider.be>:
      include/linux/bitops.h: spelling s/synomyn/synonym/

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: improve blank line after declaration test

    Peng Wang <rocking@linux.alibaba.com>:
      checkpatch: ignore warning designated initializers using NR_CPUS

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: trivial style fixes

    Joe Perches <joe@perches.com>:
      checkpatch: prefer ftrace over function entry/exit printks
      checkpatch: improve TYPECAST_INT_CONSTANT test message

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: add warning for avoiding .L prefix symbols in assembly files

    Joe Perches <joe@perches.com>:
      checkpatch: add kmalloc_array_node to unnecessary OOM message check

    Chris Down <chris@chrisdown.name>:
      checkpatch: don't warn about colon termination in linker scripts

    Song Liu <songliubraving@fb.com>:
      checkpatch: do not apply "initialise globals to 0" check to BPF progs

Subsystem: init

    Masahiro Yamada <masahiroy@kernel.org>:
      init/version.c: remove Version_<LINUX_VERSION_CODE> symbol
      init: clean up early_param_on_off() macro

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      init/Kconfig: fix a typo in CC_VERSION_TEXT help text

Subsystem: coredump

    Ira Weiny <ira.weiny@intel.com>:
      fs/coredump: use kmap_local_page()

Subsystem: seq_file

    NeilBrown <neilb@suse.de>:
    Patch series "Fix some seq_file users that were recently broken":
      seq_file: document how per-entry resources are managed.
      x86: fix seq_file iteration for pat/memtype.c

Subsystem: gdb

    George Prekas <prekageo@amazon.com>:
      scripts/gdb: fix list_for_each

    Sumit Garg <sumit.garg@linaro.org>:
      kgdb: fix to kill breakpoints on initmem after boot

Subsystem: ubsan

    Andrey Ryabinin <ryabinin.a.a@gmail.com>:
      ubsan: remove overflow checks

Subsystem: initramfs

    Florian Fainelli <f.fainelli@gmail.com>:
      initramfs: panic with memory information

Subsystem: mm/pagemap2

    Huang Pei <huangpei@loongson.cn>:
      MIPS: make userspace mapping young by default

 .mailmap                                            |    1 
 CREDITS                                             |    9 
 Documentation/ABI/testing/sysfs-devices-memory      |   58 -
 Documentation/admin-guide/auxdisplay/cfag12864b.rst |    2 
 Documentation/admin-guide/auxdisplay/ks0108.rst     |    2 
 Documentation/admin-guide/kernel-parameters.txt     |    6 
 Documentation/admin-guide/mm/memory-hotplug.rst     |   20 
 Documentation/dev-tools/index.rst                   |    1 
 Documentation/dev-tools/kasan.rst                   |    8 
 Documentation/dev-tools/kfence.rst                  |  318 +++++++
 Documentation/filesystems/seq_file.rst              |    6 
 MAINTAINERS                                         |   26 
 arch/alpha/configs/defconfig                        |    1 
 arch/arm64/Kconfig                                  |    1 
 arch/arm64/include/asm/cache.h                      |    1 
 arch/arm64/include/asm/kasan.h                      |    1 
 arch/arm64/include/asm/kfence.h                     |   26 
 arch/arm64/include/asm/mte-def.h                    |    2 
 arch/arm64/include/asm/mte-kasan.h                  |   65 +
 arch/arm64/include/asm/mte.h                        |    2 
 arch/arm64/kernel/mte.c                             |   46 -
 arch/arm64/lib/mte.S                                |   16 
 arch/arm64/mm/fault.c                               |    8 
 arch/arm64/mm/mmu.c                                 |   23 
 arch/mips/mm/cache.c                                |   30 
 arch/s390/mm/init.c                                 |    1 
 arch/s390/mm/vmem.c                                 |   14 
 arch/x86/Kconfig                                    |    1 
 arch/x86/include/asm/kfence.h                       |   76 +
 arch/x86/mm/fault.c                                 |   10 
 arch/x86/mm/pat/memtype.c                           |    4 
 drivers/auxdisplay/cfag12864b.c                     |    4 
 drivers/auxdisplay/cfag12864bfb.c                   |    4 
 drivers/auxdisplay/ks0108.c                         |    4 
 drivers/base/memory.c                               |   35 
 drivers/block/zram/zram_drv.c                       |    2 
 drivers/hv/hv_balloon.c                             |    2 
 drivers/virtio/virtio_mem.c                         |   43 
 drivers/xen/balloon.c                               |    2 
 fs/coredump.c                                       |    4 
 fs/iomap/seek.c                                     |  125 --
 fs/proc/base.c                                      |   21 
 fs/proc/proc_sysctl.c                               |    4 
 include/linux/bitops.h                              |    2 
 include/linux/cfag12864b.h                          |    2 
 include/linux/cred.h                                |    2 
 include/linux/fortify-string.h                      |  302 ++++++
 include/linux/gfp.h                                 |    2 
 include/linux/init.h                                |    4 
 include/linux/kasan.h                               |   25 
 include/linux/kfence.h                              |  230 +++++
 include/linux/kgdb.h                                |    2 
 include/linux/khugepaged.h                          |    2 
 include/linux/ks0108.h                              |    2 
 include/linux/mdev.h                                |    2 
 include/linux/memory.h                              |    3 
 include/linux/memory_hotplug.h                      |   33 
 include/linux/memremap.h                            |    6 
 include/linux/mmzone.h                              |   49 -
 include/linux/page-flags.h                          |    4 
 include/linux/pagemap.h                             |   10 
 include/linux/pagevec.h                             |   10 
 include/linux/pgtable.h                             |    8 
 include/linux/ptrace.h                              |    2 
 include/linux/rmap.h                                |    3 
 include/linux/slab_def.h                            |    3 
 include/linux/slub_def.h                            |    3 
 include/linux/stackdepot.h                          |    9 
 include/linux/string.h                              |  282 ------
 include/linux/vmstat.h                              |    6 
 include/linux/zpool.h                               |    3 
 include/linux/zsmalloc.h                            |    2 
 include/trace/events/error_report.h                 |   74 +
 include/uapi/linux/firewire-cdev.h                  |    2 
 include/uapi/linux/input.h                          |    2 
 init/Kconfig                                        |    2 
 init/initramfs.c                                    |   19 
 init/main.c                                         |    6 
 init/version.c                                      |    8 
 kernel/debug/debug_core.c                           |   11 
 kernel/events/core.c                                |    8 
 kernel/events/uprobes.c                             |    2 
 kernel/groups.c                                     |    7 
 kernel/locking/rtmutex.c                            |    4 
 kernel/locking/rwsem.c                              |    2 
 kernel/locking/semaphore.c                          |    2 
 kernel/sched/fair.c                                 |    2 
 kernel/sched/membarrier.c                           |    2 
 kernel/sysctl.c                                     |    8 
 kernel/trace/Makefile                               |    1 
 kernel/trace/error_report-traces.c                  |   12 
 lib/Kconfig                                         |    9 
 lib/Kconfig.debug                                   |    1 
 lib/Kconfig.kfence                                  |   84 +
 lib/Kconfig.ubsan                                   |   17 
 lib/cmdline.c                                       |    7 
 lib/genalloc.c                                      |    3 
 lib/stackdepot.c                                    |   41 
 lib/test_kasan.c                                    |  111 ++
 lib/test_ubsan.c                                    |   49 -
 lib/ubsan.c                                         |   68 -
 mm/Makefile                                         |    1 
 mm/backing-dev.c                                    |    3 
 mm/cma.c                                            |   64 -
 mm/dmapool.c                                        |    3 
 mm/early_ioremap.c                                  |   12 
 mm/filemap.c                                        |  361 +++++---
 mm/huge_memory.c                                    |    6 
 mm/internal.h                                       |    6 
 mm/kasan/common.c                                   |  213 +++-
 mm/kasan/generic.c                                  |    3 
 mm/kasan/hw_tags.c                                  |    2 
 mm/kasan/kasan.h                                    |   97 +-
 mm/kasan/report.c                                   |    8 
 mm/kasan/shadow.c                                   |   78 +
 mm/kfence/Makefile                                  |    6 
 mm/kfence/core.c                                    |  875 +++++++++++++++++++-
 mm/kfence/kfence.h                                  |  126 ++
 mm/kfence/kfence_test.c                             |  860 +++++++++++++++++++
 mm/kfence/report.c                                  |  350 ++++++--
 mm/khugepaged.c                                     |   22 
 mm/memory-failure.c                                 |    6 
 mm/memory.c                                         |    4 
 mm/memory_hotplug.c                                 |  178 +++-
 mm/memremap.c                                       |   23 
 mm/mlock.c                                          |    2 
 mm/page_alloc.c                                     |    1 
 mm/rmap.c                                           |   24 
 mm/shmem.c                                          |  160 +--
 mm/slab.c                                           |   38 
 mm/slab_common.c                                    |   29 
 mm/slub.c                                           |   63 +
 mm/swap.c                                           |   54 -
 mm/swap_state.c                                     |    7 
 mm/truncate.c                                       |  141 ---
 mm/vmstat.c                                         |   35 
 mm/z3fold.c                                         |    1 
 mm/zbud.c                                           |    1 
 mm/zpool.c                                          |   13 
 mm/zsmalloc.c                                       |   22 
 mm/zswap.c                                          |   57 +
 samples/auxdisplay/cfag12864b-example.c             |    2 
 scripts/Makefile.ubsan                              |    2 
 scripts/checkpatch.pl                               |  152 ++-
 scripts/gdb/linux/lists.py                          |    5 
 145 files changed, 5046 insertions(+), 1682 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-02-26  1:14 incoming Andrew Morton
@ 2021-02-26 17:55 ` Linus Torvalds
  2021-02-26 19:16   ` incoming Andrew Morton
  0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2021-02-26 17:55 UTC (permalink / raw)
  To: Andrew Morton; +Cc: mm-commits, Linux-MM

On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> - The rest of MM.
>
>   Includes kfence - another runtime memory validator.  Not as
>   thorough as KASAN, but it has unmeasurable overhead and is intended
>   to be usable in production builds.
>
> - Everything else

Just to clarify: you have nothing else really pending?

I'm hoping to just do -rc1 this weekend after all - despite my late
start due to loss of power for several days.

I'll allow late stragglers with good reason through, but the fewer of
those there are, the better, of course.

Thanks,
                   Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-02-26 17:55 ` incoming Linus Torvalds
@ 2021-02-26 19:16   ` Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-02-26 19:16 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, Linux-MM

On Fri, 26 Feb 2021 09:55:27 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > - The rest of MM.
> >
> >   Includes kfence - another runtime memory validator.  Not as
> >   thorough as KASAN, but it has unmeasurable overhead and is intended
> >   to be usable in production builds.
> >
> > - Everything else
> 
> Just to clarify: you have nothing else really pending?

Yes, that's it from me for -rc1.



^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-03-13  5:06 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-03-13  5:06 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


29 patches, based on f78d76e72a4671ea52d12752d92077788b4f5d50.

Subsystems affected by this patch series:

  mm/memblock
  core-kernel
  kconfig
  mm/pagealloc
  fork
  mm/hugetlb
  mm/highmem
  binfmt
  MAINTAINERS
  kbuild
  mm/kfence
  mm/oom-kill
  mm/madvise
  mm/kasan
  mm/userfaultfd
  mm/memory-failure
  ia64
  mm/memcg
  mm/zram

Subsystem: mm/memblock

    Arnd Bergmann <arnd@arndb.de>:
      memblock: fix section mismatch warning

Subsystem: core-kernel

    Arnd Bergmann <arnd@arndb.de>:
      stop_machine: mark helpers __always_inline

Subsystem: kconfig

    Masahiro Yamada <masahiroy@kernel.org>:
      init/Kconfig: make COMPILE_TEST depend on HAS_IOMEM

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/page_alloc.c: refactor initialization of struct page for holes in memory layout

Subsystem: fork

    Fenghua Yu <fenghua.yu@intel.com>:
      mm/fork: clear PASID for new mm

Subsystem: mm/hugetlb

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/hugetlb: Early cow on fork, and a few cleanups", v5:
      hugetlb: dedup the code to add a new file_region
      hugetlb: break earlier in add_reservation_in_range() when we can
      mm: introduce page_needs_cow_for_dma() for deciding whether cow
      mm: use is_cow_mapping() across tree where proper
      hugetlb: do early cow when page pinned on src mm

Subsystem: mm/highmem

    OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
      mm/highmem.c: fix zero_user_segments() with start > end

Subsystem: binfmt

    Lior Ribak <liorribak@gmail.com>:
      binfmt_misc: fix possible deadlock in bm_register_write

Subsystem: MAINTAINERS

    Vlastimil Babka <vbabka@suse.cz>:
      MAINTAINERS: exclude uapi directories in API/ABI section

Subsystem: kbuild

    Arnd Bergmann <arnd@arndb.de>:
      linux/compiler-clang.h: define HAVE_BUILTIN_BSWAP*

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: fix printk format for ptrdiff_t
      kfence, slab: fix cache_alloc_debugcheck_after() for bulk allocations
      kfence: fix reports if constant function prefixes exist

Subsystem: mm/oom-kill

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      include/linux/sched/mm.h: use rcu_dereference in in_vfork()

Subsystem: mm/madvise

    Suren Baghdasaryan <surenb@google.com>:
      mm/madvise: replace ptrace attach requirement for process_madvise

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan, mm: fix crash with HW_TAGS and DEBUG_PAGEALLOC
      kasan: fix KASAN_STACK dependency for HW_TAGS

Subsystem: mm/userfaultfd

    Nadav Amit <namit@vmware.com>:
      mm/userfaultfd: fix memory corruption due to writeprotect

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm, hwpoison: do not lock page again when me_huge_page() successfully recovers

Subsystem: ia64

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: fix ia64_syscall_get_set_arguments() for break-based syscalls
      ia64: fix ptrace(PTRACE_SYSCALL_INFO_EXIT) sign

Subsystem: mm/memcg

    Zhou Guanghui <zhouguanghui1@huawei.com>:
      mm/memcg: rename mem_cgroup_split_huge_fixup to split_page_memcg and add nr_pages argument
      mm/memcg: set memcg when splitting page

Subsystem: mm/zram

    Minchan Kim <minchan@kernel.org>:
      zram: fix return value on writeback_store
      zram: fix broken page writeback

 MAINTAINERS                                |    4 
 arch/ia64/include/asm/syscall.h            |    2 
 arch/ia64/kernel/ptrace.c                  |   24 +++-
 drivers/block/zram/zram_drv.c              |   17 +-
 drivers/gpu/drm/vmwgfx/vmwgfx_page_dirty.c |    4 
 drivers/gpu/drm/vmwgfx/vmwgfx_ttm_glue.c   |    2 
 fs/binfmt_misc.c                           |   29 ++---
 fs/proc/task_mmu.c                         |    2 
 include/linux/compiler-clang.h             |    6 +
 include/linux/memblock.h                   |    4 
 include/linux/memcontrol.h                 |    6 -
 include/linux/mm.h                         |   21 +++
 include/linux/mm_types.h                   |    1 
 include/linux/sched/mm.h                   |    3 
 include/linux/stop_machine.h               |   11 +
 init/Kconfig                               |    3 
 kernel/fork.c                              |    8 +
 lib/Kconfig.kasan                          |    1 
 mm/highmem.c                               |   17 ++
 mm/huge_memory.c                           |   10 -
 mm/hugetlb.c                               |  123 +++++++++++++++------
 mm/internal.h                              |    5 
 mm/kfence/report.c                         |   30 +++--
 mm/madvise.c                               |   13 ++
 mm/memcontrol.c                            |   15 +-
 mm/memory-failure.c                        |    4 
 mm/memory.c                                |   16 +-
 mm/page_alloc.c                            |  167 ++++++++++++++---------------
 mm/slab.c                                  |    2 
 29 files changed, 334 insertions(+), 216 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-03-25  4:36 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-03-25  4:36 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


14 patches, based on 7acac4b3196caee5e21fb5ea53f8bc124e6a16fc.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/kasan
  mm/gup
  mm/selftests
  mm/z3fold
  squashfs
  ia64
  gcov
  mm/kfence
  mm/memblock
  mm/highmem
  mailmap

Subsystem: mm/hugetlb

    Miaohe Lin <linmiaohe@huawei.com>:
      hugetlb_cgroup: fix imbalanced css_get and css_put pair for shared mappings

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix per-page tags for non-page_alloc pages

Subsystem: mm/gup

    Sean Christopherson <seanjc@google.com>:
      mm/mmu_notifiers: ensure range_end() is paired with range_start()

Subsystem: mm/selftests

    Rong Chen <rong.a.chen@intel.com>:
      selftests/vm: fix out-of-tree build

Subsystem: mm/z3fold

    Thomas Hebb <tommyhebb@gmail.com>:
      z3fold: prevent reclaim/free race for headless pages

Subsystem: squashfs

    Sean Nyekjaer <sean@geanix.com>:
      squashfs: fix inode lookup sanity checks

    Phillip Lougher <phillip@squashfs.org.uk>:
      squashfs: fix xattr id and id lookup sanity checks

Subsystem: ia64

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: mca: allocate early mca with GFP_ATOMIC
      ia64: fix format strings for err_inject

Subsystem: gcov

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: fix clang-11+ support

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: make compatible with kmemleak

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      mm: memblock: fix section mismatch warning again

Subsystem: mm/highmem

    Ira Weiny <ira.weiny@intel.com>:
      mm/highmem: fix CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP

Subsystem: mailmap

    Andrey Konovalov <andreyknvl@google.com>:
      mailmap: update Andrey Konovalov's email address

 .mailmap                            |    1 
 arch/ia64/kernel/err_inject.c       |   22 +++++------
 arch/ia64/kernel/mca.c              |    2 -
 fs/squashfs/export.c                |    8 +++-
 fs/squashfs/id.c                    |    6 ++-
 fs/squashfs/squashfs_fs.h           |    1 
 fs/squashfs/xattr_id.c              |    6 ++-
 include/linux/hugetlb_cgroup.h      |   15 ++++++-
 include/linux/memblock.h            |    4 +-
 include/linux/mm.h                  |   18 +++++++--
 include/linux/mmu_notifier.h        |   10 ++---
 kernel/gcov/clang.c                 |   69 ++++++++++++++++++++++++++++++++++++
 mm/highmem.c                        |    4 +-
 mm/hugetlb.c                        |   41 +++++++++++++++++++--
 mm/hugetlb_cgroup.c                 |   10 ++++-
 mm/kfence/core.c                    |    9 ++++
 mm/kmemleak.c                       |    3 +
 mm/mmu_notifier.c                   |   23 ++++++++++++
 mm/z3fold.c                         |   16 +++++++-
 tools/testing/selftests/vm/Makefile |    4 +-
 20 files changed, 230 insertions(+), 42 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-04-09 20:26 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-04-09 20:26 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

16 patches, based on 17e7124aad766b3f158943acb51467f86220afe9.

Subsystems affected by this patch series:

  MAINTAINERS
  mailmap
  mm/kasan
  mm/gup
  nds32
  gcov
  ocfs2
  ia64
  mm/pagecache
  mm/kasan
  mm/kfence
  lib

Subsystem: MAINTAINERS

    Marek Behún <kabel@kernel.org>:
      MAINTAINERS: update CZ.NIC's Turris information
      treewide: change my e-mail address, fix my name

Subsystem: mailmap

    Jordan Crouse <jordan@cosmicpenguin.net>:
      mailmap: update email address for Jordan Crouse

    Matthew Wilcox <willy@infradead.org>:
      .mailmap: fix old email addresses

Subsystem: mm/kasan

    Arnd Bergmann <arnd@arndb.de>:
      kasan: fix hwasan build for gcc

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: remove redundant config option

Subsystem: mm/gup

    Aili Yao <yaoaili@kingsoft.com>:
      mm/gup: check page posion status for coredump.

Subsystem: nds32

    Mike Rapoport <rppt@linux.ibm.com>:
      nds32: flush_dcache_page: use page_mapping_file to avoid races with swapoff

Subsystem: gcov

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: re-fix clang-11+ support

Subsystem: ocfs2

    Wengang Wang <wen.gang.wang@oracle.com>:
      ocfs2: fix deadlock between setattr and dio_end_io_write

Subsystem: ia64

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: fix user_stack_pointer() for ptrace()

Subsystem: mm/pagecache

    Jack Qiu <jack.qiu@huawei.com>:
      fs: direct-io: fix missing sdio->boundary

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix conflict with page poisoning

    Andrew Morton <akpm@linux-foundation.org>:
      lib/test_kasan_module.c: suppress unused var warning

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence, x86: fix preemptible warning on KPTI-enabled systems

Subsystem: lib

    Julian Braha <julianbraha@gmail.com>:
      lib: fix kconfig dependency on ARCH_WANT_FRAME_POINTERS

 .mailmap                                                            |    7 ++
 Documentation/ABI/testing/debugfs-moxtet                            |    4 -
 Documentation/ABI/testing/debugfs-turris-mox-rwtm                   |    2 
 Documentation/ABI/testing/sysfs-bus-moxtet-devices                  |    6 +-
 Documentation/ABI/testing/sysfs-class-led-driver-turris-omnia       |    2 
 Documentation/ABI/testing/sysfs-firmware-turris-mox-rwtm            |   10 +--
 Documentation/devicetree/bindings/leds/cznic,turris-omnia-leds.yaml |    2 
 MAINTAINERS                                                         |   13 +++-
 arch/arm64/boot/dts/marvell/armada-3720-turris-mox.dts              |    2 
 arch/arm64/kernel/sleep.S                                           |    2 
 arch/ia64/include/asm/ptrace.h                                      |    8 --
 arch/nds32/mm/cacheflush.c                                          |    2 
 arch/x86/include/asm/kfence.h                                       |    7 ++
 arch/x86/kernel/acpi/wakeup_64.S                                    |    2 
 drivers/bus/moxtet.c                                                |    4 -
 drivers/firmware/turris-mox-rwtm.c                                  |    4 -
 drivers/gpio/gpio-moxtet.c                                          |    4 -
 drivers/leds/leds-turris-omnia.c                                    |    4 -
 drivers/mailbox/armada-37xx-rwtm-mailbox.c                          |    4 -
 drivers/watchdog/armada_37xx_wdt.c                                  |    4 -
 fs/direct-io.c                                                      |    5 +
 fs/ocfs2/aops.c                                                     |   11 ---
 fs/ocfs2/file.c                                                     |    8 ++
 include/dt-bindings/bus/moxtet.h                                    |    2 
 include/linux/armada-37xx-rwtm-mailbox.h                            |    2 
 include/linux/kasan.h                                               |    2 
 include/linux/moxtet.h                                              |    2 
 kernel/gcov/clang.c                                                 |   29 ++++++----
 lib/Kconfig.debug                                                   |    6 +-
 lib/Kconfig.kasan                                                   |    9 ---
 lib/test_kasan_module.c                                             |    2 
 mm/gup.c                                                            |    4 +
 mm/internal.h                                                       |   20 ++++++
 mm/kasan/common.c                                                   |    2 
 mm/kasan/kasan.h                                                    |    2 
 mm/kasan/report_generic.c                                           |    2 
 mm/page_poison.c                                                    |    4 +
 scripts/Makefile.kasan                                              |   18 ++++--
 security/Kconfig.hardening                                          |    4 -
 39 files changed, 136 insertions(+), 91 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-04-16 22:45 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-04-16 22:45 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

12 patches, based on 06c2aac4014c38247256fe49c61b7f55890271e7.

Subsystems affected by this patch series:

  mm/documentation
  mm/kasan
  csky
  ia64
  mm/pagemap
  gcov
  lib

Subsystem: mm/documentation

    Randy Dunlap <rdunlap@infradead.org>:
      mm: eliminate "expecting prototype" kernel-doc warnings

Subsystem: mm/kasan

    Arnd Bergmann <arnd@arndb.de>:
      kasan: fix hwasan build for gcc

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: remove redundant config option

Subsystem: csky

    Randy Dunlap <rdunlap@infradead.org>:
      csky: change a Kconfig symbol name to fix e1000 build error

Subsystem: ia64

    Randy Dunlap <rdunlap@infradead.org>:
      ia64: remove duplicate entries in generic_defconfig
      ia64: fix discontig.c section mismatches

    John Paul Adrian Glaubitz <glaubitz () physik ! fu-berlin ! de>:
      ia64: tools: remove inclusion of ia64-specific version of errno.h header

    John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>:
      ia64: tools: remove duplicate definition of ia64_mf() on ia64

Subsystem: mm/pagemap

    Zack Rusin <zackr@vmware.com>:
      mm/mapping_dirty_helpers: guard hugepage pud's usage

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm: ptdump: fix build failure

Subsystem: gcov

    Johannes Berg <johannes.berg@intel.com>:
      gcov: clang: fix clang-11+ build

Subsystem: lib

    Randy Dunlap <rdunlap@infradead.org>:
      lib: remove "expecting prototype" kernel-doc warnings

 arch/arm64/kernel/sleep.S             |    2 +-
 arch/csky/Kconfig                     |    2 +-
 arch/csky/include/asm/page.h          |    2 +-
 arch/ia64/configs/generic_defconfig   |    2 --
 arch/ia64/mm/discontig.c              |    6 +++---
 arch/x86/kernel/acpi/wakeup_64.S      |    2 +-
 include/linux/kasan.h                 |    2 +-
 kernel/gcov/clang.c                   |    2 +-
 lib/Kconfig.kasan                     |    9 ++-------
 lib/earlycpio.c                       |    4 ++--
 lib/lru_cache.c                       |    3 ++-
 lib/parman.c                          |    4 ++--
 lib/radix-tree.c                      |   11 ++++++-----
 mm/kasan/common.c                     |    2 +-
 mm/kasan/kasan.h                      |    2 +-
 mm/kasan/report_generic.c             |    2 +-
 mm/mapping_dirty_helpers.c            |    2 ++
 mm/mmu_gather.c                       |   29 +++++++++++++++++++----------
 mm/oom_kill.c                         |    2 +-
 mm/ptdump.c                           |    2 +-
 mm/shuffle.c                          |    4 ++--
 scripts/Makefile.kasan                |   22 ++++++++++++++--------
 security/Kconfig.hardening            |    4 ++--
 tools/arch/ia64/include/asm/barrier.h |    3 ---
 tools/include/uapi/asm/errno.h        |    2 --
 25 files changed, 67 insertions(+), 60 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-04-23 21:28 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-04-23 21:28 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


5 patches, based on 5bfc75d92efd494db37f5c4c173d3639d4772966.

Subsystems affected by this patch series:

  coda
  overlayfs
  mm/pagecache
  mm/memcg

Subsystem: coda

    Christian König <christian.koenig@amd.com>:
      coda: fix reference counting in coda_file_mmap error path

Subsystem: overlayfs

    Christian König <christian.koenig@amd.com>:
      ovl: fix reference counting in ovl_mmap error path

Subsystem: mm/pagecache

    Hugh Dickins <hughd@google.com>:
      mm/filemap: fix find_lock_entries hang on 32-bit THP
      mm/filemap: fix mapping_seek_hole_data on THP & 32-bit

Subsystem: mm/memcg

    Vasily Averin <vvs@virtuozzo.com>:
      tools/cgroup/slabinfo.py: updated to work on current kernel

 fs/coda/file.c                 |    6 +++---
 fs/overlayfs/file.c            |   11 +----------
 mm/filemap.c                   |   31 +++++++++++++++++++------------
 tools/cgroup/memcg_slabinfo.py |    8 ++++----
 4 files changed, 27 insertions(+), 29 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-04-30  5:52 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-04-30  5:52 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


A few misc subsystems and some of MM.


178 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0.

Subsystems affected by this patch series:

  ia64
  kbuild
  scripts
  sh
  ocfs2
  kfifo
  vfs
  kernel/watchdog
  mm/slab-generic
  mm/slub
  mm/kmemleak
  mm/debug
  mm/pagecache
  mm/msync
  mm/gup
  mm/memremap
  mm/memcg
  mm/pagemap
  mm/mremap
  mm/dma
  mm/sparsemem
  mm/vmalloc
  mm/documentation
  mm/kasan
  mm/initialization
  mm/pagealloc
  mm/memory-failure

Subsystem: ia64

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      arch/ia64/kernel/head.S: remove duplicate include

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      arch/ia64/kernel/fsys.S: fix typos
      arch/ia64/include/asm/pgtable.h: minor typo fixes

    Valentin Schneider <valentin.schneider@arm.com>:
      ia64: ensure proper NUMA distance and possible map initialization

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: drop unused IA64_FW_EMU ifdef
      ia64: simplify code flow around swiotlb init

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ia64: trivial spelling fixes

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: fix EFI_DEBUG build
      ia64: mca: always make IA64_MCA_DEBUG an expression
      ia64: drop marked broken DISCONTIGMEM and VIRTUAL_MEM_MAP
      ia64: module: fix symbolizer crash on fdescr

Subsystem: kbuild

    Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
      include/linux/compiler-gcc.h: sparse can do constant folding of __builtin_bswap*()

Subsystem: scripts

    Tom Saeger <tom.saeger@oracle.com>:
      scripts/spelling.txt: add entries for recent discoveries

    Wan Jiabing <wanjiabing@vivo.com>:
      scripts: a new script for checking duplicate struct declaration

Subsystem: sh

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      arch/sh/include/asm/tlb.h: remove duplicate include

Subsystem: ocfs2

    Yang Li <yang.lee@linux.alibaba.com>:
      ocfs2: replace DEFINE_SIMPLE_ATTRIBUTE with DEFINE_DEBUGFS_ATTRIBUTE

    Joseph Qi <joseph.qi@linux.alibaba.com>:
      ocfs2: map flags directly in flags_to_o2dlm()

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ocfs2: fix a typo

    Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
      ocfs2/dlm: remove unused function

Subsystem: kfifo

    Dan Carpenter <dan.carpenter@oracle.com>:
      kfifo: fix ternary sign extension bugs

Subsystem: vfs

    Randy Dunlap <rdunlap@infradead.org>:
      vfs: fs_parser: clean up kernel-doc warnings

Subsystem: kernel/watchdog

    Petr Mladek <pmladek@suse.com>:
    Patch series "watchdog/softlockup: Report overall time and some cleanup", v2:
      watchdog: rename __touch_watchdog() to a better descriptive name
      watchdog: explicitly update timestamp when reporting softlockup
      watchdog/softlockup: report the overall time of softlockups
      watchdog/softlockup: remove logic that tried to prevent repeated reports
      watchdog: fix barriers when printing backtraces from all CPUs
      watchdog: cleanup handling of false positives

Subsystem: mm/slab-generic

    Rafael Aquini <aquini@redhat.com>:
      mm/slab_common: provide "slab_merge" option for !IS_ENABLED(CONFIG_SLAB_MERGE_DEFAULT) builds

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: enable slub_debug static key when creating cache with explicit debug flags

    Oliver Glitta <glittao@gmail.com>:
      kunit: add a KUnit test for SLUB debugging functionality
      slub: remove resiliency_test() function

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      mm/slub.c: trivial typo fixes

Subsystem: mm/kmemleak

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      mm/kmemleak.c: fix a typo

Subsystem: mm/debug

    Georgi Djakov <georgi.djakov@linaro.org>:
      mm/page_owner: record the timestamp of all pages during free

    zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>:
      mm, page_owner: remove unused parameter in __set_page_owner_handle

    Sergei Trofimovich <slyfox@gentoo.org>:
      mm: page_owner: fetch backtrace only for tracked pages
      mm: page_owner: use kstrtobool() to parse bool option
      mm: page_owner: detect page_owner recursion via task_struct
      mm: page_poison: print page info when corruption is caught

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/memtest: add ARCH_USE_MEMTEST

Subsystem: mm/pagecache

    Jens Axboe <axboe@kernel.dk>:
    Patch series "Improve IOCB_NOWAIT O_DIRECT reads", v3:
      mm: provide filemap_range_needs_writeback() helper
      mm: use filemap_range_needs_writeback() for O_DIRECT reads
      iomap: use filemap_range_needs_writeback() for O_DIRECT reads

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/filemap: use filemap_read_page in filemap_fault
      mm/filemap: drop check for truncated page after I/O

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: page-writeback: simplify memcg handling in test_clear_page_writeback()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: move page_mapping_file to pagemap.h

    Rui Sun <sunrui26@huawei.com>:
      mm/filemap: update stale comment

Subsystem: mm/msync

    Nikita Ermakov <sh1r4s3@mail.si-head.nl>:
      mm/msync: exit early when the flags is an MS_ASYNC and start < vm_start

Subsystem: mm/gup

    Joao Martins <joao.m.martins@oracle.com>:
    Patch series "mm/gup: page unpining improvements", v4:
      mm/gup: add compound page list iterator
      mm/gup: decrement head page once for group of subpages
      mm/gup: add a range variant of unpin_user_pages_dirty_lock()
      RDMA/umem: batch page unpin in __ib_umem_release()

    Yang Shi <shy828301@gmail.com>:
      mm: gup: remove FOLL_SPLIT

Subsystem: mm/memremap

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/memremap.c: fix improper SPDX comment style

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix kernel stack account

    Shakeel Butt <shakeelb@google.com>:
      memcg: cleanup root memcg checks
      memcg: enable memcg oom-kill for __GFP_NOFAIL

    Johannes Weiner <hannes@cmpxchg.org>:
    Patch series "mm: memcontrol: switch to rstat", v3:
      mm: memcontrol: fix cpuhotplug statistics flushing
      mm: memcontrol: kill mem_cgroup_nodeinfo()
      mm: memcontrol: privatize memcg_page_state query functions
      cgroup: rstat: support cgroup1
      cgroup: rstat: punt root-level optimization to individual controllers
      mm: memcontrol: switch to rstat
      mm: memcontrol: consolidate lruvec stat flushing
      kselftests: cgroup: update kmem test for new vmstat implementation

    Shakeel Butt <shakeelb@google.com>:
      memcg: charge before adding to swapcache on swapin

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Use obj_cgroup APIs to charge kmem pages", v5:
      mm: memcontrol: slab: fix obtain a reference to a freeing memcg
      mm: memcontrol: introduce obj_cgroup_{un}charge_pages
      mm: memcontrol: directly access page->memcg_data in mm/page_alloc.c
      mm: memcontrol: change ug->dummy_page only if memcg changed
      mm: memcontrol: use obj_cgroup APIs to charge kmem pages
      mm: memcontrol: inline __memcg_kmem_{un}charge() into obj_cgroup_{un}charge_pages()
      mm: memcontrol: move PageMemcgKmem to the scope of CONFIG_MEMCG_KMEM

    Wan Jiabing <wanjiabing@vivo.com>:
      linux/memcontrol.h: remove duplicate struct declaration

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: page_counter: mitigate consequences of a page_counter underflow

Subsystem: mm/pagemap

    Wang Qing <wangqing@vivo.com>:
      mm/memory.c: do_numa_page(): delete bool "migrated"

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/interval_tree: add comments to improve code readability

    Oscar Salvador <osalvador@suse.de>:
    Patch series "Cleanup and fixups for vmemmap handling", v6:
      x86/vmemmap: drop handling of 4K unaligned vmemmap range
      x86/vmemmap: drop handling of 1GB vmemmap ranges
      x86/vmemmap: handle unpopulated sub-pmd ranges
      x86/vmemmap: optimize for consecutive sections in partial populated PMDs

    Ovidiu Panait <ovidiu.panait@windriver.com>:
      mm, tracing: improve rss_stat tracepoint message

    Christoph Hellwig <hch@lst.de>:
    Patch series "add remap_pfn_range_notrack instead of reinventing it in i915", v2:
      mm: add remap_pfn_range_notrack
      mm: add a io_mapping_map_user helper
      i915: use io_mapping_map_user
      i915: fix remap_io_sg to verify the pgprot

    Huang Ying <ying.huang@intel.com>:
      NUMA balancing: reduce TLB flush via delaying mapping on hint page fault

Subsystem: mm/mremap

    Brian Geffon <bgeffon@google.com>:
    Patch series "mm: Extend MREMAP_DONTUNMAP to non-anonymous mappings", v5:
      mm: extend MREMAP_DONTUNMAP to non-anonymous mappings
      Revert "mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio"
      selftests: add a MREMAP_DONTUNMAP selftest for shmem

Subsystem: mm/dma

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/dmapool: switch from strlcpy to strscpy

Subsystem: mm/sparsemem

    Wang Wensheng <wangwensheng4@huawei.com>:
      mm/sparse: add the missing sparse_buffer_fini() in error branch

Subsystem: mm/vmalloc

    Christoph Hellwig <hch@lst.de>:
    Patch series "remap_vmalloc_range cleanups":
      samples/vfio-mdev/mdpy: use remap_vmalloc_range
      mm: unexport remap_vmalloc_range_partial

    Serapheim Dimitropoulos <serapheim.dimitro@delphix.com>:
      mm/vmalloc: use rb_tree instead of list for vread() lookups

    Nicholas Piggin <npiggin@gmail.com>:
    Patch series "huge vmalloc mappings", v13:
      ARM: mm: add missing pud_page define to 2-level page tables
      mm/vmalloc: fix HUGE_VMAP regression by enabling huge pages in vmalloc_to_page
      mm: apply_to_pte_range warn and fail if a large pte is encountered
      mm/vmalloc: rename vmap_*_range vmap_pages_*_range
      mm/ioremap: rename ioremap_*_range to vmap_*_range
      mm: HUGE_VMAP arch support cleanup
      powerpc: inline huge vmap supported functions
      arm64: inline huge vmap supported functions
      x86: inline huge vmap supported functions
      mm/vmalloc: provide fallback arch huge vmap support functions
      mm: move vmap_range from mm/ioremap.c to mm/vmalloc.c
      mm/vmalloc: add vmap_range_noflush variant
      mm/vmalloc: hugepage vmalloc mappings
    Patch series "mm/vmalloc: cleanup after hugepage series", v2:
      mm/vmalloc: remove map_kernel_range
      kernel/dma: remove unnecessary unmap_kernel_range
      powerpc/xive: remove unnecessary unmap_kernel_range
      mm/vmalloc: remove unmap_kernel_range
      mm/vmalloc: improve allocation failure error messages

    Vijayanand Jitta <vjitta@codeaurora.org>:
      mm: vmalloc: prevent use after free in _vm_unmap_aliases

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      lib/test_vmalloc.c: remove two kvfree_rcu() tests
      lib/test_vmalloc.c: add a new 'nr_threads' parameter
      vm/test_vmalloc.sh: adapt for updated driver interface
      mm/vmalloc: refactor the preloading loagic
      mm/vmalloc: remove an empty line

Subsystem: mm/documentation

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/doc: fix fault_flag_allow_retry_first kerneldoc
      mm/doc: fix page_maybe_dma_pinned kerneldoc
      mm/doc: turn fault flags into an enum
      mm/doc: add mm.h and mm_types.h to the mm-api document

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
    Patch series "kernel-doc and MAINTAINERS clean-up":
      MAINTAINERS: assign pagewalk.h to MEMORY MANAGEMENT
      pagewalk: prefix struct kernel-doc descriptions

Subsystem: mm/kasan

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/kasan: switch from strlcpy to strscpy

    Peter Collingbourne <pcc@google.com>:
      kasan: fix kasan_byte_accessible() to be consistent with actual checks

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: initialize shadow to TAG_INVALID for SW_TAGS
      mm, kasan: don't poison boot memory with tag-based modes
    Patch series "kasan: integrate with init_on_alloc/free", v3:
      arm64: kasan: allow to init memory when setting tags
      kasan: init memory in kasan_(un)poison for HW_TAGS
      kasan, mm: integrate page_alloc init with HW_TAGS
      kasan, mm: integrate slab init_on_alloc with HW_TAGS
      kasan, mm: integrate slab init_on_free with HW_TAGS
      kasan: docs: clean up sections
      kasan: docs: update overview section
      kasan: docs: update usage section
      kasan: docs: update error reports section
      kasan: docs: update boot parameters section
      kasan: docs: update GENERIC implementation details section
      kasan: docs: update SW_TAGS implementation details section
      kasan: docs: update HW_TAGS implementation details section
      kasan: docs: update shadow memory section
      kasan: docs: update ignoring accesses section
      kasan: docs: update tests section

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: record task_work_add() call stack

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: detect false-positives in tests

    Zqiang <qiang.zhang@windriver.com>:
      irq_work: record irq_work_queue() call stack

Subsystem: mm/initialization

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: move mem_init_print_info() into mm_init()

Subsystem: mm/pagealloc

    David Hildenbrand <david@redhat.com>:
      mm/page_alloc: drop pr_info_ratelimited() in alloc_contig_range()

    Minchan Kim <minchan@kernel.org>:
      mm: remove lru_add_drain_all in alloc_contig_range

    Yu Zhao <yuzhao@google.com>:
      include/linux/page-flags-layout.h: correctly determine LAST_CPUPID_WIDTH
      include/linux/page-flags-layout.h: cleanups

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Rationalise __alloc_pages wrappers", v3:
      mm/page_alloc: rename alloc_mask to alloc_gfp
      mm/page_alloc: rename gfp_mask to gfp
      mm/page_alloc: combine __alloc_pages and __alloc_pages_nodemask
      mm/mempolicy: rename alloc_pages_current to alloc_pages
      mm/mempolicy: rewrite alloc_pages documentation
      mm/mempolicy: rewrite alloc_pages_vma documentation
      mm/mempolicy: fix mpol_misplaced kernel-doc

    Minchan Kim <minchan@kernel.org>:
      mm: page_alloc: dump migrate-failed pages

    Geert Uytterhoeven <geert@linux-m68k.org>:
      mm/Kconfig: remove default DISCONTIGMEM_MANUAL

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm, page_alloc: avoid page_to_pfn() in move_freepages()

    zhouchuangao <zhouchuangao@vivo.com>:
      mm/page_alloc: duplicate include linux/vmalloc.h

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Introduce a bulk order-0 page allocator with two in-tree users", v6:
      mm/page_alloc: rename alloced to allocated
      mm/page_alloc: add a bulk page allocator
      mm/page_alloc: add an array-based interface to the bulk page allocator

    Jesper Dangaard Brouer <brouer@redhat.com>:
      mm/page_alloc: optimize code layout for __alloc_pages_bulk
      mm/page_alloc: inline __rmqueue_pcplist

    Chuck Lever <chuck.lever@oracle.com>:
    Patch series "SUNRPC consumer for the bulk page allocator":
      SUNRPC: set rq_page_end differently
      SUNRPC: refresh rq_pages using a bulk page allocator

    Jesper Dangaard Brouer <brouer@redhat.com>:
      net: page_pool: refactor dma_map into own function page_pool_dma_map
      net: page_pool: use alloc_pages_bulk in refill code path

    Sergei Trofimovich <slyfox@gentoo.org>:
      mm: page_alloc: ignore init_on_free=1 for debug_pagealloc=1

    huxiang <huxiang@uniontech.com>:
      mm/page_alloc: redundant definition variables of pfn in for loop

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/mmzone.h: fix existing kernel-doc comments and link them to core-api

Subsystem: mm/memory-failure

    Jane Chu <jane.chu@oracle.com>:
      mm/memory-failure: unnecessary amount of unmapping

 Documentation/admin-guide/kernel-parameters.txt |    7 
 Documentation/admin-guide/mm/transhuge.rst      |    2 
 Documentation/core-api/cachetlb.rst             |    4 
 Documentation/core-api/mm-api.rst               |    6 
 Documentation/dev-tools/kasan.rst               |  355 +++++-----
 Documentation/vm/page_owner.rst                 |    2 
 Documentation/vm/transhuge.rst                  |    5 
 MAINTAINERS                                     |    1 
 arch/Kconfig                                    |   11 
 arch/alpha/mm/init.c                            |    1 
 arch/arc/mm/init.c                              |    1 
 arch/arm/Kconfig                                |    1 
 arch/arm/include/asm/pgtable-3level.h           |    2 
 arch/arm/include/asm/pgtable.h                  |    3 
 arch/arm/mm/copypage-v4mc.c                     |    1 
 arch/arm/mm/copypage-v6.c                       |    1 
 arch/arm/mm/copypage-xscale.c                   |    1 
 arch/arm/mm/init.c                              |    2 
 arch/arm64/Kconfig                              |    1 
 arch/arm64/include/asm/memory.h                 |    4 
 arch/arm64/include/asm/mte-kasan.h              |   39 -
 arch/arm64/include/asm/vmalloc.h                |   38 -
 arch/arm64/mm/init.c                            |    4 
 arch/arm64/mm/mmu.c                             |   36 -
 arch/csky/abiv1/cacheflush.c                    |    1 
 arch/csky/mm/init.c                             |    1 
 arch/h8300/mm/init.c                            |    2 
 arch/hexagon/mm/init.c                          |    1 
 arch/ia64/Kconfig                               |   23 
 arch/ia64/configs/bigsur_defconfig              |    1 
 arch/ia64/include/asm/meminit.h                 |   11 
 arch/ia64/include/asm/module.h                  |    6 
 arch/ia64/include/asm/page.h                    |   25 
 arch/ia64/include/asm/pgtable.h                 |    7 
 arch/ia64/kernel/Makefile                       |    2 
 arch/ia64/kernel/acpi.c                         |    7 
 arch/ia64/kernel/efi.c                          |   11 
 arch/ia64/kernel/fsys.S                         |    4 
 arch/ia64/kernel/head.S                         |    6 
 arch/ia64/kernel/ia64_ksyms.c                   |   12 
 arch/ia64/kernel/machine_kexec.c                |    2 
 arch/ia64/kernel/mca.c                          |    4 
 arch/ia64/kernel/module.c                       |   29 
 arch/ia64/kernel/pal.S                          |    6 
 arch/ia64/mm/Makefile                           |    1 
 arch/ia64/mm/contig.c                           |    4 
 arch/ia64/mm/discontig.c                        |   21 
 arch/ia64/mm/fault.c                            |   15 
 arch/ia64/mm/init.c                             |  221 ------
 arch/m68k/mm/init.c                             |    1 
 arch/microblaze/mm/init.c                       |    1 
 arch/mips/Kconfig                               |    1 
 arch/mips/loongson64/numa.c                     |    1 
 arch/mips/mm/cache.c                            |    1 
 arch/mips/mm/init.c                             |    1 
 arch/mips/sgi-ip27/ip27-memory.c                |    1 
 arch/nds32/mm/init.c                            |    1 
 arch/nios2/mm/cacheflush.c                      |    1 
 arch/nios2/mm/init.c                            |    1 
 arch/openrisc/mm/init.c                         |    2 
 arch/parisc/mm/init.c                           |    2 
 arch/powerpc/Kconfig                            |    1 
 arch/powerpc/include/asm/vmalloc.h              |   34 -
 arch/powerpc/kernel/isa-bridge.c                |    4 
 arch/powerpc/kernel/pci_64.c                    |    2 
 arch/powerpc/mm/book3s64/radix_pgtable.c        |   29 
 arch/powerpc/mm/ioremap.c                       |    2 
 arch/powerpc/mm/mem.c                           |    1 
 arch/powerpc/sysdev/xive/common.c               |    4 
 arch/riscv/mm/init.c                            |    1 
 arch/s390/mm/init.c                             |    2 
 arch/sh/include/asm/tlb.h                       |   10 
 arch/sh/mm/cache-sh4.c                          |    1 
 arch/sh/mm/cache-sh7705.c                       |    1 
 arch/sh/mm/init.c                               |    1 
 arch/sparc/include/asm/pgtable_32.h             |    3 
 arch/sparc/mm/init_32.c                         |    2 
 arch/sparc/mm/init_64.c                         |    1 
 arch/sparc/mm/tlb.c                             |    1 
 arch/um/kernel/mem.c                            |    1 
 arch/x86/Kconfig                                |    1 
 arch/x86/include/asm/vmalloc.h                  |   42 -
 arch/x86/kernel/cpu/resctrl/pseudo_lock.c       |    2 
 arch/x86/mm/init_32.c                           |    2 
 arch/x86/mm/init_64.c                           |  222 ++++--
 arch/x86/mm/ioremap.c                           |   33 
 arch/x86/mm/pgtable.c                           |   13 
 arch/xtensa/Kconfig                             |    1 
 arch/xtensa/mm/init.c                           |    1 
 block/blk-cgroup.c                              |   17 
 drivers/gpu/drm/i915/Kconfig                    |    1 
 drivers/gpu/drm/i915/gem/i915_gem_mman.c        |    9 
 drivers/gpu/drm/i915/i915_drv.h                 |    3 
 drivers/gpu/drm/i915/i915_mm.c                  |  117 ---
 drivers/infiniband/core/umem.c                  |   12 
 drivers/pci/pci.c                               |    2 
 fs/aio.c                                        |    5 
 fs/fs_parser.c                                  |    2 
 fs/iomap/direct-io.c                            |   24 
 fs/ocfs2/blockcheck.c                           |    2 
 fs/ocfs2/dlm/dlmrecovery.c                      |    7 
 fs/ocfs2/stack_o2cb.c                           |   36 -
 fs/ocfs2/stackglue.c                            |    2 
 include/linux/compiler-gcc.h                    |    8 
 include/linux/fs.h                              |    2 
 include/linux/gfp.h                             |   45 -
 include/linux/io-mapping.h                      |    3 
 include/linux/io.h                              |    9 
 include/linux/kasan.h                           |   51 +
 include/linux/memcontrol.h                      |  271 ++++----
 include/linux/mm.h                              |   50 -
 include/linux/mmzone.h                          |   43 -
 include/linux/page-flags-layout.h               |   64 -
 include/linux/pagemap.h                         |   10 
 include/linux/pagewalk.h                        |    4 
 include/linux/sched.h                           |    4 
 include/linux/slab.h                            |    2 
 include/linux/slub_def.h                        |    2 
 include/linux/vmalloc.h                         |   73 +-
 include/linux/vmstat.h                          |   24 
 include/net/page_pool.h                         |    2 
 include/trace/events/kmem.h                     |   24 
 init/main.c                                     |    2 
 kernel/cgroup/cgroup.c                          |   34 -
 kernel/cgroup/rstat.c                           |   61 +
 kernel/dma/remap.c                              |    1 
 kernel/fork.c                                   |   13 
 kernel/irq_work.c                               |    7 
 kernel/task_work.c                              |    3 
 kernel/watchdog.c                               |  102 +--
 lib/Kconfig.debug                               |   14 
 lib/Makefile                                    |    1 
 lib/test_kasan.c                                |   59 -
 lib/test_slub.c                                 |  124 +++
 lib/test_vmalloc.c                              |  128 +--
 mm/Kconfig                                      |    4 
 mm/Makefile                                     |    1 
 mm/debug_vm_pgtable.c                           |    4 
 mm/dmapool.c                                    |    2 
 mm/filemap.c                                    |   61 +
 mm/gup.c                                        |  145 +++-
 mm/hugetlb.c                                    |    2 
 mm/internal.h                                   |   25 
 mm/interval_tree.c                              |    2 
 mm/io-mapping.c                                 |   29 
 mm/ioremap.c                                    |  361 ++--------
 mm/kasan/common.c                               |   53 -
 mm/kasan/generic.c                              |   12 
 mm/kasan/kasan.h                                |   28 
 mm/kasan/report_generic.c                       |    2 
 mm/kasan/shadow.c                               |   10 
 mm/kasan/sw_tags.c                              |   12 
 mm/kmemleak.c                                   |    2 
 mm/memcontrol.c                                 |  798 ++++++++++++------------
 mm/memory-failure.c                             |    2 
 mm/memory.c                                     |  191 +++--
 mm/mempolicy.c                                  |   78 --
 mm/mempool.c                                    |    4 
 mm/memremap.c                                   |    2 
 mm/migrate.c                                    |    2 
 mm/mm_init.c                                    |    4 
 mm/mmap.c                                       |    6 
 mm/mremap.c                                     |    6 
 mm/msync.c                                      |    6 
 mm/page-writeback.c                             |    9 
 mm/page_alloc.c                                 |  430 +++++++++---
 mm/page_counter.c                               |    8 
 mm/page_owner.c                                 |   68 --
 mm/page_poison.c                                |    6 
 mm/percpu-vm.c                                  |    7 
 mm/slab.c                                       |   43 -
 mm/slab.h                                       |   24 
 mm/slab_common.c                                |   10 
 mm/slub.c                                       |  215 ++----
 mm/sparse.c                                     |    1 
 mm/swap_state.c                                 |   13 
 mm/util.c                                       |   10 
 mm/vmalloc.c                                    |  728 ++++++++++++++++-----
 net/core/page_pool.c                            |  127 ++-
 net/sunrpc/svc_xprt.c                           |   38 -
 samples/kfifo/bytestream-example.c              |    8 
 samples/kfifo/inttype-example.c                 |    8 
 samples/kfifo/record-example.c                  |    8 
 samples/vfio-mdev/mdpy.c                        |    4 
 scripts/checkdeclares.pl                        |   53 +
 scripts/spelling.txt                            |   26 
 tools/testing/selftests/cgroup/test_kmem.c      |   22 
 tools/testing/selftests/vm/mremap_dontunmap.c   |   52 +
 tools/testing/selftests/vm/test_vmalloc.sh      |   21 
 189 files changed, 3642 insertions(+), 3013 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-05-05  1:32 Andrew Morton
  2021-05-05  1:47 ` incoming Linus Torvalds
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-05-05  1:32 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


The remainder of the main mm/ queue.

143 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus
previously sent patches.

Subsystems affected by this patch series:

  mm/pagecache
  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/compaction
  mm/migration
  mm/cma
  mm/ksm
  mm/vmstat
  mm/mmap
  mm/kconfig
  mm/util
  mm/memory-hotplug
  mm/zswap
  mm/zsmalloc
  mm/highmem
  mm/cleanups
  mm/kfence

Subsystem: mm/pagecache

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Remove nrexceptional tracking", v2:
      mm: introduce and use mapping_empty()
      mm: stop accounting shadow entries
      dax: account DAX entries as nrpages
      mm: remove nrexceptional from inode

    Hugh Dickins <hughd@google.com>:
      mm: remove nrexceptional from inode: remove BUG_ON

Subsystem: mm/hugetlb

    Peter Xu <peterx@redhat.com>:
    Patch series "hugetlb: Disable huge pmd unshare for uffd-wp", v4:
      hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share()
      hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled
      mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h
      hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: remove redundant reservation check condition in alloc_huge_page()

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm: generalize HUGETLB_PAGE_SIZE_VARIABLE

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Some cleanups for hugetlb":
      mm/hugetlb: use some helper functions to cleanup code
      mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state()
      mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate()
      mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page()
      mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case
    Patch series "Cleanup and fixup for khugepaged", v2:
      khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps()
      khugepaged: reuse the smp_wmb() inside __SetPageUptodate()
      khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter()
      khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate()
      mm/huge_memory.c: remove unnecessary local variable ret2
    Patch series "Some cleanups for huge_memory", v3:
      mm/huge_memory.c: rework the function vma_adjust_trans_huge()
      mm/huge_memory.c: make get_huge_zero_page() return bool
      mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly
      mm/huge_memory.c: remove redundant PageCompound() check
      mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG
      mm/huge_memory.c: use helper function migration_entry_to_page()

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup for khugepaged":
      khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp()
      khugepaged: remove unnecessary out label in collapse_huge_page()
      khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd()

    Zi Yan <ziy@nvidia.com>:
      mm: huge_memory: a new debugfs interface for splitting THP tests
      mm: huge_memory: debugfs for file-backed THP split

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for hugetlb", v2:
      mm/hugeltb: remove redundant VM_BUG_ON() in region_add()
      mm/hugeltb: simplify the return code of __vma_reservation_common()
      mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages()
      mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts()
      mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages()

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "make hugetlb put_page safe for all calling contexts", v5:
      mm/cma: change cma mutex to irq safe spinlock
      hugetlb: no need to drop hugetlb_lock to call cma_release
      hugetlb: add per-hstate mutex to synchronize user adjustments
      hugetlb: create remove_hugetlb_page() to separate functionality
      hugetlb: call update_and_free_page without hugetlb_lock
      hugetlb: change free_pool_huge_page to remove_pool_huge_page
      hugetlb: make free_huge_page irq safe
      hugetlb: add lockdep_assert_held() calls for hugetlb_lock

    Oscar Salvador <osalvador@suse.de>:
    Patch series "Make alloc_contig_range handle Hugetlb pages", v10:
      mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range
      mm,compaction: let isolate_migratepages_{range,block} return error codes
      mm,hugetlb: drop clearing of flag from prep_new_huge_page
      mm,hugetlb: split prep_new_huge_page functionality
      mm: make alloc_contig_range handle free hugetlb pages
      mm: make alloc_contig_range handle in-use hugetlb pages
      mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig

Subsystem: mm/userfaultfd

    Axel Rasmussen <axelrasmussen@google.com>:
    Patch series "userfaultfd: add minor fault handling", v9:
      userfaultfd: add minor fault registration mode
      userfaultfd: disable huge PMD sharing for MINOR registered VMAs
      userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled
      userfaultfd: add UFFDIO_CONTINUE ioctl
      userfaultfd: update documentation to describe minor fault handling
      userfaultfd/selftests: add test exercising minor fault handling

Subsystem: mm/vmscan

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: move RECLAIM* bits to uapi header
      mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks

    Yang Shi <shy828301@gmail.com>:
    Patch series "Make shrinker's nr_deferred memcg aware", v10:
      mm: vmscan: use nid from shrink_control for tracepoint
      mm: vmscan: consolidate shrinker_maps handling code
      mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation
      mm: vmscan: remove memcg_shrinker_map_size
      mm: vmscan: use kvfree_rcu instead of call_rcu
      mm: memcontrol: rename shrinker_map to shrinker_info
      mm: vmscan: add shrinker_info_protected() helper
      mm: vmscan: use a new flag to indicate shrinker is registered
      mm: vmscan: add per memcg shrinker nr_deferred
      mm: vmscan: use per memcg nr_deferred of shrinker
      mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers
      mm: memcontrol: reparent nr_deferred when memcg offline
      mm: vmscan: shrink deferred objects proportional to priority

Subsystem: mm/compaction

    Pintu Kumar <pintu@codeaurora.org>:
      mm/compaction: remove unused variable sysctl_compact_memory

    Charan Teja Reddy <charante@codeaurora.org>:
      mm: compaction: update the COMPACT[STALL|FAIL] events properly

Subsystem: mm/migration

    Minchan Kim <minchan@kernel.org>:
      mm: disable LRU pagevec during the migration temporarily
      mm: replace migrate_[prep|finish] with lru_cache_[disable|enable]
      mm: fs: invalidate BH LRU during page migration

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for mm/migrate.c", v3:
      mm/migrate.c: make putback_movable_page() static
      mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case
      mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page()
      mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole()
      Revert "mm: migrate: skip shared exec THP for NUMA balancing"

Subsystem: mm/cma

    Minchan Kim <minchan@kernel.org>:
      mm: vmstat: add cma statistics

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: cma: use pr_err_ratelimited for CMA warning

    Liam Mark <lmark@codeaurora.org>:
      mm: cma: add trace events for CMA alloc perf testing

    Minchan Kim <minchan@kernel.org>:
      mm: cma: support sysfs
      mm: cma: add the CMA instance name to cma trace events
      mm: use proper type for cma_[alloc|release]

Subsystem: mm/ksm

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for ksm":
      ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search()
      ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()
      ksm: remove dedicated macro KSM_FLAG_MASK
      ksm: fix potential missing rmap_item for stable_node

    Chengyang Fan <cy.fan@huawei.com>:
      mm/ksm: remove unused parameter from remove_trailing_rmap_items()

Subsystem: mm/vmstat

    Hugh Dickins <hughd@google.com>:
      mm: restore node stat checking in /proc/sys/vm/stat_refresh
      mm: no more EINVAL from /proc/sys/vm/stat_refresh
      mm: /proc/sys/vm/stat_refresh skip checking known negative stats
      mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats

    Saravanan D <saravanand@fb.com>:
      x86/mm: track linear mapping split events

Subsystem: mm/mmap

    Liam Howlett <liam.howlett@oracle.com>:
      mm/mmap.c: don't unlock VMAs in remap_file_pages()

Subsystem: mm/kconfig

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm: some config cleanups", v2:
      mm: generalize ARCH_HAS_CACHE_LINE_SIZE
      mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
      mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE]
      mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION
      mm: drop redundant ARCH_ENABLE_SPLIT_PMD_PTLOCK
      mm: drop redundant HAVE_ARCH_TRANSPARENT_HUGEPAGE

Subsystem: mm/util

    Joe Perches <joe@perches.com>:
      mm/util.c: reduce mem_dump_obj() object size

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      mm/util.c: fix typo

Subsystem: mm/memory-hotplug

    Pavel Tatashin <pasha.tatashin@soleen.com>:
    Patch series "prohibit pinning pages in ZONE_MOVABLE", v11:
      mm/gup: don't pin migrated cma pages in movable zone
      mm/gup: check every subpage of a compound page during isolation
      mm/gup: return an error on migration failure
      mm/gup: check for isolation errors
      mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN
      mm: apply per-task gfp constraints in fast path
      mm: honor PF_MEMALLOC_PIN for all movable pages
      mm/gup: do not migrate zero page
      mm/gup: migrate pinned pages out of movable zone
      memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning
      mm/gup: change index type to long as it counts pages
      mm/gup: longterm pin migration cleanup
      selftests/vm: gup_test: fix test flag
      selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages

    Mel Gorman <mgorman@techsingularity.net>:
      mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove

    Oscar Salvador <osalvador@suse.de>:
    Patch series "Allocate memmap from hotadded memory (per device)", v10:
      drivers/base/memory: introduce memory_block_{online,offline}
      mm,memory_hotplug: relax fully spanned sections check

    David Hildenbrand <david@redhat.com>:
      mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count()

    Oscar Salvador <osalvador@suse.de>:
      mm,memory_hotplug: allocate memmap from the added memory range
      acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported
      mm,memory_hotplug: add kernel boot option to enable memmap_on_memory
      x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
      arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE

Subsystem: mm/zswap

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/zswap.c: switch from strlcpy to strscpy

Subsystem: mm/zsmalloc

    zhouchuangao <zhouchuangao@vivo.com>:
      mm/zsmalloc: use BUG_ON instead of if condition followed by BUG.

Subsystem: mm/highmem

    Ira Weiny <ira.weiny@intel.com>:
    Patch series "btrfs: Convert kmap/memset/kunmap to memzero_user()":
      iov_iter: lift memzero_page() to highmem.h
      btrfs: use memzero_page() instead of open coded kmap pattern

    songqiang <songqiang@uniontech.com>:
      mm/highmem.c: fix coding style issue

Subsystem: mm/cleanups

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/mempool: minor coding style tweaks

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      mm/process_vm_access.c: remove duplicate include

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: zero guard page after out-of-bounds access
    Patch series "kfence: optimize timer scheduling", v2:
      kfence: await for allocation using wait_event
      kfence: maximize allocation wait timeout duration
      kfence: use power-efficient work queue to run delayed work

 Documentation/ABI/testing/sysfs-kernel-mm-cma     |   25 
 Documentation/admin-guide/kernel-parameters.txt   |   17 
 Documentation/admin-guide/mm/memory-hotplug.rst   |    9 
 Documentation/admin-guide/mm/userfaultfd.rst      |  105 +-
 arch/arc/Kconfig                                  |    9 
 arch/arm/Kconfig                                  |   10 
 arch/arm64/Kconfig                                |   34 
 arch/arm64/mm/hugetlbpage.c                       |    7 
 arch/ia64/Kconfig                                 |   14 
 arch/ia64/mm/hugetlbpage.c                        |    3 
 arch/mips/Kconfig                                 |    6 
 arch/mips/mm/hugetlbpage.c                        |    4 
 arch/parisc/Kconfig                               |    5 
 arch/parisc/mm/hugetlbpage.c                      |    2 
 arch/powerpc/Kconfig                              |   17 
 arch/powerpc/mm/hugetlbpage.c                     |    3 
 arch/powerpc/platforms/Kconfig.cputype            |   16 
 arch/riscv/Kconfig                                |    5 
 arch/s390/Kconfig                                 |   12 
 arch/s390/mm/hugetlbpage.c                        |    2 
 arch/sh/Kconfig                                   |    7 
 arch/sh/mm/Kconfig                                |    8 
 arch/sh/mm/hugetlbpage.c                          |    2 
 arch/sparc/mm/hugetlbpage.c                       |    2 
 arch/x86/Kconfig                                  |   33 
 arch/x86/mm/pat/set_memory.c                      |    8 
 drivers/acpi/acpi_memhotplug.c                    |    5 
 drivers/base/memory.c                             |  105 ++
 fs/Kconfig                                        |    5 
 fs/block_dev.c                                    |    2 
 fs/btrfs/compression.c                            |    5 
 fs/btrfs/extent_io.c                              |   22 
 fs/btrfs/inode.c                                  |   33 
 fs/btrfs/reflink.c                                |    6 
 fs/btrfs/zlib.c                                   |    5 
 fs/btrfs/zstd.c                                   |    5 
 fs/buffer.c                                       |   36 
 fs/dax.c                                          |    8 
 fs/gfs2/glock.c                                   |    3 
 fs/hugetlbfs/inode.c                              |    9 
 fs/inode.c                                        |   11 
 fs/proc/task_mmu.c                                |    3 
 fs/userfaultfd.c                                  |  149 +++
 include/linux/buffer_head.h                       |    4 
 include/linux/cma.h                               |    4 
 include/linux/compaction.h                        |    1 
 include/linux/fs.h                                |    2 
 include/linux/gfp.h                               |    2 
 include/linux/highmem.h                           |    7 
 include/linux/huge_mm.h                           |    3 
 include/linux/hugetlb.h                           |   37 
 include/linux/memcontrol.h                        |   27 
 include/linux/memory.h                            |    8 
 include/linux/memory_hotplug.h                    |   15 
 include/linux/memremap.h                          |    2 
 include/linux/migrate.h                           |   11 
 include/linux/mm.h                                |   28 
 include/linux/mmzone.h                            |   20 
 include/linux/pagemap.h                           |    5 
 include/linux/pgtable.h                           |   12 
 include/linux/sched.h                             |    2 
 include/linux/sched/mm.h                          |   27 
 include/linux/shrinker.h                          |    7 
 include/linux/swap.h                              |   21 
 include/linux/userfaultfd_k.h                     |   55 +
 include/linux/vm_event_item.h                     |    8 
 include/trace/events/cma.h                        |   92 +-
 include/trace/events/migrate.h                    |   25 
 include/trace/events/mmflags.h                    |    7 
 include/uapi/linux/mempolicy.h                    |    7 
 include/uapi/linux/userfaultfd.h                  |   36 
 init/Kconfig                                      |    5 
 kernel/sysctl.c                                   |    2 
 lib/Kconfig.kfence                                |    1 
 lib/iov_iter.c                                    |    8 
 mm/Kconfig                                        |   28 
 mm/Makefile                                       |    6 
 mm/cma.c                                          |   70 +
 mm/cma.h                                          |   25 
 mm/cma_debug.c                                    |    8 
 mm/cma_sysfs.c                                    |  112 ++
 mm/compaction.c                                   |  113 ++
 mm/filemap.c                                      |   24 
 mm/frontswap.c                                    |   12 
 mm/gup.c                                          |  264 +++---
 mm/gup_test.c                                     |   29 
 mm/gup_test.h                                     |    3 
 mm/highmem.c                                      |   11 
 mm/huge_memory.c                                  |  326 +++++++-
 mm/hugetlb.c                                      |  843 ++++++++++++++--------
 mm/hugetlb_cgroup.c                               |    9 
 mm/internal.h                                     |   10 
 mm/kfence/core.c                                  |   61 +
 mm/khugepaged.c                                   |   63 -
 mm/ksm.c                                          |   17 
 mm/list_lru.c                                     |    6 
 mm/memcontrol.c                                   |  137 ---
 mm/memory_hotplug.c                               |  220 +++++
 mm/mempolicy.c                                    |   16 
 mm/mempool.c                                      |    2 
 mm/migrate.c                                      |  103 --
 mm/mlock.c                                        |    4 
 mm/mmap.c                                         |   18 
 mm/oom_kill.c                                     |    2 
 mm/page_alloc.c                                   |   83 +-
 mm/process_vm_access.c                            |    1 
 mm/shmem.c                                        |    2 
 mm/sparse.c                                       |    4 
 mm/swap.c                                         |   69 +
 mm/swap_state.c                                   |    4 
 mm/swapfile.c                                     |    4 
 mm/truncate.c                                     |   19 
 mm/userfaultfd.c                                  |   39 -
 mm/util.c                                         |   26 
 mm/vmalloc.c                                      |    2 
 mm/vmscan.c                                       |  543 +++++++++-----
 mm/vmstat.c                                       |   45 -
 mm/workingset.c                                   |    1 
 mm/zsmalloc.c                                     |    6 
 mm/zswap.c                                        |    2 
 tools/testing/selftests/vm/.gitignore             |    1 
 tools/testing/selftests/vm/Makefile               |    1 
 tools/testing/selftests/vm/gup_test.c             |   38 
 tools/testing/selftests/vm/split_huge_page_test.c |  400 ++++++++++
 tools/testing/selftests/vm/userfaultfd.c          |  164 ++++
 125 files changed, 3596 insertions(+), 1668 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-05-05  1:32 incoming Andrew Morton
@ 2021-05-05  1:47 ` Linus Torvalds
  2021-05-05  3:16   ` incoming Andrew Morton
  0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2021-05-05  1:47 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 143 patches

Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.

Maybe just some mail delay? But at least right now

   https://lore.kernel.org/mm-commits/

doesn't show them (and thus 'b4' doesn't work).

I'll check again later.

             Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-05-05  1:47 ` incoming Linus Torvalds
@ 2021-05-05  3:16   ` Andrew Morton
  2021-05-05 17:10     ` incoming Linus Torvalds
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-05-05  3:16 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Linux-MM, mm-commits

On Tue, 4 May 2021 18:47:19 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 143 patches
> 
> Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.
> 
> Maybe just some mail delay? But at least right now
> 
>    https://lore.kernel.org/mm-commits/
> 
> doesn't show them (and thus 'b4' doesn't work).
> 
> I'll check again later.
> 

Well that's strange.  I see all three via cc:me, but not on linux-mm or
mm-commits.

Let me resend right now with the same in-reply-to.  Hopefully they will
land in the correct place.

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-05-05  3:16   ` incoming Andrew Morton
@ 2021-05-05 17:10     ` Linus Torvalds
  2021-05-05 17:44       ` incoming Andrew Morton
  0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2021-05-05 17:10 UTC (permalink / raw)
  To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits

On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> Let me resend right now with the same in-reply-to.  Hopefully they will
> land in the correct place.

Well, you re-sent it twice, and I have three copies in my own mailbox,
bot they still don't show up on the mm-commits mailing list.

So the list hates them for some odd reason.

I've picked them up locally, but adding Konstantin to the participants
to see if he can see what's up.

Konstantin: patches 103/106/107 are missing on lore out of Andrew's
series of 143. Odd.

             Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-05-05 17:10     ` incoming Linus Torvalds
@ 2021-05-05 17:44       ` Andrew Morton
  2021-05-06  3:19         ` incoming Anshuman Khandual
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-05-05 17:44 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits

[-- Attachment #1: Type: text/plain, Size: 1387 bytes --]

On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > Let me resend right now with the same in-reply-to.  Hopefully they will
> > land in the correct place.
> 
> Well, you re-sent it twice, and I have three copies in my own mailbox,
> bot they still don't show up on the mm-commits mailing list.
> 
> So the list hates them for some odd reason.
> 
> I've picked them up locally, but adding Konstantin to the participants
> to see if he can see what's up.
> 
> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
> series of 143. Odd.

It's weird.  They don't turn up on linux-mm either, and that's running
at kvack.org, also majordomo.  They don't get through when sent with
either heirloom-mailx or with sylpheed.

Also, it seems that when Anshuman originally sent the patch, linux-mm
and linux-kernel didn't send it back out.  So perhaps a spam filter
triggered?

I'm seeing

https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/

which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
server massacred that patch series.  Searching
https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
email series.

One of the emails (as sent my me) is attached, if that helps.



[-- Attachment #2: x.txt --]
[-- Type: text/plain, Size: 21048 bytes --]

Return-Path: <akpm@linux-foundation.org>
X-Spam-Checker-Version: SpamAssassin 3.4.1 (2015-04-28) on y
X-Spam-Level: (none)
X-Spam-Status: No, score=-101.5 required=2.5 tests=BAYES_00,T_DKIM_INVALID,
	USER_IN_WHITELIST autolearn=ham autolearn_force=no version=3.4.1
Received: from localhost.localdomain (localhost.localdomain [127.0.0.1])
	by localhost.localdomain (8.15.2/8.15.2/Debian-8ubuntu1) with ESMTP id 1453H2fk032202
	for <akpm@localhost>; Tue, 4 May 2021 20:17:03 -0700
Received: from imap.fastmail.com [66.111.4.135]
	by localhost.localdomain with IMAP (fetchmail-6.3.26)
	for <akpm@localhost> (single-drop); Tue, 04 May 2021 20:17:03 -0700 (PDT)
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
	 by sloti11d1t06 (Cyrus 3.5.0-alpha0-442-g5daca166b9-fm-20210428.001-g5daca166) with LMTPA;
	 Tue, 04 May 2021 23:16:31 -0400
X-Cyrus-Session-Id: sloti11d1t06-1620184591-1699471-2-6359664467419938249
X-Sieve: CMU Sieve 3.0
X-Resolved-to: akpm@mbx.kernel.org
X-Delivered-to: akpm@mbx.kernel.org
X-Mail-from: akpm@linux-foundation.org
Received: from mx6 ([10.202.2.205])
  by compute1.internal (LMTPProxy); Tue, 04 May 2021 23:16:31 -0400
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
	by mailmx.nyi.internal (Postfix) with ESMTP id 40796C800E1
	for <akpm@mbx.kernel.org>; Tue,  4 May 2021 23:16:31 -0400 (EDT)
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
    by mx6.messagingengine.com (Authentication Milter) with ESMTP
    id 14870833D7F;
    Tue, 4 May 2021 23:16:31 -0400
ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=messagingengine.com; s=fm2; t=
    1620184591; b=FBo7Gf3JFN+4QYg5Byan0oNm6RESv+sIf5HcaslVNsUd9SOTGS
    yI0+IsXr1CUpGH783hE6fmgEq9SyfOwQVZjdikLaJS1+7u0JtfAYQFU3RORCtXlr
    djJWrScfjVa8nAHX4rQCtzvtPYuzx5w7cTgGgeILgoJMxgLj7EC9xcT8BIf68+9W
    Lw+ohAmcuiKhL2ez+de4SMuwdh3dh2FwAIHQOsSjEU1/NV+WGxMLwYbxWgTrqQGH
    RQIzFNdq30qslW9huK47+e80uHOX2tXwxtshwbThFEn458bdV5LL6Y8Oh4ZWMbv1
    tFgTt515DVedonZknxc07XsXtAjaJyB8bfHw==
ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d=
    messagingengine.com; h=date:from:to:subject:message-id
    :in-reply-to; s=fm2; t=1620184591; bh=LuH7mbm3+zp863vKBEqKeoZtnp
    uFxYpIb5oTVwf56Es=; b=m5E1fbz2b+an/X406oY3BuG0Zm4/W05vWAki8Lsnud
    gPCc1LfPUFSuXaMppcEDPbLKprp4hH3T52itK4pivXMQCLEOyme7kVStaLMVTiky
    Xxqh5ZdhOWvygBfda/GjfuLBSbbj2gfm8HPKpbL7CA5foelknIBhJHDzGkJyxetZ
    YagZfVvtdo2OEwnC1mmjUCpKPO5+m5kaZO0ol6rPdl+TV0MKGhjLg+/i6Ia+0nFp
    zDwV4VeACvVcGb2xY7KG5Z+BtqVxeVFn+w5JcqpWUtxEKoSBR4bWARzjwHg6eouh
    7psOOKPTt/NzDKk+3f49lso5KlPiTF2xEU/+5SIttCkQ==
ARC-Authentication-Results: i=2; mx6.messagingengine.com;
    arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
    smtp.remote-ip=209.85.215.198;
    bimi=skipped (DMARC did not pass);
    dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
    header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
    header.s=korg x-bits=1024;
    dmarc=none policy.published-domain-policy=none
    policy.applied-disposition=none policy.evaluated-disposition=none
    (p=none,d=none,d.eval=none) policy.policy-from=p
    header.from=linux-foundation.org;
    iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
    spf=pass smtp.mailfrom=akpm@linux-foundation.org
    smtp.helo=mail-pg1-f198.google.com;
    x-aligned-from=pass (Address match);
    x-arc-spf=pass
    (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
    smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
    x-arc-domain=google.com (Trusted from aar.1.google.com);
    x-csa=none;
    x-google-dkim=fail (message has been altered, 2048-bit rsa key)
    header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-pg1-f198.google.com
    policy.ptr=mail-pg1-f198.google.com;
    x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
    (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
    (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
    smtp.bits=256/256;
    x-vs=clean score=40 state=0
Authentication-Results: mx6.messagingengine.com;
    arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
      smtp.remote-ip=209.85.215.198;
    bimi=skipped (DMARC did not pass);
    dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
      header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
      header.s=korg x-bits=1024;
    dmarc=none policy.published-domain-policy=none
      policy.applied-disposition=none policy.evaluated-disposition=none
      (p=none,d=none,d.eval=none) policy.policy-from=p
      header.from=linux-foundation.org;
    iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
    spf=pass smtp.mailfrom=akpm@linux-foundation.org
      smtp.helo=mail-pg1-f198.google.com;
    x-aligned-from=pass (Address match);
    x-arc-spf=pass
      (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
      smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
      x-arc-domain=google.com (Trusted from aar.1.google.com);
    x-csa=none;
    x-google-dkim=fail (message has been altered, 2048-bit rsa key)
      header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-pg1-f198.google.com
      policy.ptr=mail-pg1-f198.google.com;
    x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
      (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
      (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
      smtp.bits=256/256;
    x-vs=clean score=40 state=0
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrvdefjedgieegucetufdoteggodetrfdotf
    fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu
    rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucgoufhorhhtvggutfgvtg
    hiphdvucdlgedtmdenucfjughrpeffhffvuffkjggfsedttdertddtredtnecuhfhrohhm
    peetnhgurhgvficuofhorhhtohhnuceorghkphhmsehlihhnuhigqdhfohhunhgurghtih
    honhdrohhrgheqnecuggftrfgrthhtvghrnhepjeevfeduveffvddvudetkefhgeduveeu
    geevvdfhhfevhfekkedtieefgfduheeinecuffhomhgrihhnpehkvghrnhgvlhdrohhrgh
    enucfkphepvddtledrkeehrddvudehrdduleekpdduleekrddugeehrddvledrleelnecu
    uegrugftvghpuhhtkfhppeduleekrddugeehrddvledrleelnecuvehluhhsthgvrhfuih
    iivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudehrdduleekpdhhvghl
    ohepmhgrihhlqdhpghduqdhfudelkedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomh
    epoegrkhhpmheslhhinhhugidqfhhouhhnuggrthhiohhnrdhorhhgqe
X-ME-VSScore: 40
X-ME-VSCategory: clean
X-ME-CSA: none
Received-SPF: pass
    (linux-foundation.org: Sender is authorized to use 'akpm@linux-foundation.org' in 'mfrom' identity (mechanism 'include:_spf.google.com' matched))
    receiver=mx6.messagingengine.com;
    identity=mailfrom;
    envelope-from="akpm@linux-foundation.org";
    helo=mail-pg1-f198.google.com;
    client-ip=209.85.215.198
Received: from mail-pg1-f198.google.com (mail-pg1-f198.google.com [209.85.215.198])
	(using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)
	 key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256)
	(No client certificate requested)
	by mx6.messagingengine.com (Postfix) with ESMTPS
	for <akpm@mbx.kernel.org>; Tue,  4 May 2021 23:16:31 -0400 (EDT)
Received: by mail-pg1-f198.google.com with SMTP id g5-20020a63f4050000b02901f6c7b9a6d0so593624pgi.5
        for <akpm@mbx.kernel.org>; Tue, 04 May 2021 20:16:30 -0700 (PDT)
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
        d=1e100.net; s=20161025;
        h=x-gm-message-state:dkim-signature:date:from:to:subject:message-id
         :in-reply-to:user-agent;
        bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
        b=VZuDOxUfeHXJz1/CiFfcxuMVHkmW5RznvqYS+Py8Ub6nHHXprQJGE9Ze3WgH+1ylSe
         NJLEC7xgv15SR9A+e/MT4RTj3OVOwtd1Zi2vPav39a9K4tP+2uL2Ei+5d7FtT3LLZsjo
         feek/DqCGSkJ/EC5woLyU9BBkfLUuQ9/2HiDCk10BMetEfWdor69Slb39NOXES8br02X
         25Btabu9ZCWroyjQj7W5gwGr5Z6Hs2nbnnfAb+e92FalcUD/4ql77lNzRcWGi4/9TT8s
         ntqI2g46Xv+k5LURaRH5CRBpxkkKgzcrioRPYFUHkEgOEWy1hPzg9QPk8ZO35Xm9R9d2
         vl3Q==
X-Gm-Message-State: AOAM531IlYUTVWcMrsTunnxZWB7SKeeOmoZj5mZ1A5tl7N/JlZUueN8L
	tvyRKnvxHr6a5mDaGHN9Tb1N/iCzT0U5oQgRVTxTnj1qFGibRa9+leLQNKX0aGlNg9JiaMfromb
	xyOlCUpVXOlVvchuwTUSTn7rXum+Hh3PWQZm5II/EX+0AkzKqez62Z8U=
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203271pjq.53.1620184589161;
        Tue, 04 May 2021 20:16:29 -0700 (PDT)
X-Google-Smtp-Source: ABdhPJxffoGdRqAjUagWoMVD5p/Lk1KTEDftEhkWh8ewatgDmZLlxh0lO1hxYIdYYwoO5dsJ/i0z
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203198pjq.53.1620184588109;
        Tue, 04 May 2021 20:16:28 -0700 (PDT)
ARC-Seal: i=1; a=rsa-sha256; t=1620184588; cv=none;
        d=google.com; s=arc-20160816;
        b=Fr2b2AMXJr6OeNpSql45tq1korkuDOunp7t+DpARuEBnwvQnKfagyipQ93jywsRf/c
         /i/mP2eTmJwOLWNORClh1MGF/0VfBx1ULoB9W4CI3LpVgGFXGGFis8LTcvUYD5yvhlsV
         50rm2j34iS9lyo04FB/hbhGkwLtUhz2PGkLGuqHspTd+pUpUCf5SLxGJbZC5uCcUEsbO
         8WSDBWyvaCPjFzJQZK60gK70ticKW+fCG1xHtOG4qsFCbqEpFKBy8eVK83OBazo/dQDr
         DOheWNWyw2o/WMP4GpZMvZuj30dx3j8xnBahIpnMIQJaog6wLMcVX9pkQ8UJym3/PGNm
         pO/g==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816;
        h=user-agent:in-reply-to:message-id:subject:to:from:date
         :dkim-signature;
        bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
        b=vVN16NPMKjoxSJQ6b36VXFCkZqnmG7wABfilgE069txZqmHpEMyZb8lRStkHy557LM
         Kn7UfJFP3xwsP8ZTCipVDZ6tpFW/hYFU9o4th9G8asWs+MOf9xpWX2LQZ1FTmaao2Fg5
         uCHypz39cnAh0Z1EJfNsTcaTGIrkbBd6zje+mtBgs8hnfH8HcWBYTPCHCCx950Z928tb
         XOPd/Igs7yzD1ioBiGXZj/ciwPbWVTaZXBg4JOZSApxkDMfuMyfyLLOs++EVkyxJHUme
         TmgwvLkixcwEtKF7gIeqEhwvOUSVvilLuJLFVaLumwTcjJ1amVfGcJhBE7LIM9C3SMpA
         rOOg==
ARC-Authentication-Results: i=1; mx.google.com;
       dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
       spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: from mail.kernel.org (mail.kernel.org. [198.145.29.99])
        by mx.google.com with ESMTPS id c85si20173199pfb.8.2021.05.04.20.16.27
        (version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128);
        Tue, 04 May 2021 20:16:28 -0700 (PDT)
Received-SPF: pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) client-ip=198.145.29.99;
Authentication-Results: mx.google.com;
       dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
       spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: by mail.kernel.org (Postfix) with ESMTPSA id A4DB4610D2;
	Wed,  5 May 2021 03:16:26 +0000 (UTC)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=linux-foundation.org;
	s=korg; t=1620184587;
	bh=TxN4wgKcKf2UUem+5pL09m9GL/7U592mEalo2U6vwAU=;
	h=Date:From:To:Subject:In-Reply-To:From;
	b=Gdz/3wY9ktH3hOmn2DAOkfh0JXwPdMJ8xsNQFa9eI25K39Z3iHdRGo9jX3QtMDtog
	 D4Zakt52CQCYsV91c9oCai8KnCTkkAjJq/Ez7p8UHpz97Go3yYYxqg6DDl6d8HCQvN
	 H47dTaZAgeH2sw29bjB9fRzNuTx7k4RAPlqZIpiE=
Date: Tue, 04 May 2021 20:16:26 -0700
From: Andrew Morton <akpm@linux-foundation.org>
To: akpm@linux-foundation.org, anshuman.khandual@arm.com, aou@eecs.berkeley.edu, arnd@arndb.de, benh@kernel.crashing.org, borntraeger@de.ibm.com, bp@alien8.de, catalin.marinas@arm.com, dalias@libc.org, deller@gmx.de, gor@linux.ibm.com, hca@linux.ibm.com, hpa@zytor.com, James.Bottomley@HansenPartnership.com, linux-mm@kvack.org, linux@armlinux.org.uk, mingo@redhat.com, mm-commits@vger.kernel.org, mpe@ellerman.id.au, palmerdabbelt@google.com, paul.walmsley@sifive.com, paulus@samba.org, tglx@linutronix.de, torvalds@linux-foundation.org, tsbogend@alpha.franken.de, vgupta@synopsys.com, viro@zeniv.linux.org.uk, will@kernel.org, ysato@users.osdn.me
Subject: [patch 103/143] mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
Message-ID: <20210505031626.c8o4WL7KE%akpm@linux-foundation.org>
In-Reply-To: <20210504183219.a3cc46aee4013d77402276c5@linux-foundation.org>
User-Agent: s-nail v14.8.16
X-Gm-Original-To: akpm@linux-foundation.org

From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)

SYS_SUPPORTS_HUGETLBFS config has duplicate definitions on platforms that
subscribe it.  Instead, just make it a generic option which can be
selected on applicable platforms.  Also rename it as
ARCH_SUPPORTS_HUGETLBFS instead.  This reduces code duplication and makes
it cleaner.

Link: https://lkml.kernel.org/r/1617259448-22529-3-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com>	[arm64]
Acked-by: Palmer Dabbelt <palmerdabbelt@google.com>	[riscv]
Acked-by: Michael Ellerman <mpe@ellerman.id.au>		[powerpc]
Cc: Russell King <linux@armlinux.org.uk>
Cc: Will Deacon <will@kernel.org>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com>
Cc: Helge Deller <deller@gmx.de>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Cc: Rich Felker <dalias@libc.org>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/arm/Kconfig                       |    5 +----
 arch/arm64/Kconfig                     |    4 +---
 arch/mips/Kconfig                      |    6 +-----
 arch/parisc/Kconfig                    |    5 +----
 arch/powerpc/Kconfig                   |    3 ---
 arch/powerpc/platforms/Kconfig.cputype |    6 +++---
 arch/riscv/Kconfig                     |    5 +----
 arch/sh/Kconfig                        |    5 +----
 fs/Kconfig                             |    5 ++++-
 9 files changed, 13 insertions(+), 31 deletions(-)

--- a/arch/arm64/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm64/Kconfig
@@ -73,6 +73,7 @@ config ARM64
 	select ARCH_USE_QUEUED_SPINLOCKS
 	select ARCH_USE_SYM_ANNOTATIONS
 	select ARCH_SUPPORTS_DEBUG_PAGEALLOC
+	select ARCH_SUPPORTS_HUGETLBFS
 	select ARCH_SUPPORTS_MEMORY_FAILURE
 	select ARCH_SUPPORTS_SHADOW_CALL_STACK if CC_HAVE_SHADOW_CALL_STACK
 	select ARCH_SUPPORTS_LTO_CLANG if CPU_LITTLE_ENDIAN
@@ -1072,9 +1073,6 @@ config HW_PERF_EVENTS
 	def_bool y
 	depends on ARM_PMU
 
-config SYS_SUPPORTS_HUGETLBFS
-	def_bool y
-
 config ARCH_HAS_FILTER_PGPROT
 	def_bool y
 
--- a/arch/arm/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm/Kconfig
@@ -31,6 +31,7 @@ config ARM
 	select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT if CPU_V7
 	select ARCH_SUPPORTS_ATOMIC_RMW
+	select ARCH_SUPPORTS_HUGETLBFS if ARM_LPAE
 	select ARCH_USE_BUILTIN_BSWAP
 	select ARCH_USE_CMPXCHG_LOCKREF
 	select ARCH_USE_MEMTEST
@@ -1511,10 +1512,6 @@ config HW_PERF_EVENTS
 	def_bool y
 	depends on ARM_PMU
 
-config SYS_SUPPORTS_HUGETLBFS
-       def_bool y
-       depends on ARM_LPAE
-
 config HAVE_ARCH_TRANSPARENT_HUGEPAGE
        def_bool y
        depends on ARM_LPAE
--- a/arch/mips/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/mips/Kconfig
@@ -19,6 +19,7 @@ config MIPS
 	select ARCH_USE_MEMTEST
 	select ARCH_USE_QUEUED_RWLOCKS
 	select ARCH_USE_QUEUED_SPINLOCKS
+	select ARCH_SUPPORTS_HUGETLBFS if CPU_SUPPORTS_HUGEPAGES
 	select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
 	select ARCH_WANT_IPC_PARSE_VERSION
 	select ARCH_WANT_LD_ORPHAN_WARN
@@ -1287,11 +1288,6 @@ config SYS_SUPPORTS_BIG_ENDIAN
 config SYS_SUPPORTS_LITTLE_ENDIAN
 	bool
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-	depends on CPU_SUPPORTS_HUGEPAGES
-	default y
-
 config MIPS_HUGE_TLB_SUPPORT
 	def_bool HUGETLB_PAGE || TRANSPARENT_HUGEPAGE
 
--- a/arch/parisc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/parisc/Kconfig
@@ -12,6 +12,7 @@ config PARISC
 	select ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_HAS_UBSAN_SANITIZE_ALL
 	select ARCH_NO_SG_CHAIN
+	select ARCH_SUPPORTS_HUGETLBFS if PA20
 	select ARCH_SUPPORTS_MEMORY_FAILURE
 	select DMA_OPS
 	select RTC_CLASS
@@ -138,10 +139,6 @@ config PGTABLE_LEVELS
 	default 3 if 64BIT && PARISC_PAGE_SIZE_4KB
 	default 2
 
-config SYS_SUPPORTS_HUGETLBFS
-	def_bool y if PA20
-
-
 menu "Processor type and features"
 
 choice
--- a/arch/powerpc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/Kconfig
@@ -697,9 +697,6 @@ config ARCH_SPARSEMEM_DEFAULT
 	def_bool y
 	depends on PPC_BOOK3S_64
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-
 config ILLEGAL_POINTER_VALUE
 	hex
 	# This is roughly half way between the top of user space and the bottom
--- a/arch/powerpc/platforms/Kconfig.cputype~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/platforms/Kconfig.cputype
@@ -40,8 +40,8 @@ config PPC_85xx
 
 config PPC_8xx
 	bool "Freescale 8xx"
+	select ARCH_SUPPORTS_HUGETLBFS
 	select FSL_SOC
-	select SYS_SUPPORTS_HUGETLBFS
 	select PPC_HAVE_KUEP
 	select PPC_HAVE_KUAP
 	select HAVE_ARCH_VMAP_STACK
@@ -95,9 +95,9 @@ config PPC_BOOK3S_64
 	bool "Server processors"
 	select PPC_FPU
 	select PPC_HAVE_PMU_SUPPORT
-	select SYS_SUPPORTS_HUGETLBFS
 	select HAVE_ARCH_TRANSPARENT_HUGEPAGE
 	select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE
+	select ARCH_SUPPORTS_HUGETLBFS
 	select ARCH_SUPPORTS_NUMA_BALANCING
 	select IRQ_WORK
 	select PPC_MM_SLICES
@@ -278,9 +278,9 @@ config FSL_BOOKE
 # this is for common code between PPC32 & PPC64 FSL BOOKE
 config PPC_FSL_BOOK3E
 	bool
+	select ARCH_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
 	select FSL_EMB_PERFMON
 	select PPC_SMP_MUXED_IPI
-	select SYS_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
 	select PPC_DOORBELL
 	default y if FSL_BOOKE
 
--- a/arch/riscv/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/riscv/Kconfig
@@ -30,6 +30,7 @@ config RISCV
 	select ARCH_HAS_STRICT_KERNEL_RWX if MMU
 	select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT
+	select ARCH_SUPPORTS_HUGETLBFS if MMU
 	select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
 	select ARCH_WANT_FRAME_POINTERS
 	select ARCH_WANT_HUGE_PMD_SHARE if 64BIT
@@ -165,10 +166,6 @@ config ARCH_WANT_GENERAL_HUGETLB
 config ARCH_SUPPORTS_UPROBES
 	def_bool y
 
-config SYS_SUPPORTS_HUGETLBFS
-	depends on MMU
-	def_bool y
-
 config STACKTRACE_SUPPORT
 	def_bool y
 
--- a/arch/sh/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/sh/Kconfig
@@ -101,9 +101,6 @@ config SYS_SUPPORTS_APM_EMULATION
 	bool
 	select ARCH_SUSPEND_POSSIBLE
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-
 config SYS_SUPPORTS_SMP
 	bool
 
@@ -175,12 +172,12 @@ config CPU_SH3
 
 config CPU_SH4
 	bool
+	select ARCH_SUPPORTS_HUGETLBFS if MMU
 	select CPU_HAS_INTEVT
 	select CPU_HAS_SR_RB
 	select CPU_HAS_FPU if !CPU_SH4AL_DSP
 	select SH_INTC
 	select SYS_SUPPORTS_SH_TMU
-	select SYS_SUPPORTS_HUGETLBFS if MMU
 
 config CPU_SH4A
 	bool
--- a/fs/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/fs/Kconfig
@@ -223,10 +223,13 @@ config TMPFS_INODE64
 
 	  If unsure, say N.
 
+config ARCH_SUPPORTS_HUGETLBFS
+	def_bool n
+
 config HUGETLBFS
 	bool "HugeTLB file system support"
 	depends on X86 || IA64 || SPARC64 || (S390 && 64BIT) || \
-		   SYS_SUPPORTS_HUGETLBFS || BROKEN
+		   ARCH_SUPPORTS_HUGETLBFS || BROKEN
 	help
 	  hugetlbfs is a filesystem backing for HugeTLB pages, based on
 	  ramfs. For architectures that support it, say Y here and read
_

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-05-05 17:44       ` incoming Andrew Morton
@ 2021-05-06  3:19         ` Anshuman Khandual
  0 siblings, 0 replies; 232+ messages in thread
From: Anshuman Khandual @ 2021-05-06  3:19 UTC (permalink / raw)
  To: Andrew Morton, Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits



On 5/5/21 11:14 PM, Andrew Morton wrote:
> On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> 
>> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>>> Let me resend right now with the same in-reply-to.  Hopefully they will
>>> land in the correct place.
>> Well, you re-sent it twice, and I have three copies in my own mailbox,
>> bot they still don't show up on the mm-commits mailing list.
>>
>> So the list hates them for some odd reason.
>>
>> I've picked them up locally, but adding Konstantin to the participants
>> to see if he can see what's up.
>>
>> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
>> series of 143. Odd.
> It's weird.  They don't turn up on linux-mm either, and that's running
> at kvack.org, also majordomo.  They don't get through when sent with
> either heirloom-mailx or with sylpheed.
> 
> Also, it seems that when Anshuman originally sent the patch, linux-mm
> and linux-kernel didn't send it back out.  So perhaps a spam filter
> triggered?
> 
> I'm seeing
> 
> https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/
> 
> which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
> server massacred that patch series.  Searching
> https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
> email series.

Yeah these patches faced problem from the very beginning getting
into the MM/LKML list for some strange reason.

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-05-07  1:01 Andrew Morton
  2021-05-07  7:12 ` incoming Linus Torvalds
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-05-07  1:01 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


This is everything else from -mm for this merge window, with the
possible exception of Mike Rapoport's "secretmem" syscall patch series
(https://lkml.kernel.org/r/20210303162209.8609-1-rppt@kernel.org).

I've been wobbly about the secretmem patches due to doubts about
whether the feature is sufficiently useful to justify inclusion, but
developers are now weighing in with helpful information and I've asked Mike
for an extensively updated [0/n] changelog.  This will take a few days
to play out so it is possible that I will prevail upon you for a post-rc1
merge.  If that's a problem, there's always 5.13-rc1.

91 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus
previously sent patches.

Thanks.



Subsystems affected by this patch series:

  alpha
  procfs
  sysctl
  misc
  core-kernel
  bitmap
  lib
  compat
  checkpatch
  epoll
  isofs
  nilfs2
  hpfs
  exit
  fork
  kexec
  gcov
  panic
  delayacct
  gdb
  resource
  selftests
  async
  initramfs
  ipc
  mm/cleanups
  drivers/char
  mm/slub
  spelling

Subsystem: alpha

    Randy Dunlap <rdunlap@infradead.org>:
      alpha: eliminate old-style function definitions
      alpha: csum_partial_copy.c: add function prototypes from <net/checksum.h>

Subsystem: procfs

    Colin Ian King <colin.king@canonical.com>:
      fs/proc/generic.c: fix incorrect pde_is_permanent check

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: save LOC in __xlate_proc_name()
      proc: mandate ->proc_lseek in "struct proc_ops"
      proc: delete redundant subset=pid check
      selftests: proc: test subset=pid

Subsystem: sysctl

    zhouchuangao <zhouchuangao@vivo.com>:
      proc/sysctl: fix function name error in comments

Subsystem: misc

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      include: remove pagemap.h from blkdev.h

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: drop inclusion in bitmap.h

    Wan Jiabing <wanjiabing@vivo.com>:
      linux/profile.h: remove unnecessary declaration

Subsystem: core-kernel

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      kernel/async.c: fix pr_debug statement
      kernel/cred.c: make init_groups static

Subsystem: bitmap

    Yury Norov <yury.norov@gmail.com>:
    Patch series "lib/find_bit: fast path for small bitmaps", v6:
      tools: disable -Wno-type-limits
      tools: bitmap: sync function declarations with the kernel
      tools: sync BITMAP_LAST_WORD_MASK() macro with the kernel
      arch: rearrange headers inclusion order in asm/bitops for m68k, sh and h8300
      lib: extend the scope of small_const_nbits() macro
      tools: sync small_const_nbits() macro with the kernel
      lib: inline _find_next_bit() wrappers
      tools: sync find_next_bit implementation
      lib: add fast path for find_next_*_bit()
      lib: add fast path for find_first_*_bit() and find_last_bit()
      tools: sync lib/find_bit implementation
      MAINTAINERS: add entry for the bitmap API

Subsystem: lib

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      lib/bch.c: fix a typo in the file bch.c

    Wang Qing <wangqing@vivo.com>:
      lib: fix inconsistent indenting in process_bit1()

    ToastC <mrtoastcheng@gmail.com>:
      lib/list_sort.c: fix typo in function description

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      lib/genalloc.c: Fix a typo

    Richard Fitzgerald <rf@opensource.cirrus.com>:
      lib: crc8: pointer to data block should be const

    Zqiang <qiang.zhang@windriver.com>:
      lib: stackdepot: turn depot_lock spinlock to raw_spinlock

    Alex Shi <alexs@kernel.org>:
      lib/percpu_counter: tame kernel-doc compile warning
      lib/genalloc: add parameter description to fix doc compile warning

    Randy Dunlap <rdunlap@infradead.org>:
      lib: parser: clean up kernel-doc

Subsystem: compat

    Masahiro Yamada <masahiroy@kernel.org>:
      include/linux/compat.h: remove unneeded declaration from COMPAT_SYSCALL_DEFINEx()

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: warn when missing newline in return sysfs_emit() formats

    Vincent Mailhol <mailhol.vincent@wanadoo.fr>:
      checkpatch: exclude four preprocessor sub-expressions from MACRO_ARG_REUSE

    Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
      checkpatch: improve ALLOC_ARRAY_ARGS test

Subsystem: epoll

    Davidlohr Bueso <dave@stgolabs.net>:
    Patch series "fs/epoll: restore user-visible behavior upon event ready":
      kselftest: introduce new epoll test case
      fs/epoll: restore waking from ep_done_scan()

Subsystem: isofs

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      isofs: fix fall-through warnings for Clang

Subsystem: nilfs2

    Liu xuzhi <liu.xuzhi@zte.com.cn>:
      fs/nilfs2: fix misspellings using codespell tool

    Lu Jialin <lujialin4@huawei.com>:
      nilfs2: fix typos in comments

Subsystem: hpfs

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      hpfs: replace one-element array with flexible-array member

Subsystem: exit

    Jim Newsome <jnewsome@torproject.org>:
      do_wait: make PIDTYPE_PID case O(1) instead of O(n)

Subsystem: fork

    Rolf Eike Beer <eb@emlix.com>:
      kernel/fork.c: simplify copy_mm()

    Xiaofeng Cao <cxfcosmos@gmail.com>:
      kernel/fork.c: fix typos

Subsystem: kexec

    Saeed Mirzamohammadi <saeed.mirzamohammadi@oracle.com>:
      kernel/crash_core: add crashkernel=auto for vmcore creation

    Joe LeVeque <jolevequ@microsoft.com>:
      kexec: Add kexec reboot string

    Jia-Ju Bai <baijiaju1990@gmail.com>:
      kernel: kexec_file: fix error return code of kexec_calculate_store_digests()

    Pavel Tatashin <pasha.tatashin@soleen.com>:
      kexec: dump kmessage before machine_kexec

Subsystem: gcov

    Johannes Berg <johannes.berg@intel.com>:
      gcov: combine common code
      gcov: simplify buffer allocation
      gcov: use kvmalloc()

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: clang: drop support for clang-10 and older

Subsystem: panic

    He Ying <heying24@huawei.com>:
      smp: kernel/panic.c - silence warnings

Subsystem: delayacct

    Yafang Shao <laoar.shao@gmail.com>:
      delayacct: clear right task's flag after blkio completes

Subsystem: gdb

    Johannes Berg <johannes.berg@intel.com>:
      gdb: lx-symbols: store the abspath()

    Barry Song <song.bao.hua@hisilicon.com>:
    Patch series "scripts/gdb: clarify the platforms supporting lx_current and add arm64 support", v2:
      scripts/gdb: document lx_current is only supported by x86
      scripts/gdb: add lx_current support for arm64

Subsystem: resource

    David Hildenbrand <david@redhat.com>:
    Patch series "kernel/resource: make walk_system_ram_res() and walk_mem_res() search the whole tree", v2:
      kernel/resource: make walk_system_ram_res() find all busy IORESOURCE_SYSTEM_RAM resources
      kernel/resource: make walk_mem_res() find all busy IORESOURCE_MEM resources
      kernel/resource: remove first_lvl / siblings_only logic

    Alistair Popple <apopple@nvidia.com>:
      kernel/resource: allow region_intersects users to hold resource_lock
      kernel/resource: refactor __request_region to allow external locking
      kernel/resource: fix locking in request_free_mem_region

Subsystem: selftests

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      selftests: remove duplicate include

Subsystem: async

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      kernel/async.c: stop guarding pr_debug() statements
      kernel/async.c: remove async_unregister_domain()

Subsystem: initramfs

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
    Patch series "background initramfs unpacking, and CONFIG_MODPROBE_PATH", v3:
      init/initramfs.c: do unpacking asynchronously
      modules: add CONFIG_MODPROBE_PATH

Subsystem: ipc

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ipc/sem.c: mundane typo fixes

Subsystem: mm/cleanups

    Shijie Luo <luoshijie1@huawei.com>:
      mm: fix some typos and code style problems

Subsystem: drivers/char

    David Hildenbrand <david@redhat.com>:
    Patch series "drivers/char: remove /dev/kmem for good":
      drivers/char: remove /dev/kmem for good
      mm: remove xlate_dev_kmem_ptr()
      mm/vmalloc: remove vwrite()

Subsystem: mm/slub

    Maninder Singh <maninder1.s@samsung.com>:
      arm: print alloc free paths for address in registers

Subsystem: spelling

    Drew Fustini <drew@beagleboard.org>:
      scripts/spelling.txt: add "overlfow"

    zuoqilin <zuoqilin@yulong.com>:
      scripts/spelling.txt: Add "diabled" typo

    Drew Fustini <drew@beagleboard.org>:
      scripts/spelling.txt: add "overflw"

    Colin Ian King <colin.king@canonical.com>:
      mm/slab.c: fix spelling mistake "disired" -> "desired"

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      include/linux/pgtable.h: few spelling fixes

    zhouchuangao <zhouchuangao@vivo.com>:
      kernel/umh.c: fix some spelling mistakes

    Xiaofeng Cao <cxfcosmos@gmail.com>:
      kernel/user_namespace.c: fix typos

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      kernel/up.c: fix typo

    Xiaofeng Cao <caoxiaofeng@yulong.com>:
      kernel/sys.c: fix typo

    dingsenjie <dingsenjie@yulong.com>:
      fs: fat: fix spelling typo of values

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ipc/sem.c: spelling fix

    Masahiro Yamada <masahiroy@kernel.org>:
      treewide: remove editor modelines and cruft

    Ingo Molnar <mingo@kernel.org>:
      mm: fix typos in comments

    Lu Jialin <lujialin4@huawei.com>:
      mm: fix typos in comments

 Documentation/admin-guide/devices.txt                         |    2 
 Documentation/admin-guide/kdump/kdump.rst                     |    3 
 Documentation/admin-guide/kernel-parameters.txt               |   18 
 Documentation/dev-tools/gdb-kernel-debugging.rst              |    4 
 MAINTAINERS                                                   |   16 
 arch/Kconfig                                                  |   20 
 arch/alpha/include/asm/io.h                                   |    5 
 arch/alpha/kernel/pc873xx.c                                   |    4 
 arch/alpha/lib/csum_partial_copy.c                            |    1 
 arch/arm/configs/dove_defconfig                               |    1 
 arch/arm/configs/magician_defconfig                           |    1 
 arch/arm/configs/moxart_defconfig                             |    1 
 arch/arm/configs/mps2_defconfig                               |    1 
 arch/arm/configs/mvebu_v5_defconfig                           |    1 
 arch/arm/configs/xcep_defconfig                               |    1 
 arch/arm/include/asm/bug.h                                    |    1 
 arch/arm/include/asm/io.h                                     |    5 
 arch/arm/kernel/process.c                                     |   11 
 arch/arm/kernel/traps.c                                       |    1 
 arch/h8300/include/asm/bitops.h                               |    8 
 arch/hexagon/configs/comet_defconfig                          |    1 
 arch/hexagon/include/asm/io.h                                 |    1 
 arch/ia64/include/asm/io.h                                    |    1 
 arch/ia64/include/asm/uaccess.h                               |   18 
 arch/m68k/atari/time.c                                        |    7 
 arch/m68k/configs/amcore_defconfig                            |    1 
 arch/m68k/include/asm/bitops.h                                |    6 
 arch/m68k/include/asm/io_mm.h                                 |    5 
 arch/mips/include/asm/io.h                                    |    5 
 arch/openrisc/configs/or1ksim_defconfig                       |    1 
 arch/parisc/include/asm/io.h                                  |    5 
 arch/parisc/include/asm/pdc_chassis.h                         |    1 
 arch/powerpc/include/asm/io.h                                 |    5 
 arch/s390/include/asm/io.h                                    |    5 
 arch/sh/configs/edosk7705_defconfig                           |    1 
 arch/sh/configs/se7206_defconfig                              |    1 
 arch/sh/configs/sh2007_defconfig                              |    1 
 arch/sh/configs/sh7724_generic_defconfig                      |    1 
 arch/sh/configs/sh7770_generic_defconfig                      |    1 
 arch/sh/configs/sh7785lcr_32bit_defconfig                     |    1 
 arch/sh/include/asm/bitops.h                                  |    5 
 arch/sh/include/asm/io.h                                      |    5 
 arch/sparc/configs/sparc64_defconfig                          |    1 
 arch/sparc/include/asm/io_64.h                                |    5 
 arch/um/drivers/cow.h                                         |    7 
 arch/xtensa/configs/xip_kc705_defconfig                       |    1 
 block/blk-settings.c                                          |    1 
 drivers/auxdisplay/panel.c                                    |    7 
 drivers/base/firmware_loader/main.c                           |    2 
 drivers/block/brd.c                                           |    1 
 drivers/block/loop.c                                          |    1 
 drivers/char/Kconfig                                          |   10 
 drivers/char/mem.c                                            |  231 --------
 drivers/gpu/drm/qxl/qxl_drv.c                                 |    1 
 drivers/isdn/capi/kcapi_proc.c                                |    1 
 drivers/md/bcache/super.c                                     |    1 
 drivers/media/usb/pwc/pwc-uncompress.c                        |    3 
 drivers/net/ethernet/adaptec/starfire.c                       |    8 
 drivers/net/ethernet/amd/atarilance.c                         |    8 
 drivers/net/ethernet/amd/pcnet32.c                            |    7 
 drivers/net/wireless/intersil/hostap/hostap_proc.c            |    1 
 drivers/net/wireless/intersil/orinoco/orinoco_nortel.c        |    8 
 drivers/net/wireless/intersil/orinoco/orinoco_pci.c           |    8 
 drivers/net/wireless/intersil/orinoco/orinoco_plx.c           |    8 
 drivers/net/wireless/intersil/orinoco/orinoco_tmd.c           |    8 
 drivers/nvdimm/btt.c                                          |    1 
 drivers/nvdimm/pmem.c                                         |    1 
 drivers/parport/parport_ip32.c                                |   12 
 drivers/platform/x86/dell/dell_rbu.c                          |    3 
 drivers/scsi/53c700.c                                         |    1 
 drivers/scsi/53c700.h                                         |    1 
 drivers/scsi/ch.c                                             |    6 
 drivers/scsi/esas2r/esas2r_main.c                             |    1 
 drivers/scsi/ips.c                                            |   20 
 drivers/scsi/ips.h                                            |   20 
 drivers/scsi/lasi700.c                                        |    1 
 drivers/scsi/megaraid/mbox_defs.h                             |    2 
 drivers/scsi/megaraid/mega_common.h                           |    2 
 drivers/scsi/megaraid/megaraid_mbox.c                         |    2 
 drivers/scsi/megaraid/megaraid_mbox.h                         |    2 
 drivers/scsi/qla1280.c                                        |   12 
 drivers/scsi/scsicam.c                                        |    1 
 drivers/scsi/sni_53c710.c                                     |    1 
 drivers/video/fbdev/matrox/matroxfb_base.c                    |    9 
 drivers/video/fbdev/vga16fb.c                                 |   10 
 fs/configfs/configfs_internal.h                               |    4 
 fs/configfs/dir.c                                             |    4 
 fs/configfs/file.c                                            |    4 
 fs/configfs/inode.c                                           |    4 
 fs/configfs/item.c                                            |    4 
 fs/configfs/mount.c                                           |    4 
 fs/configfs/symlink.c                                         |    4 
 fs/eventpoll.c                                                |    6 
 fs/fat/fatent.c                                               |    2 
 fs/hpfs/hpfs.h                                                |    3 
 fs/isofs/rock.c                                               |    1 
 fs/nfs/dir.c                                                  |    7 
 fs/nfs/nfs4proc.c                                             |    6 
 fs/nfs/nfs4renewd.c                                           |    6 
 fs/nfs/nfs4state.c                                            |    6 
 fs/nfs/nfs4xdr.c                                              |    6 
 fs/nfsd/nfs4proc.c                                            |    6 
 fs/nfsd/nfs4xdr.c                                             |    6 
 fs/nfsd/xdr4.h                                                |    6 
 fs/nilfs2/cpfile.c                                            |    2 
 fs/nilfs2/ioctl.c                                             |    4 
 fs/nilfs2/segment.c                                           |    4 
 fs/nilfs2/the_nilfs.c                                         |    2 
 fs/ocfs2/acl.c                                                |    4 
 fs/ocfs2/acl.h                                                |    4 
 fs/ocfs2/alloc.c                                              |    4 
 fs/ocfs2/alloc.h                                              |    4 
 fs/ocfs2/aops.c                                               |    4 
 fs/ocfs2/aops.h                                               |    4 
 fs/ocfs2/blockcheck.c                                         |    4 
 fs/ocfs2/blockcheck.h                                         |    4 
 fs/ocfs2/buffer_head_io.c                                     |    4 
 fs/ocfs2/buffer_head_io.h                                     |    4 
 fs/ocfs2/cluster/heartbeat.c                                  |    4 
 fs/ocfs2/cluster/heartbeat.h                                  |    4 
 fs/ocfs2/cluster/masklog.c                                    |    4 
 fs/ocfs2/cluster/masklog.h                                    |    4 
 fs/ocfs2/cluster/netdebug.c                                   |    4 
 fs/ocfs2/cluster/nodemanager.c                                |    4 
 fs/ocfs2/cluster/nodemanager.h                                |    4 
 fs/ocfs2/cluster/ocfs2_heartbeat.h                            |    4 
 fs/ocfs2/cluster/ocfs2_nodemanager.h                          |    4 
 fs/ocfs2/cluster/quorum.c                                     |    4 
 fs/ocfs2/cluster/quorum.h                                     |    4 
 fs/ocfs2/cluster/sys.c                                        |    4 
 fs/ocfs2/cluster/sys.h                                        |    4 
 fs/ocfs2/cluster/tcp.c                                        |    4 
 fs/ocfs2/cluster/tcp.h                                        |    4 
 fs/ocfs2/cluster/tcp_internal.h                               |    4 
 fs/ocfs2/dcache.c                                             |    4 
 fs/ocfs2/dcache.h                                             |    4 
 fs/ocfs2/dir.c                                                |    4 
 fs/ocfs2/dir.h                                                |    4 
 fs/ocfs2/dlm/dlmapi.h                                         |    4 
 fs/ocfs2/dlm/dlmast.c                                         |    4 
 fs/ocfs2/dlm/dlmcommon.h                                      |    4 
 fs/ocfs2/dlm/dlmconvert.c                                     |    4 
 fs/ocfs2/dlm/dlmconvert.h                                     |    4 
 fs/ocfs2/dlm/dlmdebug.c                                       |    4 
 fs/ocfs2/dlm/dlmdebug.h                                       |    4 
 fs/ocfs2/dlm/dlmdomain.c                                      |    4 
 fs/ocfs2/dlm/dlmdomain.h                                      |    4 
 fs/ocfs2/dlm/dlmlock.c                                        |    4 
 fs/ocfs2/dlm/dlmmaster.c                                      |    4 
 fs/ocfs2/dlm/dlmrecovery.c                                    |    4 
 fs/ocfs2/dlm/dlmthread.c                                      |    4 
 fs/ocfs2/dlm/dlmunlock.c                                      |    4 
 fs/ocfs2/dlmfs/dlmfs.c                                        |    4 
 fs/ocfs2/dlmfs/userdlm.c                                      |    4 
 fs/ocfs2/dlmfs/userdlm.h                                      |    4 
 fs/ocfs2/dlmglue.c                                            |    4 
 fs/ocfs2/dlmglue.h                                            |    4 
 fs/ocfs2/export.c                                             |    4 
 fs/ocfs2/export.h                                             |    4 
 fs/ocfs2/extent_map.c                                         |    4 
 fs/ocfs2/extent_map.h                                         |    4 
 fs/ocfs2/file.c                                               |    4 
 fs/ocfs2/file.h                                               |    4 
 fs/ocfs2/filecheck.c                                          |    4 
 fs/ocfs2/filecheck.h                                          |    4 
 fs/ocfs2/heartbeat.c                                          |    4 
 fs/ocfs2/heartbeat.h                                          |    4 
 fs/ocfs2/inode.c                                              |    4 
 fs/ocfs2/inode.h                                              |    4 
 fs/ocfs2/journal.c                                            |    4 
 fs/ocfs2/journal.h                                            |    4 
 fs/ocfs2/localalloc.c                                         |    4 
 fs/ocfs2/localalloc.h                                         |    4 
 fs/ocfs2/locks.c                                              |    4 
 fs/ocfs2/locks.h                                              |    4 
 fs/ocfs2/mmap.c                                               |    4 
 fs/ocfs2/move_extents.c                                       |    4 
 fs/ocfs2/move_extents.h                                       |    4 
 fs/ocfs2/namei.c                                              |    4 
 fs/ocfs2/namei.h                                              |    4 
 fs/ocfs2/ocfs1_fs_compat.h                                    |    4 
 fs/ocfs2/ocfs2.h                                              |    4 
 fs/ocfs2/ocfs2_fs.h                                           |    4 
 fs/ocfs2/ocfs2_ioctl.h                                        |    4 
 fs/ocfs2/ocfs2_lockid.h                                       |    4 
 fs/ocfs2/ocfs2_lockingver.h                                   |    4 
 fs/ocfs2/refcounttree.c                                       |    4 
 fs/ocfs2/refcounttree.h                                       |    4 
 fs/ocfs2/reservations.c                                       |    4 
 fs/ocfs2/reservations.h                                       |    4 
 fs/ocfs2/resize.c                                             |    4 
 fs/ocfs2/resize.h                                             |    4 
 fs/ocfs2/slot_map.c                                           |    4 
 fs/ocfs2/slot_map.h                                           |    4 
 fs/ocfs2/stack_o2cb.c                                         |    4 
 fs/ocfs2/stack_user.c                                         |    4 
 fs/ocfs2/stackglue.c                                          |    4 
 fs/ocfs2/stackglue.h                                          |    4 
 fs/ocfs2/suballoc.c                                           |    4 
 fs/ocfs2/suballoc.h                                           |    4 
 fs/ocfs2/super.c                                              |    4 
 fs/ocfs2/super.h                                              |    4 
 fs/ocfs2/symlink.c                                            |    4 
 fs/ocfs2/symlink.h                                            |    4 
 fs/ocfs2/sysfile.c                                            |    4 
 fs/ocfs2/sysfile.h                                            |    4 
 fs/ocfs2/uptodate.c                                           |    4 
 fs/ocfs2/uptodate.h                                           |    4 
 fs/ocfs2/xattr.c                                              |    4 
 fs/ocfs2/xattr.h                                              |    4 
 fs/proc/generic.c                                             |   13 
 fs/proc/inode.c                                               |   18 
 fs/proc/proc_sysctl.c                                         |    2 
 fs/reiserfs/procfs.c                                          |   10 
 include/asm-generic/bitops/find.h                             |  108 +++
 include/asm-generic/bitops/le.h                               |   38 +
 include/asm-generic/bitsperlong.h                             |   12 
 include/asm-generic/io.h                                      |   11 
 include/linux/align.h                                         |   15 
 include/linux/async.h                                         |    1 
 include/linux/bitmap.h                                        |   11 
 include/linux/bitops.h                                        |   12 
 include/linux/blkdev.h                                        |    1 
 include/linux/compat.h                                        |    1 
 include/linux/configfs.h                                      |    4 
 include/linux/crc8.h                                          |    2 
 include/linux/cred.h                                          |    1 
 include/linux/delayacct.h                                     |   20 
 include/linux/fs.h                                            |    2 
 include/linux/genl_magic_func.h                               |    1 
 include/linux/genl_magic_struct.h                             |    1 
 include/linux/gfp.h                                           |    2 
 include/linux/init_task.h                                     |    1 
 include/linux/initrd.h                                        |    2 
 include/linux/kernel.h                                        |    9 
 include/linux/mm.h                                            |    2 
 include/linux/mmzone.h                                        |    2 
 include/linux/pgtable.h                                       |   10 
 include/linux/proc_fs.h                                       |    1 
 include/linux/profile.h                                       |    3 
 include/linux/smp.h                                           |    8 
 include/linux/swap.h                                          |    1 
 include/linux/vmalloc.h                                       |    7 
 include/uapi/linux/if_bonding.h                               |   11 
 include/uapi/linux/nfs4.h                                     |    6 
 include/xen/interface/elfnote.h                               |   10 
 include/xen/interface/hvm/hvm_vcpu.h                          |   10 
 include/xen/interface/io/xenbus.h                             |   10 
 init/Kconfig                                                  |   12 
 init/initramfs.c                                              |   38 +
 init/main.c                                                   |    1 
 ipc/sem.c                                                     |   12 
 kernel/async.c                                                |   68 --
 kernel/configs/android-base.config                            |    1 
 kernel/crash_core.c                                           |    7 
 kernel/cred.c                                                 |    2 
 kernel/exit.c                                                 |   67 ++
 kernel/fork.c                                                 |   23 
 kernel/gcov/Kconfig                                           |    1 
 kernel/gcov/base.c                                            |   49 +
 kernel/gcov/clang.c                                           |  282 ----------
 kernel/gcov/fs.c                                              |  146 ++++-
 kernel/gcov/gcc_4_7.c                                         |  173 ------
 kernel/gcov/gcov.h                                            |   14 
 kernel/kexec_core.c                                           |    4 
 kernel/kexec_file.c                                           |    4 
 kernel/kmod.c                                                 |    2 
 kernel/resource.c                                             |  198 ++++---
 kernel/sys.c                                                  |   14 
 kernel/umh.c                                                  |    8 
 kernel/up.c                                                   |    2 
 kernel/user_namespace.c                                       |    6 
 lib/bch.c                                                     |    2 
 lib/crc8.c                                                    |    2 
 lib/decompress_unlzma.c                                       |    2 
 lib/find_bit.c                                                |   68 --
 lib/genalloc.c                                                |    7 
 lib/list_sort.c                                               |    2 
 lib/parser.c                                                  |   61 +-
 lib/percpu_counter.c                                          |    2 
 lib/stackdepot.c                                              |    6 
 mm/balloon_compaction.c                                       |    4 
 mm/compaction.c                                               |    4 
 mm/filemap.c                                                  |    2 
 mm/gup.c                                                      |    2 
 mm/highmem.c                                                  |    2 
 mm/huge_memory.c                                              |    6 
 mm/hugetlb.c                                                  |    6 
 mm/internal.h                                                 |    2 
 mm/kasan/kasan.h                                              |    8 
 mm/kasan/quarantine.c                                         |    4 
 mm/kasan/shadow.c                                             |    4 
 mm/kfence/report.c                                            |    2 
 mm/khugepaged.c                                               |    2 
 mm/ksm.c                                                      |    6 
 mm/madvise.c                                                  |    4 
 mm/memcontrol.c                                               |   18 
 mm/memory-failure.c                                           |    2 
 mm/memory.c                                                   |   18 
 mm/mempolicy.c                                                |    6 
 mm/migrate.c                                                  |    8 
 mm/mmap.c                                                     |    4 
 mm/mprotect.c                                                 |    2 
 mm/mremap.c                                                   |    2 
 mm/nommu.c                                                    |   10 
 mm/oom_kill.c                                                 |    2 
 mm/page-writeback.c                                           |    4 
 mm/page_alloc.c                                               |   16 
 mm/page_owner.c                                               |    2 
 mm/page_vma_mapped.c                                          |    2 
 mm/percpu-internal.h                                          |    2 
 mm/percpu.c                                                   |    2 
 mm/pgalloc-track.h                                            |    6 
 mm/rmap.c                                                     |    2 
 mm/slab.c                                                     |    8 
 mm/slub.c                                                     |    2 
 mm/swap.c                                                     |    4 
 mm/swap_slots.c                                               |    2 
 mm/swap_state.c                                               |    2 
 mm/vmalloc.c                                                  |  124 ----
 mm/vmstat.c                                                   |    2 
 mm/z3fold.c                                                   |    2 
 mm/zpool.c                                                    |    2 
 mm/zsmalloc.c                                                 |    6 
 samples/configfs/configfs_sample.c                            |    2 
 scripts/checkpatch.pl                                         |   15 
 scripts/gdb/linux/cpus.py                                     |   23 
 scripts/gdb/linux/symbols.py                                  |    3 
 scripts/spelling.txt                                          |    3 
 tools/include/asm-generic/bitops/find.h                       |   85 ++-
 tools/include/asm-generic/bitsperlong.h                       |    3 
 tools/include/linux/bitmap.h                                  |   18 
 tools/lib/bitmap.c                                            |    4 
 tools/lib/find_bit.c                                          |   56 -
 tools/scripts/Makefile.include                                |    1 
 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c |   44 +
 tools/testing/selftests/kvm/lib/sparsebit.c                   |    1 
 tools/testing/selftests/mincore/mincore_selftest.c            |    1 
 tools/testing/selftests/powerpc/mm/tlbie_test.c               |    1 
 tools/testing/selftests/proc/Makefile                         |    1 
 tools/testing/selftests/proc/proc-subset-pid.c                |  121 ++++
 tools/testing/selftests/proc/read.c                           |    4 
 tools/usb/hcd-tests.sh                                        |    2 
 343 files changed, 1383 insertions(+), 2119 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-05-07  1:01 incoming Andrew Morton
@ 2021-05-07  7:12 ` Linus Torvalds
  0 siblings, 0 replies; 232+ messages in thread
From: Linus Torvalds @ 2021-05-07  7:12 UTC (permalink / raw)
  To: Andrew Morton; +Cc: mm-commits, Linux-MM

On Thu, May 6, 2021 at 6:01 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> I've been wobbly about the secretmem patches due to doubts about
> whether the feature is sufficiently useful to justify inclusion, but
> developers are now weighing in with helpful information and I've asked Mike
> for an extensively updated [0/n] changelog.  This will take a few days
> to play out so it is possible that I will prevail upon you for a post-rc1
> merge.

Oh, much too late for this release by now.

> If that's a problem, there's always 5.13-rc1.

5.13-rc1 is two days from now, it would be for 5.14-rc1.. How time -
and version numbers - fly.

             Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-05-15  0:26 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-05-15  0:26 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

13 patches, based on bd3c9cdb21a2674dd0db70199df884828e37abd4.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/slub
  resource
  squashfs
  mm/userfaultfd
  mm/ksm
  mm/pagealloc
  mm/kasan
  mm/pagemap
  hfsplus
  modprobe
  mm/ioremap

Subsystem: mm/hugetlb

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/hugetlb: Fix issues on file sealing and fork", v2:
      mm/hugetlb: fix F_SEAL_FUTURE_WRITE
      mm/hugetlb: fix cow where page writtable in child

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: move slub_debug static key enabling outside slab_mutex

Subsystem: resource

    Alistair Popple <apopple@nvidia.com>:
      kernel/resource: fix return code check in __request_free_mem_region

Subsystem: squashfs

    Phillip Lougher <phillip@squashfs.org.uk>:
      squashfs: fix divide error in calculate_skip()

Subsystem: mm/userfaultfd

    Axel Rasmussen <axelrasmussen@google.com>:
      userfaultfd: release page in error path to avoid BUG_ON

Subsystem: mm/ksm

    Hugh Dickins <hughd@google.com>:
      ksm: revert "use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()"

Subsystem: mm/pagealloc

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: fix struct page layout on 32-bit systems

Subsystem: mm/kasan

    Peter Collingbourne <pcc@google.com>:
      kasan: fix unit tests with CONFIG_UBSAN_LOCAL_BOUNDS enabled

Subsystem: mm/pagemap

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/filemap: fix readahead return types

Subsystem: hfsplus

    Jouni Roivas <jouni.roivas@tuxera.com>:
      hfsplus: prevent corruption in shrinking truncate

Subsystem: modprobe

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      docs: admin-guide: update description for kernel.modprobe sysctl

Subsystem: mm/ioremap

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm/ioremap: fix iomap_max_page_shift

 Documentation/admin-guide/sysctl/kernel.rst |    9 ++++---
 fs/hfsplus/extents.c                        |    7 +++--
 fs/hugetlbfs/inode.c                        |    5 ++++
 fs/iomap/buffered-io.c                      |    4 +--
 fs/squashfs/file.c                          |    6 ++--
 include/linux/mm.h                          |   32 ++++++++++++++++++++++++++
 include/linux/mm_types.h                    |    4 +--
 include/linux/pagemap.h                     |    6 ++--
 include/net/page_pool.h                     |   12 +++++++++
 kernel/resource.c                           |    2 -
 lib/test_kasan.c                            |   29 ++++++++++++++++++-----
 mm/hugetlb.c                                |    1 
 mm/ioremap.c                                |    6 ++--
 mm/ksm.c                                    |    3 +-
 mm/shmem.c                                  |   34 ++++++++++++----------------
 mm/slab_common.c                            |   10 ++++++++
 mm/slub.c                                   |    9 -------
 net/core/page_pool.c                        |   12 +++++----
 18 files changed, 129 insertions(+), 62 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-05-23  0:41 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-05-23  0:41 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

10 patches, based on 4ff2473bdb4cf2bb7d208ccf4418d3d7e6b1652c.

Subsystems affected by this patch series:

  mm/pagealloc
  mm/gup
  ipc
  selftests
  mm/kasan
  kernel/watchdog
  bitmap
  procfs
  lib
  mm/userfaultfd

Subsystem: mm/pagealloc

    Arnd Bergmann <arnd@arndb.de>:
      mm/shuffle: fix section mismatch warning

Subsystem: mm/gup

    Michal Hocko <mhocko@suse.com>:
      Revert "mm/gup: check page posion status for coredump."

Subsystem: ipc

    Varad Gautam <varad.gautam@suse.com>:
      ipc/mqueue, msg, sem: avoid relying on a stack reference past its expiry

Subsystem: selftests

    Yang Yingliang <yangyingliang@huawei.com>:
      tools/testing/selftests/exec: fix link error

Subsystem: mm/kasan

    Alexander Potapenko <glider@google.com>:
      kasan: slab: always reset the tag in get_freepointer_safe()

Subsystem: kernel/watchdog

    Petr Mladek <pmladek@suse.com>:
      watchdog: reliable handling of timestamps

Subsystem: bitmap

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      linux/bits.h: fix compilation error with GENMASK

Subsystem: procfs

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: remove Alexey from MAINTAINERS

Subsystem: lib

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib: kunit: suppress a compilation warning of frame size

Subsystem: mm/userfaultfd

    Mike Kravetz <mike.kravetz@oracle.com>:
      userfaultfd: hugetlbfs: fix new flag usage in error path

 MAINTAINERS                           |    1 -
 fs/hugetlbfs/inode.c                  |    2 +-
 include/linux/bits.h                  |    2 +-
 include/linux/const.h                 |    8 ++++++++
 include/linux/minmax.h                |   10 ++--------
 ipc/mqueue.c                          |    6 ++++--
 ipc/msg.c                             |    6 ++++--
 ipc/sem.c                             |    6 ++++--
 kernel/watchdog.c                     |   34 ++++++++++++++++++++--------------
 lib/Makefile                          |    1 +
 mm/gup.c                              |    4 ----
 mm/internal.h                         |   20 --------------------
 mm/shuffle.h                          |    4 ++--
 mm/slub.c                             |    1 +
 mm/userfaultfd.c                      |   28 ++++++++++++++--------------
 tools/include/linux/bits.h            |    2 +-
 tools/include/linux/const.h           |    8 ++++++++
 tools/testing/selftests/exec/Makefile |    6 +++---
 18 files changed, 74 insertions(+), 75 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-06-05  3:00 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-06-05  3:00 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

13 patches, based on 16f0596fc1d78a1f3ae4628cff962bb297dc908c.

Subsystems affected by this patch series:

  mips
  mm/kfence
  init
  mm/debug
  mm/pagealloc
  mm/memory-hotplug
  mm/hugetlb
  proc
  mm/kasan
  mm/hugetlb
  lib
  ocfs2
  mailmap

Subsystem: mips

    Thomas Bogendoerfer <tsbogend@alpha.franken.de>:
      Revert "MIPS: make userspace mapping young by default"

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: use TASK_IDLE when awaiting allocation

Subsystem: init

    Mark Rutland <mark.rutland@arm.com>:
      pid: take a reference when initializing `cad_pid`

Subsystem: mm/debug

    Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
      mm/debug_vm_pgtable: fix alignment for pmd/pud_advanced_tests()

Subsystem: mm/pagealloc

    Ding Hui <dinghui@sangfor.com.cn>:
      mm/page_alloc: fix counting of free pages after take off from buddy

Subsystem: mm/memory-hotplug

    David Hildenbrand <david@redhat.com>:
      drivers/base/memory: fix trying offlining memory blocks with memory holes on aarch64

Subsystem: mm/hugetlb

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      hugetlb: pass head page to remove_hugetlb_page()

Subsystem: proc

    David Matlack <dmatlack@google.com>:
      proc: add .gitignore for proc-subset-pid selftest

Subsystem: mm/kasan

    Yu Kuai <yukuai3@huawei.com>:
      mm/kasan/init.c: fix doc warning

Subsystem: mm/hugetlb

    Mina Almasry <almasrymina@google.com>:
      mm, hugetlb: fix simple resv_huge_pages underflow on UFFDIO_COPY

Subsystem: lib

    YueHaibing <yuehaibing@huawei.com>:
      lib: crc64: fix kernel-doc warning

Subsystem: ocfs2

    Junxiao Bi <junxiao.bi@oracle.com>:
      ocfs2: fix data corruption by fallocate

Subsystem: mailmap

    Michel Lespinasse <michel@lespinasse.org>:
      mailmap: use private address for Michel Lespinasse

 .mailmap                                |    3 +
 arch/mips/mm/cache.c                    |   30 ++++++++---------
 drivers/base/memory.c                   |    6 +--
 fs/ocfs2/file.c                         |   55 +++++++++++++++++++++++++++++---
 include/linux/pgtable.h                 |    8 ++++
 init/main.c                             |    2 -
 lib/crc64.c                             |    2 -
 mm/debug_vm_pgtable.c                   |    4 +-
 mm/hugetlb.c                            |   16 +++++++--
 mm/kasan/init.c                         |    4 +-
 mm/kfence/core.c                        |    6 +--
 mm/memory.c                             |    4 ++
 mm/page_alloc.c                         |    2 +
 tools/testing/selftests/proc/.gitignore |    1 
 14 files changed, 107 insertions(+), 36 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-06-16  1:22 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-06-16  1:22 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


18 patches, based on 94f0b2d4a1d0c52035aef425da5e022bd2cb1c71.

Subsystems affected by this patch series:

  mm/memory-failure
  mm/swap
  mm/slub
  mm/hugetlb
  mm/memory-failure
  coredump
  mm/slub
  mm/thp
  mm/sparsemem

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm,hwpoison: fix race with hugetlb page allocation

Subsystem: mm/swap

    Peter Xu <peterx@redhat.com>:
      mm/swap: fix pte_same_as_swp() not removing uffd-wp bit when compare

Subsystem: mm/slub

    Kees Cook <keescook@chromium.org>:
    Patch series "Actually fix freelist pointer vs redzoning", v4:
      mm/slub: clarify verification reporting
      mm/slub: fix redzoning for small allocations
      mm/slub: actually fix freelist pointer vs redzoning

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      mm/hugetlb: expand restore_reserve_on_error functionality

Subsystem: mm/memory-failure

    yangerkun <yangerkun@huawei.com>:
      mm/memory-failure: make sure wait for page writeback in memory_failure

Subsystem: coredump

    Pingfan Liu <kernelfans@gmail.com>:
      crash_core, vmcoreinfo: append 'SECTION_SIZE_BITS' to vmcoreinfo

Subsystem: mm/slub

    Andrew Morton <akpm@linux-foundation.org>:
      mm/slub.c: include swab.h

Subsystem: mm/thp

    Xu Yu <xuyu@linux.alibaba.com>:
      mm, thp: use head page in __migration_entry_wait()

    Hugh Dickins <hughd@google.com>:
    Patch series "mm/thp: fix THP splitting unmap BUGs and related", v10:
      mm/thp: fix __split_huge_pmd_locked() on shmem migration entry
      mm/thp: make is_huge_zero_pmd() safe and quicker
      mm/thp: try_to_unmap() use TTU_SYNC for safe splitting
      mm/thp: fix vma_address() if virtual address below file offset

    Jue Wang <juew@google.com>:
      mm/thp: fix page_address_in_vma() on file THP tails

    Hugh Dickins <hughd@google.com>:
      mm/thp: unmap_mapping_page() to fix THP truncate_cleanup_page()

    Yang Shi <shy828301@gmail.com>:
      mm: thp: replace DEBUG_VM BUG with VM_WARN when unmap fails for split

Subsystem: mm/sparsemem

    Miles Chen <miles.chen@mediatek.com>:
      mm/sparse: fix check_usemap_section_nr warnings

 Documentation/vm/slub.rst |   10 +--
 fs/hugetlbfs/inode.c      |    1 
 include/linux/huge_mm.h   |    8 ++
 include/linux/hugetlb.h   |    8 ++
 include/linux/mm.h        |    3 +
 include/linux/rmap.h      |    1 
 include/linux/swapops.h   |   15 +++--
 kernel/crash_core.c       |    1 
 mm/huge_memory.c          |   58 ++++++++++---------
 mm/hugetlb.c              |  137 +++++++++++++++++++++++++++++++++++++---------
 mm/internal.h             |   51 ++++++++++++-----
 mm/memory-failure.c       |   36 +++++++++++-
 mm/memory.c               |   41 +++++++++++++
 mm/migrate.c              |    1 
 mm/page_vma_mapped.c      |   27 +++++----
 mm/pgtable-generic.c      |    5 -
 mm/rmap.c                 |   41 +++++++++----
 mm/slab_common.c          |    3 -
 mm/slub.c                 |   37 +++++-------
 mm/sparse.c               |   13 +++-
 mm/swapfile.c             |    2 
 mm/truncate.c             |   43 ++++++--------
 22 files changed, 388 insertions(+), 154 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-06-25  1:38 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-06-25  1:38 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

24 patches, based on 4a09d388f2ab382f217a764e6a152b3f614246f6.

Subsystems affected by this patch series:

  mm/thp
  nilfs2
  mm/vmalloc
  kthread
  mm/hugetlb
  mm/memory-failure
  mm/pagealloc
  MAINTAINERS
  mailmap

Subsystem: mm/thp

    Hugh Dickins <hughd@google.com>:
    Patch series "mm: page_vma_mapped_walk() cleanup and THP fixes":
      mm: page_vma_mapped_walk(): use page for pvmw->page
      mm: page_vma_mapped_walk(): settle PageHuge on entry
      mm: page_vma_mapped_walk(): use pmde for *pvmw->pmd
      mm: page_vma_mapped_walk(): prettify PVMW_MIGRATION block
      mm: page_vma_mapped_walk(): crossing page table boundary
      mm: page_vma_mapped_walk(): add a level of indentation
      mm: page_vma_mapped_walk(): use goto instead of while (1)
      mm: page_vma_mapped_walk(): get vma_address_end() earlier
      mm/thp: fix page_vma_mapped_walk() if THP mapped by ptes
      mm/thp: another PVMW_SYNC fix in page_vma_mapped_walk()

Subsystem: nilfs2

    Pavel Skripkin <paskripkin@gmail.com>:
      nilfs2: fix memory leak in nilfs_sysfs_delete_device_group

Subsystem: mm/vmalloc

    Claudio Imbrenda <imbrenda@linux.ibm.com>:
    Patch series "mm: add vmalloc_no_huge and use it", v4:
      mm/vmalloc: add vmalloc_no_huge
      KVM: s390: prepare for hugepage vmalloc

    Daniel Axtens <dja@axtens.net>:
      mm/vmalloc: unbreak kasan vmalloc support

Subsystem: kthread

    Petr Mladek <pmladek@suse.com>:
    Patch series "kthread_worker: Fix race between kthread_mod_delayed_work():
      kthread_worker: split code for canceling the delayed work timer
      kthread: prevent deadlock when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync()

Subsystem: mm/hugetlb

    Hugh Dickins <hughd@google.com>:
      mm, futex: fix shared futex pgoff on shmem huge page

Subsystem: mm/memory-failure

    Tony Luck <tony.luck@intel.com>:
    Patch series "mm,hwpoison: fix sending SIGBUS for Action Required MCE", v5:
      mm/memory-failure: use a mutex to avoid memory_failure() races

    Aili Yao <yaoaili@kingsoft.com>:
      mm,hwpoison: return -EHWPOISON to denote that the page has already been poisoned

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/hwpoison: do not lock page again when me_huge_page() successfully recovers

Subsystem: mm/pagealloc

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      mm/page_alloc: __alloc_pages_bulk(): do bounds check before accessing array

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: do bulk array bounds check after checking populated elements

Subsystem: MAINTAINERS

    Marek Behún <kabel@kernel.org>:
      MAINTAINERS: fix Marek's identity again

Subsystem: mailmap

    Marek Behún <kabel@kernel.org>:
      mailmap: add Marek's other e-mail address and identity without diacritics

 .mailmap                |    2 
 MAINTAINERS             |    4 
 arch/s390/kvm/pv.c      |    7 +
 fs/nilfs2/sysfs.c       |    1 
 include/linux/hugetlb.h |   16 ---
 include/linux/pagemap.h |   13 +-
 include/linux/vmalloc.h |    1 
 kernel/futex.c          |    3 
 kernel/kthread.c        |   81 ++++++++++------
 mm/hugetlb.c            |    5 -
 mm/memory-failure.c     |   83 +++++++++++------
 mm/page_alloc.c         |    6 +
 mm/page_vma_mapped.c    |  233 +++++++++++++++++++++++++++---------------------
 mm/vmalloc.c            |   41 ++++++--
 14 files changed, 297 insertions(+), 199 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-06-29  2:32 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-06-29  2:32 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2.

Subsystems affected by this patch series:

  mm/gup
  mm/pagealloc
  kthread
  ia64
  scripts
  ntfs
  squashfs
  ocfs2
  z
  kernel/watchdog
  mm/slab
  mm/slub
  mm/kmemleak
  mm/dax
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/memcg
  mm/pagemap
  mm/mprotect
  mm/bootmem
  mm/dma
  mm/tracing
  mm/vmalloc
  mm/kasan
  mm/initialization
  mm/pagealloc
  mm/memory-failure

Subsystem: mm/gup

    Jann Horn <jannh@google.com>:
      mm/gup: fix try_grab_compound_head() race with split_huge_page()

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/page_alloc: fix memory map initialization for descending nodes

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: correct return value of populated elements if bulk array is populated

Subsystem: kthread

    Jonathan Neuschäfer <j.neuschaefer@gmx.net>:
      kthread: switch to new kerneldoc syntax for named variable macro argument

    Petr Mladek <pmladek@suse.com>:
      kthread_worker: fix return value when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync()

Subsystem: ia64

    Randy Dunlap <rdunlap@infradead.org>:
      ia64: headers: drop duplicated words

    Arnd Bergmann <arnd@arndb.de>:
      ia64: mca_drv: fix incorrect array size calculation

Subsystem: scripts

    "Steven Rostedt (VMware)" <rostedt@goodmis.org>:
    Patch series "streamline_config.pl: Fix Perl spacing":
      streamline_config.pl: make spacing consistent
      streamline_config.pl: add softtabstop=4 for vim users

    Colin Ian King <colin.king@canonical.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

Subsystem: ntfs

    Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>:
      ntfs: fix validity check for file name attribute

Subsystem: squashfs

    Vincent Whitchurch <vincent.whitchurch@axis.com>:
      squashfs: add option to panic on errors

Subsystem: ocfs2

    Yang Yingliang <yangyingliang@huawei.com>:
      ocfs2: remove unnecessary INIT_LIST_HEAD()

Subsystem: z

    Dan Carpenter <dan.carpenter@oracle.com>:
      ocfs2: fix snprintf() checking

    Colin Ian King <colin.king@canonical.com>:
      ocfs2: remove redundant assignment to pointer queue

    Wan Jiabing <wanjiabing@vivo.com>:
      ocfs2: remove repeated uptodate check for buffer

    Chen Huang <chenhuang5@huawei.com>:
      ocfs2: replace simple_strtoull() with kstrtoull()

    Colin Ian King <colin.king@canonical.com>:
      ocfs2: remove redundant initialization of variable ret

Subsystem: kernel/watchdog

    Wang Qing <wangqing@vivo.com>:
      kernel: watchdog: modify the explanation related to watchdog thread
      doc: watchdog: modify the explanation related to watchdog thread
      doc: watchdog: modify the doc related to "watchdog/%u"

Subsystem: mm/slab

    gumingtao <gumingtao1225@gmail.com>:
      slab: use __func__ to trace function name

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      kunit: make test->lock irq safe

    Oliver Glitta <glittao@gmail.com>:
      mm/slub, kunit: add a KUnit test for SLUB debugging functionality
      slub: remove resiliency_test() function

    Hyeonggon Yoo <42.hyeyoo@gmail.com>:
      mm, slub: change run-time assertion in kmalloc_index() to compile-time

    Stephen Boyd <swboyd@chromium.org>:
      slub: restore slub_debug=- behavior
      slub: actually use 'message' in restore_bytes()

    Joe Perches <joe@perches.com>:
      slub: indicate slab_fix() uses printf formats

    Stephen Boyd <swboyd@chromium.org>:
      slub: force on no_hash_pointers when slub_debug is enabled

    Faiyaz Mohammed <faiyazm@codeaurora.org>:
      mm: slub: move sysfs slab alloc/free interfaces to debugfs

    Georgi Djakov <quic_c_gdjako@quicinc.com>:
      mm/slub: add taint after the errors are printed

Subsystem: mm/kmemleak

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/kmemleak: fix possible wrong memory scanning period

Subsystem: mm/dax

    Jan Kara <jack@suse.cz>:
      dax: fix ENOMEM handling in grab_mapping_entry()

Subsystem: mm/debug

    Tang Bin <tangbin@cmss.chinamobile.com>:
      tools/vm/page_owner_sort.c: check malloc() return

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/debug_vm_pgtable: ensure THP availability via has_transparent_hugepage()

    Nicolas Saenz Julienne <nsaenzju@redhat.com>:
      mm: mmap_lock: use local locks instead of disabling preemption

    Gavin Shan <gshan@redhat.com>:
    Patch series "mm/page_reporting: Make page reporting work on arm64 with 64KB page size", v4:
      mm/page_reporting: fix code style in __page_reporting_request()
      mm/page_reporting: export reporting order as module parameter
      mm/page_reporting: allow driver to specify reporting order
      virtio_balloon: specify page reporting order if needed

Subsystem: mm/pagecache

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: page-writeback: kill get_writeback_state() comments

    Chi Wu <wuchi.zero@gmail.com>:
      mm/page-writeback: Fix performance when BDI's share of ratio is 0.
      mm/page-writeback: update the comment of Dirty position control
      mm/page-writeback: use __this_cpu_inc() in account_page_dirtied()

    Roman Gushchin <guro@fb.com>:
    Patch series "cgroup, blkcg: prevent dirty inodes to pin dying memory cgroups", v9:
      writeback, cgroup: do not switch inodes with I_WILL_FREE flag
      writeback, cgroup: add smp_mb() to cgroup_writeback_umount()
      writeback, cgroup: increment isw_nr_in_flight before grabbing an inode
      writeback, cgroup: switch to rcu_work API in inode_switch_wbs()
      writeback, cgroup: keep list of inodes attached to bdi_writeback
      writeback, cgroup: split out the functional part of inode_switch_wbs_work_fn()
      writeback, cgroup: support switching multiple inodes at once
      writeback, cgroup: release dying cgwbs by switching attached inodes

    Christoph Hellwig <hch@lst.de>:
    Patch series "remove the implicit .set_page_dirty default":
      fs: unexport __set_page_dirty
      fs: move ramfs_aops to libfs
      mm: require ->set_page_dirty to be explicitly wired up

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Further set_page_dirty cleanups":
      mm/writeback: move __set_page_dirty() to core mm
      mm/writeback: use __set_page_dirty in __set_page_dirty_nobuffers
      iomap: use __set_page_dirty_nobuffers
      fs: remove anon_set_page_dirty()
      fs: remove noop_set_page_dirty()
      mm: move page dirtying prototypes from mm.h

Subsystem: mm/gup

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/gup: Fix pin page write cache bouncing on has_pinned", v2:
      mm/gup_benchmark: support threading

    Andrea Arcangeli <aarcange@redhat.com>:
      mm: gup: allow FOLL_PIN to scale in SMP
      mm: gup: pack has_pinned in MMF_HAS_PINNED

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm: pagewalk: fix walk for hugepage tables

Subsystem: mm/swap

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "close various race windows for swap", v6:
      mm/swapfile: use percpu_ref to serialize against concurrent swapoff
      swap: fix do_swap_page() race with swapoff
      mm/swap: remove confusing checking for non_swap_entry() in swap_ra_info()
      mm/shmem: fix shmem_swapin() race with swapoff
    Patch series "Cleanups for swap", v2:
      mm/swapfile: move get_swap_page_of_type() under CONFIG_HIBERNATION
      mm/swap: remove unused local variable nr_shadows
      mm/swap_slots.c: delete meaningless forward declarations

    Huang Ying <ying.huang@intel.com>:
      mm, swap: remove unnecessary smp_rmb() in swap_type_to_swap_info()
      mm: free idle swap cache page after COW
      swap: check mapping_empty() for swap cache before being freed

Subsystem: mm/memcg

    Waiman Long <longman@redhat.com>:
    Patch series "mm/memcg: Reduce kmemcache memory accounting overhead", v6:
      mm/memcg: move mod_objcg_state() to memcontrol.c
      mm/memcg: cache vmstat data in percpu memcg_stock_pcp
      mm/memcg: improve refill_obj_stock() performance
      mm/memcg: optimize user context object stock access
    Patch series "mm: memcg/slab: Fix objcg pointer array handling problem", v4:
      mm: memcg/slab: properly set up gfp flags for objcg pointer array
      mm: memcg/slab: create a new set of kmalloc-cg-<n> caches
      mm: memcg/slab: disable cache merging for KMALLOC_NORMAL caches

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix root_mem_cgroup charging
    Patch series "memcontrol code cleanup and simplification", v3:
      mm: memcontrol: fix page charging in page replacement
      mm: memcontrol: bail out early when !mm in get_mem_cgroup_from_mm
      mm: memcontrol: remove the pgdata parameter of mem_cgroup_page_lruvec
      mm: memcontrol: simplify lruvec_holds_page_lru_lock
      mm: memcontrol: rename lruvec_holds_page_lru_lock to page_matches_lruvec
      mm: memcontrol: simplify the logic of objcg pinning memcg
      mm: memcontrol: move obj_cgroup_uncharge_pages() out of css_set_lock
      mm: vmscan: remove noinline_for_stack

    wenhuizhang <wenhui@gwmail.gwu.edu>:
      memcontrol: use flexible-array member

    Dan Schatzberg <schatzberg.dan@gmail.com>:
    Patch series "Charge loop device i/o to issuing cgroup", v14:
      loop: use worker per cgroup instead of kworker
      mm: charge active memcg when no mm is set
      loop: charge i/o to mem and blk cg

    Huilong Deng <denghuilong@cdjrlc.com>:
      mm: memcontrol: remove trailing semicolon in macros

Subsystem: mm/pagemap

    David Hildenbrand <david@redhat.com>:
    Patch series "perf/binfmt/mm: remove in-tree usage of MAP_EXECUTABLE":
      perf: MAP_EXECUTABLE does not indicate VM_MAYEXEC
      binfmt: remove in-tree usage of MAP_EXECUTABLE
      mm: ignore MAP_EXECUTABLE in ksys_mmap_pgoff()

    Gonzalo Matias Juarez Tello <gmjuareztello@gmail.com>:
      mm/mmap.c: logic of find_vma_intersection repeated in __do_munmap

    Liam Howlett <liam.howlett@oracle.com>:
      mm/mmap: introduce unlock_range() for code cleanup
      mm/mmap: use find_vma_intersection() in do_mmap() for overlap

    Liu Xiang <liu.xiang@zlingsmart.com>:
      mm/memory.c: fix comment of finish_mkwrite_fault()

    Liam Howlett <liam.howlett@oracle.com>:
    Patch series "mm: Add vma_lookup()", v2:
      mm: add vma_lookup(), update find_vma_intersection() comments
      drm/i915/selftests: use vma_lookup() in __igt_mmap()
      arch/arc/kernel/troubleshoot: use vma_lookup() instead of find_vma()
      arch/arm64/kvm: use vma_lookup() instead of find_vma_intersection()
      arch/powerpc/kvm/book3s_hv_uvmem: use vma_lookup() instead of find_vma_intersection()
      arch/powerpc/kvm/book3s: use vma_lookup() in kvmppc_hv_setup_htab_rma()
      arch/mips/kernel/traps: use vma_lookup() instead of find_vma()
      arch/m68k/kernel/sys_m68k: use vma_lookup() in sys_cacheflush()
      x86/sgx: use vma_lookup() in sgx_encl_find()
      virt/kvm: use vma_lookup() instead of find_vma_intersection()
      vfio: use vma_lookup() instead of find_vma_intersection()
      net/ipv5/tcp: use vma_lookup() in tcp_zerocopy_receive()
      drm/amdgpu: use vma_lookup() in amdgpu_ttm_tt_get_user_pages()
      media: videobuf2: use vma_lookup() in get_vaddr_frames()
      misc/sgi-gru/grufault: use vma_lookup() in gru_find_vma()
      kernel/events/uprobes: use vma_lookup() in find_active_uprobe()
      lib/test_hmm: use vma_lookup() in dmirror_migrate()
      mm/ksm: use vma_lookup() in find_mergeable_vma()
      mm/migrate: use vma_lookup() in do_pages_stat_array()
      mm/mremap: use vma_lookup() in vma_to_resize()
      mm/memory.c: use vma_lookup() in __access_remote_vm()
      mm/mempolicy: use vma_lookup() in __access_remote_vm()

    Chen Li <chenli@uniontech.com>:
      mm: update legacy flush_tlb_* to use vma

Subsystem: mm/mprotect

    Peter Collingbourne <pcc@google.com>:
      mm: improve mprotect(R|W) efficiency on pages referenced once

Subsystem: mm/bootmem

    Souptick Joarder <jrdr.linux@gmail.com>:
      h8300: remove unused variable

Subsystem: mm/dma

    YueHaibing <yuehaibing@huawei.com>:
      mm/dmapool: use DEVICE_ATTR_RO macro

Subsystem: mm/tracing

    Vincent Whitchurch <vincent.whitchurch@axis.com>:
      mm, tracing: unify PFN format strings

Subsystem: mm/vmalloc

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
    Patch series "vmalloc() vs bulk allocator", v2:
      mm/page_alloc: add an alloc_pages_bulk_array_node() helper
      mm/vmalloc: switch to bulk allocator in __vmalloc_area_node()
      mm/vmalloc: print a warning message first on failure
      mm/vmalloc: remove quoted strings split across lines

    Uladzislau Rezki <urezki@gmail.com>:
      mm/vmalloc: fallback to a single page allocator

    Rafael Aquini <aquini@redhat.com>:
      mm: vmalloc: add cond_resched() in __vunmap()

Subsystem: mm/kasan

    Alexander Potapenko <glider@google.com>:
      printk: introduce dump_stack_lvl()
      kasan: use dump_stack_lvl(KERN_ERR) to print stacks

    David Gow <davidgow@google.com>:
      kasan: test: improve failure message in KUNIT_EXPECT_KASAN_FAIL()

    Daniel Axtens <dja@axtens.net>:
    Patch series "KASAN core changes for ppc64 radix KASAN", v16:
      kasan: allow an architecture to disable inline instrumentation
      kasan: allow architectures to provide an outline readiness check
      mm: define default MAX_PTRS_PER_* in include/pgtable.h
      kasan: use MAX_PTRS_PER_* for early shadow tables

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
    Patch series "kasan: add memory corruption identification support for hw tag-based kasan", v4:
      kasan: rename CONFIG_KASAN_SW_TAGS_IDENTIFY to CONFIG_KASAN_TAGS_IDENTIFY
      kasan: integrate the common part of two KASAN tag-based modes
      kasan: add memory corruption identification support for hardware tag-based mode

Subsystem: mm/initialization

    Jungseung Lee <js07.lee@samsung.com>:
      mm: report which part of mem is being freed on initmem case

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/mmzone.h: simplify is_highmem_idx()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Constify struct page arguments":
      mm: make __dump_page static

    Aaron Tomlin <atomlin@redhat.com>:
      mm/page_alloc: bail out on fatal signal during reclaim/compaction retry attempt

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/debug: factor PagePoisoned out of __dump_page
      mm/page_owner: constify dump_page_owner
      mm: make compound_head const-preserving
      mm: constify get_pfnblock_flags_mask and get_pfnblock_migratetype
      mm: constify page_count and page_ref_count
      mm: optimise nth_page for contiguous memmap

    Heiner Kallweit <hkallweit1@gmail.com>:
      mm/page_alloc: switch to pr_debug

    Andrii Nakryiko <andrii@kernel.org>:
      kbuild: skip per-CPU BTF generation for pahole v1.18-v1.21

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: split per cpu page lists and zone stats
      mm/page_alloc: convert per-cpu list protection to local_lock
      mm/vmstat: convert NUMA statistics to basic NUMA counters
      mm/vmstat: inline NUMA event counter updates
      mm/page_alloc: batch the accounting updates in the bulk allocator
      mm/page_alloc: reduce duration that IRQs are disabled for VM counters
      mm/page_alloc: explicitly acquire the zone lock in __free_pages_ok
      mm/page_alloc: avoid conflating IRQs disabled with zone->lock
      mm/page_alloc: update PGFREE outside the zone lock in __free_pages_ok

    Minchan Kim <minchan@kernel.org>:
      mm: page_alloc: dump migrate-failed pages only at -EBUSY

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Calculate pcp->high based on zone sizes and active CPUs", v2:
      mm/page_alloc: delete vm.percpu_pagelist_fraction
      mm/page_alloc: disassociate the pcp->high from pcp->batch
      mm/page_alloc: adjust pcp->high after CPU hotplug events
      mm/page_alloc: scale the number of pages that are batch freed
      mm/page_alloc: limit the number of pages on PCP lists when reclaim is active
      mm/page_alloc: introduce vm.percpu_pagelist_high_fraction

    Dong Aisheng <aisheng.dong@nxp.com>:
      mm: drop SECTION_SHIFT in code comments
      mm/page_alloc: improve memmap_pages dbg msg

    Liu Shixin <liushixin2@huawei.com>:
      mm/page_alloc: fix counting of managed_pages

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Allow high order pages to be stored on PCP", v2:
      mm/page_alloc: move free_the_page

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "Remove DISCONTIGMEM memory model", v3:
      alpha: remove DISCONTIGMEM and NUMA
      arc: update comment about HIGHMEM implementation
      arc: remove support for DISCONTIGMEM
      m68k: remove support for DISCONTIGMEM
      mm: remove CONFIG_DISCONTIGMEM
      arch, mm: remove stale mentions of DISCONIGMEM
      docs: remove description of DISCONTIGMEM
      mm: replace CONFIG_NEED_MULTIPLE_NODES with CONFIG_NUMA
      mm: replace CONFIG_FLAT_NODE_MEM_MAP with CONFIG_FLATMEM

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: allow high-order pages to be stored on the per-cpu lists
      mm/page_alloc: split pcp->high across all online CPUs for cpuless nodes

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm,hwpoison: send SIGBUS with error virutal address
      mm,hwpoison: make get_hwpoison_page() call get_any_page()

 Documentation/admin-guide/kernel-parameters.txt    |    6 
 Documentation/admin-guide/lockup-watchdogs.rst     |    4 
 Documentation/admin-guide/sysctl/kernel.rst        |   10 
 Documentation/admin-guide/sysctl/vm.rst            |   52 -
 Documentation/dev-tools/kasan.rst                  |    9 
 Documentation/vm/memory-model.rst                  |   45 
 arch/alpha/Kconfig                                 |   22 
 arch/alpha/include/asm/machvec.h                   |    6 
 arch/alpha/include/asm/mmzone.h                    |  100 --
 arch/alpha/include/asm/pgtable.h                   |    4 
 arch/alpha/include/asm/topology.h                  |   39 
 arch/alpha/kernel/core_marvel.c                    |   53 -
 arch/alpha/kernel/core_wildfire.c                  |   29 
 arch/alpha/kernel/pci_iommu.c                      |   29 
 arch/alpha/kernel/proto.h                          |    8 
 arch/alpha/kernel/setup.c                          |   16 
 arch/alpha/kernel/sys_marvel.c                     |    5 
 arch/alpha/kernel/sys_wildfire.c                   |    5 
 arch/alpha/mm/Makefile                             |    2 
 arch/alpha/mm/init.c                               |    3 
 arch/alpha/mm/numa.c                               |  223 ----
 arch/arc/Kconfig                                   |   13 
 arch/arc/include/asm/mmzone.h                      |   40 
 arch/arc/kernel/troubleshoot.c                     |    8 
 arch/arc/mm/init.c                                 |   21 
 arch/arm/include/asm/tlbflush.h                    |   13 
 arch/arm/mm/tlb-v6.S                               |    2 
 arch/arm/mm/tlb-v7.S                               |    2 
 arch/arm64/Kconfig                                 |    2 
 arch/arm64/kvm/mmu.c                               |    2 
 arch/h8300/kernel/setup.c                          |    2 
 arch/ia64/Kconfig                                  |    2 
 arch/ia64/include/asm/pal.h                        |    2 
 arch/ia64/include/asm/spinlock.h                   |    2 
 arch/ia64/include/asm/uv/uv_hub.h                  |    2 
 arch/ia64/kernel/efi_stub.S                        |    2 
 arch/ia64/kernel/mca_drv.c                         |    2 
 arch/ia64/kernel/topology.c                        |    5 
 arch/ia64/mm/numa.c                                |    5 
 arch/m68k/Kconfig.cpu                              |   10 
 arch/m68k/include/asm/mmzone.h                     |   10 
 arch/m68k/include/asm/page.h                       |    2 
 arch/m68k/include/asm/page_mm.h                    |   35 
 arch/m68k/include/asm/tlbflush.h                   |    2 
 arch/m68k/kernel/sys_m68k.c                        |    4 
 arch/m68k/mm/init.c                                |   20 
 arch/mips/Kconfig                                  |    2 
 arch/mips/include/asm/mmzone.h                     |    8 
 arch/mips/include/asm/page.h                       |    2 
 arch/mips/kernel/traps.c                           |    4 
 arch/mips/mm/init.c                                |    7 
 arch/nds32/include/asm/memory.h                    |    6 
 arch/openrisc/include/asm/tlbflush.h               |    2 
 arch/powerpc/Kconfig                               |    2 
 arch/powerpc/include/asm/mmzone.h                  |    4 
 arch/powerpc/kernel/setup_64.c                     |    2 
 arch/powerpc/kernel/smp.c                          |    2 
 arch/powerpc/kexec/core.c                          |    4 
 arch/powerpc/kvm/book3s_hv.c                       |    4 
 arch/powerpc/kvm/book3s_hv_uvmem.c                 |    2 
 arch/powerpc/mm/Makefile                           |    2 
 arch/powerpc/mm/mem.c                              |    4 
 arch/riscv/Kconfig                                 |    2 
 arch/s390/Kconfig                                  |    2 
 arch/s390/include/asm/pgtable.h                    |    2 
 arch/sh/include/asm/mmzone.h                       |    4 
 arch/sh/kernel/topology.c                          |    2 
 arch/sh/mm/Kconfig                                 |    2 
 arch/sh/mm/init.c                                  |    2 
 arch/sparc/Kconfig                                 |    2 
 arch/sparc/include/asm/mmzone.h                    |    4 
 arch/sparc/kernel/smp_64.c                         |    2 
 arch/sparc/mm/init_64.c                            |   12 
 arch/x86/Kconfig                                   |    2 
 arch/x86/ia32/ia32_aout.c                          |    4 
 arch/x86/kernel/cpu/mce/core.c                     |   13 
 arch/x86/kernel/cpu/sgx/encl.h                     |    4 
 arch/x86/kernel/setup_percpu.c                     |    6 
 arch/x86/mm/init_32.c                              |    4 
 arch/xtensa/include/asm/page.h                     |    4 
 arch/xtensa/include/asm/tlbflush.h                 |    4 
 drivers/base/node.c                                |   18 
 drivers/block/loop.c                               |  270 ++++-
 drivers/block/loop.h                               |   15 
 drivers/dax/device.c                               |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c            |    4 
 drivers/gpu/drm/i915/gem/selftests/i915_gem_mman.c |    2 
 drivers/media/common/videobuf2/frame_vector.c      |    2 
 drivers/misc/sgi-gru/grufault.c                    |    4 
 drivers/vfio/vfio_iommu_type1.c                    |    2 
 drivers/virtio/virtio_balloon.c                    |   17 
 fs/adfs/inode.c                                    |    1 
 fs/affs/file.c                                     |    2 
 fs/bfs/file.c                                      |    1 
 fs/binfmt_aout.c                                   |    4 
 fs/binfmt_elf.c                                    |    2 
 fs/binfmt_elf_fdpic.c                              |   11 
 fs/binfmt_flat.c                                   |    2 
 fs/block_dev.c                                     |    1 
 fs/buffer.c                                        |   25 
 fs/configfs/inode.c                                |    8 
 fs/dax.c                                           |    3 
 fs/ecryptfs/mmap.c                                 |   13 
 fs/exfat/inode.c                                   |    1 
 fs/ext2/inode.c                                    |    4 
 fs/ext4/inode.c                                    |    2 
 fs/fat/inode.c                                     |    1 
 fs/fs-writeback.c                                  |  366 +++++---
 fs/fuse/dax.c                                      |    3 
 fs/gfs2/aops.c                                     |    2 
 fs/gfs2/meta_io.c                                  |    2 
 fs/hfs/inode.c                                     |    2 
 fs/hfsplus/inode.c                                 |    2 
 fs/hpfs/file.c                                     |    1 
 fs/iomap/buffered-io.c                             |   27 
 fs/jfs/inode.c                                     |    1 
 fs/kernfs/inode.c                                  |    8 
 fs/libfs.c                                         |   44 
 fs/minix/inode.c                                   |    1 
 fs/nilfs2/mdt.c                                    |    1 
 fs/ntfs/inode.c                                    |    2 
 fs/ocfs2/aops.c                                    |    4 
 fs/ocfs2/cluster/heartbeat.c                       |    7 
 fs/ocfs2/cluster/nodemanager.c                     |    2 
 fs/ocfs2/dlm/dlmmaster.c                           |    2 
 fs/ocfs2/filecheck.c                               |    6 
 fs/ocfs2/stackglue.c                               |    8 
 fs/omfs/file.c                                     |    1 
 fs/proc/task_mmu.c                                 |    2 
 fs/ramfs/inode.c                                   |    9 
 fs/squashfs/block.c                                |    5 
 fs/squashfs/squashfs_fs_sb.h                       |    1 
 fs/squashfs/super.c                                |   86 +
 fs/sysv/itree.c                                    |    1 
 fs/udf/file.c                                      |    1 
 fs/udf/inode.c                                     |    1 
 fs/ufs/inode.c                                     |    1 
 fs/xfs/xfs_aops.c                                  |    4 
 fs/zonefs/super.c                                  |    4 
 include/asm-generic/memory_model.h                 |   37 
 include/asm-generic/pgtable-nop4d.h                |    1 
 include/asm-generic/topology.h                     |    2 
 include/kunit/test.h                               |    5 
 include/linux/backing-dev-defs.h                   |   20 
 include/linux/cpuhotplug.h                         |    2 
 include/linux/fs.h                                 |    6 
 include/linux/gfp.h                                |   13 
 include/linux/iomap.h                              |    1 
 include/linux/kasan.h                              |    7 
 include/linux/kernel.h                             |    2 
 include/linux/kthread.h                            |    2 
 include/linux/memblock.h                           |    6 
 include/linux/memcontrol.h                         |   60 -
 include/linux/mm.h                                 |   53 -
 include/linux/mm_types.h                           |   10 
 include/linux/mman.h                               |    2 
 include/linux/mmdebug.h                            |    3 
 include/linux/mmzone.h                             |   96 +-
 include/linux/page-flags.h                         |   10 
 include/linux/page_owner.h                         |    6 
 include/linux/page_ref.h                           |    4 
 include/linux/page_reporting.h                     |    3 
 include/linux/pageblock-flags.h                    |    2 
 include/linux/pagemap.h                            |    4 
 include/linux/pgtable.h                            |   22 
 include/linux/printk.h                             |    5 
 include/linux/sched/coredump.h                     |    8 
 include/linux/slab.h                               |   59 +
 include/linux/swap.h                               |   19 
 include/linux/swapops.h                            |    5 
 include/linux/vmstat.h                             |   69 -
 include/linux/writeback.h                          |    1 
 include/trace/events/cma.h                         |    4 
 include/trace/events/filemap.h                     |    2 
 include/trace/events/kmem.h                        |   12 
 include/trace/events/page_pool.h                   |    4 
 include/trace/events/pagemap.h                     |    4 
 include/trace/events/vmscan.h                      |    2 
 kernel/cgroup/cgroup.c                             |    1 
 kernel/crash_core.c                                |    4 
 kernel/events/core.c                               |    2 
 kernel/events/uprobes.c                            |    4 
 kernel/fork.c                                      |    1 
 kernel/kthread.c                                   |   19 
 kernel/sysctl.c                                    |   16 
 kernel/watchdog.c                                  |   12 
 lib/Kconfig.debug                                  |   15 
 lib/Kconfig.kasan                                  |   16 
 lib/Makefile                                       |    1 
 lib/dump_stack.c                                   |   20 
 lib/kunit/test.c                                   |   18 
 lib/slub_kunit.c                                   |  152 +++
 lib/test_hmm.c                                     |    5 
 lib/test_kasan.c                                   |   11 
 lib/vsprintf.c                                     |    2 
 mm/Kconfig                                         |   38 
 mm/backing-dev.c                                   |   66 +
 mm/compaction.c                                    |    2 
 mm/debug.c                                         |   27 
 mm/debug_vm_pgtable.c                              |   63 +
 mm/dmapool.c                                       |    5 
 mm/filemap.c                                       |    2 
 mm/gup.c                                           |   81 +
 mm/hugetlb.c                                       |    2 
 mm/internal.h                                      |    9 
 mm/kasan/Makefile                                  |    4 
 mm/kasan/common.c                                  |    6 
 mm/kasan/generic.c                                 |    3 
 mm/kasan/hw_tags.c                                 |   22 
 mm/kasan/init.c                                    |    6 
 mm/kasan/kasan.h                                   |   12 
 mm/kasan/report.c                                  |    6 
 mm/kasan/report_hw_tags.c                          |    5 
 mm/kasan/report_sw_tags.c                          |   45 
 mm/kasan/report_tags.c                             |   51 +
 mm/kasan/shadow.c                                  |    6 
 mm/kasan/sw_tags.c                                 |   45 
 mm/kasan/tags.c                                    |   59 +
 mm/kfence/kfence_test.c                            |    5 
 mm/kmemleak.c                                      |   18 
 mm/ksm.c                                           |    6 
 mm/memblock.c                                      |    8 
 mm/memcontrol.c                                    |  385 ++++++--
 mm/memory-failure.c                                |  344 +++++--
 mm/memory.c                                        |   22 
 mm/memory_hotplug.c                                |    6 
 mm/mempolicy.c                                     |    4 
 mm/migrate.c                                       |    4 
 mm/mmap.c                                          |   54 -
 mm/mmap_lock.c                                     |   33 
 mm/mprotect.c                                      |   52 +
 mm/mremap.c                                        |    5 
 mm/nommu.c                                         |    2 
 mm/page-writeback.c                                |   89 +
 mm/page_alloc.c                                    |  950 +++++++++++++--------
 mm/page_ext.c                                      |    2 
 mm/page_owner.c                                    |    2 
 mm/page_reporting.c                                |   19 
 mm/page_reporting.h                                |    5 
 mm/pagewalk.c                                      |   58 +
 mm/shmem.c                                         |   18 
 mm/slab.h                                          |   24 
 mm/slab_common.c                                   |   60 -
 mm/slub.c                                          |  420 +++++----
 mm/sparse.c                                        |    2 
 mm/swap.c                                          |    4 
 mm/swap_slots.c                                    |    2 
 mm/swap_state.c                                    |   20 
 mm/swapfile.c                                      |  177 +--
 mm/vmalloc.c                                       |  181 ++--
 mm/vmscan.c                                        |   43 
 mm/vmstat.c                                        |  282 ++----
 mm/workingset.c                                    |    2 
 net/ipv4/tcp.c                                     |    4 
 scripts/kconfig/streamline_config.pl               |   76 -
 scripts/link-vmlinux.sh                            |    4 
 scripts/spelling.txt                               |   16 
 tools/testing/selftests/vm/gup_test.c              |   96 +-
 tools/vm/page_owner_sort.c                         |    4 
 virt/kvm/kvm_main.c                                |    2 
 260 files changed, 3989 insertions(+), 2996 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-07-01  1:46 Andrew Morton
  2021-07-03  0:28 ` incoming Linus Torvalds
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-07-01  1:46 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


This is the rest of the -mm tree, less 66 patches which are dependent on
things which are (or were recently) in linux-next.  I'll trickle that
material over next week.


192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2 plus the
June 28 sendings.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/kconfig
  mm/proc
  mm/z3fold
  mm/zbud
  mm/ras
  mm/mempolicy
  mm/memblock
  mm/migration
  mm/thp
  mm/nommu
  mm/kconfig
  mm/madvise
  mm/memory-hotplug
  mm/zswap
  mm/zsmalloc
  mm/zram
  mm/cleanups
  mm/kfence
  mm/hmm
  procfs
  sysctl
  misc
  core-kernel
  lib
  lz4
  checkpatch
  init
  kprobes
  nilfs2
  hfs
  signals
  exec
  kcov
  selftests
  compress/decompress
  ipc

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Free some vmemmap pages of HugeTLB page", v23:
      mm: memory_hotplug: factor out bootmem core functions to bootmem_info.c
      mm: hugetlb: introduce a new config HUGETLB_PAGE_FREE_VMEMMAP
      mm: hugetlb: gather discrete indexes of tail page
      mm: hugetlb: free the vmemmap pages associated with each HugeTLB page
      mm: hugetlb: defer freeing of HugeTLB pages
      mm: hugetlb: alloc the vmemmap pages associated with each HugeTLB page
      mm: hugetlb: add a kernel parameter hugetlb_free_vmemmap
      mm: memory_hotplug: disable memmap_on_memory when hugetlb_free_vmemmap enabled
      mm: hugetlb: introduce nr_free_vmemmap_pages in the struct hstate

    Shixin Liu <liushixin2@huawei.com>:
      mm/debug_vm_pgtable: move {pmd/pud}_huge_tests out of CONFIG_TRANSPARENT_HUGEPAGE
      mm/debug_vm_pgtable: remove redundant pfn_{pmd/pte}() and fix one comment mistake

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for huge_memory:, v3:
      mm/huge_memory.c: remove dedicated macro HPAGE_CACHE_INDEX_MASK
      mm/huge_memory.c: use page->deferred_list
      mm/huge_memory.c: add missing read-only THP checking in transparent_hugepage_enabled()
      mm/huge_memory.c: remove unnecessary tlb_remove_page_size() for huge zero pmd
      mm/huge_memory.c: don't discard hugepage if other processes are mapping it

    Christophe Leroy <christophe.leroy@csgroup.eu>:
    Patch series "Subject: [PATCH v2 0/5] Implement huge VMAP and VMALLOC on powerpc 8xx", v2:
      mm/hugetlb: change parameters of arch_make_huge_pte()
      mm/pgtable: add stubs for {pmd/pub}_{set/clear}_huge
      mm/vmalloc: enable mapping of huge pages at pte level in vmap
      mm/vmalloc: enable mapping of huge pages at pte level in vmalloc
      powerpc/8xx: add support for huge pages on VMAP and VMALLOC

    Nanyong Sun <sunnanyong@huawei.com>:
      khugepaged: selftests: remove debug_cow

    Mina Almasry <almasrymina@google.com>:
      mm, hugetlb: fix racy resv_huge_pages underflow on UFFDIO_COPY

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Split huge PMD mapping of vmemmap pages", v4:
      mm: sparsemem: split the huge PMD mapping of vmemmap pages
      mm: sparsemem: use huge PMD mapping for vmemmap pages
      mm: hugetlb: introduce CONFIG_HUGETLB_PAGE_FREE_VMEMMAP_DEFAULT_ON

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "Fix prep_compound_gigantic_page ref count adjustment":
      hugetlb: remove prep_compound_huge_page cleanup
      hugetlb: address ref count racing in prep_compound_gigantic_page

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/hwpoison: disable pcp for page_handle_poison()

Subsystem: mm/userfaultfd

    Peter Xu <peterx@redhat.com>:
    Patch series "userfaultfd/selftests: A few cleanups", v2:
      userfaultfd/selftests: use user mode only
      userfaultfd/selftests: remove the time() check on delayed uffd
      userfaultfd/selftests: dropping VERIFY check in locking_thread
      userfaultfd/selftests: only dump counts if mode enabled
      userfaultfd/selftests: unify error handling
    Patch series "mm/uffd: Misc fix for uffd-wp and one more test":
      mm/thp: simplify copying of huge zero page pmd when fork
      mm/userfaultfd: fix uffd-wp special cases for fork()
      mm/userfaultfd: fail uffd-wp registration if not supported
      mm/pagemap: export uffd-wp protection information
      userfaultfd/selftests: add pagemap uffd-wp test

    Axel Rasmussen <axelrasmussen@google.com>:
    Patch series "userfaultfd: add minor fault handling for shmem", v6:
      userfaultfd/shmem: combine shmem_{mcopy_atomic,mfill_zeropage}_pte
      userfaultfd/shmem: support minor fault registration for shmem
      userfaultfd/shmem: support UFFDIO_CONTINUE for shmem
      userfaultfd/shmem: advertise shmem minor fault support
      userfaultfd/shmem: modify shmem_mfill_atomic_pte to use install_pte()
      userfaultfd/selftests: use memfd_create for shmem test type
      userfaultfd/selftests: create alias mappings in the shmem test
      userfaultfd/selftests: reinitialize test context in each test
      userfaultfd/selftests: exercise minor fault handling shmem support

Subsystem: mm/vmscan

    Yu Zhao <yuzhao@google.com>:
      mm/vmscan.c: fix potential deadlock in reclaim_pages()
      include/trace/events/vmscan.h: remove mm_vmscan_inactive_list_is_low

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: workingset: define macro WORKINGSET_SHIFT

Subsystem: mm/kconfig

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm/kconfig: move HOLES_IN_ZONE into mm

Subsystem: mm/proc

    Mike Rapoport <rppt@linux.ibm.com>:
      docs: proc.rst: meminfo: briefly describe gaps in memory accounting

    David Hildenbrand <david@redhat.com>:
    Patch series "fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages", v3:
      fs/proc/kcore: drop KCORE_REMAP and KCORE_OTHER
      fs/proc/kcore: pfn_is_ram check only applies to KCORE_RAM
      fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages
      mm: introduce page_offline_(begin|end|freeze|thaw) to synchronize setting PageOffline()
      virtio-mem: use page_offline_(start|end) when setting PageOffline()
      fs/proc/kcore: use page_offline_(freeze|thaw)

Subsystem: mm/z3fold

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for z3fold":
      mm/z3fold: define macro NCHUNKS as TOTAL_CHUNKS - ZHDR_CHUNKS
      mm/z3fold: avoid possible underflow in z3fold_alloc()
      mm/z3fold: remove magic number in z3fold_create_pool()
      mm/z3fold: remove unused function handle_to_z3fold_header()
      mm/z3fold: fix potential memory leak in z3fold_destroy_pool()
      mm/z3fold: use release_z3fold_page_locked() to release locked z3fold page

Subsystem: mm/zbud

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups for zbud", v2:
      mm/zbud: reuse unbuddied[0] as buddied in zbud_pool
      mm/zbud: don't export any zbud API

Subsystem: mm/ras

    YueHaibing <yuehaibing@huawei.com>:
      mm/compaction: use DEVICE_ATTR_WO macro

    Liu Xiang <liu.xiang@zlingsmart.com>:
      mm: compaction: remove duplicate !list_empty(&sublist) check

    Wonhyuk Yang <vvghjk1234@gmail.com>:
      mm/compaction: fix 'limit' in fast_isolate_freepages

Subsystem: mm/mempolicy

    Feng Tang <feng.tang@intel.com>:
    Patch series "mm/mempolicy: some fix and semantics cleanup", v4:
      mm/mempolicy: cleanup nodemask intersection check for oom
      mm/mempolicy: don't handle MPOL_LOCAL like a fake MPOL_PREFERRED policy
      mm/mempolicy: unify the parameter sanity check for mbind and set_mempolicy

    Yang Shi <shy828301@gmail.com>:
      mm: mempolicy: don't have to split pmd for huge zero page

    Ben Widawsky <ben.widawsky@intel.com>:
      mm/mempolicy: use unified 'nodes' for bind/interleave/prefer policies

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "arm64: drop pfn_valid_within() and simplify pfn_valid()", v4:
      include/linux/mmzone.h: add documentation for pfn_valid()
      memblock: update initialization of reserved pages
      arm64: decouple check whether pfn is in linear map from pfn_valid()
      arm64: drop pfn_valid_within() and simplify pfn_valid()

    Anshuman Khandual <anshuman.khandual@arm.com>:
      arm64/mm: drop HAVE_ARCH_PFN_VALID

Subsystem: mm/migration

    Muchun Song <songmuchun@bytedance.com>:
      mm: migrate: fix missing update page_private to hugetlb_page_subpool

Subsystem: mm/thp

    Collin Fijalkovich <cfijalkovich@google.com>:
      mm, thp: relax the VM_DENYWRITE constraint on file-backed THPs

    Yang Shi <shy828301@gmail.com>:
      mm: memory: add orig_pmd to struct vm_fault
      mm: memory: make numa_migrate_prep() non-static
      mm: thp: refactor NUMA fault handling
      mm: migrate: account THP NUMA migration counters correctly
      mm: migrate: don't split THP for misplaced NUMA page
      mm: migrate: check mapcount for THP instead of refcount
      mm: thp: skip make PMD PROT_NONE if THP migration is not supported

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/thp: make ARCH_ENABLE_SPLIT_PMD_PTLOCK dependent on PGTABLE_LEVELS > 2

    Yang Shi <shy828301@gmail.com>:
      mm: rmap: make try_to_unmap() void function

    Hugh Dickins <hughd@google.com>:
      mm/thp: remap_page() is only needed on anonymous THP
      mm: hwpoison_user_mappings() try_to_unmap() with TTU_SYNC

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/thp: fix strncpy warning

Subsystem: mm/nommu

    Chen Li <chenli@uniontech.com>:
      nommu: remove __GFP_HIGHMEM in vmalloc/vzalloc

    Liam Howlett <liam.howlett@oracle.com>:
      mm/nommu: unexport do_munmap()

Subsystem: mm/kconfig

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: generalize ZONE_[DMA|DMA32]

Subsystem: mm/madvise

    David Hildenbrand <david@redhat.com>:
    Patch series "mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables", v2:
      mm: make variable names for populate_vma_page_range() consistent
      mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables
      MAINTAINERS: add tools/testing/selftests/vm/ to MEMORY MANAGEMENT
      selftests/vm: add protection_keys_32 / protection_keys_64 to gitignore
      selftests/vm: add test for MADV_POPULATE_(READ|WRITE)

Subsystem: mm/memory-hotplug

    Liam Mark <lmark@codeaurora.org>:
      mm/memory_hotplug: rate limit page migration warnings

    Oscar Salvador <osalvador@suse.de>:
      mm,memory_hotplug: drop unneeded locking

Subsystem: mm/zswap

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for zswap":
      mm/zswap.c: remove unused function zswap_debugfs_exit()
      mm/zswap.c: avoid unnecessary copy-in at map time
      mm/zswap.c: fix two bugs in zswap_writeback_entry()

Subsystem: mm/zsmalloc

    Zhaoyang Huang <zhaoyang.huang@unisoc.com>:
      mm: zram: amend SLAB_RECLAIM_ACCOUNT on zspage_cachep

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup for zsmalloc":
      mm/zsmalloc.c: remove confusing code in obj_free()
      mm/zsmalloc.c: improve readability for async_free_zspage()

Subsystem: mm/zram

    Yue Hu <huyue2@yulong.com>:
      zram: move backing_dev under macro CONFIG_ZRAM_WRITEBACK

Subsystem: mm/cleanups

    Hyeonggon Yoo <42.hyeyoo@gmail.com>:
      mm: fix typos and grammar error in comments

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm: define default value for FIRST_USER_ADDRESS

    Zhen Lei <thunder.leizhen@huawei.com>:
      mm: fix spelling mistakes

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Clean W=1 build warnings for mm/":
      mm/vmscan: remove kerneldoc-like comment from isolate_lru_pages
      mm/vmalloc: include header for prototype of set_iounmap_nonlazy
      mm/page_alloc: make should_fail_alloc_page() static
      mm/mapping_dirty_helpers: remove double Note in kerneldoc
      mm/memcontrol.c: fix kerneldoc comment for mem_cgroup_calculate_protection
      mm/memory_hotplug: fix kerneldoc comment for __try_online_node
      mm/memory_hotplug: fix kerneldoc comment for __remove_memory
      mm/zbud: add kerneldoc fields for zbud_pool
      mm/z3fold: add kerneldoc fields for z3fold_pool
      mm/swap: make swap_address_space an inline function
      mm/mmap_lock: remove dead code for !CONFIG_TRACING configurations
      mm/page_alloc: move prototype for find_suitable_fallback
      mm/swap: make NODE_DATA an inline function on CONFIG_FLATMEM

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/thp: define default pmd_pgtable()

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: unconditionally use unbound work queue

Subsystem: mm/hmm

    Alistair Popple <apopple@nvidia.com>:
    Patch series "Add support for SVM atomics in Nouveau", v11:
      mm: remove special swap entry functions
      mm/swapops: rework swap entry manipulation code
      mm/rmap: split try_to_munlock from try_to_unmap
      mm/rmap: split migration into its own function
      mm: rename migrate_pgmap_owner
      mm/memory.c: allow different return codes for copy_nonpresent_pte()
      mm: device exclusive memory access
      mm: selftests for exclusive device memory
      nouveau/svm: refactor nouveau_range_fault
      nouveau/svm: implement atomic SVM access

Subsystem: procfs

    Marcelo Henrique Cerri <marcelo.cerri@canonical.com>:
      proc: Avoid mixing integer types in mem_rw()

    ZHOUFENG <zhoufeng.zf@bytedance.com>:
      fs/proc/kcore.c: add mmap interface

    Kalesh Singh <kaleshsingh@google.com>:
      procfs: allow reading fdinfo with PTRACE_MODE_READ
      procfs/dmabuf: add inode number to /proc/*/fdinfo

Subsystem: sysctl

    Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
      sysctl: remove redundant assignment to first

Subsystem: misc

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      drm: include only needed headers in ascii85.h

Subsystem: core-kernel

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: split out panic and oops helpers

Subsystem: lib

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib: decompress_bunzip2: remove an unneeded semicolon

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
    Patch series "lib/string_helpers: get rid of ugly *_escape_mem_ascii()", v3:
      lib/string_helpers: switch to use BIT() macro
      lib/string_helpers: move ESCAPE_NP check inside 'else' branch in a loop
      lib/string_helpers: drop indentation level in string_escape_mem()
      lib/string_helpers: introduce ESCAPE_NA for escaping non-ASCII
      lib/string_helpers: introduce ESCAPE_NAP to escape non-ASCII and non-printable
      lib/string_helpers: allow to append additional characters to be escaped
      lib/test-string_helpers: print flags in hexadecimal format
      lib/test-string_helpers: get rid of trailing comma in terminators
      lib/test-string_helpers: add test cases for new features
      MAINTAINERS: add myself as designated reviewer for generic string library
      seq_file: introduce seq_escape_mem()
      seq_file: add seq_escape_str() as replica of string_escape_str()
      seq_file: convert seq_escape() to use seq_escape_str()
      nfsd: avoid non-flexible API in seq_quote_mem()
      seq_file: drop unused *_escape_mem_ascii()

    Trent Piepho <tpiepho@gmail.com>:
      lib/math/rational.c: fix divide by zero
      lib/math/rational: add Kunit test cases

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib/decompressors: fix spelling mistakes
      lib/mpi: fix spelling mistakes

    Alexey Dobriyan <adobriyan@gmail.com>:
      lib: memscan() fixlet
      lib: uninline simple_strtoull()

    Matteo Croce <mcroce@microsoft.com>:
      lib/test_string.c: allow module removal

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: split out kstrtox() and simple_strtox() to a separate header

Subsystem: lz4

    Rajat Asthana <thisisrast7@gmail.com>:
      lz4_decompress: declare LZ4_decompress_safe_withPrefix64k static

    Dimitri John Ledkov <dimitri.ledkov@canonical.com>:
      lib/decompress_unlz4.c: correctly handle zero-padding around initrds.

Subsystem: checkpatch

    Guenter Roeck <linux@roeck-us.net>:
      checkpatch: scripts/spdxcheck.py now requires python3

    Joe Perches <joe@perches.com>:
      checkpatch: improve the indented label test

    Guenter Roeck <linux@roeck-us.net>:
      checkpatch: do not complain about positive return values starting with EPOLL

Subsystem: init

    Andrew Halaney <ahalaney@redhat.com>:
      init: print out unknown kernel parameters

Subsystem: kprobes

    Barry Song <song.bao.hua@hisilicon.com>:
      kprobes: remove duplicated strong free_insn_page in x86 and s390

Subsystem: nilfs2

    Colin Ian King <colin.king@canonical.com>:
      nilfs2: remove redundant continue statement in a while-loop

Subsystem: hfs

    Zhen Lei <thunder.leizhen@huawei.com>:
      hfsplus: remove unnecessary oom message

    Chung-Chiang Cheng <shepjeng@gmail.com>:
      hfsplus: report create_date to kstat.btime

Subsystem: signals

    Al Viro <viro@zeniv.linux.org.uk>:
      x86: signal: don't do sas_ss_reset() until we are certain that sigframe won't be abandoned

Subsystem: exec

    Alexey Dobriyan <adobriyan@gmail.com>:
      exec: remove checks in __register_bimfmt()

Subsystem: kcov

    Marco Elver <elver@google.com>:
      kcov: add __no_sanitize_coverage to fix noinstr for all architectures

Subsystem: selftests

    Dave Hansen <dave.hansen@linux.intel.com>:
    Patch series "selftests/vm/pkeys: Bug fixes and a new test":
      selftests/vm/pkeys: fix alloc_random_pkey() to make it really, really random
      selftests/vm/pkeys: handle negative sys_pkey_alloc() return code
      selftests/vm/pkeys: refill shadow register after implicit kernel write
      selftests/vm/pkeys: exercise x86 XSAVE init state

Subsystem: compress/decompress

    Yu Kuai <yukuai3@huawei.com>:
      lib/decompressors: remove set but not used variabled 'level'

Subsystem: ipc

    Vasily Averin <vvs@virtuozzo.com>:
    Patch series "ipc: allocations cleanup", v2:
      ipc sem: use kvmalloc for sem_undo allocation
      ipc: use kmalloc for msg_queue and shmid_kernel

    Manfred Spraul <manfred@colorfullife.com>:
      ipc/sem.c: use READ_ONCE()/WRITE_ONCE() for use_global_lock
      ipc/util.c: use binary search for max_idx

 Documentation/admin-guide/kernel-parameters.txt    |   35 
 Documentation/admin-guide/mm/hugetlbpage.rst       |   11 
 Documentation/admin-guide/mm/memory-hotplug.rst    |   13 
 Documentation/admin-guide/mm/pagemap.rst           |    2 
 Documentation/admin-guide/mm/userfaultfd.rst       |    3 
 Documentation/core-api/kernel-api.rst              |    7 
 Documentation/filesystems/proc.rst                 |   48 
 Documentation/vm/hmm.rst                           |   19 
 Documentation/vm/unevictable-lru.rst               |   33 
 MAINTAINERS                                        |   10 
 arch/alpha/Kconfig                                 |    5 
 arch/alpha/include/asm/pgalloc.h                   |    1 
 arch/alpha/include/asm/pgtable.h                   |    1 
 arch/alpha/include/uapi/asm/mman.h                 |    3 
 arch/alpha/kernel/setup.c                          |    2 
 arch/arc/include/asm/pgalloc.h                     |    2 
 arch/arc/include/asm/pgtable.h                     |    8 
 arch/arm/Kconfig                                   |    3 
 arch/arm/include/asm/pgalloc.h                     |    1 
 arch/arm64/Kconfig                                 |   15 
 arch/arm64/include/asm/hugetlb.h                   |    3 
 arch/arm64/include/asm/memory.h                    |    2 
 arch/arm64/include/asm/page.h                      |    4 
 arch/arm64/include/asm/pgalloc.h                   |    1 
 arch/arm64/include/asm/pgtable.h                   |    2 
 arch/arm64/kernel/setup.c                          |    1 
 arch/arm64/kvm/mmu.c                               |    2 
 arch/arm64/mm/hugetlbpage.c                        |    5 
 arch/arm64/mm/init.c                               |   51 
 arch/arm64/mm/ioremap.c                            |    4 
 arch/arm64/mm/mmu.c                                |   22 
 arch/csky/include/asm/pgalloc.h                    |    2 
 arch/csky/include/asm/pgtable.h                    |    1 
 arch/hexagon/include/asm/pgtable.h                 |    4 
 arch/ia64/Kconfig                                  |    7 
 arch/ia64/include/asm/pal.h                        |    1 
 arch/ia64/include/asm/pgalloc.h                    |    1 
 arch/ia64/include/asm/pgtable.h                    |    1 
 arch/m68k/Kconfig                                  |    5 
 arch/m68k/include/asm/mcf_pgalloc.h                |    2 
 arch/m68k/include/asm/mcf_pgtable.h                |    2 
 arch/m68k/include/asm/motorola_pgalloc.h           |    1 
 arch/m68k/include/asm/motorola_pgtable.h           |    2 
 arch/m68k/include/asm/pgtable_mm.h                 |    1 
 arch/m68k/include/asm/sun3_pgalloc.h               |    1 
 arch/microblaze/Kconfig                            |    4 
 arch/microblaze/include/asm/pgalloc.h              |    2 
 arch/microblaze/include/asm/pgtable.h              |    2 
 arch/mips/Kconfig                                  |   10 
 arch/mips/include/asm/pgalloc.h                    |    1 
 arch/mips/include/asm/pgtable-32.h                 |    1 
 arch/mips/include/asm/pgtable-64.h                 |    1 
 arch/mips/include/uapi/asm/mman.h                  |    3 
 arch/mips/kernel/relocate.c                        |    1 
 arch/mips/sgi-ip22/ip22-reset.c                    |    1 
 arch/mips/sgi-ip32/ip32-reset.c                    |    1 
 arch/nds32/include/asm/pgalloc.h                   |    5 
 arch/nios2/include/asm/pgalloc.h                   |    1 
 arch/nios2/include/asm/pgtable.h                   |    2 
 arch/openrisc/include/asm/pgalloc.h                |    2 
 arch/openrisc/include/asm/pgtable.h                |    1 
 arch/parisc/include/asm/pgalloc.h                  |    1 
 arch/parisc/include/asm/pgtable.h                  |    2 
 arch/parisc/include/uapi/asm/mman.h                |    3 
 arch/parisc/kernel/pdc_chassis.c                   |    1 
 arch/powerpc/Kconfig                               |    6 
 arch/powerpc/include/asm/book3s/pgtable.h          |    1 
 arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h   |    5 
 arch/powerpc/include/asm/nohash/32/mmu-8xx.h       |   43 
 arch/powerpc/include/asm/nohash/32/pgtable.h       |    1 
 arch/powerpc/include/asm/nohash/64/pgtable.h       |    2 
 arch/powerpc/include/asm/pgalloc.h                 |    5 
 arch/powerpc/include/asm/pgtable.h                 |    6 
 arch/powerpc/kernel/setup-common.c                 |    1 
 arch/powerpc/platforms/Kconfig.cputype             |    1 
 arch/riscv/Kconfig                                 |    5 
 arch/riscv/include/asm/pgalloc.h                   |    2 
 arch/riscv/include/asm/pgtable.h                   |    2 
 arch/s390/Kconfig                                  |    6 
 arch/s390/include/asm/pgalloc.h                    |    3 
 arch/s390/include/asm/pgtable.h                    |    5 
 arch/s390/kernel/ipl.c                             |    1 
 arch/s390/kernel/kprobes.c                         |    5 
 arch/s390/mm/pgtable.c                             |    2 
 arch/sh/include/asm/pgalloc.h                      |    1 
 arch/sh/include/asm/pgtable.h                      |    2 
 arch/sparc/Kconfig                                 |    5 
 arch/sparc/include/asm/pgalloc_32.h                |    1 
 arch/sparc/include/asm/pgalloc_64.h                |    1 
 arch/sparc/include/asm/pgtable_32.h                |    3 
 arch/sparc/include/asm/pgtable_64.h                |    8 
 arch/sparc/kernel/sstate.c                         |    1 
 arch/sparc/mm/hugetlbpage.c                        |    6 
 arch/sparc/mm/init_64.c                            |    1 
 arch/um/drivers/mconsole_kern.c                    |    1 
 arch/um/include/asm/pgalloc.h                      |    1 
 arch/um/include/asm/pgtable-2level.h               |    1 
 arch/um/include/asm/pgtable-3level.h               |    1 
 arch/um/kernel/um_arch.c                           |    1 
 arch/x86/Kconfig                                   |   17 
 arch/x86/include/asm/desc.h                        |    1 
 arch/x86/include/asm/pgalloc.h                     |    2 
 arch/x86/include/asm/pgtable_types.h               |    2 
 arch/x86/kernel/cpu/mshyperv.c                     |    1 
 arch/x86/kernel/kprobes/core.c                     |    6 
 arch/x86/kernel/setup.c                            |    1 
 arch/x86/mm/init_64.c                              |   21 
 arch/x86/mm/pgtable.c                              |   34 
 arch/x86/purgatory/purgatory.c                     |    2 
 arch/x86/xen/enlighten.c                           |    1 
 arch/xtensa/include/asm/pgalloc.h                  |    2 
 arch/xtensa/include/asm/pgtable.h                  |    1 
 arch/xtensa/include/uapi/asm/mman.h                |    3 
 arch/xtensa/platforms/iss/setup.c                  |    1 
 drivers/block/zram/zram_drv.h                      |    2 
 drivers/bus/brcmstb_gisb.c                         |    1 
 drivers/char/ipmi/ipmi_msghandler.c                |    1 
 drivers/clk/analogbits/wrpll-cln28hpc.c            |    4 
 drivers/edac/altera_edac.c                         |    1 
 drivers/firmware/google/gsmi.c                     |    1 
 drivers/gpu/drm/nouveau/include/nvif/if000c.h      |    1 
 drivers/gpu/drm/nouveau/nouveau_svm.c              |  162 ++-
 drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmm.h      |    1 
 drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmmgp100.c |    6 
 drivers/hv/vmbus_drv.c                             |    1 
 drivers/hwtracing/coresight/coresight-cpu-debug.c  |    1 
 drivers/leds/trigger/ledtrig-activity.c            |    1 
 drivers/leds/trigger/ledtrig-heartbeat.c           |    1 
 drivers/leds/trigger/ledtrig-panic.c               |    1 
 drivers/misc/bcm-vk/bcm_vk_dev.c                   |    1 
 drivers/misc/ibmasm/heartbeat.c                    |    1 
 drivers/misc/pvpanic/pvpanic.c                     |    1 
 drivers/net/ipa/ipa_smp2p.c                        |    1 
 drivers/parisc/power.c                             |    1 
 drivers/power/reset/ltc2952-poweroff.c             |    1 
 drivers/remoteproc/remoteproc_core.c               |    1 
 drivers/s390/char/con3215.c                        |    1 
 drivers/s390/char/con3270.c                        |    1 
 drivers/s390/char/sclp.c                           |    1 
 drivers/s390/char/sclp_con.c                       |    1 
 drivers/s390/char/sclp_vt220.c                     |    1 
 drivers/s390/char/zcore.c                          |    1 
 drivers/soc/bcm/brcmstb/pm/pm-arm.c                |    1 
 drivers/staging/olpc_dcon/olpc_dcon.c              |    1 
 drivers/video/fbdev/hyperv_fb.c                    |    1 
 drivers/virtio/virtio_mem.c                        |    2 
 fs/Kconfig                                         |   15 
 fs/exec.c                                          |    3 
 fs/hfsplus/inode.c                                 |    5 
 fs/hfsplus/xattr.c                                 |    1 
 fs/nfsd/nfs4state.c                                |    2 
 fs/nilfs2/btree.c                                  |    1 
 fs/open.c                                          |   13 
 fs/proc/base.c                                     |    6 
 fs/proc/fd.c                                       |   20 
 fs/proc/kcore.c                                    |  136 ++
 fs/proc/task_mmu.c                                 |   34 
 fs/seq_file.c                                      |   43 
 fs/userfaultfd.c                                   |   15 
 include/asm-generic/bug.h                          |    3 
 include/linux/ascii85.h                            |    3 
 include/linux/bootmem_info.h                       |   68 +
 include/linux/compat.h                             |    2 
 include/linux/compiler-clang.h                     |   17 
 include/linux/compiler-gcc.h                       |    6 
 include/linux/compiler_types.h                     |    2 
 include/linux/huge_mm.h                            |   74 -
 include/linux/hugetlb.h                            |   80 +
 include/linux/hugetlb_cgroup.h                     |   19 
 include/linux/kcore.h                              |    3 
 include/linux/kernel.h                             |  227 ----
 include/linux/kprobes.h                            |    1 
 include/linux/kstrtox.h                            |  155 ++
 include/linux/memblock.h                           |    4 
 include/linux/memory_hotplug.h                     |   27 
 include/linux/mempolicy.h                          |    9 
 include/linux/memremap.h                           |    2 
 include/linux/migrate.h                            |   27 
 include/linux/mm.h                                 |   18 
 include/linux/mm_types.h                           |    2 
 include/linux/mmu_notifier.h                       |   26 
 include/linux/mmzone.h                             |   27 
 include/linux/mpi.h                                |    4 
 include/linux/page-flags.h                         |   22 
 include/linux/panic.h                              |   98 +
 include/linux/panic_notifier.h                     |   12 
 include/linux/pgtable.h                            |   44 
 include/linux/rmap.h                               |   13 
 include/linux/seq_file.h                           |   10 
 include/linux/shmem_fs.h                           |   19 
 include/linux/signal.h                             |    2 
 include/linux/string.h                             |    7 
 include/linux/string_helpers.h                     |   31 
 include/linux/sunrpc/cache.h                       |    1 
 include/linux/swap.h                               |   19 
 include/linux/swapops.h                            |  171 +--
 include/linux/thread_info.h                        |    1 
 include/linux/userfaultfd_k.h                      |    5 
 include/linux/vmalloc.h                            |   15 
 include/linux/zbud.h                               |   23 
 include/trace/events/vmscan.h                      |   41 
 include/uapi/asm-generic/mman-common.h             |    3 
 include/uapi/linux/mempolicy.h                     |    1 
 include/uapi/linux/userfaultfd.h                   |    7 
 init/main.c                                        |   42 
 ipc/msg.c                                          |    6 
 ipc/sem.c                                          |   25 
 ipc/shm.c                                          |    6 
 ipc/util.c                                         |   44 
 ipc/util.h                                         |    3 
 kernel/hung_task.c                                 |    1 
 kernel/kexec_core.c                                |    1 
 kernel/kprobes.c                                   |    2 
 kernel/panic.c                                     |    1 
 kernel/rcu/tree.c                                  |    2 
 kernel/signal.c                                    |   14 
 kernel/sysctl.c                                    |    4 
 kernel/trace/trace.c                               |    1 
 lib/Kconfig.debug                                  |   12 
 lib/decompress_bunzip2.c                           |    6 
 lib/decompress_unlz4.c                             |    8 
 lib/decompress_unlzo.c                             |    3 
 lib/decompress_unxz.c                              |    2 
 lib/decompress_unzstd.c                            |    4 
 lib/kstrtox.c                                      |    5 
 lib/lz4/lz4_decompress.c                           |    2 
 lib/math/Makefile                                  |    1 
 lib/math/rational-test.c                           |   56 +
 lib/math/rational.c                                |   16 
 lib/mpi/longlong.h                                 |    4 
 lib/mpi/mpicoder.c                                 |    6 
 lib/mpi/mpiutil.c                                  |    2 
 lib/parser.c                                       |    1 
 lib/string.c                                       |    2 
 lib/string_helpers.c                               |  142 +-
 lib/test-string_helpers.c                          |  157 ++-
 lib/test_hmm.c                                     |  127 ++
 lib/test_hmm_uapi.h                                |    2 
 lib/test_string.c                                  |    5 
 lib/vsprintf.c                                     |    1 
 lib/xz/xz_dec_bcj.c                                |    2 
 lib/xz/xz_dec_lzma2.c                              |    8 
 lib/zlib_inflate/inffast.c                         |    2 
 lib/zstd/huf.h                                     |    2 
 mm/Kconfig                                         |   16 
 mm/Makefile                                        |    2 
 mm/bootmem_info.c                                  |  127 ++
 mm/compaction.c                                    |   20 
 mm/debug_vm_pgtable.c                              |  109 --
 mm/gup.c                                           |   58 +
 mm/hmm.c                                           |   12 
 mm/huge_memory.c                                   |  269 ++---
 mm/hugetlb.c                                       |  369 +++++--
 mm/hugetlb_vmemmap.c                               |  332 ++++++
 mm/hugetlb_vmemmap.h                               |   53 -
 mm/internal.h                                      |   29 
 mm/kfence/core.c                                   |    4 
 mm/khugepaged.c                                    |   20 
 mm/madvise.c                                       |   66 +
 mm/mapping_dirty_helpers.c                         |    2 
 mm/memblock.c                                      |   28 
 mm/memcontrol.c                                    |    4 
 mm/memory-failure.c                                |   38 
 mm/memory.c                                        |  239 +++-
 mm/memory_hotplug.c                                |  161 ---
 mm/mempolicy.c                                     |  323 ++----
 mm/migrate.c                                       |  268 +----
 mm/mlock.c                                         |   12 
 mm/mmap_lock.c                                     |   59 -
 mm/mprotect.c                                      |   18 
 mm/nommu.c                                         |    5 
 mm/oom_kill.c                                      |    2 
 mm/page_alloc.c                                    |    5 
 mm/page_vma_mapped.c                               |   15 
 mm/rmap.c                                          |  644 +++++++++---
 mm/shmem.c                                         |  125 --
 mm/sparse-vmemmap.c                                |  432 +++++++-
 mm/sparse.c                                        |    1 
 mm/swap.c                                          |    2 
 mm/swapfile.c                                      |    2 
 mm/userfaultfd.c                                   |  249 ++--
 mm/util.c                                          |   40 
 mm/vmalloc.c                                       |   37 
 mm/vmscan.c                                        |   20 
 mm/workingset.c                                    |   10 
 mm/z3fold.c                                        |   39 
 mm/zbud.c                                          |  235 ++--
 mm/zsmalloc.c                                      |    5 
 mm/zswap.c                                         |   26 
 scripts/checkpatch.pl                              |   16 
 tools/testing/selftests/vm/.gitignore              |    3 
 tools/testing/selftests/vm/Makefile                |    5 
 tools/testing/selftests/vm/hmm-tests.c             |  158 +++
 tools/testing/selftests/vm/khugepaged.c            |    4 
 tools/testing/selftests/vm/madv_populate.c         |  342 ++++++
 tools/testing/selftests/vm/pkey-x86.h              |    1 
 tools/testing/selftests/vm/protection_keys.c       |   85 +
 tools/testing/selftests/vm/run_vmtests.sh          |   16 
 tools/testing/selftests/vm/userfaultfd.c           | 1094 ++++++++++-----------
 299 files changed, 6277 insertions(+), 3183 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-07-01  1:46 incoming Andrew Morton
@ 2021-07-03  0:28 ` Linus Torvalds
  2021-07-03  1:06   ` incoming Linus Torvalds
  0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2021-07-03  0:28 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Wed, Jun 30, 2021 at 6:46 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> This is the rest of the -mm tree, less 66 patches which are dependent on
> things which are (or were recently) in linux-next.  I'll trickle that
> material over next week.

I haven't bisected this yet, but with the current -git I'm getting

   watchdog: BUG: soft lockup - CPU#41 stuck for 49s!

and the common call chain seems to be in flush_tlb_mm_range ->
on_each_cpu_cond_mask.

Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking
at the pulls and merges I've done since, this -mm series looks like
the obvious culprit.

I'll go start bisection, but I thought I'd give a heads-up in case
somebody else has seen TLB-flush-related lockups and already figured
out the guilty party..

                 Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-07-03  0:28 ` incoming Linus Torvalds
@ 2021-07-03  1:06   ` Linus Torvalds
  0 siblings, 0 replies; 232+ messages in thread
From: Linus Torvalds @ 2021-07-03  1:06 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Fri, Jul 2, 2021 at 5:28 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking
> at the pulls and merges I've done since, this -mm series looks like
> the obvious culprit.

No, unless my bisection is wrong, the -mm branch is innocent, and was
discarded from the suspects on the very first bisection trial.

So never mind.

             Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-07-08  0:59 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-07-08  0:59 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

54 patches, based on a931dd33d370896a683236bba67c0d6f3d01144d.

Subsystems affected by this patch series:

  lib
  mm/slub
  mm/secretmem
  mm/cleanups
  mm/init
  debug
  mm/pagemap
  mm/mremap

Subsystem: lib

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib/test: fix spelling mistakes
      lib: fix spelling mistakes
      lib: fix spelling mistakes in header files

Subsystem: mm/slub

    Nathan Chancellor <nathan@kernel.org>:
    Patch series "hexagon: Fix build error with CONFIG_STACKDEPOT and select CONFIG_ARCH_WANT_LD_ORPHAN_WARN":
      hexagon: handle {,SOFT}IRQENTRY_TEXT in linker script
      hexagon: use common DISCARDS macro
      hexagon: select ARCH_WANT_LD_ORPHAN_WARN

    Oliver Glitta <glittao@gmail.com>:
      mm/slub: use stackdepot to save stack trace in objects

Subsystem: mm/secretmem

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: introduce memfd_secret system call to create "secret" memory areas", v20:
      mmap: make mlock_future_check() global
      riscv/Kconfig: make direct map manipulation options depend on MMU
      set_memory: allow querying whether set_direct_map_*() is actually enabled
      mm: introduce memfd_secret system call to create "secret" memory areas
      PM: hibernate: disable when there are active secretmem users
      arch, mm: wire up memfd_secret system call where relevant
      secretmem: test: add basic selftest for memfd_secret(2)

Subsystem: mm/cleanups

    Zhen Lei <thunder.leizhen@huawei.com>:
      mm: fix spelling mistakes in header files

Subsystem: mm/init

    Kefeng Wang <wangkefeng.wang@huawei.com>:
    Patch series "init_mm: cleanup ARCH's text/data/brk setup code", v3:
      mm: add setup_initial_init_mm() helper
      arc: convert to setup_initial_init_mm()
      arm: convert to setup_initial_init_mm()
      arm64: convert to setup_initial_init_mm()
      csky: convert to setup_initial_init_mm()
      h8300: convert to setup_initial_init_mm()
      m68k: convert to setup_initial_init_mm()
      nds32: convert to setup_initial_init_mm()
      nios2: convert to setup_initial_init_mm()
      openrisc: convert to setup_initial_init_mm()
      powerpc: convert to setup_initial_init_mm()
      riscv: convert to setup_initial_init_mm()
      s390: convert to setup_initial_init_mm()
      sh: convert to setup_initial_init_mm()
      x86: convert to setup_initial_init_mm()

Subsystem: debug

    Stephen Boyd <swboyd@chromium.org>:
    Patch series "Add build ID to stacktraces", v6:
      buildid: only consider GNU notes for build ID parsing
      buildid: add API to parse build ID out of buffer
      buildid: stash away kernels build ID on init
      dump_stack: add vmlinux build ID to stack traces
      module: add printk formats to add module build ID to stacktraces
      arm64: stacktrace: use %pSb for backtrace printing
      x86/dumpstack: use %pSb/%pBb for backtrace printing
      scripts/decode_stacktrace.sh: support debuginfod
      scripts/decode_stacktrace.sh: silence stderr messages from addr2line/nm
      scripts/decode_stacktrace.sh: indicate 'auto' can be used for base path
      buildid: mark some arguments const
      buildid: fix kernel-doc notation
      kdump: use vmlinux_build_id to simplify

Subsystem: mm/pagemap

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm: rename pud_page_vaddr to pud_pgtable and make it return pmd_t *
      mm: rename p4d_page_vaddr to p4d_pgtable and make it return pud_t *

Subsystem: mm/mremap

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
    Patch series "mrermap fixes", v2:
      selftest/mremap_test: update the test to handle pagesize other than 4K
      selftest/mremap_test: avoid crash with static build
      mm/mremap: convert huge PUD move to separate helper
      mm/mremap: don't enable optimized PUD move if page table levels is 2
      mm/mremap: use pmd/pud_poplulate to update page table entries
      mm/mremap: hold the rmap lock in write mode when moving page table entries.
    Patch series "Speedup mremap on ppc64", v8:
      mm/mremap: allow arch runtime override
      powerpc/book3s64/mm: update flush_tlb_range to flush page walk cache
      powerpc/mm: enable HAVE_MOVE_PMD support

 Documentation/core-api/printk-formats.rst           |   11 
 arch/alpha/include/asm/pgtable.h                    |    8 
 arch/arc/mm/init.c                                  |    5 
 arch/arm/include/asm/pgtable-3level.h               |    2 
 arch/arm/kernel/setup.c                             |    5 
 arch/arm64/include/asm/Kbuild                       |    1 
 arch/arm64/include/asm/cacheflush.h                 |    6 
 arch/arm64/include/asm/kfence.h                     |    2 
 arch/arm64/include/asm/pgtable.h                    |    8 
 arch/arm64/include/asm/set_memory.h                 |   17 +
 arch/arm64/include/uapi/asm/unistd.h                |    1 
 arch/arm64/kernel/machine_kexec.c                   |    1 
 arch/arm64/kernel/setup.c                           |    5 
 arch/arm64/kernel/stacktrace.c                      |    2 
 arch/arm64/mm/mmu.c                                 |    7 
 arch/arm64/mm/pageattr.c                            |   13 
 arch/csky/kernel/setup.c                            |    5 
 arch/h8300/kernel/setup.c                           |    5 
 arch/hexagon/Kconfig                                |    1 
 arch/hexagon/kernel/vmlinux.lds.S                   |    9 
 arch/ia64/include/asm/pgtable.h                     |    4 
 arch/m68k/include/asm/motorola_pgtable.h            |    2 
 arch/m68k/kernel/setup_mm.c                         |    5 
 arch/m68k/kernel/setup_no.c                         |    5 
 arch/mips/include/asm/pgtable-64.h                  |    8 
 arch/nds32/kernel/setup.c                           |    5 
 arch/nios2/kernel/setup.c                           |    5 
 arch/openrisc/kernel/setup.c                        |    5 
 arch/parisc/include/asm/pgtable.h                   |    4 
 arch/powerpc/include/asm/book3s/64/pgtable.h        |   11 
 arch/powerpc/include/asm/book3s/64/tlbflush-radix.h |    2 
 arch/powerpc/include/asm/nohash/64/pgtable-4k.h     |    6 
 arch/powerpc/include/asm/nohash/64/pgtable.h        |    6 
 arch/powerpc/include/asm/tlb.h                      |    6 
 arch/powerpc/kernel/setup-common.c                  |    5 
 arch/powerpc/mm/book3s64/radix_hugetlbpage.c        |    8 
 arch/powerpc/mm/book3s64/radix_pgtable.c            |    6 
 arch/powerpc/mm/book3s64/radix_tlb.c                |   44 +-
 arch/powerpc/mm/pgtable_64.c                        |    4 
 arch/powerpc/platforms/Kconfig.cputype              |    2 
 arch/riscv/Kconfig                                  |    4 
 arch/riscv/include/asm/pgtable-64.h                 |    4 
 arch/riscv/include/asm/unistd.h                     |    1 
 arch/riscv/kernel/setup.c                           |    5 
 arch/s390/kernel/setup.c                            |    5 
 arch/sh/include/asm/pgtable-3level.h                |    4 
 arch/sh/kernel/setup.c                              |    5 
 arch/sparc/include/asm/pgtable_32.h                 |    6 
 arch/sparc/include/asm/pgtable_64.h                 |   10 
 arch/um/include/asm/pgtable-3level.h                |    2 
 arch/x86/entry/syscalls/syscall_32.tbl              |    1 
 arch/x86/entry/syscalls/syscall_64.tbl              |    1 
 arch/x86/include/asm/pgtable.h                      |    8 
 arch/x86/kernel/dumpstack.c                         |    2 
 arch/x86/kernel/setup.c                             |    5 
 arch/x86/mm/init_64.c                               |    4 
 arch/x86/mm/pat/set_memory.c                        |    4 
 arch/x86/mm/pgtable.c                               |    2 
 include/asm-generic/pgtable-nop4d.h                 |    2 
 include/asm-generic/pgtable-nopmd.h                 |    2 
 include/asm-generic/pgtable-nopud.h                 |    4 
 include/linux/bootconfig.h                          |    4 
 include/linux/buildid.h                             |   10 
 include/linux/compaction.h                          |    4 
 include/linux/cpumask.h                             |    2 
 include/linux/crash_core.h                          |   12 
 include/linux/debugobjects.h                        |    2 
 include/linux/hmm.h                                 |    2 
 include/linux/hugetlb.h                             |    6 
 include/linux/kallsyms.h                            |   21 +
 include/linux/list_lru.h                            |    4 
 include/linux/lru_cache.h                           |    8 
 include/linux/mm.h                                  |    3 
 include/linux/mmu_notifier.h                        |    8 
 include/linux/module.h                              |    9 
 include/linux/nodemask.h                            |    6 
 include/linux/percpu-defs.h                         |    2 
 include/linux/percpu-refcount.h                     |    2 
 include/linux/pgtable.h                             |    4 
 include/linux/scatterlist.h                         |    2 
 include/linux/secretmem.h                           |   54 +++
 include/linux/set_memory.h                          |   12 
 include/linux/shrinker.h                            |    2 
 include/linux/syscalls.h                            |    1 
 include/linux/vmalloc.h                             |    4 
 include/uapi/asm-generic/unistd.h                   |    7 
 include/uapi/linux/magic.h                          |    1 
 init/Kconfig                                        |    1 
 init/main.c                                         |    2 
 kernel/crash_core.c                                 |   50 ---
 kernel/kallsyms.c                                   |  104 +++++--
 kernel/module.c                                     |   42 ++
 kernel/power/hibernate.c                            |    5 
 kernel/sys_ni.c                                     |    2 
 lib/Kconfig.debug                                   |   17 -
 lib/asn1_encoder.c                                  |    2 
 lib/buildid.c                                       |   80 ++++-
 lib/devres.c                                        |    2 
 lib/dump_stack.c                                    |   13 
 lib/dynamic_debug.c                                 |    2 
 lib/fonts/font_pearl_8x8.c                          |    2 
 lib/kfifo.c                                         |    2 
 lib/list_sort.c                                     |    2 
 lib/nlattr.c                                        |    4 
 lib/oid_registry.c                                  |    2 
 lib/pldmfw/pldmfw.c                                 |    2 
 lib/reed_solomon/test_rslib.c                       |    2 
 lib/refcount.c                                      |    2 
 lib/rhashtable.c                                    |    2 
 lib/sbitmap.c                                       |    2 
 lib/scatterlist.c                                   |    4 
 lib/seq_buf.c                                       |    2 
 lib/sort.c                                          |    2 
 lib/stackdepot.c                                    |    2 
 lib/test_bitops.c                                   |    2 
 lib/test_bpf.c                                      |    2 
 lib/test_kasan.c                                    |    2 
 lib/test_kmod.c                                     |    6 
 lib/test_scanf.c                                    |    2 
 lib/vsprintf.c                                      |   10 
 mm/Kconfig                                          |    4 
 mm/Makefile                                         |    1 
 mm/gup.c                                            |   12 
 mm/init-mm.c                                        |    9 
 mm/internal.h                                       |    3 
 mm/mlock.c                                          |    3 
 mm/mmap.c                                           |    5 
 mm/mremap.c                                         |  108 ++++++-
 mm/secretmem.c                                      |  254 +++++++++++++++++
 mm/slub.c                                           |   79 +++--
 scripts/checksyscalls.sh                            |    4 
 scripts/decode_stacktrace.sh                        |   89 +++++-
 tools/testing/selftests/vm/.gitignore               |    1 
 tools/testing/selftests/vm/Makefile                 |    3 
 tools/testing/selftests/vm/memfd_secret.c           |  296 ++++++++++++++++++++
 tools/testing/selftests/vm/mremap_test.c            |  116 ++++---
 tools/testing/selftests/vm/run_vmtests.sh           |   17 +
 137 files changed, 1470 insertions(+), 442 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-07-15  4:26 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-07-15  4:26 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

13 patches, based on 40226a3d96ef8ab8980f032681c8bfd46d63874e.

Subsystems affected by this patch series:

  mm/kasan
  mm/pagealloc
  mm/rmap
  mm/hmm
  hfs
  mm/hugetlb

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
      mm: move helper to check slub_debug_enabled

    Yee Lee <yee.lee@mediatek.com>:
      kasan: add memzero init for unaligned size at DEBUG

    Marco Elver <elver@google.com>:
      kasan: fix build by including kernel.h

Subsystem: mm/pagealloc

    Matteo Croce <mcroce@microsoft.com>:
      Revert "mm/page_alloc: make should_fail_alloc_page() static"

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: avoid page allocator recursion with pagesets.lock held

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/page_alloc: correct return value when failing at preparing

    Chuck Lever <chuck.lever@oracle.com>:
      mm/page_alloc: further fix __alloc_pages_bulk() return value

Subsystem: mm/rmap

    Christoph Hellwig <hch@lst.de>:
      mm: fix the try_to_unmap prototype for !CONFIG_MMU

Subsystem: mm/hmm

    Alistair Popple <apopple@nvidia.com>:
      lib/test_hmm: remove set but unused page variable

Subsystem: hfs

    Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>:
    Patch series "hfs: fix various errors", v2:
      hfs: add missing clean-up in hfs_fill_super
      hfs: fix high memory mapping in hfs_bnode_read
      hfs: add lock nesting notation to hfs_find_init

Subsystem: mm/hugetlb

    Joao Martins <joao.m.martins@oracle.com>:
      mm/hugetlb: fix refs calculation from unaligned @vaddr

 fs/hfs/bfind.c        |   14 +++++++++++++-
 fs/hfs/bnode.c        |   25 ++++++++++++++++++++-----
 fs/hfs/btree.h        |    7 +++++++
 fs/hfs/super.c        |   10 +++++-----
 include/linux/kasan.h |    1 +
 include/linux/rmap.h  |    4 +++-
 lib/test_hmm.c        |    2 --
 mm/hugetlb.c          |    5 +++--
 mm/kasan/kasan.h      |   12 ++++++++++++
 mm/page_alloc.c       |   30 ++++++++++++++++++++++--------
 mm/slab.h             |   15 +++++++++++----
 mm/slub.c             |   14 --------------
 12 files changed, 97 insertions(+), 42 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-07-23 22:49 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-07-23 22:49 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

15 patches, based on 704f4cba43d4ed31ef4beb422313f1263d87bc55.

Subsystems affected by this patch series:

  mm/userfaultfd
  mm/kfence
  mm/highmem
  mm/pagealloc
  mm/memblock
  mm/pagecache
  mm/secretmem
  mm/pagemap
  mm/hugetlbfs

Subsystem: mm/userfaultfd

    Peter Collingbourne <pcc@google.com>:
    Patch series "userfaultfd: do not untag user pointers", v5:
      userfaultfd: do not untag user pointers
      selftest: use mmap instead of posix_memalign to allocate memory

Subsystem: mm/kfence

    Weizhao Ouyang <o451686892@gmail.com>:
      kfence: defer kfence_test_init to ensure that kunit debugfs is created

    Alexander Potapenko <glider@google.com>:
      kfence: move the size check to the beginning of __kfence_alloc()
      kfence: skip all GFP_ZONEMASK allocations

Subsystem: mm/highmem

    Christoph Hellwig <hch@lst.de>:
      mm: call flush_dcache_page() in memcpy_to_page() and memzero_page()
      mm: use kmap_local_page in memzero_page

Subsystem: mm/pagealloc

    Sergei Trofimovich <slyfox@gentoo.org>:
      mm: page_alloc: fix page_poison=1 / INIT_ON_ALLOC_DEFAULT_ON interaction

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      memblock: make for_each_mem_range() traverse MEMBLOCK_HOTPLUG regions

Subsystem: mm/pagecache

    Roman Gushchin <guro@fb.com>:
      writeback, cgroup: remove wb from offline list before releasing refcnt
      writeback, cgroup: do not reparent dax inodes

Subsystem: mm/secretmem

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/secretmem: wire up ->set_page_dirty

Subsystem: mm/pagemap

    Muchun Song <songmuchun@bytedance.com>:
      mm: mmap_lock: fix disabling preemption directly

    Qi Zheng <zhengqi.arch@bytedance.com>:
      mm: fix the deadlock in finish_fault()

Subsystem: mm/hugetlbfs

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlbfs: fix mount mode command line processing

 Documentation/arm64/tagged-address-abi.rst |   26 ++++++++++++++++++--------
 fs/fs-writeback.c                          |    3 +++
 fs/hugetlbfs/inode.c                       |    2 +-
 fs/userfaultfd.c                           |   26 ++++++++++++--------------
 include/linux/highmem.h                    |    6 ++++--
 include/linux/memblock.h                   |    4 ++--
 mm/backing-dev.c                           |    2 +-
 mm/kfence/core.c                           |   19 ++++++++++++++++---
 mm/kfence/kfence_test.c                    |    2 +-
 mm/memblock.c                              |    3 ++-
 mm/memory.c                                |   11 ++++++++++-
 mm/mmap_lock.c                             |    4 ++--
 mm/page_alloc.c                            |   29 ++++++++++++++++-------------
 mm/secretmem.c                             |    1 +
 tools/testing/selftests/vm/userfaultfd.c   |    6 ++++--
 15 files changed, 93 insertions(+), 51 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-07-29 21:52 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-07-29 21:52 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

7 patches, based on 7e96bf476270aecea66740a083e51b38c1371cd2.

Subsystems affected by this patch series:

  lib
  ocfs2
  mm/memcg
  mm/migration
  mm/slub
  mm/memcg

Subsystem: lib

    Matteo Croce <mcroce@microsoft.com>:
      lib/test_string.c: move string selftest in the Runtime Testing menu

Subsystem: ocfs2

    Junxiao Bi <junxiao.bi@oracle.com>:
      ocfs2: fix zero out valid data
      ocfs2: issue zeroout to EOF blocks

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: fix blocking rstat function called from atomic cgroup1 thresholding code

Subsystem: mm/migration

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/migrate: fix NR_ISOLATED corruption on 64-bit

Subsystem: mm/slub

    Shakeel Butt <shakeelb@google.com>:
      slub: fix unreclaimable slab stat for bulk free

Subsystem: mm/memcg

    Wang Hai <wanghai38@huawei.com>:
      mm/memcg: fix NULL pointer dereference in memcg_slab_free_hook()

 fs/ocfs2/file.c   |  103 ++++++++++++++++++++++++++++++++----------------------
 lib/Kconfig       |    3 -
 lib/Kconfig.debug |    3 +
 mm/memcontrol.c   |    3 +
 mm/migrate.c      |    2 -
 mm/slab.h         |    2 -
 mm/slub.c         |   22 ++++++-----
 7 files changed, 81 insertions(+), 57 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-08-13 23:53 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-08-13 23:53 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

7 patches, based on f8e6dfc64f6135d1b6c5215c14cd30b9b60a0008.

Subsystems affected by this patch series:

  mm/kasan
  mm/slub
  mm/madvise
  mm/memcg
  lib

Subsystem: mm/kasan

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
    Patch series "kasan, slub: reset tag when printing address", v3:
      kasan, kmemleak: reset tags when scanning block
      kasan, slub: reset tag when printing address

Subsystem: mm/slub

    Shakeel Butt <shakeelb@google.com>:
      slub: fix kmalloc_pagealloc_invalid_free unit test

    Vlastimil Babka <vbabka@suse.cz>:
      mm: slub: fix slub_debug disabling for list of slabs

Subsystem: mm/madvise

    David Hildenbrand <david@redhat.com>:
      mm/madvise: report SIGBUS as -EFAULT for MADV_POPULATE_(READ|WRITE)

Subsystem: mm/memcg

    Waiman Long <longman@redhat.com>:
      mm/memcg: fix incorrect flushing of lruvec data in obj_stock

Subsystem: lib

    Liang Wang <wangliang101@huawei.com>:
      lib: use PFN_PHYS() in devmem_is_allowed()

 lib/devmem_is_allowed.c |    2 +-
 mm/gup.c                |    7 +++++--
 mm/kmemleak.c           |    6 +++---
 mm/madvise.c            |    4 +++-
 mm/memcontrol.c         |    6 ++++--
 mm/slub.c               |   25 ++++++++++++++-----------
 6 files changed, 30 insertions(+), 20 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-08-20  2:03 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-08-20  2:03 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

10 patches, based on 614cb2751d3150850d459bee596c397f344a7936.

Subsystems affected by this patch series:

  mm/shmem
  mm/pagealloc
  mm/tracing
  MAINTAINERS
  mm/memcg
  mm/memory-failure
  mm/vmscan
  mm/kfence
  mm/hugetlb

Subsystem: mm/shmem

    Yang Shi <shy828301@gmail.com>:
      Revert "mm/shmem: fix shmem_swapin() race with swapoff"
      Revert "mm: swap: check if swap backing device is congested or not"

Subsystem: mm/pagealloc

    Doug Berger <opendmb@gmail.com>:
      mm/page_alloc: don't corrupt pcppage_migratetype

Subsystem: mm/tracing

    Mike Rapoport <rppt@linux.ibm.com>:
      mmflags.h: add missing __GFP_ZEROTAGS and __GFP_SKIP_KASAN_POISON names

Subsystem: MAINTAINERS

    Nathan Chancellor <nathan@kernel.org>:
      MAINTAINERS: update ClangBuiltLinux IRC chat

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: fix occasional OOMs due to proportional memory.low reclaim

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/hwpoison: retry with shake_page() for unhandlable pages

Subsystem: mm/vmscan

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: vmscan: fix missing psi annotation for node_reclaim()

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: fix is_kfence_address() for addresses below KFENCE_POOL_SIZE

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: don't pass page cache pages to restore_reserve_on_error

 MAINTAINERS                    |    2 +-
 include/linux/kfence.h         |    7 ++++---
 include/linux/memcontrol.h     |   29 +++++++++++++++--------------
 include/trace/events/mmflags.h |    4 +++-
 mm/hugetlb.c                   |   19 ++++++++++++++-----
 mm/memory-failure.c            |   12 +++++++++---
 mm/page_alloc.c                |   25 ++++++++++++-------------
 mm/shmem.c                     |   14 +-------------
 mm/swap_state.c                |    7 -------
 mm/vmscan.c                    |   30 ++++++++++++++++++++++--------
 10 files changed, 81 insertions(+), 68 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-08-25 19:17 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-08-25 19:17 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

2 patches, based on 6e764bcd1cf72a2846c0e53d3975a09b242c04c9.

Subsystems affected by this patch series:

  mm/memory-hotplug
  MAINTAINERS

Subsystem: mm/memory-hotplug

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memory_hotplug: fix potential permanent lru cache disable

Subsystem: MAINTAINERS

    Namjae Jeon <namjae.jeon@samsung.com>:
      MAINTAINERS: exfat: update my email address

 MAINTAINERS         |    2 +-
 mm/memory_hotplug.c |    1 +
 2 files changed, 2 insertions(+), 1 deletion(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-09-02 21:48 Andrew Morton
  2021-09-02 21:49 ` incoming Andrew Morton
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-09-02 21:48 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b.

Subsystems affected by this patch series:

  ia64
  ocfs2
  block
  mm/slub
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/shmem
  mm/memcg
  mm/selftests
  mm/pagemap
  mm/mremap
  mm/bootmem
  mm/sparsemem
  mm/vmalloc
  mm/kasan
  mm/pagealloc
  mm/memory-failure
  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/compaction
  mm/mempolicy
  mm/memblock
  mm/oom-kill
  mm/migration
  mm/ksm
  mm/percpu
  mm/vmstat
  mm/madvise

Subsystem: ia64

    Jason Wang <wangborong@cdjrlc.com>:
      ia64: fix typo in a comment

    Geert Uytterhoeven <geert+renesas@glider.be>:
    Patch series "ia64: Miscellaneous fixes and cleanups":
      ia64: fix #endif comment for reserve_elfcorehdr()
      ia64: make reserve_elfcorehdr() static
      ia64: make num_rsvd_regions static

Subsystem: ocfs2

    Dan Carpenter <dan.carpenter@oracle.com>:
      ocfs2: remove an unnecessary condition

    Tuo Li <islituo@gmail.com>:
      ocfs2: quota_local: fix possible uninitialized-variable access in ocfs2_local_read_info()

    Gang He <ghe@suse.com>:
      ocfs2: ocfs2_downconvert_lock failure results in deadlock

Subsystem: block

    kernel test robot <lkp@intel.com>:
      arch/csky/kernel/probes/kprobes.c: fix bugon.cocci warnings

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v4:
      mm, slub: don't call flush_all() from slab_debug_trace_open()
      mm, slub: allocate private object map for debugfs listings
      mm, slub: allocate private object map for validate_slab_cache()
      mm, slub: don't disable irq for debug_check_no_locks_freed()
      mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
      mm, slub: unify cmpxchg_double_slab() and __cmpxchg_double_slab()
      mm, slub: extract get_partial() from new_slab_objects()
      mm, slub: dissolve new_slab_objects() into ___slab_alloc()
      mm, slub: return slab page from get_partial() and set c->page afterwards
      mm, slub: restructure new page checks in ___slab_alloc()
      mm, slub: simplify kmem_cache_cpu and tid setup
      mm, slub: move disabling/enabling irqs to ___slab_alloc()
      mm, slub: do initial checks in ___slab_alloc() with irqs enabled
      mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
      mm, slub: restore irqs around calling new_slab()
      mm, slub: validate slab from partial list or page allocator before making it cpu slab
      mm, slub: check new pages with restored irqs
      mm, slub: stop disabling irqs around get_partial()
      mm, slub: move reset of c->page and freelist out of deactivate_slab()
      mm, slub: make locking in deactivate_slab() irq-safe
      mm, slub: call deactivate_slab() without disabling irqs
      mm, slub: move irq control into unfreeze_partials()
      mm, slub: discard slabs in unfreeze_partials() without irqs disabled
      mm, slub: detach whole partial list at once in unfreeze_partials()
      mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
      mm, slub: only disable irq with spin_lock in __unfreeze_partials()
      mm, slub: don't disable irqs in slub_cpu_dead()
      mm, slab: make flush_slab() possible to call with irqs enabled

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
      mm: slub: make object_map_lock a raw_spinlock_t

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: optionally save/restore irqs in slab_[un]lock()/
      mm, slub: make slab_lock() disable irqs with PREEMPT_RT
      mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
      mm, slub: use migrate_disable() on PREEMPT_RT
      mm, slub: convert kmem_cpu_slab protection to local_lock

Subsystem: mm/debug

    Gavin Shan <gshan@redhat.com>:
    Patch series "mm/debug_vm_pgtable: Enhancements", v6:
      mm/debug_vm_pgtable: introduce struct pgtable_debug_args
      mm/debug_vm_pgtable: use struct pgtable_debug_args in basic tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in leaf and savewrite tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in protnone and devmap tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in soft_dirty and swap tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in migration and thp tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PTE modifying tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PMD modifying tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PUD modifying tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PGD and P4D modifying tests
      mm/debug_vm_pgtable: remove unused code
      mm/debug_vm_pgtable: fix corrupted page flag

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: report a more useful address for reclaim acquisition

    liuhailong <liuhailong@oppo.com>:
      mm: add kernel_misc_reclaimable in show_free_areas

Subsystem: mm/pagecache

    Jan Kara <jack@suse.cz>:
    Patch series "writeback: Fix bandwidth estimates", v4:
      writeback: track number of inodes under writeback
      writeback: reliably update bandwidth estimation
      writeback: fix bandwidth estimate for spiky workload
      writeback: rename domain_update_bandwidth()
      writeback: use READ_ONCE for unlocked reads of writeback stats

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: remove irqsave/restore locking from contexts with irqs enabled
      fs: drop_caches: fix skipping over shadow cache inodes
      fs: inode: count invalidated shadow pages in pginodesteal

    Shakeel Butt <shakeelb@google.com>:
      writeback: memcg: simplify cgroup_writeback_by_id

    Jing Yangyang <jing.yangyang@zte.com.cn>:
      include/linux/buffer_head.h: fix boolreturn.cocci warnings

Subsystem: mm/gup

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups and fixup for gup":
      mm: gup: remove set but unused local variable major
      mm: gup: remove unneed local variable orig_refs
      mm: gup: remove useless BUG_ON in __get_user_pages()
      mm: gup: fix potential pgmap refcnt leak in __gup_device_huge()
      mm: gup: use helper PAGE_ALIGNED in populate_vma_page_range()

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "A few gup refactorings and documentation updates", v3:
      mm/gup: documentation corrections for gup/pup
      mm/gup: small refactoring: simplify try_grab_page()
      mm/gup: remove try_get_page(), call try_get_compound_head() directly

Subsystem: mm/swap

    Hugh Dickins <hughd@google.com>:
      fs, mm: fix race in unlinking swapfile

    John Hubbard <jhubbard@nvidia.com>:
      mm: delete unused get_kernel_page()

Subsystem: mm/shmem

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      shmem: use raw_spinlock_t for ->stat_lock

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups for shmem":
      shmem: remove unneeded variable ret
      shmem: remove unneeded header file
      shmem: remove unneeded function forward declaration
      shmem: include header file to declare swap_info

    Hugh Dickins <hughd@google.com>:
    Patch series "huge tmpfs: shmem_is_huge() fixes and cleanups":
      huge tmpfs: fix fallocate(vanilla) advance over huge pages
      huge tmpfs: fix split_huge_page() after FALLOC_FL_KEEP_SIZE
      huge tmpfs: remove shrinklist addition from shmem_setattr()
      huge tmpfs: revert shmem's use of transhuge_vma_enabled()
      huge tmpfs: move shmem_huge_enabled() upwards
      huge tmpfs: SGP_NOALLOC to stop collapse_file() on race
      huge tmpfs: shmem_is_huge(vma, inode, index)
      huge tmpfs: decide stat.st_blksize by shmem_is_huge()
      shmem: shmem_writepage() split unlikely i915 THP

Subsystem: mm/memcg

    Suren Baghdasaryan <surenb@google.com>:
      mm, memcg: add mem_cgroup_disabled checks in vmpressure and swap-related functions
      mm, memcg: inline mem_cgroup_{charge/uncharge} to improve disabled memcg config
      mm, memcg: inline swap-related functions to improve disabled memcg config

    Vasily Averin <vvs@virtuozzo.com>:
      memcg: enable accounting for pids in nested pid namespaces

    Shakeel Butt <shakeelb@google.com>:
      memcg: switch lruvec stats to rstat
      memcg: infrastructure to flush memcg stats

    Yutian Yang <nglaive@gmail.com>:
      memcg: charge fs_context and legacy_fs_context

    Vasily Averin <vvs@virtuozzo.com>:
    Patch series "memcg accounting from OpenVZ", v7:
      memcg: enable accounting for mnt_cache entries
      memcg: enable accounting for pollfd and select bits arrays
      memcg: enable accounting for file lock caches
      memcg: enable accounting for fasync_cache
      memcg: enable accounting for new namesapces and struct nsproxy
      memcg: enable accounting of ipc resources
      memcg: enable accounting for signals
      memcg: enable accounting for posix_timers_cache slab
      memcg: enable accounting for ldt_struct objects

    Shakeel Butt <shakeelb@google.com>:
      memcg: cleanup racy sum avoidance code

    Vasily Averin <vvs@virtuozzo.com>:
      memcg: replace in_interrupt() by !in_task() in active_memcg()

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: memcontrol: set the correct memcg swappiness restriction

    Miaohe Lin <linmiaohe@huawei.com>:
      mm, memcg: remove unused functions
      mm, memcg: save some atomic ops when flush is already true

    Michal Hocko <mhocko@suse.com>:
      memcg: fix up drain_local_stock comment

    Shakeel Butt <shakeelb@google.com>:
      memcg: make memcg->event_list_lock irqsafe

Subsystem: mm/selftests

    Po-Hsu Lin <po-hsu.lin@canonical.com>:
      selftests/vm: use kselftest skip code for skipped tests

    Colin Ian King <colin.king@canonical.com>:
      selftests: Fix spelling mistake "cann't" -> "cannot"

Subsystem: mm/pagemap

    Nicholas Piggin <npiggin@gmail.com>:
    Patch series "shoot lazy tlbs", v4:
      lazy tlb: introduce lazy mm refcount helper functions
      lazy tlb: allow lazy tlb mm refcounting to be configurable
      lazy tlb: shoot lazies, a non-refcounting lazy tlb option
      powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN

    Christoph Hellwig <hch@lst.de>:
    Patch series "_kernel_dcache_page fixes and removal":
      mmc: JZ4740: remove the flush_kernel_dcache_page call in jz4740_mmc_read_data
      mmc: mmc_spi: replace flush_kernel_dcache_page with flush_dcache_page
      scatterlist: replace flush_kernel_dcache_page with flush_dcache_page
      mm: remove flush_kernel_dcache_page

    Huang Ying <ying.huang@intel.com>:
      mm,do_huge_pmd_numa_page: remove unnecessary TLB flushing code

    Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
      mm: change fault_in_pages_* to have an unsigned size parameter

    Luigi Rizzo <lrizzo@google.com>:
      mm/pagemap: add mmap_assert_locked() annotations to find_vma*()

    "Liam R. Howlett" <Liam.Howlett@Oracle.com>:
      remap_file_pages: Use vma_lookup() instead of find_vma()

Subsystem: mm/mremap

    Chen Wandun <chenwandun@huawei.com>:
      mm/mremap: fix memory account on do_munmap() failure

Subsystem: mm/bootmem

    Muchun Song <songmuchun@bytedance.com>:
      mm/bootmem_info.c: mark __init on register_page_bootmem_info_section

Subsystem: mm/sparsemem

    Ohhoon Kwon <ohoono.kwon@samsung.com>:
    Patch series "mm: sparse: remove __section_nr() function", v4:
      mm: sparse: pass section_nr to section_mark_present
      mm: sparse: pass section_nr to find_memory_block
      mm: sparse: remove __section_nr() function

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/sparse: set SECTION_NID_SHIFT to 6

    Matthew Wilcox <willy@infradead.org>:
      include/linux/mmzone.h: avoid a warning in sparse memory support

    Miles Chen <miles.chen@mediatek.com>:
      mm/sparse: clarify pgdat_to_phys

Subsystem: mm/vmalloc

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: use batched page requests in bulk-allocator
      mm/vmalloc: remove gfpflags_allow_blocking() check
      lib/test_vmalloc.c: add a new 'nr_pages' parameter

    Chen Wandun <chenwandun@huawei.com>:
      mm/vmalloc: fix wrong behavior in vread

Subsystem: mm/kasan

    Woody Lin <woodylin@google.com>:
      mm/kasan: move kasan.fault to mm/kasan/report.c

    Andrey Konovalov <andreyknvl@gmail.com>:
    Patch series "kasan: test: avoid crashing the kernel with HW_TAGS", v2:
      kasan: test: rework kmalloc_oob_right
      kasan: test: avoid writing invalid memory
      kasan: test: avoid corrupting memory via memset
      kasan: test: disable kmalloc_memmove_invalid_size for HW_TAGS
      kasan: test: only do kmalloc_uaf_memset for generic mode
      kasan: test: clean up ksize_uaf
      kasan: test: avoid corrupting memory in copy_user_test
      kasan: test: avoid corrupting memory in kasan_rcu_uaf

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: ensure consistency of memory map poisoning":
      mm/page_alloc: always initialize memory map for the holes
      microblaze: simplify pte_alloc_one_kernel()
      mm: introduce memmap_alloc() to unify memory map allocation
      memblock: stop poisoning raw allocations

    Nico Pache <npache@redhat.com>:
      mm/page_alloc.c: fix 'zone_id' may be used uninitialized in this function warning

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/page_alloc: make alloc_node_mem_map() __init rather than __ref

    Vasily Averin <vvs@virtuozzo.com>:
      mm/page_alloc.c: use in_task()

    "George G. Davis" <davis.george@siemens.com>:
      mm/page_isolation: tracing: trace all test_pages_isolated failures

Subsystem: mm/memory-failure

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups and fixup for hwpoison":
      mm/hwpoison: remove unneeded variable unmap_success
      mm/hwpoison: fix potential pte_unmap_unlock pte error
      mm/hwpoison: change argument struct page **hpagep to *hpage
      mm/hwpoison: fix some obsolete comments

    Yang Shi <shy828301@gmail.com>:
      mm: hwpoison: don't drop slab caches for offlining non-LRU page
      doc: hwpoison: correct the support for hugepage
      mm: hwpoison: dump page for unhandlable page

    Michael Wang <yun.wang@linux.alibaba.com>:
      mm: fix panic caused by __page_handle_poison()

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: simplify prep_compound_gigantic_page ref count racing code
      hugetlb: drop ref count earlier after page allocation
      hugetlb: before freeing hugetlb page set dtor to appropriate value
      hugetlb: fix hugetlb cgroup refcounting during vma split

Subsystem: mm/userfaultfd

    Nadav Amit <namit@vmware.com>:
    Patch series "userfaultfd: minor bug fixes":
      userfaultfd: change mmap_changing to atomic
      userfaultfd: prevent concurrent API initialization
      selftests/vm/userfaultfd: wake after copy failure

Subsystem: mm/vmscan

    Dave Hansen <dave.hansen@linux.intel.com>:
    Patch series "Migrate Pages in lieu of discard", v11:
      mm/numa: automatically generate node migration order
      mm/migrate: update node demotion order on hotplug events

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm/migrate: enable returning precise migrate_pages() success count

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/migrate: demote pages during reclaim

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm/vmscan: add page demotion counter

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: add helper for querying ability to age anonymous pages

    Keith Busch <kbusch@kernel.org>:
      mm/vmscan: Consider anonymous pages without swap

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: never demote for memcg reclaim

    Huang Ying <ying.huang@intel.com>:
      mm/migrate: add sysfs interface to enable reclaim migration

    Hui Su <suhui@zeku.com>:
      mm/vmpressure: replace vmpressure_to_css() with vmpressure_to_memcg()

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups for vmscan", v2:
      mm/vmscan: remove the PageDirty check after MADV_FREE pages are page_ref_freezed
      mm/vmscan: remove misleading setting to sc->priority
      mm/vmscan: remove unneeded return value of kswapd_run()
      mm/vmscan: add 'else' to remove check_pending label

    Vlastimil Babka <vbabka@suse.cz>:
      mm, vmscan: guarantee drop_slab_node() termination

Subsystem: mm/compaction

    Charan Teja Reddy <charante@codeaurora.org>:
      mm: compaction: optimize proactive compaction deferrals
      mm: compaction: support triggering of proactive compaction by user

Subsystem: mm/mempolicy

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/mempolicy: use readable NUMA_NO_NODE macro instead of magic number

    Dave Hansen <dave.hansen@linux.intel.com>:
    Patch series "Introduce multi-preference mempolicy", v7:
      mm/mempolicy: add MPOL_PREFERRED_MANY for multiple preferred nodes

    Feng Tang <feng.tang@intel.com>:
      mm/memplicy: add page allocation function for MPOL_PREFERRED_MANY policy

    Ben Widawsky <ben.widawsky@intel.com>:
      mm/hugetlb: add support for mempolicy MPOL_PREFERRED_MANY
      mm/mempolicy: advertise new MPOL_PREFERRED_MANY

    Feng Tang <feng.tang@intel.com>:
      mm/mempolicy: unify the create() func for bind/interleave/prefer-many policies

    Vasily Averin <vvs@virtuozzo.com>:
      mm/mempolicy.c: use in_task() in mempolicy_slab_node()

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      memblock: make memblock_find_in_range method private

Subsystem: mm/oom-kill

    Suren Baghdasaryan <surenb@google.com>:
      mm: introduce process_mrelease system call
      mm: wire up syscall process_mrelease

Subsystem: mm/migration

    Randy Dunlap <rdunlap@infradead.org>:
      mm/migrate: correct kernel-doc notation

Subsystem: mm/ksm

    Zhansaya Bagdauletkyzy <zhansayabagdaulet@gmail.com>:
    Patch series "add KSM selftests":
      selftests: vm: add KSM merge test
      selftests: vm: add KSM unmerge test
      selftests: vm: add KSM zero page merging test
      selftests: vm: add KSM merging across nodes test
      mm: KSM: fix data type
    Patch series "add KSM performance tests", v3:
      selftests: vm: add KSM merging time test
      selftests: vm: add COW time test for KSM pages

Subsystem: mm/percpu

    Jing Xiangfeng <jingxiangfeng@huawei.com>:
      mm/percpu,c: remove obsolete comments of pcpu_chunk_populated()

Subsystem: mm/vmstat

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup for vmstat":
      mm/vmstat: correct some wrong comments
      mm/vmstat: simplify the array size calculation
      mm/vmstat: remove unneeded return value

Subsystem: mm/madvise

    zhangkui <zhangkui@oppo.com>:
      mm/madvise: add MADV_WILLNEED to process_madvise()

 Documentation/ABI/testing/sysfs-kernel-mm-numa         |   24 
 Documentation/admin-guide/mm/numa_memory_policy.rst    |   15 
 Documentation/admin-guide/sysctl/vm.rst                |    3 
 Documentation/core-api/cachetlb.rst                    |   86 -
 Documentation/dev-tools/kasan.rst                      |   13 
 Documentation/translations/zh_CN/core-api/cachetlb.rst |    9 
 Documentation/vm/hwpoison.rst                          |    1 
 arch/Kconfig                                           |   28 
 arch/alpha/kernel/syscalls/syscall.tbl                 |    2 
 arch/arm/include/asm/cacheflush.h                      |    4 
 arch/arm/kernel/setup.c                                |   20 
 arch/arm/mach-rpc/ecard.c                              |    2 
 arch/arm/mm/flush.c                                    |   33 
 arch/arm/mm/nommu.c                                    |    6 
 arch/arm/tools/syscall.tbl                             |    2 
 arch/arm64/include/asm/unistd.h                        |    2 
 arch/arm64/include/asm/unistd32.h                      |    2 
 arch/arm64/kvm/hyp/reserved_mem.c                      |    9 
 arch/arm64/mm/init.c                                   |   38 
 arch/csky/abiv1/cacheflush.c                           |   11 
 arch/csky/abiv1/inc/abi/cacheflush.h                   |    4 
 arch/csky/kernel/probes/kprobes.c                      |    3 
 arch/ia64/include/asm/meminit.h                        |    2 
 arch/ia64/kernel/acpi.c                                |    2 
 arch/ia64/kernel/setup.c                               |   55 
 arch/ia64/kernel/syscalls/syscall.tbl                  |    2 
 arch/m68k/kernel/syscalls/syscall.tbl                  |    2 
 arch/microblaze/include/asm/page.h                     |    3 
 arch/microblaze/include/asm/pgtable.h                  |    2 
 arch/microblaze/kernel/syscalls/syscall.tbl            |    2 
 arch/microblaze/mm/init.c                              |   12 
 arch/microblaze/mm/pgtable.c                           |   17 
 arch/mips/include/asm/cacheflush.h                     |    8 
 arch/mips/kernel/setup.c                               |   14 
 arch/mips/kernel/syscalls/syscall_n32.tbl              |    2 
 arch/mips/kernel/syscalls/syscall_n64.tbl              |    2 
 arch/mips/kernel/syscalls/syscall_o32.tbl              |    2 
 arch/nds32/include/asm/cacheflush.h                    |    3 
 arch/nds32/mm/cacheflush.c                             |    9 
 arch/parisc/include/asm/cacheflush.h                   |    8 
 arch/parisc/kernel/cache.c                             |    3 
 arch/parisc/kernel/syscalls/syscall.tbl                |    2 
 arch/powerpc/Kconfig                                   |    1 
 arch/powerpc/kernel/smp.c                              |    2 
 arch/powerpc/kernel/syscalls/syscall.tbl               |    2 
 arch/powerpc/mm/book3s64/radix_tlb.c                   |    4 
 arch/powerpc/platforms/pseries/hotplug-memory.c        |    4 
 arch/riscv/mm/init.c                                   |   44 
 arch/s390/kernel/setup.c                               |    9 
 arch/s390/kernel/syscalls/syscall.tbl                  |    2 
 arch/s390/mm/fault.c                                   |    2 
 arch/sh/include/asm/cacheflush.h                       |    8 
 arch/sh/kernel/syscalls/syscall.tbl                    |    2 
 arch/sparc/kernel/syscalls/syscall.tbl                 |    2 
 arch/x86/entry/syscalls/syscall_32.tbl                 |    1 
 arch/x86/entry/syscalls/syscall_64.tbl                 |    1 
 arch/x86/kernel/aperture_64.c                          |    5 
 arch/x86/kernel/ldt.c                                  |    6 
 arch/x86/mm/init.c                                     |   23 
 arch/x86/mm/numa.c                                     |    5 
 arch/x86/mm/numa_emulation.c                           |    5 
 arch/x86/realmode/init.c                               |    2 
 arch/xtensa/kernel/syscalls/syscall.tbl                |    2 
 block/blk-map.c                                        |    2 
 drivers/acpi/tables.c                                  |    5 
 drivers/base/arch_numa.c                               |    5 
 drivers/base/memory.c                                  |    4 
 drivers/mmc/host/jz4740_mmc.c                          |    4 
 drivers/mmc/host/mmc_spi.c                             |    2 
 drivers/of/of_reserved_mem.c                           |   12 
 fs/drop_caches.c                                       |    3 
 fs/exec.c                                              |   12 
 fs/fcntl.c                                             |    3 
 fs/fs-writeback.c                                      |   28 
 fs/fs_context.c                                        |    4 
 fs/inode.c                                             |    2 
 fs/locks.c                                             |    6 
 fs/namei.c                                             |    8 
 fs/namespace.c                                         |    7 
 fs/ocfs2/dlmglue.c                                     |   14 
 fs/ocfs2/quota_global.c                                |    1 
 fs/ocfs2/quota_local.c                                 |    2 
 fs/pipe.c                                              |    2 
 fs/select.c                                            |    4 
 fs/userfaultfd.c                                       |  116 -
 include/linux/backing-dev-defs.h                       |    2 
 include/linux/backing-dev.h                            |   19 
 include/linux/buffer_head.h                            |    2 
 include/linux/compaction.h                             |    2 
 include/linux/highmem.h                                |    5 
 include/linux/hugetlb_cgroup.h                         |   12 
 include/linux/memblock.h                               |    2 
 include/linux/memcontrol.h                             |  118 +
 include/linux/memory.h                                 |    2 
 include/linux/mempolicy.h                              |   16 
 include/linux/migrate.h                                |   14 
 include/linux/mm.h                                     |   17 
 include/linux/mmzone.h                                 |    4 
 include/linux/page-flags.h                             |    9 
 include/linux/pagemap.h                                |    4 
 include/linux/sched/mm.h                               |   35 
 include/linux/shmem_fs.h                               |   25 
 include/linux/slub_def.h                               |    6 
 include/linux/swap.h                                   |   28 
 include/linux/syscalls.h                               |    1 
 include/linux/userfaultfd_k.h                          |    8 
 include/linux/vm_event_item.h                          |    2 
 include/linux/vmpressure.h                             |    2 
 include/linux/writeback.h                              |    4 
 include/trace/events/migrate.h                         |    3 
 include/uapi/asm-generic/unistd.h                      |    4 
 include/uapi/linux/mempolicy.h                         |    1 
 ipc/msg.c                                              |    2 
 ipc/namespace.c                                        |    2 
 ipc/sem.c                                              |    9 
 ipc/shm.c                                              |    2 
 kernel/cgroup/namespace.c                              |    2 
 kernel/cpu.c                                           |    2 
 kernel/exit.c                                          |    2 
 kernel/fork.c                                          |   51 
 kernel/kthread.c                                       |   21 
 kernel/nsproxy.c                                       |    2 
 kernel/pid_namespace.c                                 |    5 
 kernel/sched/core.c                                    |   37 
 kernel/sched/sched.h                                   |    4 
 kernel/signal.c                                        |    2 
 kernel/sys_ni.c                                        |    1 
 kernel/sysctl.c                                        |    2 
 kernel/time/namespace.c                                |    4 
 kernel/time/posix-timers.c                             |    4 
 kernel/user_namespace.c                                |    2 
 lib/scatterlist.c                                      |    5 
 lib/test_kasan.c                                       |   80 -
 lib/test_kasan_module.c                                |   20 
 lib/test_vmalloc.c                                     |    5 
 mm/backing-dev.c                                       |   11 
 mm/bootmem_info.c                                      |    4 
 mm/compaction.c                                        |   69 -
 mm/debug_vm_pgtable.c                                  |  982 +++++++++------
 mm/filemap.c                                           |   15 
 mm/gup.c                                               |  109 -
 mm/huge_memory.c                                       |   32 
 mm/hugetlb.c                                           |  173 ++
 mm/hwpoison-inject.c                                   |    2 
 mm/internal.h                                          |    9 
 mm/kasan/hw_tags.c                                     |   43 
 mm/kasan/kasan.h                                       |    1 
 mm/kasan/report.c                                      |   29 
 mm/khugepaged.c                                        |    2 
 mm/ksm.c                                               |    8 
 mm/madvise.c                                           |    1 
 mm/memblock.c                                          |   22 
 mm/memcontrol.c                                        |  234 +--
 mm/memory-failure.c                                    |   53 
 mm/memory_hotplug.c                                    |    2 
 mm/mempolicy.c                                         |  207 ++-
 mm/migrate.c                                           |  319 ++++
 mm/mmap.c                                              |    7 
 mm/mremap.c                                            |    2 
 mm/oom_kill.c                                          |   70 +
 mm/page-writeback.c                                    |  133 +-
 mm/page_alloc.c                                        |   62 
 mm/page_isolation.c                                    |   13 
 mm/percpu.c                                            |    3 
 mm/shmem.c                                             |  309 ++--
 mm/slab_common.c                                       |    2 
 mm/slub.c                                              | 1085 ++++++++++-------
 mm/sparse.c                                            |   46 
 mm/swap.c                                              |   22 
 mm/swapfile.c                                          |   14 
 mm/truncate.c                                          |   28 
 mm/userfaultfd.c                                       |   15 
 mm/vmalloc.c                                           |   79 -
 mm/vmpressure.c                                        |   10 
 mm/vmscan.c                                            |  220 ++-
 mm/vmstat.c                                            |   25 
 security/tomoyo/domain.c                               |   13 
 tools/testing/scatterlist/linux/mm.h                   |    1 
 tools/testing/selftests/vm/.gitignore                  |    1 
 tools/testing/selftests/vm/Makefile                    |    3 
 tools/testing/selftests/vm/charge_reserved_hugetlb.sh  |    5 
 tools/testing/selftests/vm/hugetlb_reparenting_test.sh |    5 
 tools/testing/selftests/vm/ksm_tests.c                 |  696 ++++++++++
 tools/testing/selftests/vm/mlock-random-test.c         |    2 
 tools/testing/selftests/vm/run_vmtests.sh              |   98 +
 tools/testing/selftests/vm/userfaultfd.c               |   13 
 186 files changed, 4488 insertions(+), 2281 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-09-02 21:48 incoming Andrew Morton
@ 2021-09-02 21:49 ` Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-09-02 21:49 UTC (permalink / raw)
  To: Linus Torvalds, linux-mm, mm-commits

On Thu, 2 Sep 2021 14:48:20 -0700 Andrew Morton <akpm@linux-foundation.org> wrote:

> 212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b.

Make that "based on 7d2a07b769330c34b4deabeed939325c77a7ec2f".

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-09-08  2:52 Andrew Morton
  2021-09-08  8:57 ` incoming Vlastimil Babka
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-09-08  2:52 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

147 patches, based on 7d2a07b769330c34b4deabeed939325c77a7ec2f.

Subsystems affected by this patch series:

  mm/slub
  mm/memory-hotplug
  mm/rmap
  mm/ioremap
  mm/highmem
  mm/cleanups
  mm/secretmem
  mm/kfence
  mm/damon
  alpha
  percpu
  procfs
  misc
  core-kernel
  MAINTAINERS
  lib
  bitops
  checkpatch
  epoll
  init
  nilfs2
  coredump
  fork
  pids
  criu
  kconfig
  selftests
  ipc
  mm/vmscan
  scripts

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6:
      mm, slub: don't call flush_all() from slab_debug_trace_open()
      mm, slub: allocate private object map for debugfs listings
      mm, slub: allocate private object map for validate_slab_cache()
      mm, slub: don't disable irq for debug_check_no_locks_freed()
      mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
      mm, slub: extract get_partial() from new_slab_objects()
      mm, slub: dissolve new_slab_objects() into ___slab_alloc()
      mm, slub: return slab page from get_partial() and set c->page afterwards
      mm, slub: restructure new page checks in ___slab_alloc()
      mm, slub: simplify kmem_cache_cpu and tid setup
      mm, slub: move disabling/enabling irqs to ___slab_alloc()
      mm, slub: do initial checks in ___slab_alloc() with irqs enabled
      mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
      mm, slub: restore irqs around calling new_slab()
      mm, slub: validate slab from partial list or page allocator before making it cpu slab
      mm, slub: check new pages with restored irqs
      mm, slub: stop disabling irqs around get_partial()
      mm, slub: move reset of c->page and freelist out of deactivate_slab()
      mm, slub: make locking in deactivate_slab() irq-safe
      mm, slub: call deactivate_slab() without disabling irqs
      mm, slub: move irq control into unfreeze_partials()
      mm, slub: discard slabs in unfreeze_partials() without irqs disabled
      mm, slub: detach whole partial list at once in unfreeze_partials()
      mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
      mm, slub: only disable irq with spin_lock in __unfreeze_partials()
      mm, slub: don't disable irqs in slub_cpu_dead()
      mm, slab: split out the cpu offline variant of flush_slab()

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
      mm: slub: make object_map_lock a raw_spinlock_t

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: make slab_lock() disable irqs with PREEMPT_RT
      mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
      mm, slub: use migrate_disable() on PREEMPT_RT
      mm, slub: convert kmem_cpu_slab protection to local_lock

Subsystem: mm/memory-hotplug

    David Hildenbrand <david@redhat.com>:
    Patch series "memory-hotplug.rst: complete admin-guide overhaul", v3:
      memory-hotplug.rst: remove locking details from admin-guide
      memory-hotplug.rst: complete admin-guide overhaul

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE":
      mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE
      mm: memory_hotplug: cleanup after removal of pfn_valid_within()

    David Hildenbrand <david@redhat.com>:
    Patch series "mm/memory_hotplug: preparatory patches for new online policy and memory":
      mm/memory_hotplug: use "unsigned long" for PFN in zone_for_pfn_range()
      mm/memory_hotplug: remove nid parameter from arch_remove_memory()
      mm/memory_hotplug: remove nid parameter from remove_memory() and friends
      ACPI: memhotplug: memory resources cannot be enabled yet
    Patch series "mm/memory_hotplug: "auto-movable" online policy and memory groups", v3:
      mm: track present early pages per zone
      mm/memory_hotplug: introduce "auto-movable" online policy
      drivers/base/memory: introduce "memory groups" to logically group memory blocks
      mm/memory_hotplug: track present pages in memory groups
      ACPI: memhotplug: use a single static memory group for a single memory device
      dax/kmem: use a single static memory group for a single probed unit
      virtio-mem: use a single dynamic memory group for a single virtio-mem device
      mm/memory_hotplug: memory group aware "auto-movable" online policy
      mm/memory_hotplug: improved dynamic memory group aware "auto-movable" online policy

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixups for memory hotplug":
      mm/memory_hotplug: use helper zone_is_zone_device() to simplify the code

Subsystem: mm/rmap

    Muchun Song <songmuchun@bytedance.com>:
      mm: remove redundant compound_head() calling

Subsystem: mm/ioremap

    Christoph Hellwig <hch@lst.de>:
      riscv: only select GENERIC_IOREMAP if MMU support is enabled
    Patch series "small ioremap cleanups":
      mm: move ioremap_page_range to vmalloc.c
      mm: don't allow executable ioremap mappings

    Weizhao Ouyang <o451686892@gmail.com>:
      mm/early_ioremap.c: remove redundant early_ioremap_shutdown()

Subsystem: mm/highmem

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      highmem: don't disable preemption on RT in kmap_atomic()

Subsystem: mm/cleanups

    Changbin Du <changbin.du@gmail.com>:
      mm: in_irq() cleanup

    Muchun Song <songmuchun@bytedance.com>:
      mm: introduce PAGEFLAGS_MASK to replace ((1UL << NR_PAGEFLAGS) - 1)

Subsystem: mm/secretmem

    Jordy Zomer <jordy@jordyzomer.github.io>:
      mm/secretmem: use refcount_t instead of atomic_t

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: show cpu and timestamp in alloc/free info
      kfence: test: fail fast if disabled at boot

Subsystem: mm/damon

    SeongJae Park <sjpark@amazon.de>:
    Patch series "Introduce Data Access MONitor (DAMON)", v34:
      mm: introduce Data Access MONitor (DAMON)
      mm/damon/core: implement region-based sampling
      mm/damon: adaptively adjust regions
      mm/idle_page_tracking: make PG_idle reusable
      mm/damon: implement primitives for the virtual memory address spaces
      mm/damon: add a tracepoint
      mm/damon: implement a debugfs-based user space interface
      mm/damon/dbgfs: export kdamond pid to the user space
      mm/damon/dbgfs: support multiple contexts
      Documentation: add documents for DAMON
      mm/damon: add kunit tests
      mm/damon: add user space selftests
      MAINTAINERS: update for DAMON

Subsystem: alpha

    Randy Dunlap <rdunlap@infradead.org>:
      alpha: agp: make empty macros use do-while-0 style
      alpha: pci-sysfs: fix all kernel-doc warnings

Subsystem: percpu

    Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
      percpu: remove export of pcpu_base_addr

Subsystem: procfs

    Feng Zhou <zhoufeng.zf@bytedance.com>:
      fs/proc/kcore.c: add mmap interface

    Christoph Hellwig <hch@lst.de>:
      proc: stop using seq_get_buf in proc_task_name

    Ohhoon Kwon <ohoono.kwon@samsung.com>:
      connector: send event on write to /proc/[pid]/comm

Subsystem: misc

    Colin Ian King <colin.king@canonical.com>:
      arch: Kconfig: fix spelling mistake "seperate" -> "separate"

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      include/linux/once.h: fix trivia typo Not -> Note

    Daniel Lezcano <daniel.lezcano@linaro.org>:
    Patch series "Add Hz macros", v3:
      units: change from 'L' to 'UL'
      units: add the HZ macros
      thermal/drivers/devfreq_cooling: use HZ macros
      devfreq: use HZ macros
      iio/drivers/as73211: use HZ macros
      hwmon/drivers/mr75203: use HZ macros
      iio/drivers/hid-sensor: use HZ macros
      i2c/drivers/ov02q10: use HZ macros
      mtd/drivers/nand: use HZ macros
      phy/drivers/stm32: use HZ macros

Subsystem: core-kernel

    Yang Yang <yang.yang29@zte.com.cn>:
      kernel/acct.c: use dedicated helper to access rlimit values

    Pavel Skripkin <paskripkin@gmail.com>:
      profiling: fix shift-out-of-bounds bugs

Subsystem: MAINTAINERS

    Nathan Chancellor <nathan@kernel.org>:
      MAINTAINERS: update ClangBuiltLinux mailing list
      Documentation/llvm: update mailing list
      Documentation/llvm: update IRC location

Subsystem: lib

    Geert Uytterhoeven <geert@linux-m68k.org>:
    Patch series "math: RATIONAL and RATIONAL_KUNIT_TEST improvements":
      math: make RATIONAL tristate
      math: RATIONAL_KUNIT_TEST should depend on RATIONAL instead of selecting it

    Matteo Croce <mcroce@microsoft.com>:
    Patch series "lib/string: optimized mem* functions", v2:
      lib/string: optimized memcpy
      lib/string: optimized memmove
      lib/string: optimized memset

    Daniel Latypov <dlatypov@google.com>:
      lib/test: convert test_sort.c to use KUnit

    Randy Dunlap <rdunlap@infradead.org>:
      lib/dump_stack: correct kernel-doc notation
      lib/iov_iter.c: fix kernel-doc warnings

Subsystem: bitops

    Yury Norov <yury.norov@gmail.com>:
    Patch series "Resend bitmap patches":
      bitops: protect find_first_{,zero}_bit properly
      bitops: move find_bit_*_le functions from le.h to find.h
      include: move find.h from asm_generic to linux
      arch: remove GENERIC_FIND_FIRST_BIT entirely
      lib: add find_first_and_bit()
      cpumask: use find_first_and_bit()
      all: replace find_next{,_zero}_bit with find_first{,_zero}_bit where appropriate
      tools: sync tools/bitmap with mother linux
      cpumask: replace cpumask_next_* with cpumask_first_* where appropriate
      include/linux: move for_each_bit() macros from bitops.h to find.h
      find: micro-optimize for_each_{set,clear}_bit()
      bitops: replace for_each_*_bit_from() with for_each_*_bit() where appropriate

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      tools: rename bitmap_alloc() to bitmap_zalloc()

    Yury Norov <yury.norov@gmail.com>:
      mm/percpu: micro-optimize pcpu_is_populated()
      bitmap: unify find_bit operations
      lib: bitmap: add performance test for bitmap_print_to_pagebuf
      vsprintf: rework bitmap_list_string

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: support wide strings

    Mimi Zohar <zohar@linux.ibm.com>:
      checkpatch: make email address check case insensitive

    Joe Perches <joe@perches.com>:
      checkpatch: improve GIT_COMMIT_ID test

Subsystem: epoll

    Nicholas Piggin <npiggin@gmail.com>:
      fs/epoll: use a per-cpu counter for user's watches count

Subsystem: init

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      init: move usermodehelper_enable() to populate_rootfs()

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      trap: cleanup trap_init()

Subsystem: nilfs2

    Nanyong Sun <sunnanyong@huawei.com>:
    Patch series "nilfs2: fix incorrect usage of kobject":
      nilfs2: fix memory leak in nilfs_sysfs_create_device_group
      nilfs2: fix NULL pointer in nilfs_##name##_attr_release
      nilfs2: fix memory leak in nilfs_sysfs_create_##name##_group
      nilfs2: fix memory leak in nilfs_sysfs_delete_##name##_group
      nilfs2: fix memory leak in nilfs_sysfs_create_snapshot_group
      nilfs2: fix memory leak in nilfs_sysfs_delete_snapshot_group

    Zhen Lei <thunder.leizhen@huawei.com>:
      nilfs2: use refcount_dec_and_lock() to fix potential UAF

Subsystem: coredump

    David Oberhollenzer <david.oberhollenzer@sigma-star.at>:
      fs/coredump.c: log if a core dump is aborted due to changed file permissions

    QiuXi <qiuxi1@huawei.com>:
      coredump: fix memleak in dump_vma_snapshot()

Subsystem: fork

    Christoph Hellwig <hch@lst.de>:
      kernel/fork.c: unexport get_{mm,task}_exe_file

Subsystem: pids

    Takahiro Itazuri <itazur@amazon.com>:
      pid: cleanup the stale comment mentioning pidmap_init().

Subsystem: criu

    Cyrill Gorcunov <gorcunov@gmail.com>:
      prctl: allow to setup brk for et_dyn executables

Subsystem: kconfig

    Zenghui Yu <yuzenghui@huawei.com>:
      configs: remove the obsolete CONFIG_INPUT_POLLDEV

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      Kconfig.debug: drop selecting non-existing HARDLOCKUP_DETECTOR_ARCH

Subsystem: selftests

    Greg Thelen <gthelen@google.com>:
      selftests/memfd: remove unused variable

Subsystem: ipc

    Rafael Aquini <aquini@redhat.com>:
      ipc: replace costly bailout check in sysvipc_find_ipc()

Subsystem: mm/vmscan

    Randy Dunlap <rdunlap@infradead.org>:
      mm/workingset: correct kernel-doc notations

Subsystem: scripts

    Randy Dunlap <rdunlap@infradead.org>:
      scripts: check_extable: fix typo in user error message

 a/Documentation/admin-guide/mm/damon/index.rst            |   15 
 a/Documentation/admin-guide/mm/damon/start.rst            |  114 +
 a/Documentation/admin-guide/mm/damon/usage.rst            |  112 +
 a/Documentation/admin-guide/mm/index.rst                  |    1 
 a/Documentation/admin-guide/mm/memory-hotplug.rst         |  842 ++++++-----
 a/Documentation/dev-tools/kfence.rst                      |   98 -
 a/Documentation/kbuild/llvm.rst                           |    5 
 a/Documentation/vm/damon/api.rst                          |   20 
 a/Documentation/vm/damon/design.rst                       |  166 ++
 a/Documentation/vm/damon/faq.rst                          |   51 
 a/Documentation/vm/damon/index.rst                        |   30 
 a/Documentation/vm/index.rst                              |    1 
 a/MAINTAINERS                                             |   17 
 a/arch/Kconfig                                            |    2 
 a/arch/alpha/include/asm/agp.h                            |    4 
 a/arch/alpha/include/asm/bitops.h                         |    2 
 a/arch/alpha/kernel/pci-sysfs.c                           |   12 
 a/arch/arc/Kconfig                                        |    1 
 a/arch/arc/include/asm/bitops.h                           |    1 
 a/arch/arc/kernel/traps.c                                 |    5 
 a/arch/arm/configs/dove_defconfig                         |    1 
 a/arch/arm/configs/pxa_defconfig                          |    1 
 a/arch/arm/include/asm/bitops.h                           |    1 
 a/arch/arm/kernel/traps.c                                 |    5 
 a/arch/arm64/Kconfig                                      |    1 
 a/arch/arm64/include/asm/bitops.h                         |    1 
 a/arch/arm64/mm/mmu.c                                     |    3 
 a/arch/csky/include/asm/bitops.h                          |    1 
 a/arch/h8300/include/asm/bitops.h                         |    1 
 a/arch/h8300/kernel/traps.c                               |    4 
 a/arch/hexagon/include/asm/bitops.h                       |    1 
 a/arch/hexagon/kernel/traps.c                             |    4 
 a/arch/ia64/include/asm/bitops.h                          |    2 
 a/arch/ia64/mm/init.c                                     |    3 
 a/arch/m68k/include/asm/bitops.h                          |    2 
 a/arch/mips/Kconfig                                       |    1 
 a/arch/mips/configs/lemote2f_defconfig                    |    1 
 a/arch/mips/configs/pic32mzda_defconfig                   |    1 
 a/arch/mips/configs/rt305x_defconfig                      |    1 
 a/arch/mips/configs/xway_defconfig                        |    1 
 a/arch/mips/include/asm/bitops.h                          |    1 
 a/arch/nds32/kernel/traps.c                               |    5 
 a/arch/nios2/kernel/traps.c                               |    5 
 a/arch/openrisc/include/asm/bitops.h                      |    1 
 a/arch/openrisc/kernel/traps.c                            |    5 
 a/arch/parisc/configs/generic-32bit_defconfig             |    1 
 a/arch/parisc/include/asm/bitops.h                        |    2 
 a/arch/parisc/kernel/traps.c                              |    4 
 a/arch/powerpc/include/asm/bitops.h                       |    2 
 a/arch/powerpc/include/asm/cputhreads.h                   |    2 
 a/arch/powerpc/kernel/traps.c                             |    5 
 a/arch/powerpc/mm/mem.c                                   |    3 
 a/arch/powerpc/platforms/pasemi/dma_lib.c                 |    4 
 a/arch/powerpc/platforms/pseries/hotplug-memory.c         |    9 
 a/arch/riscv/Kconfig                                      |    2 
 a/arch/riscv/include/asm/bitops.h                         |    1 
 a/arch/riscv/kernel/traps.c                               |    5 
 a/arch/s390/Kconfig                                       |    1 
 a/arch/s390/include/asm/bitops.h                          |    1 
 a/arch/s390/kvm/kvm-s390.c                                |    2 
 a/arch/s390/mm/init.c                                     |    3 
 a/arch/sh/include/asm/bitops.h                            |    1 
 a/arch/sh/mm/init.c                                       |    3 
 a/arch/sparc/include/asm/bitops_32.h                      |    1 
 a/arch/sparc/include/asm/bitops_64.h                      |    2 
 a/arch/um/kernel/trap.c                                   |    4 
 a/arch/x86/Kconfig                                        |    1 
 a/arch/x86/configs/i386_defconfig                         |    1 
 a/arch/x86/configs/x86_64_defconfig                       |    1 
 a/arch/x86/include/asm/bitops.h                           |    2 
 a/arch/x86/kernel/apic/vector.c                           |    4 
 a/arch/x86/mm/init_32.c                                   |    3 
 a/arch/x86/mm/init_64.c                                   |    3 
 a/arch/x86/um/Kconfig                                     |    1 
 a/arch/xtensa/include/asm/bitops.h                        |    1 
 a/block/blk-mq.c                                          |    2 
 a/drivers/acpi/acpi_memhotplug.c                          |   46 
 a/drivers/base/memory.c                                   |  231 ++-
 a/drivers/base/node.c                                     |    2 
 a/drivers/block/rnbd/rnbd-clt.c                           |    2 
 a/drivers/dax/kmem.c                                      |   43 
 a/drivers/devfreq/devfreq.c                               |    2 
 a/drivers/dma/ti/edma.c                                   |    2 
 a/drivers/gpu/drm/etnaviv/etnaviv_gpu.c                   |    4 
 a/drivers/hwmon/ltc2992.c                                 |    3 
 a/drivers/hwmon/mr75203.c                                 |    2 
 a/drivers/iio/adc/ad7124.c                                |    2 
 a/drivers/iio/common/hid-sensors/hid-sensor-attributes.c  |    3 
 a/drivers/iio/light/as73211.c                             |    3 
 a/drivers/infiniband/hw/irdma/hw.c                        |   16 
 a/drivers/media/cec/core/cec-core.c                       |    2 
 a/drivers/media/i2c/ov02a10.c                             |    2 
 a/drivers/media/mc/mc-devnode.c                           |    2 
 a/drivers/mmc/host/renesas_sdhi_core.c                    |    2 
 a/drivers/mtd/nand/raw/intel-nand-controller.c            |    2 
 a/drivers/net/virtio_net.c                                |    2 
 a/drivers/pci/controller/dwc/pci-dra7xx.c                 |    2 
 a/drivers/phy/st/phy-stm32-usbphyc.c                      |    2 
 a/drivers/scsi/lpfc/lpfc_sli.c                            |   10 
 a/drivers/soc/fsl/qbman/bman_portal.c                     |    2 
 a/drivers/soc/fsl/qbman/qman_portal.c                     |    2 
 a/drivers/soc/ti/k3-ringacc.c                             |    4 
 a/drivers/thermal/devfreq_cooling.c                       |    2 
 a/drivers/tty/n_tty.c                                     |    2 
 a/drivers/virt/acrn/ioreq.c                               |    3 
 a/drivers/virtio/virtio_mem.c                             |   26 
 a/fs/coredump.c                                           |   15 
 a/fs/eventpoll.c                                          |   18 
 a/fs/f2fs/segment.c                                       |    8 
 a/fs/nilfs2/sysfs.c                                       |   26 
 a/fs/nilfs2/the_nilfs.c                                   |    9 
 a/fs/ocfs2/cluster/heartbeat.c                            |    2 
 a/fs/ocfs2/dlm/dlmdomain.c                                |    4 
 a/fs/ocfs2/dlm/dlmmaster.c                                |   18 
 a/fs/ocfs2/dlm/dlmrecovery.c                              |    2 
 a/fs/ocfs2/dlm/dlmthread.c                                |    2 
 a/fs/proc/array.c                                         |   18 
 a/fs/proc/base.c                                          |    5 
 a/fs/proc/kcore.c                                         |   73 
 a/include/asm-generic/bitops.h                            |    1 
 a/include/asm-generic/bitops/find.h                       |  198 --
 a/include/asm-generic/bitops/le.h                         |   64 
 a/include/asm-generic/early_ioremap.h                     |    6 
 a/include/linux/bitmap.h                                  |   34 
 a/include/linux/bitops.h                                  |   34 
 a/include/linux/cpumask.h                                 |   46 
 a/include/linux/damon.h                                   |  290 +++
 a/include/linux/find.h                                    |  134 +
 a/include/linux/highmem-internal.h                        |   27 
 a/include/linux/memory.h                                  |   55 
 a/include/linux/memory_hotplug.h                          |   40 
 a/include/linux/mmzone.h                                  |   19 
 a/include/linux/once.h                                    |    2 
 a/include/linux/page-flags.h                              |   17 
 a/include/linux/page_ext.h                                |    2 
 a/include/linux/page_idle.h                               |    6 
 a/include/linux/pagemap.h                                 |    7 
 a/include/linux/sched/user.h                              |    3 
 a/include/linux/slub_def.h                                |    6 
 a/include/linux/threads.h                                 |    2 
 a/include/linux/units.h                                   |   10 
 a/include/linux/vmalloc.h                                 |    3 
 a/include/trace/events/damon.h                            |   43 
 a/include/trace/events/mmflags.h                          |    2 
 a/include/trace/events/page_ref.h                         |    4 
 a/init/initramfs.c                                        |    2 
 a/init/main.c                                             |    3 
 a/init/noinitramfs.c                                      |    2 
 a/ipc/util.c                                              |   16 
 a/kernel/acct.c                                           |    2 
 a/kernel/fork.c                                           |    2 
 a/kernel/profile.c                                        |   21 
 a/kernel/sys.c                                            |    7 
 a/kernel/time/clocksource.c                               |    4 
 a/kernel/user.c                                           |   25 
 a/lib/Kconfig                                             |    3 
 a/lib/Kconfig.debug                                       |    9 
 a/lib/dump_stack.c                                        |    3 
 a/lib/find_bit.c                                          |   21 
 a/lib/find_bit_benchmark.c                                |   21 
 a/lib/genalloc.c                                          |    2 
 a/lib/iov_iter.c                                          |    8 
 a/lib/math/Kconfig                                        |    2 
 a/lib/math/rational.c                                     |    3 
 a/lib/string.c                                            |  130 +
 a/lib/test_bitmap.c                                       |   37 
 a/lib/test_printf.c                                       |    2 
 a/lib/test_sort.c                                         |   40 
 a/lib/vsprintf.c                                          |   26 
 a/mm/Kconfig                                              |   15 
 a/mm/Makefile                                             |    4 
 a/mm/compaction.c                                         |   20 
 a/mm/damon/Kconfig                                        |   68 
 a/mm/damon/Makefile                                       |    5 
 a/mm/damon/core-test.h                                    |  253 +++
 a/mm/damon/core.c                                         |  748 ++++++++++
 a/mm/damon/dbgfs-test.h                                   |  126 +
 a/mm/damon/dbgfs.c                                        |  631 ++++++++
 a/mm/damon/vaddr-test.h                                   |  329 ++++
 a/mm/damon/vaddr.c                                        |  672 +++++++++
 a/mm/early_ioremap.c                                      |    5 
 a/mm/highmem.c                                            |    2 
 a/mm/ioremap.c                                            |   25 
 a/mm/kfence/core.c                                        |    3 
 a/mm/kfence/kfence.h                                      |    2 
 a/mm/kfence/kfence_test.c                                 |    3 
 a/mm/kfence/report.c                                      |   19 
 a/mm/kmemleak.c                                           |    2 
 a/mm/memory_hotplug.c                                     |  396 ++++-
 a/mm/memremap.c                                           |    5 
 a/mm/page_alloc.c                                         |   27 
 a/mm/page_ext.c                                           |   12 
 a/mm/page_idle.c                                          |   10 
 a/mm/page_isolation.c                                     |    7 
 a/mm/page_owner.c                                         |   14 
 a/mm/percpu.c                                             |   36 
 a/mm/rmap.c                                               |    6 
 a/mm/secretmem.c                                          |    9 
 a/mm/slab_common.c                                        |    2 
 a/mm/slub.c                                               | 1023 +++++++++-----
 a/mm/vmalloc.c                                            |   24 
 a/mm/workingset.c                                         |    2 
 a/net/ncsi/ncsi-manage.c                                  |    4 
 a/scripts/check_extable.sh                                |    2 
 a/scripts/checkpatch.pl                                   |   93 -
 a/tools/include/linux/bitmap.h                            |    4 
 a/tools/perf/bench/find-bit-bench.c                       |    2 
 a/tools/perf/builtin-c2c.c                                |    6 
 a/tools/perf/builtin-record.c                             |    2 
 a/tools/perf/tests/bitmap.c                               |    2 
 a/tools/perf/tests/mem2node.c                             |    2 
 a/tools/perf/util/affinity.c                              |    4 
 a/tools/perf/util/header.c                                |    4 
 a/tools/perf/util/metricgroup.c                           |    2 
 a/tools/perf/util/mmap.c                                  |    4 
 a/tools/testing/selftests/damon/Makefile                  |    7 
 a/tools/testing/selftests/damon/_chk_dependency.sh        |   28 
 a/tools/testing/selftests/damon/debugfs_attrs.sh          |   75 +
 a/tools/testing/selftests/kvm/dirty_log_perf_test.c       |    2 
 a/tools/testing/selftests/kvm/dirty_log_test.c            |    4 
 a/tools/testing/selftests/kvm/x86_64/vmx_dirty_log_test.c |    2 
 a/tools/testing/selftests/memfd/memfd_test.c              |    2 
 b/MAINTAINERS                                             |    2 
 b/tools/include/asm-generic/bitops.h                      |    1 
 b/tools/include/linux/bitmap.h                            |    7 
 b/tools/include/linux/find.h                              |   81 +
 b/tools/lib/find_bit.c                                    |   20 
 227 files changed, 6695 insertions(+), 1875 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-09-08  2:52 incoming Andrew Morton
@ 2021-09-08  8:57 ` Vlastimil Babka
  0 siblings, 0 replies; 232+ messages in thread
From: Vlastimil Babka @ 2021-09-08  8:57 UTC (permalink / raw)
  To: Andrew Morton, Linus Torvalds
  Cc: linux-mm, mm-commits, Mike Galbraith, Mel Gorman

On 9/8/21 04:52, Andrew Morton wrote:
> Subsystem: mm/slub
> 
>     Vlastimil Babka <vbabka@suse.cz>:
>     Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6:
>       mm, slub: don't call flush_all() from slab_debug_trace_open()
>       mm, slub: allocate private object map for debugfs listings
>       mm, slub: allocate private object map for validate_slab_cache()
>       mm, slub: don't disable irq for debug_check_no_locks_freed()
>       mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
>       mm, slub: extract get_partial() from new_slab_objects()
>       mm, slub: dissolve new_slab_objects() into ___slab_alloc()
>       mm, slub: return slab page from get_partial() and set c->page afterwards
>       mm, slub: restructure new page checks in ___slab_alloc()
>       mm, slub: simplify kmem_cache_cpu and tid setup
>       mm, slub: move disabling/enabling irqs to ___slab_alloc()
>       mm, slub: do initial checks in ___slab_alloc() with irqs enabled
>       mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
>       mm, slub: restore irqs around calling new_slab()
>       mm, slub: validate slab from partial list or page allocator before making it cpu slab
>       mm, slub: check new pages with restored irqs
>       mm, slub: stop disabling irqs around get_partial()
>       mm, slub: move reset of c->page and freelist out of deactivate_slab()
>       mm, slub: make locking in deactivate_slab() irq-safe
>       mm, slub: call deactivate_slab() without disabling irqs
>       mm, slub: move irq control into unfreeze_partials()
>       mm, slub: discard slabs in unfreeze_partials() without irqs disabled
>       mm, slub: detach whole partial list at once in unfreeze_partials()
>       mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
>       mm, slub: only disable irq with spin_lock in __unfreeze_partials()
>       mm, slub: don't disable irqs in slub_cpu_dead()
>       mm, slab: split out the cpu offline variant of flush_slab()
> 
>     Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
>       mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
>       mm: slub: make object_map_lock a raw_spinlock_t
> 
>     Vlastimil Babka <vbabka@suse.cz>:
>       mm, slub: make slab_lock() disable irqs with PREEMPT_RT
>       mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
>       mm, slub: use migrate_disable() on PREEMPT_RT
>       mm, slub: convert kmem_cpu_slab protection to local_lock

For my own piece of mind, I've checked that this part (patches 1 to 33)
are identical to the v6 posting [1] and git version [2] that Mel and
Mike tested (replies to [1]).

[1] https://lore.kernel.org/all/20210904105003.11688-1-vbabka@suse.cz/
[2] git://git.kernel.org/pub/scm/linux/kernel/git/vbabka/linux.git
tags/mm-slub-5.15-rc1

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-09-08 22:17 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-09-08 22:17 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


This is the post-linux-next material, so it is based upon latest
upstream to catch the now-merged dependencies.

10 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c.

Subsystems affected by this patch series:

  mm/vmstat
  mm/migration
  compat

Subsystem: mm/vmstat

    Ingo Molnar <mingo@elte.hu>:
      mm/vmstat: protect per cpu variables with preempt disable on RT

Subsystem: mm/migration

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: migrate: introduce a local variable to get the number of pages
      mm: migrate: fix the incorrect function name in comments
      mm: migrate: change to use bool type for 'page_was_mapped'

Subsystem: compat

    Arnd Bergmann <arnd@arndb.de>:
    Patch series "compat: remove compat_alloc_user_space", v5:
      kexec: move locking into do_kexec_load
      kexec: avoid compat_alloc_user_space
      mm: simplify compat_sys_move_pages
      mm: simplify compat numa syscalls
      compat: remove some compat entry points
      arch: remove compat_alloc_user_space

 arch/arm64/include/asm/compat.h           |    5 
 arch/arm64/include/asm/uaccess.h          |   11 -
 arch/arm64/include/asm/unistd32.h         |   10 -
 arch/arm64/lib/Makefile                   |    2 
 arch/arm64/lib/copy_in_user.S             |   77 ----------
 arch/mips/cavium-octeon/octeon-memcpy.S   |    2 
 arch/mips/include/asm/compat.h            |    8 -
 arch/mips/include/asm/uaccess.h           |   26 ---
 arch/mips/kernel/syscalls/syscall_n32.tbl |   10 -
 arch/mips/kernel/syscalls/syscall_o32.tbl |   10 -
 arch/mips/lib/memcpy.S                    |   11 -
 arch/parisc/include/asm/compat.h          |    6 
 arch/parisc/include/asm/uaccess.h         |    2 
 arch/parisc/kernel/syscalls/syscall.tbl   |    8 -
 arch/parisc/lib/memcpy.c                  |    9 -
 arch/powerpc/include/asm/compat.h         |   16 --
 arch/powerpc/kernel/syscalls/syscall.tbl  |   10 -
 arch/s390/include/asm/compat.h            |   10 -
 arch/s390/include/asm/uaccess.h           |    3 
 arch/s390/kernel/syscalls/syscall.tbl     |   10 -
 arch/s390/lib/uaccess.c                   |   63 --------
 arch/sparc/include/asm/compat.h           |   19 --
 arch/sparc/kernel/process_64.c            |    2 
 arch/sparc/kernel/signal32.c              |   12 -
 arch/sparc/kernel/signal_64.c             |    8 -
 arch/sparc/kernel/syscalls/syscall.tbl    |   10 -
 arch/x86/entry/syscalls/syscall_32.tbl    |    4 
 arch/x86/entry/syscalls/syscall_64.tbl    |    2 
 arch/x86/include/asm/compat.h             |   13 -
 arch/x86/include/asm/uaccess_64.h         |    7 
 include/linux/compat.h                    |   39 +----
 include/linux/uaccess.h                   |   10 -
 include/uapi/asm-generic/unistd.h         |   10 -
 kernel/compat.c                           |   21 --
 kernel/kexec.c                            |  105 +++++---------
 kernel/sys_ni.c                           |    5 
 mm/mempolicy.c                            |  213 +++++++-----------------------
 mm/migrate.c                              |   69 +++++----
 mm/vmstat.c                               |   48 ++++++
 39 files changed, 243 insertions(+), 663 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-09-09  1:08 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-09-09  1:08 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


A bunch of hotfixes, mostly cc:stable.


8 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c.

Subsystems affected by this patch series:

  mm/hmm
  mm/hugetlb
  mm/vmscan
  mm/pagealloc
  mm/pagemap
  mm/kmemleak
  mm/mempolicy
  mm/memblock

Subsystem: mm/hmm

    Li Zhijian <lizhijian@cn.fujitsu.com>:
      mm/hmm: bypass devmap pte when all pfn requested flags are fulfilled

Subsystem: mm/hugetlb

    Liu Zixian <liuzixian4@huawei.com>:
      mm/hugetlb: initialize hugetlb_usage in mm_init

Subsystem: mm/vmscan

    Rik van Riel <riel@surriel.com>:
      mm,vmscan: fix divide by zero in get_scan_count

Subsystem: mm/pagealloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/page_alloc.c: avoid accessing uninitialized pcp page migratetype

Subsystem: mm/pagemap

    Liam Howlett <liam.howlett@oracle.com>:
      mmap_lock: change trace and locking order

Subsystem: mm/kmemleak

    Naohiro Aota <naohiro.aota@wdc.com>:
      mm/kmemleak: allow __GFP_NOLOCKDEP passed to kmemleak's gfp

Subsystem: mm/mempolicy

    yanghui <yanghui.def@bytedance.com>:
      mm/mempolicy: fix a race between offset_il_node and mpol_rebind_task

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      nds32/setup: remove unused memblock_region variable in setup_memory()

 arch/nds32/kernel/setup.c |    1 -
 include/linux/hugetlb.h   |    9 +++++++++
 include/linux/mmap_lock.h |    8 ++++----
 kernel/fork.c             |    1 +
 mm/hmm.c                  |    5 ++++-
 mm/kmemleak.c             |    3 ++-
 mm/mempolicy.c            |   17 +++++++++++++----
 mm/page_alloc.c           |    4 +++-
 mm/vmscan.c               |    2 +-
 9 files changed, 37 insertions(+), 13 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-09-10  3:09 Andrew Morton
  2021-09-10 17:11 ` incoming Kees Cook
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-09-10  3:09 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


More post linux-next material.

9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.

Subsystems affected by this patch series:

  mm/slab-generic
  rapidio
  mm/debug

Subsystem: mm/slab-generic

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: move kvmalloc-related functions to slab.h

Subsystem: rapidio

    Kees Cook <keescook@chromium.org>:
      rapidio: avoid bogus __alloc_size warning

Subsystem: mm/debug

    Kees Cook <keescook@chromium.org>:
    Patch series "Add __alloc_size() for better bounds checking", v2:
      Compiler Attributes: add __alloc_size() for better bounds checking
      checkpatch: add __alloc_size() to known $Attribute
      slab: clean up function declarations
      slab: add __alloc_size attributes for better bounds checking
      mm/page_alloc: add __alloc_size attributes for better bounds checking
      percpu: add __alloc_size attributes for better bounds checking
      mm/vmalloc: add __alloc_size attributes for better bounds checking

 Makefile                                 |   15 +++
 drivers/of/kexec.c                       |    1 
 drivers/rapidio/devices/rio_mport_cdev.c |    9 +-
 include/linux/compiler_attributes.h      |    6 +
 include/linux/gfp.h                      |    2 
 include/linux/mm.h                       |   34 --------
 include/linux/percpu.h                   |    3 
 include/linux/slab.h                     |  122 ++++++++++++++++++++++---------
 include/linux/vmalloc.h                  |   11 ++
 scripts/checkpatch.pl                    |    3 
 10 files changed, 132 insertions(+), 74 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-09-10  3:09 incoming Andrew Morton
@ 2021-09-10 17:11 ` Kees Cook
  2021-09-10 20:13   ` incoming Kees Cook
  0 siblings, 1 reply; 232+ messages in thread
From: Kees Cook @ 2021-09-10 17:11 UTC (permalink / raw)
  To: Linus Torvalds, Andrew Morton; +Cc: linux-mm, mm-commits

On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote:
> 
> More post linux-next material.
> 
> 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
> 
> Subsystems affected by this patch series:
> 
>   mm/slab-generic
>   rapidio
>   mm/debug
> 
> Subsystem: mm/slab-generic
> 
>     "Matthew Wilcox (Oracle)" <willy@infradead.org>:
>       mm: move kvmalloc-related functions to slab.h
> 
> Subsystem: rapidio
> 
>     Kees Cook <keescook@chromium.org>:
>       rapidio: avoid bogus __alloc_size warning
> 
> Subsystem: mm/debug
> 
>     Kees Cook <keescook@chromium.org>:
>     Patch series "Add __alloc_size() for better bounds checking", v2:
>       Compiler Attributes: add __alloc_size() for better bounds checking
>       checkpatch: add __alloc_size() to known $Attribute
>       slab: clean up function declarations
>       slab: add __alloc_size attributes for better bounds checking
>       mm/page_alloc: add __alloc_size attributes for better bounds checking
>       percpu: add __alloc_size attributes for better bounds checking
>       mm/vmalloc: add __alloc_size attributes for better bounds checking

Hi,

FYI, in overnight build testing I found yet another corner case in
GCC's handling of the __alloc_size attribute. It's the gift that keeps
on giving. The fix is here:

https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/

> 
>  Makefile                                 |   15 +++
>  drivers/of/kexec.c                       |    1 
>  drivers/rapidio/devices/rio_mport_cdev.c |    9 +-
>  include/linux/compiler_attributes.h      |    6 +
>  include/linux/gfp.h                      |    2 
>  include/linux/mm.h                       |   34 --------
>  include/linux/percpu.h                   |    3 
>  include/linux/slab.h                     |  122 ++++++++++++++++++++++---------
>  include/linux/vmalloc.h                  |   11 ++
>  scripts/checkpatch.pl                    |    3 
>  10 files changed, 132 insertions(+), 74 deletions(-)
> 

-- 
Kees Cook

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2021-09-10 17:11 ` incoming Kees Cook
@ 2021-09-10 20:13   ` Kees Cook
  0 siblings, 0 replies; 232+ messages in thread
From: Kees Cook @ 2021-09-10 20:13 UTC (permalink / raw)
  To: linux-kernel; +Cc: Linus Torvalds, Andrew Morton, linux-mm, mm-commits

On Fri, Sep 10, 2021 at 10:11:53AM -0700, Kees Cook wrote:
> On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote:
> > 
> > More post linux-next material.
> > 
> > 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
> > 
> > Subsystems affected by this patch series:
> > 
> >   mm/slab-generic
> >   rapidio
> >   mm/debug
> > 
> > Subsystem: mm/slab-generic
> > 
> >     "Matthew Wilcox (Oracle)" <willy@infradead.org>:
> >       mm: move kvmalloc-related functions to slab.h
> > 
> > Subsystem: rapidio
> > 
> >     Kees Cook <keescook@chromium.org>:
> >       rapidio: avoid bogus __alloc_size warning
> > 
> > Subsystem: mm/debug
> > 
> >     Kees Cook <keescook@chromium.org>:
> >     Patch series "Add __alloc_size() for better bounds checking", v2:
> >       Compiler Attributes: add __alloc_size() for better bounds checking
> >       checkpatch: add __alloc_size() to known $Attribute
> >       slab: clean up function declarations
> >       slab: add __alloc_size attributes for better bounds checking
> >       mm/page_alloc: add __alloc_size attributes for better bounds checking
> >       percpu: add __alloc_size attributes for better bounds checking
> >       mm/vmalloc: add __alloc_size attributes for better bounds checking
> 
> Hi,
> 
> FYI, in overnight build testing I found yet another corner case in
> GCC's handling of the __alloc_size attribute. It's the gift that keeps
> on giving. The fix is here:
> 
> https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/

I'm so glad it's Friday. Here's the v2 fix... *sigh*

https://lore.kernel.org/lkml/20210910201132.3809437-1-keescook@chromium.org/

-Kees

> 
> > 
> >  Makefile                                 |   15 +++
> >  drivers/of/kexec.c                       |    1 
> >  drivers/rapidio/devices/rio_mport_cdev.c |    9 +-
> >  include/linux/compiler_attributes.h      |    6 +
> >  include/linux/gfp.h                      |    2 
> >  include/linux/mm.h                       |   34 --------
> >  include/linux/percpu.h                   |    3 
> >  include/linux/slab.h                     |  122 ++++++++++++++++++++++---------
> >  include/linux/vmalloc.h                  |   11 ++
> >  scripts/checkpatch.pl                    |    3 
> >  10 files changed, 132 insertions(+), 74 deletions(-)
> > 
> 
> -- 
> Kees Cook

-- 
Kees Cook

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-09-24 22:42 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-09-24 22:42 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

16 patches, based on 7d42e98182586f57f376406d033f05fe135edb75.

Subsystems affected by this patch series:

  mm/memory-failure
  mm/kasan
  mm/damon
  xtensa
  mm/shmem
  ocfs2
  scripts
  mm/tools
  lib
  mm/pagecache
  mm/debug
  sh
  mm/kasan
  mm/memory-failure
  mm/pagemap

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm, hwpoison: add is_free_buddy_page() in HWPoisonHandlable()

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
      kasan: fix Kconfig check of CC_HAS_WORKING_NOSANITIZE_ADDRESS

Subsystem: mm/damon

    Adam Borowski <kilobyte@angband.pl>:
      mm/damon: don't use strnlen() with known-bogus source length

Subsystem: xtensa

    Guenter Roeck <linux@roeck-us.net>:
      xtensa: increase size of gcc stack frame check

Subsystem: mm/shmem

    Liu Yuntao <liuyuntao10@huawei.com>:
      mm/shmem.c: fix judgment error in shmem_is_huge()

Subsystem: ocfs2

    Wengang Wang <wen.gang.wang@oracle.com>:
      ocfs2: drop acl cache for directories too

Subsystem: scripts

    Miles Chen <miles.chen@mediatek.com>:
      scripts/sorttable: riscv: fix undeclared identifier 'EM_RISCV' error

Subsystem: mm/tools

    Changbin Du <changbin.du@gmail.com>:
      tools/vm/page-types: remove dependency on opt_file for idle page tracking

Subsystem: lib

    Paul Menzel <pmenzel@molgen.mpg.de>:
      lib/zlib_inflate/inffast: check config in C to avoid unused function warning

Subsystem: mm/pagecache

    Minchan Kim <minchan@kernel.org>:
      mm: fs: invalidate bh_lrus for only cold path

Subsystem: mm/debug

    Weizhao Ouyang <o451686892@gmail.com>:
      mm/debug: sync up MR_CONTIG_RANGE and MR_LONGTERM_PIN
      mm/debug: sync up latest migrate_reason to migrate_reason_names

Subsystem: sh

    Geert Uytterhoeven <geert+renesas@glider.be>:
      sh: pgtable-3level: fix cast to pointer from integer of different size

Subsystem: mm/kasan

    Nathan Chancellor <nathan@kernel.org>:
      kasan: always respect CONFIG_KASAN_STACK

Subsystem: mm/memory-failure

    Qi Zheng <zhengqi.arch@bytedance.com>:
      mm/memory_failure: fix the missing pte_unmap() call

Subsystem: mm/pagemap

    Chen Jun <chenjun102@huawei.com>:
      mm: fix uninitialized use in overcommit_policy_handler

 arch/sh/include/asm/pgtable-3level.h |    2 +-
 fs/buffer.c                          |    8 ++++++--
 fs/ocfs2/dlmglue.c                   |    3 ++-
 include/linux/buffer_head.h          |    4 ++--
 include/linux/migrate.h              |    6 +++++-
 lib/Kconfig.debug                    |    2 +-
 lib/Kconfig.kasan                    |    2 ++
 lib/zlib_inflate/inffast.c           |   13 ++++++-------
 mm/damon/dbgfs-test.h                |   16 ++++++++--------
 mm/debug.c                           |    4 +++-
 mm/memory-failure.c                  |   12 ++++++------
 mm/shmem.c                           |    4 ++--
 mm/swap.c                            |   19 ++++++++++++++++---
 mm/util.c                            |    4 ++--
 scripts/Makefile.kasan               |    3 ++-
 scripts/sorttable.c                  |    4 ++++
 tools/vm/page-types.c                |    2 +-
 17 files changed, 69 insertions(+), 39 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-10-18 22:14 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-10-18 22:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


19 patches, based on 519d81956ee277b4419c723adfb154603c2565ba.

Subsystems affected by this patch series:

  mm/userfaultfd
  mm/migration
  ocfs2
  mm/memblock
  mm/mempolicy
  mm/slub
  binfmt
  vfs
  mm/secretmem
  mm/thp
  misc

Subsystem: mm/userfaultfd

    Peter Xu <peterx@redhat.com>:
      mm/userfaultfd: selftests: fix memory corruption with thp enabled

    Nadav Amit <namit@vmware.com>:
      userfaultfd: fix a race between writeprotect and exit_mmap()

Subsystem: mm/migration

    Dave Hansen <dave.hansen@linux.intel.com>:
    Patch series "mm/migrate: 5.15 fixes for automatic demotion", v2:
      mm/migrate: optimize hotplug-time demotion order updates
      mm/migrate: add CPU hotplug to demotion #ifdef

    Huang Ying <ying.huang@intel.com>:
      mm/migrate: fix CPUHP state to update node demotion order

Subsystem: ocfs2

    Jan Kara <jack@suse.cz>:
      ocfs2: fix data corruption after conversion from inline format

    Valentin Vidic <vvidic@valentin-vidic.from.hr>:
      ocfs2: mount fails with buffer overflow in strlen

Subsystem: mm/memblock

    Peng Fan <peng.fan@nxp.com>:
      memblock: check memory total_size

Subsystem: mm/mempolicy

    Eric Dumazet <edumazet@google.com>:
      mm/mempolicy: do not allow illegal MPOL_F_NUMA_BALANCING | MPOL_LOCAL in mbind()

Subsystem: mm/slub

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Fixups for slub":
      mm, slub: fix two bugs in slab_debug_trace_open()
      mm, slub: fix mismatch between reconstructed freelist depth and cnt
      mm, slub: fix potential memoryleak in kmem_cache_open()
      mm, slub: fix potential use-after-free in slab_debugfs_fops
      mm, slub: fix incorrect memcg slab count for bulk free

Subsystem: binfmt

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      elfcore: correct reference to CONFIG_UML

Subsystem: vfs

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      vfs: check fd has read access in kernel_read_file_from_fd()

Subsystem: mm/secretmem

    Sean Christopherson <seanjc@google.com>:
      mm/secretmem: fix NULL page->mapping dereference in page_is_secretmem()

Subsystem: mm/thp

    Marek Szyprowski <m.szyprowski@samsung.com>:
      mm/thp: decrease nr_thps in file's mapping on THP split

Subsystem: misc

    Andrej Shadura <andrew.shadura@collabora.co.uk>:
      mailmap: add Andrej Shadura

 .mailmap                                 |    2 +
 fs/kernel_read_file.c                    |    2 -
 fs/ocfs2/alloc.c                         |   46 ++++++-----------------
 fs/ocfs2/super.c                         |   14 +++++--
 fs/userfaultfd.c                         |   12 ++++--
 include/linux/cpuhotplug.h               |    4 ++
 include/linux/elfcore.h                  |    2 -
 include/linux/memory.h                   |    5 ++
 include/linux/secretmem.h                |    2 -
 mm/huge_memory.c                         |    6 ++-
 mm/memblock.c                            |    2 -
 mm/mempolicy.c                           |   16 ++------
 mm/migrate.c                             |   62 ++++++++++++++++++-------------
 mm/page_ext.c                            |    4 --
 mm/slab.c                                |    4 +-
 mm/slub.c                                |   31 ++++++++++++---
 tools/testing/selftests/vm/userfaultfd.c |   23 ++++++++++-
 17 files changed, 138 insertions(+), 99 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-10-28 21:35 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-10-28 21:35 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

11 patches, based on 411a44c24a561e449b592ff631b7ae321f1eb559.

Subsystems affected by this patch series:

  mm/memcg
  mm/memory-failure
  mm/oom-kill
  ocfs2
  mm/secretmem
  mm/vmalloc
  mm/hugetlb
  mm/damon
  mm/tools

Subsystem: mm/memcg

    Shakeel Butt <shakeelb@google.com>:
      memcg: page_alloc: skip bulk allocator for __GFP_ACCOUNT

Subsystem: mm/memory-failure

    Yang Shi <shy828301@gmail.com>:
      mm: hwpoison: remove the unnecessary THP check
      mm: filemap: check if THP has hwpoisoned subpage for PMD page fault

Subsystem: mm/oom-kill

    Suren Baghdasaryan <surenb@google.com>:
      mm/oom_kill.c: prevent a race between process_mrelease and exit_mmap

Subsystem: ocfs2

    Gautham Ananthakrishna <gautham.ananthakrishna@oracle.com>:
      ocfs2: fix race between searching chunks and release journal_head from buffer_head

Subsystem: mm/secretmem

    Kees Cook <keescook@chromium.org>:
      mm/secretmem: avoid letting secretmem_users drop to zero

Subsystem: mm/vmalloc

    Chen Wandun <chenwandun@huawei.com>:
      mm/vmalloc: fix numa spreading for large hash tables

Subsystem: mm/hugetlb

    Rongwei Wang <rongwei.wang@linux.alibaba.com>:
      mm, thp: bail out early in collapse_file for writeback page

    Yang Shi <shy828301@gmail.com>:
      mm: khugepaged: skip huge page collapse for special files

Subsystem: mm/damon

    SeongJae Park <sj@kernel.org>:
      mm/damon/core-test: fix wrong expectations for 'damon_split_regions_of()'

Subsystem: mm/tools

    David Yang <davidcomponentone@gmail.com>:
      tools/testing/selftests/vm/split_huge_page_test.c: fix application of sizeof to pointer

 fs/ocfs2/suballoc.c                               |   22 ++++++++++-------
 include/linux/page-flags.h                        |   23 ++++++++++++++++++
 mm/damon/core-test.h                              |    4 +--
 mm/huge_memory.c                                  |    2 +
 mm/khugepaged.c                                   |   26 +++++++++++++-------
 mm/memory-failure.c                               |   28 +++++++++++-----------
 mm/memory.c                                       |    9 +++++++
 mm/oom_kill.c                                     |   23 +++++++++---------
 mm/page_alloc.c                                   |    8 +++++-
 mm/secretmem.c                                    |    2 -
 mm/vmalloc.c                                      |   15 +++++++----
 tools/testing/selftests/vm/split_huge_page_test.c |    2 -
 12 files changed, 110 insertions(+), 54 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-11-05 20:34 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-11-05 20:34 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

262 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813

Subsystems affected by this patch series:

  scripts
  ocfs2
  vfs
  mm/slab-generic
  mm/slab
  mm/slub
  mm/kconfig
  mm/dax
  mm/kasan
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/memcg
  mm/pagemap
  mm/mprotect
  mm/mremap
  mm/iomap
  mm/tracing
  mm/vmalloc
  mm/pagealloc
  mm/memory-failure
  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/tools
  mm/memblock
  mm/oom-kill
  mm/hugetlbfs
  mm/migration
  mm/thp
  mm/readahead
  mm/nommu
  mm/ksm
  mm/vmstat
  mm/madvise
  mm/memory-hotplug
  mm/rmap
  mm/zsmalloc
  mm/highmem
  mm/zram
  mm/cleanups
  mm/kfence
  mm/damon

Subsystem: scripts

    Colin Ian King <colin.king@canonical.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

    Sven Eckelmann <sven@narfation.org>:
      scripts/spelling.txt: fix "mistake" version of "synchronization"

    weidonghui <weidonghui@allwinnertech.com>:
      scripts/decodecode: fix faulting instruction no print when opps.file is DOS format

Subsystem: ocfs2

    Chenyuan Mi <cymi20@fudan.edu.cn>:
      ocfs2: fix handle refcount leak in two exception handling paths

    Valentin Vidic <vvidic@valentin-vidic.from.hr>:
      ocfs2: cleanup journal init and shutdown

    Colin Ian King <colin.king@canonical.com>:
      ocfs2/dlm: remove redundant assignment of variable ret

    Jan Kara <jack@suse.cz>:
    Patch series "ocfs2: Truncate data corruption fix":
      ocfs2: fix data corruption on truncate
      ocfs2: do not zero pages beyond i_size

Subsystem: vfs

    Arnd Bergmann <arnd@arndb.de>:
      fs/posix_acl.c: avoid -Wempty-body warning

    Jia He <justin.he@arm.com>:
      d_path: fix Kernel doc validator complaining

Subsystem: mm/slab-generic

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: move kvmalloc-related functions to slab.h

Subsystem: mm/slab

    Shi Lei <shi_lei@massclouds.com>:
      mm/slab.c: remove useless lines in enable_cpucache()

Subsystem: mm/slub

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      slub: add back check for free nonslab objects

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: change percpu partial accounting from objects to pages
      mm/slub: increase default cpu partial list sizes

    Hyeonggon Yoo <42.hyeyoo@gmail.com>:
      mm, slub: use prefetchw instead of prefetch

Subsystem: mm/kconfig

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm: disable NUMA_BALANCING_DEFAULT_ENABLED and TRANSPARENT_HUGEPAGE on PREEMPT_RT

Subsystem: mm/dax

    Christoph Hellwig <hch@lst.de>:
      mm: don't include <linux/dax.h> in <linux/mempolicy.h>

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
    Patch series "stackdepot, kasan, workqueue: Avoid expanding stackdepot slabs when holding raw_spin_lock", v2:
      lib/stackdepot: include gfp.h
      lib/stackdepot: remove unused function argument
      lib/stackdepot: introduce __stack_depot_save()
      kasan: common: provide can_alloc in kasan_save_stack()
      kasan: generic: introduce kasan_record_aux_stack_noalloc()
      workqueue, kasan: avoid alloc_pages() when recording stack

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      kasan: fix tag for large allocations when using CONFIG_SLAB

    Peter Collingbourne <pcc@google.com>:
      kasan: test: add memcpy test that avoids out-of-bounds write

Subsystem: mm/debug

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/smaps: Fixes and optimizations on shmem swap handling":
      mm/smaps: fix shmem pte hole swap calculation
      mm/smaps: use vma->vm_pgoff directly when counting partial swap
      mm/smaps: simplify shmem handling of pte holes

    Guo Ren <guoren@linux.alibaba.com>:
      mm: debug_vm_pgtable: don't use __P000 directly

    Kees Cook <keescook@chromium.org>:
      kasan: test: bypass __alloc_size checks
    Patch series "Add __alloc_size()", v3:
      rapidio: avoid bogus __alloc_size warning
      Compiler Attributes: add __alloc_size() for better bounds checking
      slab: clean up function prototypes
      slab: add __alloc_size attributes for better bounds checking
      mm/kvmalloc: add __alloc_size attributes for better bounds checking
      mm/vmalloc: add __alloc_size attributes for better bounds checking
      mm/page_alloc: add __alloc_size attributes for better bounds checking
      percpu: add __alloc_size attributes for better bounds checking

    Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
      mm/page_ext.c: fix a comment

Subsystem: mm/pagecache

    David Howells <dhowells@redhat.com>:
      mm: stop filemap_read() from grabbing a superfluous page

    Christoph Hellwig <hch@lst.de>:
    Patch series "simplify bdi unregistation":
      mm: export bdi_unregister
      mtd: call bdi_unregister explicitly
      fs: explicitly unregister per-superblock BDIs
      mm: don't automatically unregister bdis
      mm: simplify bdi refcounting

    Jens Axboe <axboe@kernel.dk>:
      mm: don't read i_size of inode unless we need it

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/filemap.c: remove bogus VM_BUG_ON

    Jens Axboe <axboe@kernel.dk>:
      mm: move more expensive part of XA setup out of mapping check

Subsystem: mm/gup

    John Hubbard <jhubbard@nvidia.com>:
      mm/gup: further simplify __gup_device_huge()

Subsystem: mm/swap

    Xu Wang <vulab@iscas.ac.cn>:
      mm/swapfile: remove needless request_queue NULL pointer check

    Rafael Aquini <aquini@redhat.com>:
      mm/swapfile: fix an integer overflow in swap_show()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: optimise put_pages_list()

Subsystem: mm/memcg

    Peter Xu <peterx@redhat.com>:
      mm/memcg: drop swp_entry_t* in mc_handle_file_pte()

    Shakeel Butt <shakeelb@google.com>:
      memcg: flush stats only if updated
      memcg: unify memcg stat flushing

    Waiman Long <longman@redhat.com>:
      mm/memcg: remove obsolete memcg_free_kmem()

    Len Baker <len.baker@gmx.com>:
      mm/list_lru.c: prefer struct_size over open coded arithmetic

    Shakeel Butt <shakeelb@google.com>:
      memcg, kmem: further deprecate kmem.limit_in_bytes

    Muchun Song <songmuchun@bytedance.com>:
      mm: list_lru: remove holding lru lock
      mm: list_lru: fix the return value of list_lru_count_one()
      mm: memcontrol: remove kmemcg_id reparenting
      mm: memcontrol: remove the kmem states
      mm: list_lru: only add memcg-aware lrus to the global lru list

    Vasily Averin <vvs@virtuozzo.com>:
    Patch series "memcg: prohibit unconditional exceeding the limit of dying tasks", v3:
      mm, oom: pagefault_out_of_memory: don't force global OOM for dying tasks

    Michal Hocko <mhocko@suse.com>:
      mm, oom: do not trigger out_of_memory from the #PF

    Vasily Averin <vvs@virtuozzo.com>:
      memcg: prohibit unconditional exceeding the limit of dying tasks

Subsystem: mm/pagemap

    Peng Liu <liupeng256@huawei.com>:
      mm/mmap.c: fix a data race of mm->total_vm

    Rolf Eike Beer <eb@emlix.com>:
      mm: use __pfn_to_section() instead of open coding it

    Amit Daniel Kachhap <amit.kachhap@arm.com>:
      mm/memory.c: avoid unnecessary kernel/user pointer conversion

    Nadav Amit <namit@vmware.com>:
      mm/memory.c: use correct VMA flags when freeing page-tables

    Peter Xu <peterx@redhat.com>:
    Patch series "mm: A few cleanup patches around zap, shmem and uffd", v4:
      mm/shmem: unconditionally set pte dirty in mfill_atomic_install_pte
      mm: clear vmf->pte after pte_unmap_same() returns
      mm: drop first_index/last_index in zap_details
      mm: add zap_skip_check_mapping() helper

    Qi Zheng <zhengqi.arch@bytedance.com>:
    Patch series "Do some code cleanups related to mm", v3:
      mm: introduce pmd_install() helper
      mm: remove redundant smp_wmb()

    Tiberiu A Georgescu <tiberiu.georgescu@nutanix.com>:
      Documentation: update pagemap with shmem exceptions

    Nicholas Piggin <npiggin@gmail.com>:
    Patch series "shoot lazy tlbs", v4:
      lazy tlb: introduce lazy mm refcount helper functions
      lazy tlb: allow lazy tlb mm refcounting to be configurable
      lazy tlb: shoot lazies, a non-refcounting lazy tlb option
      powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      memory: remove unused CONFIG_MEM_BLOCK_SIZE

Subsystem: mm/mprotect

    Liu Song <liu.song11@zte.com.cn>:
      mm/mprotect.c: avoid repeated assignment in do_mprotect_pkey()

Subsystem: mm/mremap

    Dmitry Safonov <dima@arista.com>:
      mm/mremap: don't account pages in vma_to_resize()

Subsystem: mm/iomap

    Lucas De Marchi <lucas.demarchi@intel.com>:
      include/linux/io-mapping.h: remove fallback for writecombine

Subsystem: mm/tracing

    Gang Li <ligang.bdlg@bytedance.com>:
      mm: mmap_lock: remove redundant newline  in TP_printk
      mm: mmap_lock: use DECLARE_EVENT_CLASS and DEFINE_EVENT_FN

Subsystem: mm/vmalloc

    Vasily Averin <vvs@virtuozzo.com>:
      mm/vmalloc: repair warn_alloc()s in __vmalloc_area_node()

    Peter Zijlstra <peterz@infradead.org>:
      mm/vmalloc: don't allow VM_NO_GUARD on vmap()

    Eric Dumazet <edumazet@google.com>:
      mm/vmalloc: make show_numa_info() aware of hugepage mappings
      mm/vmalloc: make sure to dump unpurged areas in /proc/vmallocinfo

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: do not adjust the search size for alignment overhead
      mm/vmalloc: check various alignments when debugging

    Vasily Averin <vvs@virtuozzo.com>:
      vmalloc: back off when the current task is OOM-killed

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      vmalloc: choose a better start address in vm_area_register_early()
      arm64: support page mapping percpu first chunk allocator
      kasan: arm64: fix pcpu_page_first_chunk crash with KASAN_VMALLOC

    Michal Hocko <mhocko@suse.com>:
      mm/vmalloc: be more explicit about supported gfp flags

    Chen Wandun <chenwandun@huawei.com>:
      mm/vmalloc: introduce alloc_pages_bulk_array_mempolicy to accelerate memory allocation

    Changcheng Deng <deng.changcheng@zte.com.cn>:
      lib/test_vmalloc.c: use swap() to make code cleaner

Subsystem: mm/pagealloc

    Eric Dumazet <edumazet@google.com>:
      mm/large system hash: avoid possible NULL deref in alloc_large_system_hash

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups and fixup for page_alloc", v2:
      mm/page_alloc.c: remove meaningless VM_BUG_ON() in pindex_to_order()
      mm/page_alloc.c: simplify the code by using macro K()
      mm/page_alloc.c: fix obsolete comment in free_pcppages_bulk()
      mm/page_alloc.c: use helper function zone_spans_pfn()
      mm/page_alloc.c: avoid allocating highmem pages via alloc_pages_exact[_nid]

    Bharata B Rao <bharata@amd.com>:
    Patch series "Fix NUMA nodes fallback list ordering":
      mm/page_alloc: print node fallback order

    Krupa Ramakrishnan <krupa.ramakrishnan@amd.com>:
      mm/page_alloc: use accumulated load when building node fallback list

    Geert Uytterhoeven <geert+renesas@glider.be>:
    Patch series "Fix NUMA without SMP":
      mm: move node_reclaim_distance to fix NUMA without SMP
      mm: move fold_vm_numa_events() to fix NUMA without SMP

    Eric Dumazet <edumazet@google.com>:
      mm/page_alloc.c: do not acquire zone lock in is_free_buddy_page()

    Feng Tang <feng.tang@intel.com>:
      mm/page_alloc: detect allocation forbidden by cpuset and bail out early

    Liangcai Fan <liangcaifan19@gmail.com>:
      mm/page_alloc.c: show watermark_boost of zone in zoneinfo

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm: create a new system state and fix core_kernel_text()
      mm: make generic arch_is_kernel_initmem_freed() do what it says
      powerpc: use generic version of arch_is_kernel_initmem_freed()
      s390: use generic version of arch_is_kernel_initmem_freed()

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm: page_alloc: use migrate_disable() in drain_local_pages_wq()

    Wang ShaoBo <bobo.shaobowang@huawei.com>:
      mm/page_alloc: use clamp() to simplify code

Subsystem: mm/memory-failure

    Marco Elver <elver@google.com>:
      mm: fix data race in PagePoisoned()

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      mm/memory_failure: constify static mm_walk_ops

    Yang Shi <shy828301@gmail.com>:
    Patch series "Solve silent data loss caused by poisoned page cache (shmem/tmpfs)", v5:
      mm: filemap: coding style cleanup for filemap_map_pmd()
      mm: hwpoison: refactor refcount check handling
      mm: shmem: don't truncate page if memory failure happens
      mm: hwpoison: handle non-anonymous THP correctly

Subsystem: mm/hugetlb

    Peter Xu <peterx@redhat.com>:
      mm/hugetlb: drop __unmap_hugepage_range definition from hugetlb.h

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "hugetlb: add demote/split page functionality", v4:
      hugetlb: add demote hugetlb page sysfs interfaces
      mm/cma: add cma_pages_valid to determine if pages are in CMA
      hugetlb: be sure to free demoted CMA pages to CMA
      hugetlb: add demote bool to gigantic page routines
      hugetlb: add hugetlb demote page support

    Liangcai Fan <liangcaifan19@gmail.com>:
      mm: khugepaged: recalculate min_free_kbytes after stopping khugepaged

    Mina Almasry <almasrymina@google.com>:
      mm, hugepages: add mremap() support for hugepage backed vma
      mm, hugepages: add hugetlb vma mremap() test

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      hugetlb: support node specified when using cma for gigantic hugepages

    Ran Jianping <ran.jianping@zte.com.cn>:
      mm: remove duplicate include in hugepage-mremap.c

    Baolin Wang <baolin.wang@linux.alibaba.com>:
    Patch series "Some cleanups and improvements for hugetlb":
      hugetlb_cgroup: remove unused hugetlb_cgroup_from_counter macro
      hugetlb: replace the obsolete hugetlb_instantiation_mutex in the comments
      hugetlb: remove redundant validation in has_same_uncharge_info()
      hugetlb: remove redundant VM_BUG_ON() in add_reservation_in_range()

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: remove unnecessary set_page_count in prep_compound_gigantic_page

Subsystem: mm/userfaultfd

    Axel Rasmussen <axelrasmussen@google.com>:
    Patch series "Small userfaultfd selftest fixups", v2:
      userfaultfd/selftests: don't rely on GNU extensions for random numbers
      userfaultfd/selftests: fix feature support detection
      userfaultfd/selftests: fix calculation of expected ioctls

Subsystem: mm/vmscan

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/page_isolation: fix potential missing call to unset_migratetype_isolate()
      mm/page_isolation: guard against possible putback unisolated page

    Kai Song <songkai01@inspur.com>:
      mm/vmscan.c: fix -Wunused-but-set-variable warning

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Remove dependency on congestion_wait in mm/", v5. Patch series:
      mm/vmscan: throttle reclaim until some writeback completes if congested
      mm/vmscan: throttle reclaim and compaction when too may pages are isolated
      mm/vmscan: throttle reclaim when no progress is being made
      mm/writeback: throttle based on page writeback instead of congestion
      mm/page_alloc: remove the throttling logic from the page allocator
      mm/vmscan: centralise timeout values for reclaim_throttle
      mm/vmscan: increase the timeout if page reclaim is not making progress
      mm/vmscan: delay waking of tasks throttled on NOPROGRESS

    Yuanzheng Song <songyuanzheng@huawei.com>:
      mm/vmpressure: fix data-race with memcg->socket_pressure

Subsystem: mm/tools

    Zhenliang Wei <weizhenliang@huawei.com>:
      tools/vm/page_owner_sort.c: count and sort by mem

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
    Patch series "tools/vm/page-types.c: a few improvements":
      tools/vm/page-types.c: make walk_file() aware of address range option
      tools/vm/page-types.c: move show_file() to summary output
      tools/vm/page-types.c: print file offset in hexadecimal

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "memblock: cleanup memblock_free interface", v2:
      arch_numa: simplify numa_distance allocation
      xen/x86: free_p2m_page: use memblock_free_ptr() to free a virtual pointer
      memblock: drop memblock_free_early_nid() and memblock_free_early()
      memblock: stop aliasing __memblock_free_late with memblock_free_late
      memblock: rename memblock_free to memblock_phys_free
      memblock: use memblock_free for freeing virtual pointers

Subsystem: mm/oom-kill

    Sultan Alsawaf <sultan@kerneltoast.com>:
      mm: mark the OOM reaper thread as freezable

Subsystem: mm/hugetlbfs

    Zhenguo Yao <yaozhenguo1@gmail.com>:
      hugetlbfs: extend the definition of hugepages parameter to support node allocation

Subsystem: mm/migration

    John Hubbard <jhubbard@nvidia.com>:
      mm/migrate: de-duplicate migrate_reason strings

    Yang Shi <shy828301@gmail.com>:
      mm: migrate: make demotion knob depend on migration

Subsystem: mm/thp

    "George G. Davis" <davis.george@siemens.com>:
      selftests/vm/transhuge-stress: fix ram size thinko

    Rongwei Wang <rongwei.wang@linux.alibaba.com>:
    Patch series "fix two bugs for file THP":
      mm, thp: lock filemap when truncating page cache
      mm, thp: fix incorrect unmap behavior for private pages

Subsystem: mm/readahead

    Lin Feng <linf@wangsu.com>:
      mm/readahead.c: fix incorrect comments for get_init_ra_size

Subsystem: mm/nommu

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: nommu: kill arch_get_unmapped_area()

Subsystem: mm/ksm

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      selftest/vm: fix ksm selftest to run with different NUMA topologies

    Pedro Demarchi Gomes <pedrodemargomes@gmail.com>:
      selftests: vm: add KSM huge pages merging time test

Subsystem: mm/vmstat

    Liu Shixin <liushixin2@huawei.com>:
      mm/vmstat: annotate data race for zone->free_area[order].nr_free

    Lin Feng <linf@wangsu.com>:
      mm: vmstat.c: make extfrag_index show more pretty

Subsystem: mm/madvise

    David Hildenbrand <david@redhat.com>:
      selftests/vm: make MADV_POPULATE_(READ|WRITE) use in-tree headers

Subsystem: mm/memory-hotplug

    Tang Yizhou <tangyizhou@huawei.com>:
      mm/memory_hotplug: add static qualifier for online_policy_to_str()

    David Hildenbrand <david@redhat.com>:
    Patch series "memory-hotplug.rst: document the "auto-movable" online policy":
      memory-hotplug.rst: fix two instances of "movablecore" that should be "movable_node"
      memory-hotplug.rst: fix wrong /sys/module/memory_hotplug/parameters/ path
      memory-hotplug.rst: document the "auto-movable" online policy
    Patch series "mm/memory_hotplug: Kconfig and 32 bit cleanups":
      mm/memory_hotplug: remove CONFIG_X86_64_ACPI_NUMA dependency from CONFIG_MEMORY_HOTPLUG
      mm/memory_hotplug: remove CONFIG_MEMORY_HOTPLUG_SPARSE
      mm/memory_hotplug: restrict CONFIG_MEMORY_HOTPLUG to 64 bit
      mm/memory_hotplug: remove HIGHMEM leftovers
      mm/memory_hotplug: remove stale function declarations
      x86: remove memory hotplug support on X86_32
    Patch series "mm/memory_hotplug: full support for add_memory_driver_managed() with CONFIG_ARCH_KEEP_MEMBLOCK", v2:
      mm/memory_hotplug: handle memblock_add_node() failures in add_memory_resource()
      memblock: improve MEMBLOCK_HOTPLUG documentation
      memblock: allow to specify flags with memblock_add_node()
      memblock: add MEMBLOCK_DRIVER_MANAGED to mimic IORESOURCE_SYSRAM_DRIVER_MANAGED
      mm/memory_hotplug: indicate MEMBLOCK_DRIVER_MANAGED with IORESOURCE_SYSRAM_DRIVER_MANAGED

Subsystem: mm/rmap

    Alistair Popple <apopple@nvidia.com>:
      mm/rmap.c: avoid double faults migrating device private pages

Subsystem: mm/zsmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/zsmalloc.c: close race window between zs_pool_dec_isolated() and zs_unregister_migration()

Subsystem: mm/highmem

    Ira Weiny <ira.weiny@intel.com>:
      mm/highmem: remove deprecated kmap_atomic

Subsystem: mm/zram

    Jaewon Kim <jaewon31.kim@samsung.com>:
      zram_drv: allow reclaim on bio_alloc

    Dan Carpenter <dan.carpenter@oracle.com>:
      zram: off by one in read_block_state()

    Brian Geffon <bgeffon@google.com>:
      zram: introduce an aged idle interface

Subsystem: mm/cleanups

    Stephen Kitt <steve@sk2.org>:
      mm: remove HARDENED_USERCOPY_FALLBACK

    Mianhan Liu <liumh1@shanghaitech.edu.cn>:
      include/linux/mm.h: move nr_free_buffer_pages from swap.h to mm.h

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      stacktrace: move filter_irq_stacks() to kernel/stacktrace.c
      kfence: count unexpectedly skipped allocations
      kfence: move saving stack trace of allocations into __kfence_alloc()
      kfence: limit currently covered allocations when pool nearly full
      kfence: add note to documentation about skipping covered allocations
      kfence: test: use kunit_skip() to skip tests
      kfence: shorten critical sections of alloc/free
      kfence: always use static branches to guard kfence_alloc()
      kfence: default to dynamic branch instead of static keys mode

Subsystem: mm/damon

    Geert Uytterhoeven <geert@linux-m68k.org>:
      mm/damon: grammar s/works/work/

    SeongJae Park <sjpark@amazon.de>:
      Documentation/vm: move user guides to admin-guide/mm/

    SeongJae Park <sj@kernel.org>:
      MAINTAINERS: update SeongJae's email address

    SeongJae Park <sjpark@amazon.de>:
      docs/vm/damon: remove broken reference
      include/linux/damon.h: fix kernel-doc comments for 'damon_callback'

    SeongJae Park <sj@kernel.org>:
      mm/damon/core: print kdamond start log in debug mode only

    Changbin Du <changbin.du@gmail.com>:
      mm/damon: remove unnecessary do_exit() from kdamond
      mm/damon: needn't hold kdamond_lock to print pid of kdamond

    Colin Ian King <colin.king@canonical.com>:
      mm/damon/core: nullify pointer ctx->kdamond with a NULL

    SeongJae Park <sj@kernel.org>:
    Patch series "Implement Data Access Monitoring-based Memory Operation Schemes":
      mm/damon/core: account age of target regions
      mm/damon/core: implement DAMON-based Operation Schemes (DAMOS)
      mm/damon/vaddr: support DAMON-based Operation Schemes
      mm/damon/dbgfs: support DAMON-based Operation Schemes
      mm/damon/schemes: implement statistics feature
      selftests/damon: add 'schemes' debugfs tests
      Docs/admin-guide/mm/damon: document DAMON-based Operation Schemes
    Patch series "DAMON: Support Physical Memory Address Space Monitoring::
      mm/damon/dbgfs: allow users to set initial monitoring target regions
      mm/damon/dbgfs-test: add a unit test case for 'init_regions'
      Docs/admin-guide/mm/damon: document 'init_regions' feature
      mm/damon/vaddr: separate commonly usable functions
      mm/damon: implement primitives for physical address space monitoring
      mm/damon/dbgfs: support physical memory monitoring
      Docs/DAMON: document physical memory monitoring support

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      mm/damon/vaddr: constify static mm_walk_ops

    Rongwei Wang <rongwei.wang@linux.alibaba.com>:
      mm/damon/dbgfs: remove unnecessary variables

    SeongJae Park <sj@kernel.org>:
      mm/damon/paddr: support the pageout scheme
      mm/damon/schemes: implement size quota for schemes application speed control
      mm/damon/schemes: skip already charged targets and regions
      mm/damon/schemes: implement time quota
      mm/damon/dbgfs: support quotas of schemes
      mm/damon/selftests: support schemes quotas
      mm/damon/schemes: prioritize regions within the quotas
      mm/damon/vaddr,paddr: support pageout prioritization
      mm/damon/dbgfs: support prioritization weights
      tools/selftests/damon: update for regions prioritization of schemes
      mm/damon/schemes: activate schemes based on a watermarks mechanism
      mm/damon/dbgfs: support watermarks
      selftests/damon: support watermarks
      mm/damon: introduce DAMON-based Reclamation (DAMON_RECLAIM)
      Documentation/admin-guide/mm/damon: add a document for DAMON_RECLAIM

    Xin Hao <xhao@linux.alibaba.com>:
    Patch series "mm/damon: Fix some small bugs", v4:
      mm/damon: remove unnecessary variable initialization
      mm/damon/dbgfs: add adaptive_targets list check before enable monitor_on

    SeongJae Park <sj@kernel.org>:
    Patch series "Fix trivial nits in Documentation/admin-guide/mm":
      Docs/admin-guide/mm/damon/start: fix wrong example commands
      Docs/admin-guide/mm/damon/start: fix a wrong link
      Docs/admin-guide/mm/damon/start: simplify the content
      Docs/admin-guide/mm/pagemap: wordsmith page flags descriptions

    Changbin Du <changbin.du@gmail.com>:
      mm/damon: simplify stop mechanism

    Colin Ian King <colin.i.king@googlemail.com>:
      mm/damon: fix a few spelling mistakes in comments and a pr_debug message

    Changbin Du <changbin.du@gmail.com>:
      mm/damon: remove return value from before_terminate callback

 a/Documentation/admin-guide/blockdev/zram.rst                  |    8 
 a/Documentation/admin-guide/cgroup-v1/memory.rst               |   11 
 a/Documentation/admin-guide/kernel-parameters.txt              |   14 
 a/Documentation/admin-guide/mm/damon/index.rst                 |    1 
 a/Documentation/admin-guide/mm/damon/reclaim.rst               |  235 +++
 a/Documentation/admin-guide/mm/damon/start.rst                 |  140 +
 a/Documentation/admin-guide/mm/damon/usage.rst                 |  117 +
 a/Documentation/admin-guide/mm/hugetlbpage.rst                 |   42 
 a/Documentation/admin-guide/mm/memory-hotplug.rst              |  147 +-
 a/Documentation/admin-guide/mm/pagemap.rst                     |   75 -
 a/Documentation/core-api/memory-hotplug.rst                    |    3 
 a/Documentation/dev-tools/kfence.rst                           |   23 
 a/Documentation/translations/zh_CN/core-api/memory-hotplug.rst |    4 
 a/Documentation/vm/damon/design.rst                            |   29 
 a/Documentation/vm/damon/faq.rst                               |    5 
 a/Documentation/vm/damon/index.rst                             |    1 
 a/Documentation/vm/page_owner.rst                              |   23 
 a/MAINTAINERS                                                  |    2 
 a/Makefile                                                     |   15 
 a/arch/Kconfig                                                 |   28 
 a/arch/alpha/kernel/core_irongate.c                            |    6 
 a/arch/arc/mm/init.c                                           |    6 
 a/arch/arm/mach-hisi/platmcpm.c                                |    2 
 a/arch/arm/mach-rpc/ecard.c                                    |    2 
 a/arch/arm/mm/init.c                                           |    2 
 a/arch/arm64/Kconfig                                           |    4 
 a/arch/arm64/mm/kasan_init.c                                   |   16 
 a/arch/arm64/mm/mmu.c                                          |    4 
 a/arch/ia64/mm/contig.c                                        |    2 
 a/arch/ia64/mm/init.c                                          |    2 
 a/arch/m68k/mm/mcfmmu.c                                        |    3 
 a/arch/m68k/mm/motorola.c                                      |    6 
 a/arch/mips/loongson64/init.c                                  |    4 
 a/arch/mips/mm/init.c                                          |    6 
 a/arch/mips/sgi-ip27/ip27-memory.c                             |    3 
 a/arch/mips/sgi-ip30/ip30-setup.c                              |    6 
 a/arch/powerpc/Kconfig                                         |    1 
 a/arch/powerpc/configs/skiroot_defconfig                       |    1 
 a/arch/powerpc/include/asm/machdep.h                           |    2 
 a/arch/powerpc/include/asm/sections.h                          |   13 
 a/arch/powerpc/kernel/dt_cpu_ftrs.c                            |    8 
 a/arch/powerpc/kernel/paca.c                                   |    8 
 a/arch/powerpc/kernel/setup-common.c                           |    4 
 a/arch/powerpc/kernel/setup_64.c                               |    6 
 a/arch/powerpc/kernel/smp.c                                    |    2 
 a/arch/powerpc/mm/book3s64/radix_tlb.c                         |    4 
 a/arch/powerpc/mm/hugetlbpage.c                                |    9 
 a/arch/powerpc/platforms/powernv/pci-ioda.c                    |    4 
 a/arch/powerpc/platforms/powernv/setup.c                       |    4 
 a/arch/powerpc/platforms/pseries/setup.c                       |    2 
 a/arch/powerpc/platforms/pseries/svm.c                         |    9 
 a/arch/riscv/kernel/setup.c                                    |   10 
 a/arch/s390/include/asm/sections.h                             |   12 
 a/arch/s390/kernel/setup.c                                     |   11 
 a/arch/s390/kernel/smp.c                                       |    6 
 a/arch/s390/kernel/uv.c                                        |    2 
 a/arch/s390/mm/init.c                                          |    3 
 a/arch/s390/mm/kasan_init.c                                    |    2 
 a/arch/sh/boards/mach-ap325rxa/setup.c                         |    2 
 a/arch/sh/boards/mach-ecovec24/setup.c                         |    4 
 a/arch/sh/boards/mach-kfr2r09/setup.c                          |    2 
 a/arch/sh/boards/mach-migor/setup.c                            |    2 
 a/arch/sh/boards/mach-se/7724/setup.c                          |    4 
 a/arch/sparc/kernel/smp_64.c                                   |    4 
 a/arch/um/kernel/mem.c                                         |    4 
 a/arch/x86/Kconfig                                             |    6 
 a/arch/x86/kernel/setup.c                                      |    4 
 a/arch/x86/kernel/setup_percpu.c                               |    2 
 a/arch/x86/mm/init.c                                           |    2 
 a/arch/x86/mm/init_32.c                                        |   31 
 a/arch/x86/mm/kasan_init_64.c                                  |    4 
 a/arch/x86/mm/numa.c                                           |    2 
 a/arch/x86/mm/numa_emulation.c                                 |    2 
 a/arch/x86/xen/mmu_pv.c                                        |    8 
 a/arch/x86/xen/p2m.c                                           |    4 
 a/arch/x86/xen/setup.c                                         |    6 
 a/drivers/base/Makefile                                        |    2 
 a/drivers/base/arch_numa.c                                     |   96 +
 a/drivers/base/node.c                                          |    9 
 a/drivers/block/zram/zram_drv.c                                |   66 
 a/drivers/firmware/efi/memmap.c                                |    2 
 a/drivers/hwmon/occ/p9_sbe.c                                   |    1 
 a/drivers/macintosh/smu.c                                      |    2 
 a/drivers/mmc/core/mmc_test.c                                  |    1 
 a/drivers/mtd/mtdcore.c                                        |    1 
 a/drivers/of/kexec.c                                           |    4 
 a/drivers/of/of_reserved_mem.c                                 |    5 
 a/drivers/rapidio/devices/rio_mport_cdev.c                     |    9 
 a/drivers/s390/char/sclp_early.c                               |    4 
 a/drivers/usb/early/xhci-dbc.c                                 |   10 
 a/drivers/virtio/Kconfig                                       |    2 
 a/drivers/xen/swiotlb-xen.c                                    |    4 
 a/fs/d_path.c                                                  |    8 
 a/fs/exec.c                                                    |    4 
 a/fs/ocfs2/alloc.c                                             |   21 
 a/fs/ocfs2/dlm/dlmrecovery.c                                   |    1 
 a/fs/ocfs2/file.c                                              |    8 
 a/fs/ocfs2/inode.c                                             |    4 
 a/fs/ocfs2/journal.c                                           |   28 
 a/fs/ocfs2/journal.h                                           |    3 
 a/fs/ocfs2/super.c                                             |   40 
 a/fs/open.c                                                    |   16 
 a/fs/posix_acl.c                                               |    3 
 a/fs/proc/task_mmu.c                                           |   28 
 a/fs/super.c                                                   |    3 
 a/include/asm-generic/sections.h                               |   14 
 a/include/linux/backing-dev-defs.h                             |    3 
 a/include/linux/backing-dev.h                                  |    1 
 a/include/linux/cma.h                                          |    1 
 a/include/linux/compiler-gcc.h                                 |    8 
 a/include/linux/compiler_attributes.h                          |   10 
 a/include/linux/compiler_types.h                               |   12 
 a/include/linux/cpuset.h                                       |   17 
 a/include/linux/damon.h                                        |  258 +++
 a/include/linux/fs.h                                           |    1 
 a/include/linux/gfp.h                                          |    8 
 a/include/linux/highmem.h                                      |   28 
 a/include/linux/hugetlb.h                                      |   36 
 a/include/linux/io-mapping.h                                   |    6 
 a/include/linux/kasan.h                                        |    8 
 a/include/linux/kernel.h                                       |    1 
 a/include/linux/kfence.h                                       |   21 
 a/include/linux/memblock.h                                     |   48 
 a/include/linux/memcontrol.h                                   |    9 
 a/include/linux/memory.h                                       |   26 
 a/include/linux/memory_hotplug.h                               |    3 
 a/include/linux/mempolicy.h                                    |    5 
 a/include/linux/migrate.h                                      |   23 
 a/include/linux/migrate_mode.h                                 |   13 
 a/include/linux/mm.h                                           |   57 
 a/include/linux/mm_types.h                                     |    2 
 a/include/linux/mmzone.h                                       |   41 
 a/include/linux/node.h                                         |    4 
 a/include/linux/page-flags.h                                   |    2 
 a/include/linux/percpu.h                                       |    6 
 a/include/linux/sched/mm.h                                     |   25 
 a/include/linux/slab.h                                         |  181 +-
 a/include/linux/slub_def.h                                     |   13 
 a/include/linux/stackdepot.h                                   |    8 
 a/include/linux/stacktrace.h                                   |    1 
 a/include/linux/swap.h                                         |    1 
 a/include/linux/vmalloc.h                                      |   24 
 a/include/trace/events/mmap_lock.h                             |   50 
 a/include/trace/events/vmscan.h                                |   42 
 a/include/trace/events/writeback.h                             |    7 
 a/init/Kconfig                                                 |    2 
 a/init/initramfs.c                                             |    4 
 a/init/main.c                                                  |    6 
 a/kernel/cgroup/cpuset.c                                       |   23 
 a/kernel/cpu.c                                                 |    2 
 a/kernel/dma/swiotlb.c                                         |    6 
 a/kernel/exit.c                                                |    2 
 a/kernel/extable.c                                             |    2 
 a/kernel/fork.c                                                |   51 
 a/kernel/kexec_file.c                                          |    5 
 a/kernel/kthread.c                                             |   21 
 a/kernel/locking/lockdep.c                                     |   15 
 a/kernel/printk/printk.c                                       |    4 
 a/kernel/sched/core.c                                          |   37 
 a/kernel/sched/sched.h                                         |    4 
 a/kernel/sched/topology.c                                      |    1 
 a/kernel/stacktrace.c                                          |   30 
 a/kernel/tsacct.c                                              |    2 
 a/kernel/workqueue.c                                           |    2 
 a/lib/Kconfig.debug                                            |    2 
 a/lib/Kconfig.kfence                                           |   26 
 a/lib/bootconfig.c                                             |    2 
 a/lib/cpumask.c                                                |    6 
 a/lib/stackdepot.c                                             |   76 -
 a/lib/test_kasan.c                                             |   26 
 a/lib/test_kasan_module.c                                      |    2 
 a/lib/test_vmalloc.c                                           |    6 
 a/mm/Kconfig                                                   |   10 
 a/mm/backing-dev.c                                             |   65 
 a/mm/cma.c                                                     |   26 
 a/mm/compaction.c                                              |   12 
 a/mm/damon/Kconfig                                             |   24 
 a/mm/damon/Makefile                                            |    4 
 a/mm/damon/core.c                                              |  500 ++++++-
 a/mm/damon/dbgfs-test.h                                        |   56 
 a/mm/damon/dbgfs.c                                             |  486 +++++-
 a/mm/damon/paddr.c                                             |  275 +++
 a/mm/damon/prmtv-common.c                                      |  133 +
 a/mm/damon/prmtv-common.h                                      |   20 
 a/mm/damon/reclaim.c                                           |  356 ++++
 a/mm/damon/vaddr-test.h                                        |    2 
 a/mm/damon/vaddr.c                                             |  167 +-
 a/mm/debug.c                                                   |   20 
 a/mm/debug_vm_pgtable.c                                        |    7 
 a/mm/filemap.c                                                 |   78 -
 a/mm/gup.c                                                     |    5 
 a/mm/highmem.c                                                 |    6 
 a/mm/hugetlb.c                                                 |  713 +++++++++-
 a/mm/hugetlb_cgroup.c                                          |    3 
 a/mm/internal.h                                                |   26 
 a/mm/kasan/common.c                                            |    8 
 a/mm/kasan/generic.c                                           |   16 
 a/mm/kasan/kasan.h                                             |    2 
 a/mm/kasan/shadow.c                                            |    5 
 a/mm/kfence/core.c                                             |  214 ++-
 a/mm/kfence/kfence.h                                           |    2 
 a/mm/kfence/kfence_test.c                                      |   14 
 a/mm/khugepaged.c                                              |   10 
 a/mm/list_lru.c                                                |   58 
 a/mm/memblock.c                                                |   35 
 a/mm/memcontrol.c                                              |  217 +--
 a/mm/memory-failure.c                                          |  117 +
 a/mm/memory.c                                                  |  166 +-
 a/mm/memory_hotplug.c                                          |   57 
 a/mm/mempolicy.c                                               |  143 +-
 a/mm/migrate.c                                                 |   61 
 a/mm/mmap.c                                                    |    2 
 a/mm/mprotect.c                                                |    5 
 a/mm/mremap.c                                                  |   86 -
 a/mm/nommu.c                                                   |    6 
 a/mm/oom_kill.c                                                |   27 
 a/mm/page-writeback.c                                          |   13 
 a/mm/page_alloc.c                                              |  119 -
 a/mm/page_ext.c                                                |    2 
 a/mm/page_isolation.c                                          |   29 
 a/mm/percpu.c                                                  |   24 
 a/mm/readahead.c                                               |    2 
 a/mm/rmap.c                                                    |    8 
 a/mm/shmem.c                                                   |   44 
 a/mm/slab.c                                                    |   16 
 a/mm/slab_common.c                                             |    8 
 a/mm/slub.c                                                    |  117 -
 a/mm/sparse-vmemmap.c                                          |    2 
 a/mm/sparse.c                                                  |    6 
 a/mm/swap.c                                                    |   23 
 a/mm/swapfile.c                                                |    6 
 a/mm/userfaultfd.c                                             |    8 
 a/mm/vmalloc.c                                                 |  107 +
 a/mm/vmpressure.c                                              |    2 
 a/mm/vmscan.c                                                  |  194 ++
 a/mm/vmstat.c                                                  |   76 -
 a/mm/zsmalloc.c                                                |    7 
 a/net/ipv4/tcp.c                                               |    1 
 a/net/ipv4/udp.c                                               |    1 
 a/net/netfilter/ipvs/ip_vs_ctl.c                               |    1 
 a/net/openvswitch/meter.c                                      |    1 
 a/net/sctp/protocol.c                                          |    1 
 a/scripts/checkpatch.pl                                        |    3 
 a/scripts/decodecode                                           |    2 
 a/scripts/spelling.txt                                         |   18 
 a/security/Kconfig                                             |   14 
 a/tools/testing/selftests/damon/debugfs_attrs.sh               |   25 
 a/tools/testing/selftests/memory-hotplug/config                |    1 
 a/tools/testing/selftests/vm/.gitignore                        |    1 
 a/tools/testing/selftests/vm/Makefile                          |    1 
 a/tools/testing/selftests/vm/hugepage-mremap.c                 |  161 ++
 a/tools/testing/selftests/vm/ksm_tests.c                       |  154 ++
 a/tools/testing/selftests/vm/madv_populate.c                   |   15 
 a/tools/testing/selftests/vm/run_vmtests.sh                    |   11 
 a/tools/testing/selftests/vm/transhuge-stress.c                |    2 
 a/tools/testing/selftests/vm/userfaultfd.c                     |  157 +-
 a/tools/vm/page-types.c                                        |   38 
 a/tools/vm/page_owner_sort.c                                   |   94 +
 b/Documentation/admin-guide/mm/index.rst                       |    2 
 b/Documentation/vm/index.rst                                   |   26 
 260 files changed, 6448 insertions(+), 2327 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-11-09  2:30 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-11-09  2:30 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

87 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813, plus
previously sent material.

Subsystems affected by this patch series:

  mm/pagecache
  mm/hugetlb
  procfs
  misc
  MAINTAINERS
  lib
  checkpatch
  binfmt
  kallsyms
  ramfs
  init
  codafs
  nilfs2
  hfs
  crash_dump
  signals
  seq_file
  fork
  sysvfs
  kcov
  gdb
  resource
  selftests
  ipc

Subsystem: mm/pagecache

    Johannes Weiner <hannes@cmpxchg.org>:
      vfs: keep inodes with page cache off the inode shrinker LRU

Subsystem: mm/hugetlb

    zhangyiru <zhangyiru3@huawei.com>:
      mm,hugetlb: remove mlock ulimit for SHM_HUGETLB

Subsystem: procfs

    Florian Weimer <fweimer@redhat.com>:
      procfs: do not list TID 0 in /proc/<pid>/task

    David Hildenbrand <david@redhat.com>:
      x86/xen: update xen_oldmem_pfn_is_ram() documentation
      x86/xen: simplify xen_oldmem_pfn_is_ram()
      x86/xen: print a warning when HVMOP_get_mem_type fails
      proc/vmcore: let pfn_is_ram() return a bool
      proc/vmcore: convert oldmem_pfn_is_ram callback to more generic vmcore callbacks
      virtio-mem: factor out hotplug specifics from virtio_mem_init() into virtio_mem_init_hotplug()
      virtio-mem: factor out hotplug specifics from virtio_mem_probe() into virtio_mem_init_hotplug()
      virtio-mem: factor out hotplug specifics from virtio_mem_remove() into virtio_mem_deinit_hotplug()
      virtio-mem: kdump mode to sanitize /proc/vmcore access

    Stephen Brennan <stephen.s.brennan@oracle.com>:
      proc: allow pid_revalidate() during LOOKUP_RCU

Subsystem: misc

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
    Patch series "kernel.h further split", v5:
      kernel.h: drop unneeded <linux/kernel.h> inclusion from other headers
      kernel.h: split out container_of() and typeof_member() macros
      include/kunit/test.h: replace kernel.h with the necessary inclusions
      include/linux/list.h: replace kernel.h with the necessary inclusions
      include/linux/llist.h: replace kernel.h with the necessary inclusions
      include/linux/plist.h: replace kernel.h with the necessary inclusions
      include/media/media-entity.h: replace kernel.h with the necessary inclusions
      include/linux/delay.h: replace kernel.h with the necessary inclusions
      include/linux/sbitmap.h: replace kernel.h with the necessary inclusions
      include/linux/radix-tree.h: replace kernel.h with the necessary inclusions
      include/linux/generic-radix-tree.h: replace kernel.h with the necessary inclusions

    Stephen Rothwell <sfr@canb.auug.org.au>:
      kernel.h: split out instruction pointer accessors

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      linux/container_of.h: switch to static_assert

    Colin Ian King <colin.i.king@googlemail.com>:
      mailmap: update email address for Colin King

Subsystem: MAINTAINERS

    Kees Cook <keescook@chromium.org>:
      MAINTAINERS: add "exec & binfmt" section with myself and Eric

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
    Patch series "Rectify file references for dt-bindings in MAINTAINERS", v5:
      MAINTAINERS: rectify entry for ARM/TOSHIBA VISCONTI ARCHITECTURE
      MAINTAINERS: rectify entry for HIKEY960 ONBOARD USB GPIO HUB DRIVER
      MAINTAINERS: rectify entry for INTEL KEEM BAY DRM DRIVER
      MAINTAINERS: rectify entry for ALLWINNER HARDWARE SPINLOCK SUPPORT

Subsystem: lib

    Imran Khan <imran.f.khan@oracle.com>:
    Patch series "lib, stackdepot: check stackdepot handle before accessing slabs", v2:
      lib, stackdepot: check stackdepot handle before accessing slabs
      lib, stackdepot: add helper to print stack entries
      lib, stackdepot: add helper to print stack entries into buffer

    Lucas De Marchi <lucas.demarchi@intel.com>:
      include/linux/string_helpers.h: add linux/string.h for strlen()

    Alexey Dobriyan <adobriyan@gmail.com>:
      lib: uninline simple_strntoull() as well

    Thomas Gleixner <tglx@linutronix.de>:
      mm/scatterlist: replace the !preemptible warning in sg_miter_stop()

Subsystem: checkpatch

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      const_structs.checkpatch: add a few sound ops structs

    Joe Perches <joe@perches.com>:
      checkpatch: improve EXPORT_SYMBOL test for EXPORT_SYMBOL_NS uses

    Peter Ujfalusi <peter.ujfalusi@linux.intel.com>:
      checkpatch: get default codespell dictionary path from package location

Subsystem: binfmt

    Kees Cook <keescook@chromium.org>:
      binfmt_elf: reintroduce using MAP_FIXED_NOREPLACE

    Alexey Dobriyan <adobriyan@gmail.com>:
      ELF: simplify STACK_ALLOC macro

Subsystem: kallsyms

    Kefeng Wang <wangkefeng.wang@huawei.com>:
    Patch series "sections: Unify kernel sections range check and use", v4:
      kallsyms: remove arch specific text and data check
      kallsyms: fix address-checks for kernel related range
      sections: move and rename core_kernel_data() to is_kernel_core_data()
      sections: move is_kernel_inittext() into sections.h
      x86: mm: rename __is_kernel_text() to is_x86_32_kernel_text()
      sections: provide internal __is_kernel() and __is_kernel_text() helper
      mm: kasan: use is_kernel() helper
      extable: use is_kernel_text() helper
      powerpc/mm: use core_kernel_text() helper
      microblaze: use is_kernel_text() helper
      alpha: use is_kernel_text() helper

Subsystem: ramfs

    yangerkun <yangerkun@huawei.com>:
      ramfs: fix mount source show for ramfs

Subsystem: init

    Andrew Halaney <ahalaney@redhat.com>:
      init: make unknown command line param message clearer

Subsystem: codafs

    Jan Harkes <jaharkes@cs.cmu.edu>:
    Patch series "Coda updates for -next":
      coda: avoid NULL pointer dereference from a bad inode
      coda: check for async upcall request using local state

    Alex Shi <alex.shi@linux.alibaba.com>:
      coda: remove err which no one care

    Jan Harkes <jaharkes@cs.cmu.edu>:
      coda: avoid flagging NULL inodes
      coda: avoid hidden code duplication in rename
      coda: avoid doing bad things on inode type changes during revalidation

    Xiyu Yang <xiyuyang19@fudan.edu.cn>:
      coda: convert from atomic_t to refcount_t on coda_vm_ops->refcnt

    Jing Yangyang <jing.yangyang@zte.com.cn>:
      coda: use vmemdup_user to replace the open code

    Jan Harkes <jaharkes@cs.cmu.edu>:
      coda: bump module version to 7.2

Subsystem: nilfs2

    Qing Wang <wangqing@vivo.com>:
    Patch series "nilfs2 updates":
      nilfs2: replace snprintf in show functions with sysfs_emit

    Ryusuke Konishi <konishi.ryusuke@gmail.com>:
      nilfs2: remove filenames from file comments

Subsystem: hfs

    Arnd Bergmann <arnd@arndb.de>:
      hfs/hfsplus: use WARN_ON for sanity check

Subsystem: crash_dump

    Changcheng Deng <deng.changcheng@zte.com.cn>:
      crash_dump: fix boolreturn.cocci warning

    Ye Guojin <ye.guojin@zte.com.cn>:
      crash_dump: remove duplicate include in crash_dump.h

Subsystem: signals

    Ye Guojin <ye.guojin@zte.com.cn>:
      signal: remove duplicate include in signal.h

Subsystem: seq_file

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      seq_file: move seq_escape() to a header

    Muchun Song <songmuchun@bytedance.com>:
      seq_file: fix passing wrong private data

Subsystem: fork

    Ran Xiaokai <ran.xiaokai@zte.com.cn>:
      kernel/fork.c: unshare(): use swap() to make code cleaner

Subsystem: sysvfs

    Pavel Skripkin <paskripkin@gmail.com>:
      sysv: use BUILD_BUG_ON instead of runtime check

Subsystem: kcov

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
    Patch series "kcov: PREEMPT_RT fixup + misc", v2:
      Documentation/kcov: include types.h in the example
      Documentation/kcov: define `ip' in the example
      kcov: allocate per-CPU memory on the relevant node
      kcov: avoid enable+disable interrupts if !in_task()
      kcov: replace local_irq_save() with a local_lock_t

Subsystem: gdb

    Douglas Anderson <dianders@chromium.org>:
      scripts/gdb: handle split debug for vmlinux

Subsystem: resource

    David Hildenbrand <david@redhat.com>:
    Patch series "virtio-mem: disallow mapping virtio-mem memory via /dev/mem", v5:
      kernel/resource: clean up and optimize iomem_is_exclusive()
      kernel/resource: disallow access to exclusive system RAM regions
      virtio-mem: disallow mapping virtio-mem memory via /dev/mem

Subsystem: selftests

    SeongJae Park <sjpark@amazon.de>:
      selftests/kselftest/runner/run_one(): allow running non-executable files

Subsystem: ipc

    Michal Clapinski <mclapinski@google.com>:
      ipc: check checkpoint_restore_ns_capable() to modify C/R proc files

    Manfred Spraul <manfred@colorfullife.com>:
      ipc/ipc_sysctl.c: remove fallback for !CONFIG_PROC_SYSCTL

 .mailmap                                             |    2 
 Documentation/dev-tools/kcov.rst                     |    5 
 MAINTAINERS                                          |   21 +
 arch/alpha/kernel/traps.c                            |    4 
 arch/microblaze/mm/pgtable.c                         |    3 
 arch/powerpc/mm/pgtable_32.c                         |    7 
 arch/riscv/lib/delay.c                               |    4 
 arch/s390/include/asm/facility.h                     |    4 
 arch/x86/kernel/aperture_64.c                        |   13 
 arch/x86/kernel/unwind_orc.c                         |    2 
 arch/x86/mm/init_32.c                                |   14 
 arch/x86/xen/mmu_hvm.c                               |   39 --
 drivers/gpu/drm/drm_dp_mst_topology.c                |    5 
 drivers/gpu/drm/drm_mm.c                             |    5 
 drivers/gpu/drm/i915/i915_vma.c                      |    5 
 drivers/gpu/drm/i915/intel_runtime_pm.c              |   20 -
 drivers/media/dvb-frontends/cxd2880/cxd2880_common.h |    1 
 drivers/virtio/Kconfig                               |    1 
 drivers/virtio/virtio_mem.c                          |  321 +++++++++++++------
 fs/binfmt_elf.c                                      |   33 +
 fs/coda/cnode.c                                      |   13 
 fs/coda/coda_linux.c                                 |   39 +-
 fs/coda/coda_linux.h                                 |    6 
 fs/coda/dir.c                                        |   20 -
 fs/coda/file.c                                       |   12 
 fs/coda/psdev.c                                      |   14 
 fs/coda/upcall.c                                     |    3 
 fs/hfs/inode.c                                       |    6 
 fs/hfsplus/inode.c                                   |   12 
 fs/hugetlbfs/inode.c                                 |   23 -
 fs/inode.c                                           |   46 +-
 fs/internal.h                                        |    1 
 fs/nilfs2/alloc.c                                    |    2 
 fs/nilfs2/alloc.h                                    |    2 
 fs/nilfs2/bmap.c                                     |    2 
 fs/nilfs2/bmap.h                                     |    2 
 fs/nilfs2/btnode.c                                   |    2 
 fs/nilfs2/btnode.h                                   |    2 
 fs/nilfs2/btree.c                                    |    2 
 fs/nilfs2/btree.h                                    |    2 
 fs/nilfs2/cpfile.c                                   |    2 
 fs/nilfs2/cpfile.h                                   |    2 
 fs/nilfs2/dat.c                                      |    2 
 fs/nilfs2/dat.h                                      |    2 
 fs/nilfs2/dir.c                                      |    2 
 fs/nilfs2/direct.c                                   |    2 
 fs/nilfs2/direct.h                                   |    2 
 fs/nilfs2/file.c                                     |    2 
 fs/nilfs2/gcinode.c                                  |    2 
 fs/nilfs2/ifile.c                                    |    2 
 fs/nilfs2/ifile.h                                    |    2 
 fs/nilfs2/inode.c                                    |    2 
 fs/nilfs2/ioctl.c                                    |    2 
 fs/nilfs2/mdt.c                                      |    2 
 fs/nilfs2/mdt.h                                      |    2 
 fs/nilfs2/namei.c                                    |    2 
 fs/nilfs2/nilfs.h                                    |    2 
 fs/nilfs2/page.c                                     |    2 
 fs/nilfs2/page.h                                     |    2 
 fs/nilfs2/recovery.c                                 |    2 
 fs/nilfs2/segbuf.c                                   |    2 
 fs/nilfs2/segbuf.h                                   |    2 
 fs/nilfs2/segment.c                                  |    2 
 fs/nilfs2/segment.h                                  |    2 
 fs/nilfs2/sufile.c                                   |    2 
 fs/nilfs2/sufile.h                                   |    2 
 fs/nilfs2/super.c                                    |    2 
 fs/nilfs2/sysfs.c                                    |   78 ++--
 fs/nilfs2/sysfs.h                                    |    2 
 fs/nilfs2/the_nilfs.c                                |    2 
 fs/nilfs2/the_nilfs.h                                |    2 
 fs/proc/base.c                                       |   21 -
 fs/proc/vmcore.c                                     |  109 ++++--
 fs/ramfs/inode.c                                     |   11 
 fs/seq_file.c                                        |   16 
 fs/sysv/super.c                                      |    6 
 include/asm-generic/sections.h                       |   75 +++-
 include/kunit/test.h                                 |   13 
 include/linux/bottom_half.h                          |    3 
 include/linux/container_of.h                         |   52 ++-
 include/linux/crash_dump.h                           |   30 +
 include/linux/delay.h                                |    2 
 include/linux/fs.h                                   |    1 
 include/linux/fwnode.h                               |    1 
 include/linux/generic-radix-tree.h                   |    3 
 include/linux/hugetlb.h                              |    6 
 include/linux/instruction_pointer.h                  |    8 
 include/linux/kallsyms.h                             |   21 -
 include/linux/kernel.h                               |   39 --
 include/linux/list.h                                 |    4 
 include/linux/llist.h                                |    4 
 include/linux/pagemap.h                              |   50 ++
 include/linux/plist.h                                |    5 
 include/linux/radix-tree.h                           |    4 
 include/linux/rwsem.h                                |    1 
 include/linux/sbitmap.h                              |   11 
 include/linux/seq_file.h                             |   19 +
 include/linux/signal.h                               |    1 
 include/linux/smp.h                                  |    1 
 include/linux/spinlock.h                             |    1 
 include/linux/stackdepot.h                           |    5 
 include/linux/string_helpers.h                       |    1 
 include/media/media-entity.h                         |    3 
 init/main.c                                          |    4 
 ipc/ipc_sysctl.c                                     |   42 +-
 ipc/shm.c                                            |    8 
 kernel/extable.c                                     |   33 -
 kernel/fork.c                                        |    9 
 kernel/kcov.c                                        |   40 +-
 kernel/locking/lockdep.c                             |    3 
 kernel/resource.c                                    |   54 ++-
 kernel/trace/ftrace.c                                |    2 
 lib/scatterlist.c                                    |   11 
 lib/stackdepot.c                                     |   46 ++
 lib/vsprintf.c                                       |    3 
 mm/Kconfig                                           |    7 
 mm/filemap.c                                         |    8 
 mm/kasan/report.c                                    |   17 -
 mm/memfd.c                                           |    4 
 mm/mmap.c                                            |    3 
 mm/page_owner.c                                      |   18 -
 mm/truncate.c                                        |   19 +
 mm/vmscan.c                                          |    7 
 mm/workingset.c                                      |   10 
 net/sysctl_net.c                                     |    2 
 scripts/checkpatch.pl                                |   33 +
 scripts/const_structs.checkpatch                     |    4 
 scripts/gdb/linux/symbols.py                         |    3 
 tools/testing/selftests/kselftest/runner.sh          |   28 +
 tools/testing/selftests/proc/.gitignore              |    1 
 tools/testing/selftests/proc/Makefile                |    2 
 tools/testing/selftests/proc/proc-tid0.c             |   81 ++++
 132 files changed, 1206 insertions(+), 681 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-11-11  4:32 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-11-11  4:32 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

The post-linux-next material.

7 patches, based on debe436e77c72fcee804fb867f275e6d31aa999c.

Subsystems affected by this patch series:

  mm/debug
  mm/slab-generic
  mm/migration
  mm/memcg
  mm/kasan

Subsystem: mm/debug

    Yixuan Cao <caoyixuan2019@email.szu.edu.cn>:
      mm/page_owner.c: modify the type of argument "order" in some functions

Subsystem: mm/slab-generic

    Ingo Molnar <mingo@kernel.org>:
      mm: allow only SLUB on PREEMPT_RT

Subsystem: mm/migration

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: migrate: simplify the file-backed pages validation when migrating its mapping

    Alistair Popple <apopple@nvidia.com>:
      mm/migrate.c: remove MIGRATE_PFN_LOCKED

Subsystem: mm/memcg

    Christoph Hellwig <hch@lst.de>:
    Patch series "unexport memcg locking helpers":
      mm: unexport folio_memcg_{,un}lock
      mm: unexport {,un}lock_page_memcg

Subsystem: mm/kasan

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
      kasan: add kasan mode messages when kasan init

 Documentation/vm/hmm.rst                 |    2 
 arch/arm64/mm/kasan_init.c               |    2 
 arch/powerpc/kvm/book3s_hv_uvmem.c       |    4 
 drivers/gpu/drm/amd/amdkfd/kfd_migrate.c |    2 
 drivers/gpu/drm/nouveau/nouveau_dmem.c   |    4 
 include/linux/migrate.h                  |    1 
 include/linux/page_owner.h               |   12 +-
 init/Kconfig                             |    2 
 lib/test_hmm.c                           |    5 -
 mm/kasan/hw_tags.c                       |   14 ++
 mm/kasan/sw_tags.c                       |    2 
 mm/memcontrol.c                          |    4 
 mm/migrate.c                             |  151 +++++--------------------------
 mm/page_owner.c                          |    6 -
 14 files changed, 61 insertions(+), 150 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-11-20  0:42 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-11-20  0:42 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

15 patches, based on a90af8f15bdc9449ee2d24e1d73fa3f7e8633f81.

Subsystems affected by this patch series:

  mm/swap
  ipc
  mm/slab-generic
  hexagon
  mm/kmemleak
  mm/hugetlb
  mm/kasan
  mm/damon
  mm/highmem
  proc

Subsystem: mm/swap

    Matthew Wilcox <willy@infradead.org>:
      mm/swap.c:put_pages_list(): reinitialise the page list

Subsystem: ipc

    Alexander Mikhalitsyn <alexander.mikhalitsyn@virtuozzo.com>:
    Patch series "shm: shm_rmid_forced feature fixes":
      ipc: WARN if trying to remove ipc object which is absent
      shm: extend forced shm destroy to support objects from several IPC nses

Subsystem: mm/slab-generic

    Yunfeng Ye <yeyunfeng@huawei.com>:
      mm: emit the "free" trace report before freeing memory in kmem_cache_free()

Subsystem: hexagon

    Nathan Chancellor <nathan@kernel.org>:
    Patch series "Fixes for ARCH=hexagon allmodconfig", v2:
      hexagon: export raw I/O routines for modules
      hexagon: clean up timer-regs.h
      hexagon: ignore vmlinux.lds

Subsystem: mm/kmemleak

    Rustam Kovhaev <rkovhaev@gmail.com>:
      mm: kmemleak: slob: respect SLAB_NOLEAKTRACE flag

Subsystem: mm/hugetlb

    Bui Quang Minh <minhquangbui99@gmail.com>:
      hugetlb: fix hugetlb cgroup refcounting during mremap

    Mina Almasry <almasrymina@google.com>:
      hugetlb, userfaultfd: fix reservation restore on userfaultfd error

Subsystem: mm/kasan

    Kees Cook <keescook@chromium.org>:
      kasan: test: silence intentional read overflow warnings

Subsystem: mm/damon

    SeongJae Park <sj@kernel.org>:
    Patch series "DAMON fixes":
      mm/damon/dbgfs: use '__GFP_NOWARN' for user-specified size buffer allocation
      mm/damon/dbgfs: fix missed use of damon_dbgfs_lock

Subsystem: mm/highmem

    Ard Biesheuvel <ardb@kernel.org>:
      kmap_local: don't assume kmap PTEs are linear arrays in memory

Subsystem: proc

    David Hildenbrand <david@redhat.com>:
      proc/vmcore: fix clearing user buffer by properly using clear_user()

 arch/arm/Kconfig                      |    1 
 arch/hexagon/include/asm/timer-regs.h |   26 ----
 arch/hexagon/include/asm/timex.h      |    3 
 arch/hexagon/kernel/.gitignore        |    1 
 arch/hexagon/kernel/time.c            |   12 +-
 arch/hexagon/lib/io.c                 |    4 
 fs/proc/vmcore.c                      |   20 ++-
 include/linux/hugetlb_cgroup.h        |   12 ++
 include/linux/ipc_namespace.h         |   15 ++
 include/linux/sched/task.h            |    2 
 ipc/shm.c                             |  189 +++++++++++++++++++++++++---------
 ipc/util.c                            |    6 -
 lib/test_kasan.c                      |    2 
 mm/Kconfig                            |    3 
 mm/damon/dbgfs.c                      |   20 ++-
 mm/highmem.c                          |   32 +++--
 mm/hugetlb.c                          |   11 +
 mm/slab.c                             |    3 
 mm/slab.h                             |    2 
 mm/slob.c                             |    3 
 mm/slub.c                             |    2 
 mm/swap.c                             |    1 
 22 files changed, 254 insertions(+), 116 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-12-10 22:45 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-12-10 22:45 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

21 patches, based on c741e49150dbb0c0aebe234389f4aa8b47958fa8.

Subsystems affected by this patch series:

  mm/mlock
  MAINTAINERS
  mailmap
  mm/pagecache
  mm/damon
  mm/slub
  mm/memcg
  mm/hugetlb
  mm/pagecache

Subsystem: mm/mlock

    Drew DeVault <sir@cmpwn.com>:
      Increase default MLOCK_LIMIT to 8 MiB

Subsystem: MAINTAINERS

    Dave Young <dyoung@redhat.com>:
      MAINTAINERS: update kdump maintainers

Subsystem: mailmap

    Guo Ren <guoren@linux.alibaba.com>:
      mailmap: update email address for Guo Ren

Subsystem: mm/pagecache

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      filemap: remove PageHWPoison check from next_uptodate_page()

Subsystem: mm/damon

    SeongJae Park <sj@kernel.org>:
    Patch series "mm/damon: Fix fake /proc/loadavg reports", v3:
      timers: implement usleep_idle_range()
      mm/damon/core: fix fake load reports due to uninterruptible sleeps
    Patch series "mm/damon: Trivial fixups and improvements":
      mm/damon/core: use better timer mechanisms selection threshold
      mm/damon/dbgfs: remove an unnecessary error message
      mm/damon/core: remove unnecessary error messages
      mm/damon/vaddr: remove an unnecessary warning message
      mm/damon/vaddr-test: split a test function having >1024 bytes frame size
      mm/damon/vaddr-test: remove unnecessary variables
      selftests/damon: skip test if DAMON is running
      selftests/damon: test DAMON enabling with empty target_ids case
      selftests/damon: test wrong DAMOS condition ranges input
      selftests/damon: test debugfs file reads/writes with huge count
      selftests/damon: split test cases

Subsystem: mm/slub

    Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
      mm/slub: fix endianness bug for alloc/free_traces attributes

Subsystem: mm/memcg

    Waiman Long <longman@redhat.com>:
      mm/memcg: relocate mod_objcg_mlstate(), get_obj_stock() and put_obj_stock()

Subsystem: mm/hugetlb

    Zhenguo Yao <yaozhenguo1@gmail.com>:
      hugetlbfs: fix issue of preallocation of gigantic pages can't work

Subsystem: mm/pagecache

    Manjong Lee <mj0123.lee@samsung.com>:
      mm: bdi: initialize bdi_min_ratio when bdi is unregistered

 .mailmap                                                       |    2 
 MAINTAINERS                                                    |    2 
 include/linux/delay.h                                          |   14 
 include/uapi/linux/resource.h                                  |   13 
 kernel/time/timer.c                                            |   16 -
 mm/backing-dev.c                                               |    7 
 mm/damon/core.c                                                |   20 -
 mm/damon/dbgfs.c                                               |    4 
 mm/damon/vaddr-test.h                                          |   85 ++---
 mm/damon/vaddr.c                                               |    1 
 mm/filemap.c                                                   |    2 
 mm/hugetlb.c                                                   |    2 
 mm/memcontrol.c                                                |  106 +++----
 mm/slub.c                                                      |   15 -
 tools/testing/selftests/damon/.gitignore                       |    2 
 tools/testing/selftests/damon/Makefile                         |    7 
 tools/testing/selftests/damon/_debugfs_common.sh               |   52 +++
 tools/testing/selftests/damon/debugfs_attrs.sh                 |  149 ++--------
 tools/testing/selftests/damon/debugfs_empty_targets.sh         |   13 
 tools/testing/selftests/damon/debugfs_huge_count_read_write.sh |   22 +
 tools/testing/selftests/damon/debugfs_schemes.sh               |   19 +
 tools/testing/selftests/damon/debugfs_target_ids.sh            |   19 +
 tools/testing/selftests/damon/huge_count_read_write.c          |   39 ++
 23 files changed, 363 insertions(+), 248 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-12-25  5:11 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-12-25  5:11 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

9 patches, based on bc491fb12513e79702c6f936c838f792b5389129.

Subsystems affected by this patch series:

  mm/kfence
  mm/mempolicy
  core-kernel
  MAINTAINERS
  mm/memory-failure
  mm/pagemap
  mm/pagealloc
  mm/damon
  mm/memory-failure

Subsystem: mm/kfence

    Baokun Li <libaokun1@huawei.com>:
      kfence: fix memory leak when cat kfence objects

Subsystem: mm/mempolicy

    Andrey Ryabinin <arbn@yandex-team.com>:
      mm: mempolicy: fix THP allocations escaping mempolicy restrictions

Subsystem: core-kernel

    Philipp Rudo <prudo@redhat.com>:
      kernel/crash_core: suppress unknown crashkernel parameter warning

Subsystem: MAINTAINERS

    Randy Dunlap <rdunlap@infradead.org>:
      MAINTAINERS: mark more list instances as moderated

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm, hwpoison: fix condition in free hugetlb page path

Subsystem: mm/pagemap

    Hugh Dickins <hughd@google.com>:
      mm: delete unsafe BUG from page_cache_add_speculative()

Subsystem: mm/pagealloc

    Thibaut Sautereau <thibaut.sautereau@ssi.gouv.fr>:
      mm/page_alloc: fix __alloc_size attribute for alloc_pages_exact_nid

Subsystem: mm/damon

    SeongJae Park <sj@kernel.org>:
      mm/damon/dbgfs: protect targets destructions with kdamond_lock

Subsystem: mm/memory-failure

    Liu Shixin <liushixin2@huawei.com>:
      mm/hwpoison: clear MF_COUNT_INCREASED before retrying get_any_page()

 MAINTAINERS             |    4 ++--
 include/linux/gfp.h     |    2 +-
 include/linux/pagemap.h |    1 -
 kernel/crash_core.c     |   11 +++++++++++
 mm/damon/dbgfs.c        |    2 ++
 mm/kfence/core.c        |    1 +
 mm/memory-failure.c     |   14 +++++---------
 mm/mempolicy.c          |    3 +--
 8 files changed, 23 insertions(+), 15 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2021-12-31  4:12 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-12-31  4:12 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

2 patches, based on 4f3d93c6eaff6b84e43b63e0d7a119c5920e1020.

Subsystems affected by this patch series:

  mm/userfaultfd
  mm/damon

Subsystem: mm/userfaultfd

    Mike Kravetz <mike.kravetz@oracle.com>:
      userfaultfd/selftests: fix hugetlb area allocations

Subsystem: mm/damon

    SeongJae Park <sj@kernel.org>:
      mm/damon/dbgfs: fix 'struct pid' leaks in 'dbgfs_target_ids_write()'

 mm/damon/dbgfs.c                         |    9 +++++++--
 tools/testing/selftests/vm/userfaultfd.c |   16 ++++++++++------
 2 files changed, 17 insertions(+), 8 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-01-14 22:02 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-01-14 22:02 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

146 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16")

Subsystems affected by this patch series:

  kthread
  ia64
  scripts
  ntfs
  squashfs
  ocfs2
  vfs
  mm/slab-generic
  mm/slab
  mm/kmemleak
  mm/dax
  mm/kasan
  mm/debug
  mm/pagecache
  mm/gup
  mm/shmem
  mm/frontswap
  mm/memremap
  mm/memcg
  mm/selftests
  mm/pagemap
  mm/dma
  mm/vmalloc
  mm/memory-failure
  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/mempolicy
  mm/oom-kill
  mm/hugetlbfs
  mm/migration
  mm/thp
  mm/ksm
  mm/page-poison
  mm/percpu
  mm/rmap
  mm/zswap
  mm/zram
  mm/cleanups
  mm/hmm
  mm/damon

Subsystem: kthread

    Cai Huoqing <caihuoqing@baidu.com>:
      kthread: add the helper function kthread_run_on_cpu()
      RDMA/siw: make use of the helper function kthread_run_on_cpu()
      ring-buffer: make use of the helper function kthread_run_on_cpu()
      rcutorture: make use of the helper function kthread_run_on_cpu()
      trace/osnoise: make use of the helper function kthread_run_on_cpu()
      trace/hwlat: make use of the helper function kthread_run_on_cpu()

Subsystem: ia64

    Yang Guang <yang.guang5@zte.com.cn>:
      ia64: module: use swap() to make code cleaner
      arch/ia64/kernel/setup.c: use swap() to make code cleaner

    Jason Wang <wangborong@cdjrlc.com>:
      ia64: fix typo in a comment

    Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
      ia64: topology: use default_groups in kobj_type

Subsystem: scripts

    Drew Fustini <dfustini@baylibre.com>:
      scripts/spelling.txt: add "oveflow"

Subsystem: ntfs

    Yang Li <yang.lee@linux.alibaba.com>:
      fs/ntfs/attrib.c: fix one kernel-doc comment

Subsystem: squashfs

    Zheng Liang <zhengliang6@huawei.com>:
      squashfs: provide backing_dev_info in order to disable read-ahead

Subsystem: ocfs2

    Zhang Mingyu <zhang.mingyu@zte.com.cn>:
      ocfs2: use BUG_ON instead of if condition followed by BUG.

    Joseph Qi <joseph.qi@linux.alibaba.com>:
      ocfs2: clearly handle ocfs2_grab_pages_for_write() return value

    Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
      ocfs2: use default_groups in kobj_type

    Colin Ian King <colin.i.king@gmail.com>:
      ocfs2: remove redundant assignment to pointer root_bh

    Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
      ocfs2: cluster: use default_groups in kobj_type

    Colin Ian King <colin.i.king@gmail.com>:
      ocfs2: remove redundant assignment to variable free_space

Subsystem: vfs

    Amit Daniel Kachhap <amit.kachhap@arm.com>:
      fs/ioctl: remove unnecessary __user annotation

Subsystem: mm/slab-generic

    Marco Elver <elver@google.com>:
      mm/slab_common: use WARN() if cache still has objects on destroy

Subsystem: mm/slab

    Muchun Song <songmuchun@bytedance.com>:
      mm: slab: make slab iterator functions static

Subsystem: mm/kmemleak

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
      kmemleak: fix kmemleak false positive report with HW tag-based kasan enable

    Calvin Zhang <calvinzhang.cool@gmail.com>:
      mm: kmemleak: alloc gray object for reserved region with direct map

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: defer kmemleak object creation of module_alloc()

Subsystem: mm/dax

    Joao Martins <joao.m.martins@oracle.com>:
    Patch series "mm, device-dax: Introduce compound pages in devmap", v7:
      mm/page_alloc: split prep_compound_page into head and tail subparts
      mm/page_alloc: refactor memmap_init_zone_device() page init
      mm/memremap: add ZONE_DEVICE support for compound pages
      device-dax: use ALIGN() for determining pgoff
      device-dax: use struct_size()
      device-dax: ensure dev_dax->pgmap is valid for dynamic devices
      device-dax: factor out page mapping initialization
      device-dax: set mapping prior to vmf_insert_pfn{,_pmd,pud}()
      device-dax: remove pfn from __dev_dax_{pte,pmd,pud}_fault()
      device-dax: compound devmap support

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
      kasan: test: add globals left-out-of-bounds test
      kasan: add ability to detect double-kmem_cache_destroy()
      kasan: test: add test case for double-kmem_cache_destroy()

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix quarantine conflicting with init_on_free

Subsystem: mm/debug

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm,fs: split dump_mapping() out from dump_page()

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/debug_vm_pgtable: update comments regarding migration swap entries

Subsystem: mm/pagecache

    chiminghao <chi.minghao@zte.com.cn>:
      mm/truncate.c: remove unneeded variable

Subsystem: mm/gup

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      gup: avoid multiple user access locking/unlocking in fault_in_{read/write}able

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm/gup.c: stricter check on THP migration entry during follow_pmd_mask

Subsystem: mm/shmem

    Yang Shi <shy828301@gmail.com>:
      mm: shmem: don't truncate page if memory failure happens

    Gang Li <ligang.bdlg@bytedance.com>:
      shmem: fix a race between shmem_unused_huge_shrink and shmem_evict_inode

Subsystem: mm/frontswap

    Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
      mm/frontswap.c: use non-atomic '__set_bit()' when possible

Subsystem: mm/memremap

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: make cgroup_memory_nokmem static

    Donghai Qiao <dqiao@redhat.com>:
      mm/page_counter: remove an incorrect call to propagate_protected_usage()

    Dan Schatzberg <schatzberg.dan@gmail.com>:
      mm/memcg: add oom_group_kill memory event

    Shakeel Butt <shakeelb@google.com>:
      memcg: better bounds on the memcg stats updates

    Wang Weiyang <wangweiyang2@huawei.com>:
      mm/memcg: use struct_size() helper in kzalloc()

    Shakeel Butt <shakeelb@google.com>:
      memcg: add per-memcg vmalloc stat

Subsystem: mm/selftests

    chiminghao <chi.minghao@zte.com.cn>:
      tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner

Subsystem: mm/pagemap

    Qi Zheng <zhengqi.arch@bytedance.com>:
      mm: remove redundant check about FAULT_FLAG_ALLOW_RETRY bit

    Colin Cross <ccross@google.com>:
    Patch series "mm: rearrange madvise code to allow for reuse", v11:
      mm: rearrange madvise code to allow for reuse
      mm: add a field to store names for private anonymous memory

    Suren Baghdasaryan <surenb@google.com>:
      mm: add anonymous vma name refcounting

    Arnd Bergmann <arnd@arndb.de>:
      mm: move anon_vma declarations to linux/mm_inline.h
      mm: move tlb_flush_pending inline helpers to mm_inline.h

    Suren Baghdasaryan <surenb@google.com>:
      mm: protect free_pgtables with mmap_lock write lock in exit_mmap
      mm: document locking restrictions for vm_operations_struct::close
      mm/oom_kill: allow process_mrelease to run under mmap_lock protection

    Shuah Khan <skhan@linuxfoundation.org>:
      docs/vm: add vmalloced-kernel-stacks document

    Pasha Tatashin <pasha.tatashin@soleen.com>:
    Patch series "page table check", v3:
      mm: change page type prior to adding page table entry
      mm: ptep_clear() page table helper
      mm: page table check
      x86: mm: add x86_64 support for page table check

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: remove last argument of reuse_swap_page()
      mm: remove the total_mapcount argument from page_trans_huge_map_swapcount()
      mm: remove the total_mapcount argument from page_trans_huge_mapcount()

Subsystem: mm/dma

    Christian König <christian.koenig@amd.com>:
      mm/dmapool.c: revert "make dma pool to use kmalloc_node"

Subsystem: mm/vmalloc

    Michal Hocko <mhocko@suse.com>:
    Patch series "extend vmalloc support for constrained allocations", v2:
      mm/vmalloc: alloc GFP_NO{FS,IO} for vmalloc
      mm/vmalloc: add support for __GFP_NOFAIL
      mm/vmalloc: be more explicit about supported gfp flags.
      mm: allow !GFP_KERNEL allocations for kvmalloc
      mm: make slab and vmalloc allocators __GFP_NOLOCKDEP aware

    "NeilBrown" <neilb@suse.de>:
      mm: introduce memalloc_retry_wait()

    Suren Baghdasaryan <surenb@google.com>:
      mm/pagealloc: sysctl: change watermark_scale_factor max limit to 30%

    Changcheng Deng <deng.changcheng@zte.com.cn>:
      mm: fix boolreturn.cocci warning

    Xiongwei Song <sxwjean@gmail.com>:
      mm: page_alloc: fix building error on -Werror=array-compare

    Michal Hocko <mhocko@suse.com>:
      mm: drop node from alloc_pages_vma

    Miles Chen <miles.chen@mediatek.com>:
      include/linux/gfp.h: further document GFP_DMA32

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/page_alloc.c: modify the comment section for alloc_contig_pages()

    Baoquan He <bhe@redhat.com>:
    Patch series "Handle warning of allocation failure on DMA zone w/o managed pages", v4:
      mm_zone: add function to check if managed dma zone exists
      dma/pool: create dma atomic pool only if dma zone has managed pages
      mm/page_alloc.c: do not warn allocation failure on zone DMA if no managed pages

Subsystem: mm/memory-failure

Subsystem: mm/hugetlb

    Mina Almasry <almasrymina@google.com>:
      hugetlb: add hugetlb.*.numa_stat file

    Yosry Ahmed <yosryahmed@google.com>:
      mm, hugepages: make memory size variable in hugepage-mremap selftest

    Yang Yang <yang.yang29@zte.com.cn>:
      mm/vmstat: add events for THP max_ptes_* exceeds

    Waiman Long <longman@redhat.com>:
      selftests/vm: make charge_reserved_hugetlb.sh work with existing cgroup setting

Subsystem: mm/userfaultfd

    Peter Xu <peterx@redhat.com>:
      selftests/uffd: allow EINTR/EAGAIN

    Mike Kravetz <mike.kravetz@oracle.com>:
      userfaultfd/selftests: clean up hugetlb allocation code

Subsystem: mm/vmscan

    Gang Li <ligang.bdlg@bytedance.com>:
      vmscan: make drop_slab_node static

    Chen Wandun <chenwandun@huawei.com>:
      mm/page_isolation: unset migratetype directly for non Buddy page

Subsystem: mm/mempolicy

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
    Patch series "mm: add new syscall set_mempolicy_home_node", v6:
      mm/mempolicy: use policy_node helper with MPOL_PREFERRED_MANY
      mm/mempolicy: add set_mempolicy_home_node syscall
      mm/mempolicy: wire up syscall set_mempolicy_home_node

    Randy Dunlap <rdunlap@infradead.org>:
      mm/mempolicy: fix all kernel-doc warnings

Subsystem: mm/oom-kill

    Jann Horn <jannh@google.com>:
      mm, oom: OOM sysrq should always kill a process

Subsystem: mm/hugetlbfs

    Sean Christopherson <seanjc@google.com>:
      hugetlbfs: fix off-by-one error in hugetlb_vmdelete_list()

Subsystem: mm/migration

    Baolin Wang <baolin.wang@linux.alibaba.com>:
    Patch series "Improve the migration stats":
      mm: migrate: fix the return value of migrate_pages()
      mm: migrate: correct the hugetlb migration stats
      mm: compaction: fix the migration stats in trace_mm_compaction_migratepages()
      mm: migrate: support multiple target nodes demotion
      mm: migrate: add more comments for selecting target node randomly

    Huang Ying <ying.huang@intel.com>:
      mm/migrate: move node demotion code to near its user

    Colin Ian King <colin.i.king@gmail.com>:
      mm/migrate: remove redundant variables used in a for-loop

Subsystem: mm/thp

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/thp: drop unused trace events hugepage_[invalidate|splitting]

Subsystem: mm/ksm

    Nanyong Sun <sunnanyong@huawei.com>:
      mm: ksm: fix use-after-free kasan report in ksm_might_need_to_copy

Subsystem: mm/page-poison

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
    Patch series "mm/hwpoison: fix unpoison_memory()", v4:
      mm/hwpoison: mf_mutex for soft offline and unpoison
      mm/hwpoison: remove MF_MSG_BUDDY_2ND and MF_MSG_POISONED_HUGE
      mm/hwpoison: fix unpoison_memory()

Subsystem: mm/percpu

    Qi Zheng <zhengqi.arch@bytedance.com>:
      mm: memcg/percpu: account extra objcg space to memory cgroups

Subsystem: mm/rmap

    Huang Ying <ying.huang@intel.com>:
      mm/rmap: fix potential batched TLB flush race

Subsystem: mm/zswap

    Zhaoyu Liu <zackary.liu.pro@gmail.com>:
      zpool: remove the list of pools_head

Subsystem: mm/zram

    Luis Chamberlain <mcgrof@kernel.org>:
      zram: use ATTRIBUTE_GROUPS

Subsystem: mm/cleanups

    Quanfa Fu <fuqf0919@gmail.com>:
      mm: fix some comment errors

    Ting Liu <liuting.0x7c00@bytedance.com>:
      mm: make some vars and functions static or __init

Subsystem: mm/hmm

    Alistair Popple <apopple@nvidia.com>:
      mm/hmm.c: allow VM_MIXEDMAP to work with hmm_range_fault

Subsystem: mm/damon

    Xin Hao <xhao@linux.alibaba.com>:
    Patch series "mm/damon: Do some small changes", v4:
      mm/damon: unified access_check function naming rules
      mm/damon: add 'age' of region tracepoint support
      mm/damon/core: use abs() instead of diff_of()
      mm/damon: remove some unneeded function definitions in damon.h

    Yihao Han <hanyihao@vivo.com>:
      mm/damon/vaddr: remove swap_ranges() and replace it with swap()

    Xin Hao <xhao@linux.alibaba.com>:
      mm/damon/schemes: add the validity judgment of thresholds
      mm/damon: move damon_rand() definition into damon.h
      mm/damon: modify damon_rand() macro to static inline function

    SeongJae Park <sj@kernel.org>:
    Patch series "mm/damon: Misc cleanups":
      mm/damon: convert macro functions to static inline functions
      Docs/admin-guide/mm/damon/usage: update for scheme quotas and watermarks
      Docs/admin-guide/mm/damon/usage: remove redundant information
      Docs/admin-guide/mm/damon/usage: mention tracepoint at the beginning
      Docs/admin-guide/mm/damon/usage: update for kdamond_pid and (mk|rm)_contexts
      mm/damon: remove a mistakenly added comment for a future feature
    Patch series "mm/damon/schemes: Extend stats for better online analysis and tuning":
      mm/damon/schemes: account scheme actions that successfully applied
      mm/damon/schemes: account how many times quota limit has exceeded
      mm/damon/reclaim: provide reclamation statistics
      Docs/admin-guide/mm/damon/reclaim: document statistics parameters
      mm/damon/dbgfs: support all DAMOS stats
      Docs/admin-guide/mm/damon/usage: update for schemes statistics

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/damon: add access checking for hugetlb pages

    Guoqing Jiang <guoqing.jiang@linux.dev>:
      mm/damon: move the implementation of damon_insert_region to damon.h

    SeongJae Park <sj@kernel.org>:
    Patch series "mm/damon: Hide unnecessary information disclosures":
      mm/damon/dbgfs: remove an unnecessary variable
      mm/damon/vaddr: use pr_debug() for damon_va_three_regions() failure logging
      mm/damon/vaddr: hide kernel pointer from damon_va_three_regions() failure log
      mm/damon: hide kernel pointer from tracepoint event

 Documentation/admin-guide/cgroup-v1/hugetlb.rst        |    4 
 Documentation/admin-guide/cgroup-v2.rst                |   11 
 Documentation/admin-guide/mm/damon/reclaim.rst         |   25 
 Documentation/admin-guide/mm/damon/usage.rst           |  235 +++++--
 Documentation/admin-guide/mm/numa_memory_policy.rst    |   16 
 Documentation/admin-guide/sysctl/vm.rst                |    2 
 Documentation/filesystems/proc.rst                     |    6 
 Documentation/vm/arch_pgtable_helpers.rst              |   20 
 Documentation/vm/index.rst                             |    2 
 Documentation/vm/page_migration.rst                    |   12 
 Documentation/vm/page_table_check.rst                  |   56 +
 Documentation/vm/vmalloced-kernel-stacks.rst           |  153 ++++
 MAINTAINERS                                            |    9 
 arch/Kconfig                                           |    3 
 arch/alpha/kernel/syscalls/syscall.tbl                 |    1 
 arch/alpha/mm/fault.c                                  |   16 
 arch/arc/mm/fault.c                                    |    3 
 arch/arm/mm/fault.c                                    |    2 
 arch/arm/tools/syscall.tbl                             |    1 
 arch/arm64/include/asm/unistd.h                        |    2 
 arch/arm64/include/asm/unistd32.h                      |    2 
 arch/arm64/kernel/module.c                             |    4 
 arch/arm64/mm/fault.c                                  |    6 
 arch/hexagon/mm/vm_fault.c                             |    8 
 arch/ia64/kernel/module.c                              |    6 
 arch/ia64/kernel/setup.c                               |    5 
 arch/ia64/kernel/syscalls/syscall.tbl                  |    1 
 arch/ia64/kernel/topology.c                            |    3 
 arch/ia64/kernel/uncached.c                            |    2 
 arch/ia64/mm/fault.c                                   |   16 
 arch/m68k/kernel/syscalls/syscall.tbl                  |    1 
 arch/m68k/mm/fault.c                                   |   18 
 arch/microblaze/kernel/syscalls/syscall.tbl            |    1 
 arch/microblaze/mm/fault.c                             |   18 
 arch/mips/kernel/syscalls/syscall_n32.tbl              |    1 
 arch/mips/kernel/syscalls/syscall_n64.tbl              |    1 
 arch/mips/kernel/syscalls/syscall_o32.tbl              |    1 
 arch/mips/mm/fault.c                                   |   19 
 arch/nds32/mm/fault.c                                  |   16 
 arch/nios2/mm/fault.c                                  |   18 
 arch/openrisc/mm/fault.c                               |   18 
 arch/parisc/kernel/syscalls/syscall.tbl                |    1 
 arch/parisc/mm/fault.c                                 |   18 
 arch/powerpc/kernel/syscalls/syscall.tbl               |    1 
 arch/powerpc/mm/fault.c                                |    6 
 arch/riscv/mm/fault.c                                  |    2 
 arch/s390/kernel/module.c                              |    5 
 arch/s390/kernel/syscalls/syscall.tbl                  |    1 
 arch/s390/mm/fault.c                                   |   28 
 arch/sh/kernel/syscalls/syscall.tbl                    |    1 
 arch/sh/mm/fault.c                                     |   18 
 arch/sparc/kernel/syscalls/syscall.tbl                 |    1 
 arch/sparc/mm/fault_32.c                               |   16 
 arch/sparc/mm/fault_64.c                               |   16 
 arch/um/kernel/trap.c                                  |    8 
 arch/x86/Kconfig                                       |    1 
 arch/x86/entry/syscalls/syscall_32.tbl                 |    1 
 arch/x86/entry/syscalls/syscall_64.tbl                 |    1 
 arch/x86/include/asm/pgtable.h                         |   31 -
 arch/x86/kernel/module.c                               |    7 
 arch/x86/mm/fault.c                                    |    3 
 arch/xtensa/kernel/syscalls/syscall.tbl                |    1 
 arch/xtensa/mm/fault.c                                 |   17 
 drivers/block/zram/zram_drv.c                          |   11 
 drivers/dax/bus.c                                      |   32 +
 drivers/dax/bus.h                                      |    1 
 drivers/dax/device.c                                   |  140 ++--
 drivers/infiniband/sw/siw/siw_main.c                   |    7 
 drivers/of/fdt.c                                       |    6 
 fs/ext4/extents.c                                      |    8 
 fs/ext4/inline.c                                       |    5 
 fs/ext4/page-io.c                                      |    9 
 fs/f2fs/data.c                                         |    4 
 fs/f2fs/gc.c                                           |    5 
 fs/f2fs/inode.c                                        |    4 
 fs/f2fs/node.c                                         |    4 
 fs/f2fs/recovery.c                                     |    6 
 fs/f2fs/segment.c                                      |    9 
 fs/f2fs/super.c                                        |    5 
 fs/hugetlbfs/inode.c                                   |    7 
 fs/inode.c                                             |   49 +
 fs/ioctl.c                                             |    2 
 fs/ntfs/attrib.c                                       |    2 
 fs/ocfs2/alloc.c                                       |    2 
 fs/ocfs2/aops.c                                        |   26 
 fs/ocfs2/cluster/masklog.c                             |   11 
 fs/ocfs2/dir.c                                         |    2 
 fs/ocfs2/filecheck.c                                   |    3 
 fs/ocfs2/journal.c                                     |    6 
 fs/proc/task_mmu.c                                     |   13 
 fs/squashfs/super.c                                    |   33 +
 fs/userfaultfd.c                                       |    8 
 fs/xfs/kmem.c                                          |    3 
 fs/xfs/xfs_buf.c                                       |    2 
 include/linux/ceph/libceph.h                           |    1 
 include/linux/damon.h                                  |   93 +--
 include/linux/fs.h                                     |    1 
 include/linux/gfp.h                                    |   12 
 include/linux/hugetlb.h                                |    4 
 include/linux/hugetlb_cgroup.h                         |    7 
 include/linux/kasan.h                                  |    4 
 include/linux/kthread.h                                |   25 
 include/linux/memcontrol.h                             |   22 
 include/linux/mempolicy.h                              |    1 
 include/linux/memremap.h                               |   11 
 include/linux/mm.h                                     |   76 --
 include/linux/mm_inline.h                              |  136 ++++
 include/linux/mm_types.h                               |  252 +++-----
 include/linux/mmzone.h                                 |    9 
 include/linux/page-flags.h                             |    6 
 include/linux/page_idle.h                              |    1 
 include/linux/page_table_check.h                       |  147 ++++
 include/linux/pgtable.h                                |    8 
 include/linux/sched/mm.h                               |   26 
 include/linux/swap.h                                   |    8 
 include/linux/syscalls.h                               |    3 
 include/linux/vm_event_item.h                          |    3 
 include/linux/vmalloc.h                                |    7 
 include/ras/ras_event.h                                |    2 
 include/trace/events/compaction.h                      |   24 
 include/trace/events/damon.h                           |   15 
 include/trace/events/thp.h                             |   35 -
 include/uapi/asm-generic/unistd.h                      |    5 
 include/uapi/linux/prctl.h                             |    3 
 kernel/dma/pool.c                                      |    4 
 kernel/fork.c                                          |    3 
 kernel/kthread.c                                       |    1 
 kernel/rcu/rcutorture.c                                |    7 
 kernel/sys.c                                           |   63 ++
 kernel/sys_ni.c                                        |    1 
 kernel/sysctl.c                                        |    3 
 kernel/trace/ring_buffer.c                             |    7 
 kernel/trace/trace_hwlat.c                             |    6 
 kernel/trace/trace_osnoise.c                           |    3 
 lib/test_hmm.c                                         |   24 
 lib/test_kasan.c                                       |   30 
 mm/Kconfig                                             |   14 
 mm/Kconfig.debug                                       |   24 
 mm/Makefile                                            |    1 
 mm/compaction.c                                        |    7 
 mm/damon/core.c                                        |   45 -
 mm/damon/dbgfs.c                                       |   20 
 mm/damon/paddr.c                                       |   24 
 mm/damon/prmtv-common.h                                |    4 
 mm/damon/reclaim.c                                     |   46 +
 mm/damon/vaddr.c                                       |  186 ++++--
 mm/debug.c                                             |   52 -
 mm/debug_vm_pgtable.c                                  |    6 
 mm/dmapool.c                                           |    2 
 mm/frontswap.c                                         |    4 
 mm/gup.c                                               |   31 -
 mm/hmm.c                                               |    5 
 mm/huge_memory.c                                       |   32 -
 mm/hugetlb.c                                           |    6 
 mm/hugetlb_cgroup.c                                    |  133 +++-
 mm/internal.h                                          |    7 
 mm/kasan/quarantine.c                                  |   11 
 mm/kasan/shadow.c                                      |    9 
 mm/khugepaged.c                                        |   23 
 mm/kmemleak.c                                          |   21 
 mm/ksm.c                                               |    5 
 mm/madvise.c                                           |  510 ++++++++++------
 mm/mapping_dirty_helpers.c                             |    1 
 mm/memcontrol.c                                        |   44 -
 mm/memory-failure.c                                    |  189 +++---
 mm/memory.c                                            |   12 
 mm/mempolicy.c                                         |   95 ++-
 mm/memremap.c                                          |   18 
 mm/migrate.c                                           |  527 ++++++++++-------
 mm/mlock.c                                             |    2 
 mm/mmap.c                                              |   55 +
 mm/mmu_gather.c                                        |    1 
 mm/mprotect.c                                          |    2 
 mm/oom_kill.c                                          |   30 
 mm/page_alloc.c                                        |  198 ++++--
 mm/page_counter.c                                      |    1 
 mm/page_ext.c                                          |    8 
 mm/page_isolation.c                                    |    2 
 mm/page_owner.c                                        |    4 
 mm/page_table_check.c                                  |  270 ++++++++
 mm/percpu-internal.h                                   |   18 
 mm/percpu.c                                            |   10 
 mm/pgtable-generic.c                                   |    1 
 mm/rmap.c                                              |   43 +
 mm/shmem.c                                             |   91 ++
 mm/slab.h                                              |    5 
 mm/slab_common.c                                       |   34 -
 mm/swap.c                                              |    2 
 mm/swapfile.c                                          |   46 -
 mm/truncate.c                                          |    5 
 mm/userfaultfd.c                                       |    5 
 mm/util.c                                              |   15 
 mm/vmalloc.c                                           |   75 +-
 mm/vmscan.c                                            |    2 
 mm/vmstat.c                                            |    3 
 mm/zpool.c                                             |   12 
 net/ceph/buffer.c                                      |    4 
 net/ceph/ceph_common.c                                 |   27 
 net/ceph/crypto.c                                      |    2 
 net/ceph/messenger.c                                   |    2 
 net/ceph/messenger_v2.c                                |    2 
 net/ceph/osdmap.c                                      |   12 
 net/sunrpc/svc_xprt.c                                  |    3 
 scripts/spelling.txt                                   |    1 
 tools/testing/selftests/vm/charge_reserved_hugetlb.sh  |   34 -
 tools/testing/selftests/vm/hmm-tests.c                 |   42 +
 tools/testing/selftests/vm/hugepage-mremap.c           |   46 -
 tools/testing/selftests/vm/hugetlb_reparenting_test.sh |   21 
 tools/testing/selftests/vm/run_vmtests.sh              |    2 
 tools/testing/selftests/vm/userfaultfd.c               |   33 -
 tools/testing/selftests/vm/write_hugetlb_memory.sh     |    2 
 211 files changed, 3980 insertions(+), 1759 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-01-20  2:07 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-01-20  2:07 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

55 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16")

Subsystems affected by this patch series:

  percpu
  procfs
  sysctl
  misc
  core-kernel
  get_maintainer
  lib
  checkpatch
  binfmt
  nilfs2
  hfs
  fat
  adfs
  panic
  delayacct
  kconfig
  kcov
  ubsan

Subsystem: percpu

    Kefeng Wang <wangkefeng.wang@huawei.com>:
    Patch series "mm: percpu: Cleanup percpu first chunk function":
      mm: percpu: generalize percpu related config
      mm: percpu: add pcpu_fc_cpu_to_node_fn_t typedef
      mm: percpu: add generic pcpu_fc_alloc/free funciton
      mm: percpu: add generic pcpu_populate_pte() function

Subsystem: procfs

    David Hildenbrand <david@redhat.com>:
      proc/vmcore: don't fake reading zeroes on surprise vmcore_cb unregistration

    Hans de Goede <hdegoede@redhat.com>:
      proc: make the proc_create[_data]() stubs static inlines

    Qi Zheng <zhengqi.arch@bytedance.com>:
      proc: convert the return type of proc_fd_access_allowed() to be boolean

Subsystem: sysctl

    Geert Uytterhoeven <geert+renesas@glider.be>:
      sysctl: fix duplicate path separator in printed entries

    luo penghao <luo.penghao@zte.com.cn>:
      sysctl: remove redundant ret assignment

Subsystem: misc

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      include/linux/unaligned: replace kernel.h with the necessary inclusions
      kernel.h: include a note to discourage people from including it in headers

Subsystem: core-kernel

    Yafang Shao <laoar.shao@gmail.com>:
    Patch series "task comm cleanups", v2:
      fs/exec: replace strlcpy with strscpy_pad in __set_task_comm
      fs/exec: replace strncpy with strscpy_pad in __get_task_comm
      drivers/infiniband: replace open-coded string copy with get_task_comm
      fs/binfmt_elf: replace open-coded string copy with get_task_comm
      samples/bpf/test_overhead_kprobe_kern: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm
      tools/bpf/bpftool/skeleton: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm
      tools/testing/selftests/bpf: replace open-coded 16 with TASK_COMM_LEN
      kthread: dynamically allocate memory to store kthread's full name

    Davidlohr Bueso <dave@stgolabs.net>:
      kernel/sys.c: only take tasklist_lock for get/setpriority(PRIO_PGRP)

Subsystem: get_maintainer

    Randy Dunlap <rdunlap@infradead.org>:
      get_maintainer: don't remind about no git repo when --nogit is used

Subsystem: lib

    Alexey Dobriyan <adobriyan@gmail.com>:
      kstrtox: uninline everything

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      list: introduce list_is_head() helper and re-use it in list.h

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib/list_debug.c: print more list debugging context in __list_del_entry_valid()

    Isabella Basso <isabbasso@riseup.net>:
    Patch series "test_hash.c: refactor into KUnit", v3:
      hash.h: remove unused define directive
      test_hash.c: split test_int_hash into arch-specific functions
      test_hash.c: split test_hash_init
      lib/Kconfig.debug: properly split hash test kernel entries
      test_hash.c: refactor into kunit

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kunit: replace kernel.h with the necessary inclusions
      uuid: discourage people from using UAPI header in new code
      uuid: remove licence boilerplate text from the header

    Andrey Konovalov <andreyknvl@google.com>:
      lib/test_meminit: destroy cache in kmem_cache_alloc_bulk() test

Subsystem: checkpatch

    Jerome Forissier <jerome@forissier.org>:
      checkpatch: relax regexp for COMMIT_LOG_LONG_LINE

    Joe Perches <joe@perches.com>:
      checkpatch: improve Kconfig help test

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      const_structs.checkpatch: add frequently used ops structs

Subsystem: binfmt

    "H.J. Lu" <hjl.tools@gmail.com>:
      fs/binfmt_elf: use PT_LOAD p_align values for static PIE

Subsystem: nilfs2

    Colin Ian King <colin.i.king@gmail.com>:
      nilfs2: remove redundant pointer sbufs

Subsystem: hfs

    Kees Cook <keescook@chromium.org>:
      hfsplus: use struct_group_attr() for memcpy() region

Subsystem: fat

    "NeilBrown" <neilb@suse.de>:
       FAT: use io_schedule_timeout() instead of congestion_wait()

Subsystem: adfs

    Minghao Chi <chi.minghao@zte.com.cn>:
      fs/adfs: remove unneeded variable make code cleaner

Subsystem: panic

    Marco Elver <elver@google.com>:
      panic: use error_report_end tracepoint on warnings

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      panic: remove oops_id

Subsystem: delayacct

    Yang Yang <yang.yang29@zte.com.cn>:
      delayacct: support swapin delay accounting for swapping without blkio
      delayacct: fix incomplete disable operation when switch enable to disable
      delayacct: cleanup flags in struct task_delay_info and functions use it

    wangyong <wang.yong12@zte.com.cn>:
      Documentation/accounting/delay-accounting.rst: add thrashing page cache and direct compact
      delayacct: track delays from memory compact

Subsystem: kconfig

    Qian Cai <quic_qiancai@quicinc.com>:
      configs: introduce debug.config for CI-like setup

    Nathan Chancellor <nathan@kernel.org>:
    Patch series "Fix CONFIG_TEST_KMOD with 256kB page size":
      arch/Kconfig: split PAGE_SIZE_LESS_THAN_256KB from PAGE_SIZE_LESS_THAN_64KB
      btrfs: use generic Kconfig option for 256kB page size limit
      lib/Kconfig.debug: make TEST_KMOD depend on PAGE_SIZE_LESS_THAN_256KB

Subsystem: kcov

    Marco Elver <elver@google.com>:
      kcov: fix generic Kconfig dependencies if ARCH_WANTS_NO_INSTR

Subsystem: ubsan

    Kees Cook <keescook@chromium.org>:
      ubsan: remove CONFIG_UBSAN_OBJECT_SIZE

    Colin Ian King <colin.i.king@gmail.com>:
      lib: remove redundant assignment to variable ret

 Documentation/accounting/delay-accounting.rst           |   63 +-
 arch/Kconfig                                            |    4 
 arch/arm64/Kconfig                                      |   20 
 arch/ia64/Kconfig                                       |    9 
 arch/mips/Kconfig                                       |   10 
 arch/mips/mm/init.c                                     |   28 -
 arch/powerpc/Kconfig                                    |   17 
 arch/powerpc/kernel/setup_64.c                          |  113 ----
 arch/riscv/Kconfig                                      |   10 
 arch/sparc/Kconfig                                      |   12 
 arch/sparc/kernel/led.c                                 |    8 
 arch/sparc/kernel/smp_64.c                              |  119 -----
 arch/x86/Kconfig                                        |   19 
 arch/x86/kernel/setup_percpu.c                          |   82 ---
 drivers/base/arch_numa.c                                |   78 ---
 drivers/infiniband/hw/qib/qib.h                         |    2 
 drivers/infiniband/hw/qib/qib_file_ops.c                |    2 
 drivers/infiniband/sw/rxe/rxe_qp.c                      |    3 
 drivers/net/wireless/broadcom/brcm80211/brcmfmac/xtlv.c |    2 
 fs/adfs/inode.c                                         |    4 
 fs/binfmt_elf.c                                         |    6 
 fs/btrfs/Kconfig                                        |    3 
 fs/exec.c                                               |    5 
 fs/fat/file.c                                           |    5 
 fs/hfsplus/hfsplus_raw.h                                |   12 
 fs/hfsplus/xattr.c                                      |    4 
 fs/nilfs2/page.c                                        |    4 
 fs/proc/array.c                                         |    3 
 fs/proc/base.c                                          |    4 
 fs/proc/proc_sysctl.c                                   |    9 
 fs/proc/vmcore.c                                        |   10 
 include/kunit/assert.h                                  |    2 
 include/linux/delayacct.h                               |  107 ++--
 include/linux/elfcore-compat.h                          |    5 
 include/linux/elfcore.h                                 |    5 
 include/linux/hash.h                                    |    5 
 include/linux/kernel.h                                  |    9 
 include/linux/kthread.h                                 |    1 
 include/linux/list.h                                    |   36 -
 include/linux/percpu.h                                  |   21 
 include/linux/proc_fs.h                                 |   12 
 include/linux/sched.h                                   |    9 
 include/linux/unaligned/packed_struct.h                 |    2 
 include/trace/events/error_report.h                     |    8 
 include/uapi/linux/taskstats.h                          |    6 
 include/uapi/linux/uuid.h                               |   10 
 kernel/configs/debug.config                             |  105 ++++
 kernel/delayacct.c                                      |   49 +-
 kernel/kthread.c                                        |   32 +
 kernel/panic.c                                          |   21 
 kernel/sys.c                                            |   16 
 lib/Kconfig.debug                                       |   45 +
 lib/Kconfig.ubsan                                       |   13 
 lib/Makefile                                            |    5 
 lib/asn1_encoder.c                                      |    2 
 lib/kstrtox.c                                           |   12 
 lib/list_debug.c                                        |    8 
 lib/lz4/lz4defs.h                                       |    2 
 lib/test_hash.c                                         |  375 +++++++---------
 lib/test_meminit.c                                      |    1 
 lib/test_ubsan.c                                        |   22 
 mm/Kconfig                                              |   12 
 mm/memory.c                                             |    4 
 mm/page_alloc.c                                         |    3 
 mm/page_io.c                                            |    3 
 mm/percpu.c                                             |  168 +++++--
 samples/bpf/offwaketime_kern.c                          |    4 
 samples/bpf/test_overhead_kprobe_kern.c                 |   11 
 samples/bpf/test_overhead_tp_kern.c                     |    5 
 scripts/Makefile.ubsan                                  |    1 
 scripts/checkpatch.pl                                   |   54 +-
 scripts/const_structs.checkpatch                        |   23 
 scripts/get_maintainer.pl                               |    2 
 tools/accounting/getdelays.c                            |    8 
 tools/bpf/bpftool/skeleton/pid_iter.bpf.c               |    4 
 tools/include/linux/hash.h                              |    5 
 tools/testing/selftests/bpf/progs/test_stacktrace_map.c |    6 
 tools/testing/selftests/bpf/progs/test_tracepoint.c     |    6 
 78 files changed, 943 insertions(+), 992 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-01-22  6:10 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-01-22  6:10 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


This is the post-linux-next queue.  Material which was based on or
dependent upon material which was in -next.

69 patches, based on 9b57f458985742bd1c585f4c7f36d04634ce1143.

Subsystems affected by this patch series:

  mm/migration
  sysctl
  mm/zsmalloc
  proc
  lib

Subsystem: mm/migration

    Alistair Popple <apopple@nvidia.com>:
      mm/migrate.c: rework migration_entry_wait() to not take a pageref

Subsystem: sysctl

    Xiaoming Ni <nixiaoming@huawei.com>:
    Patch series "sysctl: first set of kernel/sysctl cleanups", v2:
      sysctl: add a new register_sysctl_init() interface
      sysctl: move some boundary constants from sysctl.c to sysctl_vals
      hung_task: move hung_task sysctl interface to hung_task.c
      watchdog: move watchdog sysctl interface to watchdog.c

    Stephen Kitt <steve@sk2.org>:
      sysctl: make ngroups_max const

    Xiaoming Ni <nixiaoming@huawei.com>:
      sysctl: use const for typically used max/min proc sysctls
      sysctl: use SYSCTL_ZERO to replace some static int zero uses
      aio: move aio sysctl to aio.c
      dnotify: move dnotify sysctl to dnotify.c

    Luis Chamberlain <mcgrof@kernel.org>:
    Patch series "sysctl: second set of kernel/sysctl cleanups", v2:
      hpet: simplify subdirectory registration with register_sysctl()
      i915: simplify subdirectory registration with register_sysctl()
      macintosh/mac_hid.c: simplify subdirectory registration with register_sysctl()
      ocfs2: simplify subdirectory registration with register_sysctl()
      test_sysctl: simplify subdirectory registration with register_sysctl()

    Xiaoming Ni <nixiaoming@huawei.com>:
      inotify: simplify subdirectory registration with register_sysctl()

    Luis Chamberlain <mcgrof@kernel.org>:
      cdrom: simplify subdirectory registration with register_sysctl()

    Xiaoming Ni <nixiaoming@huawei.com>:
      eventpoll: simplify sysctl declaration with register_sysctl()
    Patch series "sysctl: 3rd set of kernel/sysctl cleanups", v2:
      firmware_loader: move firmware sysctl to its own files
      random: move the random sysctl declarations to its own file

    Luis Chamberlain <mcgrof@kernel.org>:
      sysctl: add helper to register a sysctl mount point
      fs: move binfmt_misc sysctl to its own file

    Xiaoming Ni <nixiaoming@huawei.com>:
      printk: move printk sysctl to printk/sysctl.c
      scsi/sg: move sg-big-buff sysctl to scsi/sg.c
      stackleak: move stack_erasing sysctl to stackleak.c

    Luis Chamberlain <mcgrof@kernel.org>:
      sysctl: share unsigned long const values
    Patch series "sysctl: 4th set of kernel/sysctl cleanups":
      fs: move inode sysctls to its own file
      fs: move fs stat sysctls to file_table.c
      fs: move dcache sysctls to its own file
      sysctl: move maxolduid as a sysctl specific const
      fs: move shared sysctls to fs/sysctls.c
      fs: move locking sysctls where they are used
      fs: move namei sysctls to its own file
      fs: move fs/exec.c sysctls into its own file
      fs: move pipe sysctls to is own file
    Patch series "sysctl: add and use base directory declarer and registration helper":
      sysctl: add and use base directory declarer and registration helper
      fs: move namespace sysctls and declare fs base directory
      kernel/sysctl.c: rename sysctl_init() to sysctl_init_bases()

    Xiaoming Ni <nixiaoming@huawei.com>:
      printk: fix build warning when CONFIG_PRINTK=n
      fs/coredump: move coredump sysctls into its own file
      kprobe: move sysctl_kprobes_optimization to kprobes.c

    Colin Ian King <colin.i.king@gmail.com>:
      kernel/sysctl.c: remove unused variable ten_thousand

    Baokun Li <libaokun1@huawei.com>:
      sysctl: returns -EINVAL when a negative value is passed to proc_doulongvec_minmax

Subsystem: mm/zsmalloc

    Minchan Kim <minchan@kernel.org>:
    Patch series "zsmalloc: remove bit_spin_lock", v2:
      zsmalloc: introduce some helper functions
      zsmalloc: rename zs_stat_type to class_stat_type
      zsmalloc: decouple class actions from zspage works
      zsmalloc: introduce obj_allocated
      zsmalloc: move huge compressed obj from page to zspage
      zsmalloc: remove zspage isolation for migration
      locking/rwlocks: introduce write_lock_nested
      zsmalloc: replace per zpage lock with pool->migrate_lock

    Mike Galbraith <umgwanakikbuti@gmail.com>:
      zsmalloc: replace get_cpu_var with local_lock

Subsystem: proc

    Muchun Song <songmuchun@bytedance.com>:
      fs: proc: store PDE()->data into inode->i_private
      proc: remove PDE_DATA() completely

Subsystem: lib

    Vlastimil Babka <vbabka@suse.cz>:
      lib/stackdepot: allow optional init and stack_table allocation by kvmalloc()
lib/stackdepot: fix spelling mistake and grammar in pr_err message
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup3
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup4

    Marco Elver <elver@google.com>:
      lib/stackdepot: always do filter_irq_stacks() in stack_depot_save()

    Christoph Hellwig <hch@lst.de>:
    Patch series "remove Xen tmem leftovers":
      mm: remove cleancache
      frontswap: remove frontswap_writethrough
      frontswap: remove frontswap_tmem_exclusive_gets
      frontswap: remove frontswap_shrink
      frontswap: remove frontswap_curr_pages
      frontswap: simplify frontswap_init
      frontswap: remove the frontswap exports
      mm: simplify try_to_unuse
      frontswap: remove frontswap_test
      frontswap: simplify frontswap_register_ops
      mm: mark swap_lock and swap_active_head static
      frontswap: remove support for multiple ops
      mm: hide the FRONTSWAP Kconfig symbol

 Documentation/vm/cleancache.rst                        |  296 ------
 Documentation/vm/frontswap.rst                         |   31 
 Documentation/vm/index.rst                             |    1 
 MAINTAINERS                                            |    7 
 arch/alpha/kernel/srm_env.c                            |    4 
 arch/arm/configs/bcm2835_defconfig                     |    1 
 arch/arm/configs/qcom_defconfig                        |    1 
 arch/arm/kernel/atags_proc.c                           |    2 
 arch/arm/mm/alignment.c                                |    2 
 arch/ia64/kernel/salinfo.c                             |   10 
 arch/m68k/configs/amiga_defconfig                      |    1 
 arch/m68k/configs/apollo_defconfig                     |    1 
 arch/m68k/configs/atari_defconfig                      |    1 
 arch/m68k/configs/bvme6000_defconfig                   |    1 
 arch/m68k/configs/hp300_defconfig                      |    1 
 arch/m68k/configs/mac_defconfig                        |    1 
 arch/m68k/configs/multi_defconfig                      |    1 
 arch/m68k/configs/mvme147_defconfig                    |    1 
 arch/m68k/configs/mvme16x_defconfig                    |    1 
 arch/m68k/configs/q40_defconfig                        |    1 
 arch/m68k/configs/sun3_defconfig                       |    1 
 arch/m68k/configs/sun3x_defconfig                      |    1 
 arch/powerpc/kernel/proc_powerpc.c                     |    4 
 arch/s390/configs/debug_defconfig                      |    1 
 arch/s390/configs/defconfig                            |    1 
 arch/sh/mm/alignment.c                                 |    4 
 arch/xtensa/platforms/iss/simdisk.c                    |    4 
 block/bdev.c                                           |    5 
 drivers/acpi/proc.c                                    |    2 
 drivers/base/firmware_loader/fallback.c                |    7 
 drivers/base/firmware_loader/fallback.h                |   11 
 drivers/base/firmware_loader/fallback_table.c          |   25 
 drivers/cdrom/cdrom.c                                  |   23 
 drivers/char/hpet.c                                    |   22 
 drivers/char/random.c                                  |   14 
 drivers/gpu/drm/drm_dp_mst_topology.c                  |    1 
 drivers/gpu/drm/drm_mm.c                               |    4 
 drivers/gpu/drm/drm_modeset_lock.c                     |    9 
 drivers/gpu/drm/i915/i915_perf.c                       |   22 
 drivers/gpu/drm/i915/intel_runtime_pm.c                |    3 
 drivers/hwmon/dell-smm-hwmon.c                         |    4 
 drivers/macintosh/mac_hid.c                            |   24 
 drivers/net/bonding/bond_procfs.c                      |    8 
 drivers/net/wireless/cisco/airo.c                      |   22 
 drivers/net/wireless/intersil/hostap/hostap_ap.c       |   16 
 drivers/net/wireless/intersil/hostap/hostap_download.c |    2 
 drivers/net/wireless/intersil/hostap/hostap_proc.c     |   24 
 drivers/net/wireless/ray_cs.c                          |    2 
 drivers/nubus/proc.c                                   |   36 
 drivers/parisc/led.c                                   |    4 
 drivers/pci/proc.c                                     |   10 
 drivers/platform/x86/thinkpad_acpi.c                   |    4 
 drivers/platform/x86/toshiba_acpi.c                    |   16 
 drivers/pnp/isapnp/proc.c                              |    2 
 drivers/pnp/pnpbios/proc.c                             |    4 
 drivers/scsi/scsi_proc.c                               |    4 
 drivers/scsi/sg.c                                      |   35 
 drivers/usb/gadget/function/rndis.c                    |    4 
 drivers/zorro/proc.c                                   |    2 
 fs/Makefile                                            |    4 
 fs/afs/proc.c                                          |    6 
 fs/aio.c                                               |   31 
 fs/binfmt_misc.c                                       |    6 
 fs/btrfs/extent_io.c                                   |   10 
 fs/btrfs/super.c                                       |    2 
 fs/coredump.c                                          |   66 +
 fs/dcache.c                                            |   37 
 fs/eventpoll.c                                         |   10 
 fs/exec.c                                              |  145 +--
 fs/ext4/mballoc.c                                      |   14 
 fs/ext4/readpage.c                                     |    6 
 fs/ext4/super.c                                        |    3 
 fs/f2fs/data.c                                         |   13 
 fs/file_table.c                                        |   47 -
 fs/inode.c                                             |   39 
 fs/jbd2/journal.c                                      |    2 
 fs/locks.c                                             |   34 
 fs/mpage.c                                             |    7 
 fs/namei.c                                             |   58 +
 fs/namespace.c                                         |   24 
 fs/notify/dnotify/dnotify.c                            |   21 
 fs/notify/fanotify/fanotify_user.c                     |   10 
 fs/notify/inotify/inotify_user.c                       |   11 
 fs/ntfs3/ntfs_fs.h                                     |    1 
 fs/ocfs2/stackglue.c                                   |   25 
 fs/ocfs2/super.c                                       |    2 
 fs/pipe.c                                              |   64 +
 fs/proc/generic.c                                      |    6 
 fs/proc/inode.c                                        |    1 
 fs/proc/internal.h                                     |    5 
 fs/proc/proc_net.c                                     |    8 
 fs/proc/proc_sysctl.c                                  |   67 +
 fs/super.c                                             |    3 
 fs/sysctls.c                                           |   47 -
 include/linux/aio.h                                    |    4 
 include/linux/cleancache.h                             |  124 --
 include/linux/coredump.h                               |   10 
 include/linux/dcache.h                                 |   10 
 include/linux/dnotify.h                                |    1 
 include/linux/fanotify.h                               |    2 
 include/linux/frontswap.h                              |   35 
 include/linux/fs.h                                     |   18 
 include/linux/inotify.h                                |    3 
 include/linux/kprobes.h                                |    6 
 include/linux/migrate.h                                |    2 
 include/linux/mount.h                                  |    3 
 include/linux/pipe_fs_i.h                              |    4 
 include/linux/poll.h                                   |    2 
 include/linux/printk.h                                 |    4 
 include/linux/proc_fs.h                                |   17 
 include/linux/ref_tracker.h                            |    2 
 include/linux/rwlock.h                                 |    6 
 include/linux/rwlock_api_smp.h                         |    8 
 include/linux/rwlock_rt.h                              |   10 
 include/linux/sched/sysctl.h                           |   14 
 include/linux/seq_file.h                               |    2 
 include/linux/shmem_fs.h                               |    3 
 include/linux/spinlock_api_up.h                        |    1 
 include/linux/stackdepot.h                             |   25 
 include/linux/stackleak.h                              |    5 
 include/linux/swapfile.h                               |    3 
 include/linux/sysctl.h                                 |   67 +
 include/scsi/sg.h                                      |    4 
 init/main.c                                            |    9 
 ipc/util.c                                             |    2 
 kernel/hung_task.c                                     |   81 +
 kernel/irq/proc.c                                      |    8 
 kernel/kprobes.c                                       |   30 
 kernel/locking/spinlock.c                              |   10 
 kernel/locking/spinlock_rt.c                           |   12 
 kernel/printk/Makefile                                 |    5 
 kernel/printk/internal.h                               |    8 
 kernel/printk/printk.c                                 |    4 
 kernel/printk/sysctl.c                                 |   85 +
 kernel/resource.c                                      |    4 
 kernel/stackleak.c                                     |   26 
 kernel/sysctl.c                                        |  790 +----------------
 kernel/watchdog.c                                      |  101 ++
 lib/Kconfig                                            |    4 
 lib/Kconfig.kasan                                      |    2 
 lib/stackdepot.c                                       |   46 
 lib/test_sysctl.c                                      |   22 
 mm/Kconfig                                             |   40 
 mm/Makefile                                            |    1 
 mm/cleancache.c                                        |  315 ------
 mm/filemap.c                                           |  102 +-
 mm/frontswap.c                                         |  259 -----
 mm/kasan/common.c                                      |    1 
 mm/migrate.c                                           |   38 
 mm/page_owner.c                                        |    2 
 mm/shmem.c                                             |   33 
 mm/swapfile.c                                          |   90 -
 mm/truncate.c                                          |   15 
 mm/zsmalloc.c                                          |  557 ++++-------
 mm/zswap.c                                             |    8 
 net/atm/proc.c                                         |    4 
 net/bluetooth/af_bluetooth.c                           |    8 
 net/can/bcm.c                                          |    2 
 net/can/proc.c                                         |    2 
 net/core/neighbour.c                                   |    6 
 net/core/pktgen.c                                      |    6 
 net/ipv4/netfilter/ipt_CLUSTERIP.c                     |    6 
 net/ipv4/raw.c                                         |    8 
 net/ipv4/tcp_ipv4.c                                    |    2 
 net/ipv4/udp.c                                         |    6 
 net/netfilter/x_tables.c                               |   10 
 net/netfilter/xt_hashlimit.c                           |   18 
 net/netfilter/xt_recent.c                              |    4 
 net/sunrpc/auth_gss/svcauth_gss.c                      |    4 
 net/sunrpc/cache.c                                     |   24 
 net/sunrpc/stats.c                                     |    2 
 sound/core/info.c                                      |    4 
 172 files changed, 1877 insertions(+), 2931 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-01-29  2:13 Andrew Morton
  2022-01-29  4:25 ` incoming Matthew Wilcox
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2022-01-29  2:13 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f.

Subsystems affected by this patch series:

  sysctl
  binfmt
  ia64
  mm/memory-failure
  mm/folios
  selftests
  mm/kasan
  mm/psi
  ocfs2

Subsystem: sysctl

    Andrew Morton <akpm@linux-foundation.org>:
      include/linux/sysctl.h: fix register_sysctl_mount_point() return type

Subsystem: binfmt

    Tong Zhang <ztong0001@gmail.com>:
      binfmt_misc: fix crash when load/unload module

Subsystem: ia64

    Randy Dunlap <rdunlap@infradead.org>:
      ia64: make IA64_MCA_RECOVERY bool instead of tristate

Subsystem: mm/memory-failure

    Joao Martins <joao.m.martins@oracle.com>:
      memory-failure: fetch compound_head after pgmap_pfn_valid()

Subsystem: mm/folios

    Wei Yang <richard.weiyang@gmail.com>:
      mm: page->mapping folio->mapping should have the same offset

Subsystem: selftests

    Maor Gottlieb <maorg@nvidia.com>:
      tools/testing/scatterlist: add missing defines

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
      kasan: test: fix compatibility with FORTIFY_SOURCE

    Peter Collingbourne <pcc@google.com>:
      mm, kasan: use compare-exchange operation to set KASAN page tag

Subsystem: mm/psi

    Suren Baghdasaryan <surenb@google.com>:
      psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n
      psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n

Subsystem: ocfs2

    Joseph Qi <joseph.qi@linux.alibaba.com>:
    Patch series "ocfs2: fix a deadlock case":
      jbd2: export jbd2_journal_[grab|put]_journal_head
      ocfs2: fix a deadlock when commit trans

 arch/ia64/Kconfig                    |    2 
 fs/binfmt_misc.c                     |    8 +--
 fs/jbd2/journal.c                    |    2 
 fs/ocfs2/suballoc.c                  |   25 ++++-------
 include/linux/mm.h                   |   17 +++++--
 include/linux/mm_types.h             |    1 
 include/linux/psi.h                  |   11 ++--
 include/linux/sysctl.h               |    2 
 kernel/sched/psi.c                   |   79 ++++++++++++++++++-----------------
 lib/test_kasan.c                     |    5 ++
 mm/memory-failure.c                  |    6 ++
 tools/testing/scatterlist/linux/mm.h |    3 -
 12 files changed, 91 insertions(+), 70 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2022-01-29  2:13 incoming Andrew Morton
@ 2022-01-29  4:25 ` Matthew Wilcox
  2022-01-29  6:23   ` incoming Andrew Morton
  0 siblings, 1 reply; 232+ messages in thread
From: Matthew Wilcox @ 2022-01-29  4:25 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linus Torvalds, mm-commits, linux-mm

On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote:
> 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f.
  ^^

I see 7?

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2022-01-29  4:25 ` incoming Matthew Wilcox
@ 2022-01-29  6:23   ` Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-01-29  6:23 UTC (permalink / raw)
  To: Matthew Wilcox; +Cc: Linus Torvalds, mm-commits, linux-mm

On Sat, 29 Jan 2022 04:25:33 +0000 Matthew Wilcox <willy@infradead.org> wrote:

> On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote:
> > 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f.
>   ^^
> 
> I see 7?

Crap, sorry, ignore all this, shall redo tomorrow.

(It wasn't a good day over here.  The thing with disk drives is that
the bigger they are, the harder they fall).


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-01-29 21:40 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-01-29 21:40 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

12 patches, based on f8c7e4ede46fe63ff10000669652648aab09d112.

Subsystems affected by this patch series:

  sysctl
  binfmt
  ia64
  mm/memory-failure
  mm/folios
  selftests
  mm/kasan
  mm/psi
  ocfs2

Subsystem: sysctl

    Andrew Morton <akpm@linux-foundation.org>:
      include/linux/sysctl.h: fix register_sysctl_mount_point() return type

Subsystem: binfmt

    Tong Zhang <ztong0001@gmail.com>:
      binfmt_misc: fix crash when load/unload module

Subsystem: ia64

    Randy Dunlap <rdunlap@infradead.org>:
      ia64: make IA64_MCA_RECOVERY bool instead of tristate

Subsystem: mm/memory-failure

    Joao Martins <joao.m.martins@oracle.com>:
      memory-failure: fetch compound_head after pgmap_pfn_valid()

Subsystem: mm/folios

    Wei Yang <richard.weiyang@gmail.com>:
      mm: page->mapping folio->mapping should have the same offset

Subsystem: selftests

    Maor Gottlieb <maorg@nvidia.com>:
      tools/testing/scatterlist: add missing defines

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
      kasan: test: fix compatibility with FORTIFY_SOURCE

    Peter Collingbourne <pcc@google.com>:
      mm, kasan: use compare-exchange operation to set KASAN page tag

Subsystem: mm/psi

    Suren Baghdasaryan <surenb@google.com>:
      psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n
      psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n

Subsystem: ocfs2

    Joseph Qi <joseph.qi@linux.alibaba.com>:
    Patch series "ocfs2: fix a deadlock case":
      jbd2: export jbd2_journal_[grab|put]_journal_head
      ocfs2: fix a deadlock when commit trans

 arch/ia64/Kconfig                    |    2 
 fs/binfmt_misc.c                     |    8 +--
 fs/jbd2/journal.c                    |    2 
 fs/ocfs2/suballoc.c                  |   25 ++++-------
 include/linux/mm.h                   |   17 +++++--
 include/linux/mm_types.h             |    1 
 include/linux/psi.h                  |   11 ++--
 include/linux/sysctl.h               |    2 
 kernel/sched/psi.c                   |   79 ++++++++++++++++++-----------------
 lib/test_kasan.c                     |    5 ++
 mm/memory-failure.c                  |    6 ++
 tools/testing/scatterlist/linux/mm.h |    3 -
 12 files changed, 91 insertions(+), 70 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-02-04  4:48 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-02-04  4:48 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

10 patches, based on 1f2cfdd349b7647f438c1e552dc1b983da86d830.

Subsystems affected by this patch series:

  mm/vmscan
  mm/debug
  mm/pagemap
  ipc
  mm/kmemleak
  MAINTAINERS
  mm/selftests

Subsystem: mm/vmscan

    Chen Wandun <chenwandun@huawei.com>:
      Revert "mm/page_isolation: unset migratetype directly for non Buddy page"

Subsystem: mm/debug

    Pasha Tatashin <pasha.tatashin@soleen.com>:
    Patch series "page table check fixes and cleanups", v5:
      mm/debug_vm_pgtable: remove pte entry from the page table
      mm/page_table_check: use unsigned long for page counters and cleanup
      mm/khugepaged: unify collapse pmd clear, flush and free
      mm/page_table_check: check entries at pmd levels

Subsystem: mm/pagemap

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/pgtable: define pte_index so that preprocessor could recognize it

Subsystem: ipc

    Minghao Chi <chi.minghao@zte.com.cn>:
      ipc/sem: do not sleep with a spin lock held

Subsystem: mm/kmemleak

    Lang Yu <lang.yu@amd.com>:
      mm/kmemleak: avoid scanning potential huge holes

Subsystem: MAINTAINERS

    Mike Rapoport <rppt@linux.ibm.com>:
      MAINTAINERS: update rppt's email

Subsystem: mm/selftests

    Shuah Khan <skhan@linuxfoundation.org>:
      kselftest/vm: revert "tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner"

 MAINTAINERS                              |    2 -
 include/linux/page_table_check.h         |   19 ++++++++++
 include/linux/pgtable.h                  |    1 
 ipc/sem.c                                |    4 +-
 mm/debug_vm_pgtable.c                    |    2 +
 mm/khugepaged.c                          |   37 +++++++++++---------
 mm/kmemleak.c                            |   13 +++----
 mm/page_isolation.c                      |    2 -
 mm/page_table_check.c                    |   55 +++++++++++++++----------------
 tools/testing/selftests/vm/userfaultfd.c |   11 ++++--
 10 files changed, 89 insertions(+), 57 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-02-12  0:27 Andrew Morton
  2022-02-12  2:02 ` incoming Linus Torvalds
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2022-02-12  0:27 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches

5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43.

Subsystems affected by this patch series:

  binfmt
  procfs
  mm/vmscan
  mm/memcg
  mm/kfence

Subsystem: binfmt

    Mike Rapoport <rppt@linux.ibm.com>:
      fs/binfmt_elf: fix PT_LOAD p_align values for loaders

Subsystem: procfs

    Yang Shi <shy828301@gmail.com>:
      fs/proc: task_mmu.c: don't read mapcount for migration entry

Subsystem: mm/vmscan

    Mel Gorman <mgorman@suse.de>:
      mm: vmscan: remove deadlock due to throttling failing to make progress

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg: synchronize objcg lists with a dedicated spinlock

Subsystem: mm/kfence

    Peng Liu <liupeng256@huawei.com>:
      kfence: make test case compatible with run time set sample interval

 fs/binfmt_elf.c            |    2 +-
 fs/proc/task_mmu.c         |   40 +++++++++++++++++++++++++++++++---------
 include/linux/kfence.h     |    2 ++
 include/linux/memcontrol.h |    5 +++--
 mm/kfence/core.c           |    3 ++-
 mm/kfence/kfence_test.c    |    8 ++++----
 mm/memcontrol.c            |   10 +++++-----
 mm/vmscan.c                |    4 +++-
 8 files changed, 51 insertions(+), 23 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2022-02-12  0:27 incoming Andrew Morton
@ 2022-02-12  2:02 ` Linus Torvalds
  2022-02-12  5:24   ` incoming Andrew Morton
  0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2022-02-12  2:02 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits, patches

On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43.

So this *completely* flummoxed 'b4', because you first sent the wrong
series, and then sent the right one in the same thread.

I fetched the emails  manually, but honestly, this was confusing even
then, with two "[PATCH x/5]" series where the only way to tell the
right one was basically by date of email. They did arrive in the same
order in my mailbox, but even that wouldn't have been guaranteed if
there had been some mailer delays somewhere..

So next time when you mess up, resend it all as a completely new
series and completely new threading - so with a new header email too.
Please?

And since I'm here, let me just verify that yes, the series you
actually want me to apply is this one (as described by the head
email):

  Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values ..
  Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f..
  Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl..
  Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a ..
  Subject: [patch 5/5] kfence: make test case compatible with run..

and not the other one with GUP patches?

             Linus

^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2022-02-12  2:02 ` incoming Linus Torvalds
@ 2022-02-12  5:24   ` Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-02-12  5:24 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Linux-MM, mm-commits, patches

On Fri, 11 Feb 2022 18:02:53 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43.
> 
> So this *completely* flummoxed 'b4', because you first sent the wrong
> series, and then sent the right one in the same thread.
> 
> I fetched the emails  manually, but honestly, this was confusing even
> then, with two "[PATCH x/5]" series where the only way to tell the
> right one was basically by date of email. They did arrive in the same
> order in my mailbox, but even that wouldn't have been guaranteed if
> there had been some mailer delays somewhere..

Yes, I wondered.  Sorry bout that.

> So next time when you mess up, resend it all as a completely new
> series and completely new threading - so with a new header email too.
> Please?

Wilco.

> And since I'm here, let me just verify that yes, the series you
> actually want me to apply is this one (as described by the head
> email):
> 
>   Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values ..
>   Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f..
>   Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl..
>   Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a ..
>   Subject: [patch 5/5] kfence: make test case compatible with run..
> 
> and not the other one with GUP patches?

Those are the ones.  Five fixes, three with cc:stable.

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-02-26  3:10 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-02-26  3:10 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches

12 patches, based on c47658311d60be064b839f329c0e4d34f5f0735b.

Subsystems affected by this patch series:

  MAINTAINERS
  mm/hugetlb
  mm/kasan
  mm/hugetlbfs
  mm/pagemap
  mm/selftests
  mm/memcg
  m/slab
  mailmap
  memfd

Subsystem: MAINTAINERS

    Luis Chamberlain <mcgrof@kernel.org>:
      MAINTAINERS: add sysctl-next git tree

Subsystem: mm/hugetlb

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/hugetlb: fix kernel crash with hugetlb mremap

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: test: prevent cache merging in kmem_cache_double_destroy

Subsystem: mm/hugetlbfs

    Liu Yuntao <liuyuntao10@huawei.com>:
      hugetlbfs: fix a truncation issue in hugepages parameter

Subsystem: mm/pagemap

    Suren Baghdasaryan <surenb@google.com>:
      mm: fix use-after-free bug when mm->mmap is reused after being freed

Subsystem: mm/selftests

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      selftest/vm: fix map_fixed_noreplace test failure

Subsystem: mm/memcg

    Roman Gushchin <roman.gushchin@linux.dev>:
      MAINTAINERS: add Roman as a memcg co-maintainer

    Vladimir Davydov <vdavydov.dev@gmail.com>:
      MAINTAINERS: remove Vladimir from memcg maintainers

    Shakeel Butt <shakeelb@google.com>:
      MAINTAINERS: add Shakeel as a memcg co-maintainer

Subsystem: m/slab

    Vlastimil Babka <vbabka@suse.cz>:
      MAINTAINERS, SLAB: add Roman as reviewer, git tree

Subsystem: mailmap

    Roman Gushchin <roman.gushchin@linux.dev>:
      mailmap: update Roman Gushchin's email

Subsystem: memfd

    Mike Kravetz <mike.kravetz@oracle.com>:
      selftests/memfd: clean up mapping in mfd_fail_write

 .mailmap                                         |    3 +
 MAINTAINERS                                      |    6 ++
 lib/test_kasan.c                                 |    5 +-
 mm/hugetlb.c                                     |   11 ++---
 mm/mmap.c                                        |    1 
 tools/testing/selftests/memfd/memfd_test.c       |    1 
 tools/testing/selftests/vm/map_fixed_noreplace.c |   49 +++++++++++++++++------
 7 files changed, 56 insertions(+), 20 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-03-05  4:28 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-03-05  4:28 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches

8 patches, based on 07ebd38a0da24d2534da57b4841346379db9f354.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/pagemap
  memfd
  selftests
  mm/userfaultfd
  kconfig

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      selftests/vm: cleanup hugetlb file after mremap test

Subsystem: mm/pagemap

    Suren Baghdasaryan <surenb@google.com>:
      mm: refactor vm_area_struct::anon_vma_name usage code
      mm: prevent vm_area_struct::anon_name refcount saturation
      mm: fix use-after-free when anon vma name is used after vma is freed

Subsystem: memfd

    Hugh Dickins <hughd@google.com>:
      memfd: fix F_SEAL_WRITE after shmem huge page allocated

Subsystem: selftests

    Chengming Zhou <zhouchengming@bytedance.com>:
      kselftest/vm: fix tests build with old libc

Subsystem: mm/userfaultfd

    Yun Zhou <yun.zhou@windriver.com>:
      proc: fix documentation and description of pagemap

Subsystem: kconfig

    Qian Cai <quic_qiancai@quicinc.com>:
      configs/debug: set CONFIG_DEBUG_INFO=y properly

 Documentation/admin-guide/mm/pagemap.rst     |    2 
 fs/proc/task_mmu.c                           |    9 +-
 fs/userfaultfd.c                             |    6 -
 include/linux/mm.h                           |    7 +
 include/linux/mm_inline.h                    |  105 ++++++++++++++++++---------
 include/linux/mm_types.h                     |    5 +
 kernel/configs/debug.config                  |    2 
 kernel/fork.c                                |    4 -
 kernel/sys.c                                 |   19 +++-
 mm/madvise.c                                 |   98 +++++++++----------------
 mm/memfd.c                                   |   40 +++++++---
 mm/mempolicy.c                               |    2 
 mm/mlock.c                                   |    2 
 mm/mmap.c                                    |   12 +--
 mm/mprotect.c                                |    2 
 tools/testing/selftests/vm/hugepage-mremap.c |   26 ++++--
 tools/testing/selftests/vm/run_vmtests.sh    |    3 
 tools/testing/selftests/vm/userfaultfd.c     |    1 
 18 files changed, 201 insertions(+), 144 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-03-16 23:14 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-03-16 23:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches

4 patches, based on 56e337f2cf1326323844927a04e9dbce9a244835.

Subsystems affected by this patch series:

  mm/swap
  kconfig
  ocfs2
  selftests

Subsystem: mm/swap

    Guo Ziliang <guo.ziliang@zte.com.cn>:
      mm: swap: get rid of deadloop in swapin readahead

Subsystem: kconfig

    Qian Cai <quic_qiancai@quicinc.com>:
      configs/debug: restore DEBUG_INFO=y for overriding

Subsystem: ocfs2

    Joseph Qi <joseph.qi@linux.alibaba.com>:
      ocfs2: fix crash when initialize filecheck kobj fails

Subsystem: selftests

    Yosry Ahmed <yosryahmed@google.com>:
      selftests: vm: fix clang build error multiple output files

 fs/ocfs2/super.c                    |   22 +++++++++++-----------
 kernel/configs/debug.config         |    1 +
 mm/swap_state.c                     |    2 +-
 tools/testing/selftests/vm/Makefile |    6 ++----
 4 files changed, 15 insertions(+), 16 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-03-22 21:38 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-03-22 21:38 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches


- A few misc subsystems

- There is a lot of MM material in Willy's tree.  Folio work and
  non-folio patches which depended on that work.

  Here I send almost all the MM patches which precede the patches in
  Willy's tree.  The remaining ~100 MM patches are staged on Willy's
  tree and I'll send those along once Willy is merged up.

  I tried this batch against your current tree (as of
  51912904076680281) and a couple need some extra persuasion to apply,
  but all looks OK otherwise.


227 patches, based on f443e374ae131c168a065ea1748feac6b2e76613

Subsystems affected by this patch series:

  kthread
  scripts
  ntfs
  ocfs2
  block
  vfs
  mm/kasan
  mm/pagecache
  mm/gup
  mm/swap
  mm/shmem
  mm/memcg
  mm/selftests
  mm/pagemap
  mm/mremap
  mm/sparsemem
  mm/vmalloc
  mm/pagealloc
  mm/memory-failure
  mm/mlock
  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/compaction
  mm/mempolicy
  mm/oom-kill
  mm/migration
  mm/thp
  mm/cma
  mm/autonuma
  mm/psi
  mm/ksm
  mm/page-poison
  mm/madvise
  mm/memory-hotplug
  mm/rmap
  mm/zswap
  mm/uaccess
  mm/ioremap
  mm/highmem
  mm/cleanups
  mm/kfence
  mm/hmm
  mm/damon

Subsystem: kthread

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      linux/kthread.h: remove unused macros

Subsystem: scripts

    Colin Ian King <colin.i.king@gmail.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

Subsystem: ntfs

    Dongliang Mu <mudongliangabcd@gmail.com>:
      ntfs: add sanity check on allocation size

Subsystem: ocfs2

    Joseph Qi <joseph.qi@linux.alibaba.com>:
      ocfs2: cleanup some return variables

    hongnanli <hongnan.li@linux.alibaba.com>:
      fs/ocfs2: fix comments mentioning i_mutex

Subsystem: block

    NeilBrown <neilb@suse.de>:
    Patch series "Remove remaining parts of congestion tracking code", v2:
      doc: convert 'subsection' to 'section' in gfp.h
      mm: document and polish read-ahead code
      mm: improve cleanup when ->readpages doesn't process all pages
      fuse: remove reliance on bdi congestion
      nfs: remove reliance on bdi congestion
      ceph: remove reliance on bdi congestion
      remove inode_congested()
      remove bdi_congested() and wb_congested() and related functions
      f2fs: replace congestion_wait() calls with io_schedule_timeout()
      block/bfq-iosched.c: use "false" rather than "BLK_RW_ASYNC"
      remove congestion tracking framework

Subsystem: vfs

    Anthony Iliopoulos <ailiop@suse.com>:
      mount: warn only once about timestamp range expiration

Subsystem: mm/kasan

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memremap: avoid calling kasan_remove_zero_shadow() for device private memory

Subsystem: mm/pagecache

    Miaohe Lin <linmiaohe@huawei.com>:
      filemap: remove find_get_pages()
      mm/writeback: minor clean up for highmem_dirtyable_memory

    Minchan Kim <minchan@kernel.org>:
      mm: fs: fix lru_cache_disabled race in bh_lru

Subsystem: mm/gup

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/gup: some cleanups", v5:
      mm: fix invalid page pointer returned with FOLL_PIN gups

    John Hubbard <jhubbard@nvidia.com>:
      mm/gup: follow_pfn_pte(): -EEXIST cleanup
      mm/gup: remove unused pin_user_pages_locked()
      mm: change lookup_node() to use get_user_pages_fast()
      mm/gup: remove unused get_user_pages_locked()

Subsystem: mm/swap

    Bang Li <libang.linuxer@gmail.com>:
      mm/swap: fix confusing comment in folio_mark_accessed

Subsystem: mm/shmem

    Xavier Roche <xavier.roche@algolia.com>:
      tmpfs: support for file creation time

    Hugh Dickins <hughd@google.com>:
      shmem: mapping_set_exiting() to help mapped resilience
      tmpfs: do not allocate pages on read

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: shmem: use helper macro __ATTR_RW

Subsystem: mm/memcg

    Shakeel Butt <shakeelb@google.com>:
      memcg: replace in_interrupt() with !in_task()

    Yosry Ahmed <yosryahmed@google.com>:
      memcg: add per-memcg total kernel memory stat

    Wei Yang <richard.weiyang@gmail.com>:
      mm/memcg: mem_cgroup_per_node is already set to 0 on allocation
      mm/memcg: retrieve parent memcg from css.parent

    Shakeel Butt <shakeelb@google.com>:
    Patch series "memcg: robust enforcement of memory.high", v2:
      memcg: refactor mem_cgroup_oom
      memcg: unify force charging conditions
      selftests: memcg: test high limit for single entry allocation
      memcg: synchronously enforce memory.high for large overcharges

    Randy Dunlap <rdunlap@infradead.org>:
      mm/memcontrol: return 1 from cgroup.memory __setup() handler

    Michal Hocko <mhocko@suse.com>:
    Patch series "mm/memcg: Address PREEMPT_RT problems instead of disabling it", v5:
      mm/memcg: revert ("mm/memcg: optimize user context object stock access")

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm/memcg: disable threshold event handlers on PREEMPT_RT
      mm/memcg: protect per-CPU counter by disabling preemption on PREEMPT_RT where needed.

    Johannes Weiner <hannes@cmpxchg.org>:
      mm/memcg: opencode the inner part of obj_cgroup_uncharge_pages() in drain_obj_stock()

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm/memcg: protect memcg_stock with a local_lock_t
      mm/memcg: disable migration instead of preemption in drain_all_stock().

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Optimize list lru memory consumption", v6:
      mm: list_lru: transpose the array of per-node per-memcg lru lists
      mm: introduce kmem_cache_alloc_lru
      fs: introduce alloc_inode_sb() to allocate filesystems specific inode
      fs: allocate inode by using alloc_inode_sb()
      f2fs: allocate inode by using alloc_inode_sb()
      mm: dcache: use kmem_cache_alloc_lru() to allocate dentry
      xarray: use kmem_cache_alloc_lru to allocate xa_node
      mm: memcontrol: move memcg_online_kmem() to mem_cgroup_css_online()
      mm: list_lru: allocate list_lru_one only when needed
      mm: list_lru: rename memcg_drain_all_list_lrus to memcg_reparent_list_lrus
      mm: list_lru: replace linear array with xarray
      mm: memcontrol: reuse memory cgroup ID for kmem ID
      mm: memcontrol: fix cannot alloc the maximum memcg ID
      mm: list_lru: rename list_lru_per_memcg to list_lru_memcg
      mm: memcontrol: rename memcg_cache_id to memcg_kmem_id

    Vasily Averin <vvs@virtuozzo.com>:
      memcg: enable accounting for tty-related objects

Subsystem: mm/selftests

    Guillaume Tucker <guillaume.tucker@collabora.com>:
      selftests, x86: fix how check_cc.sh is being invoked

Subsystem: mm/pagemap

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm: merge pte_mkhuge() call into arch_make_huge_pte()

    Stafford Horne <shorne@gmail.com>:
      mm: remove mmu_gathers storage from remaining architectures

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Fix some cache flush bugs", v5:
      mm: thp: fix wrong cache flush in remove_migration_pmd()
      mm: fix missing cache flush for all tail pages of compound page
      mm: hugetlb: fix missing cache flush in copy_huge_page_from_user()
      mm: hugetlb: fix missing cache flush in hugetlb_mcopy_atomic_pte()
      mm: shmem: fix missing cache flush in shmem_mfill_atomic_pte()
      mm: userfaultfd: fix missing cache flush in mcopy_atomic_pte() and __mcopy_atomic()
      mm: replace multiple dcache flush with flush_dcache_folio()

    Peter Xu <peterx@redhat.com>:
    Patch series "mm: Rework zap ptes on swap entries", v5:
      mm: don't skip swap entry even if zap_details specified
      mm: rename zap_skip_check_mapping() to should_zap_page()
      mm: change zap_details.zap_mapping into even_cows
      mm: rework swap handling of zap_pte_range

    Randy Dunlap <rdunlap@infradead.org>:
      mm/mmap: return 1 from stack_guard_gap __setup() handler

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memory.c: use helper function range_in_vma()
      mm/memory.c: use helper macro min and max in unmap_mapping_range_tree()

    Hugh Dickins <hughd@google.com>:
      mm: _install_special_mapping() apply VM_LOCKED_CLEAR_MASK

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mmap: remove obsolete comment in ksys_mmap_pgoff

Subsystem: mm/mremap

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mremap:: use vma_lookup() instead of find_vma()

Subsystem: mm/sparsemem

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/sparse: make mminit_validate_memmodel_limits() static

Subsystem: mm/vmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/vmalloc: remove unneeded function forward declaration

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: Move draining areas out of caller context

    Uladzislau Rezki <uladzislau.rezki@sony.com>:
      mm/vmalloc: add adjust_search_size parameter

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: eliminate an extra orig_gfp_mask

    Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
      mm/vmalloc.c: fix "unused function" warning

    Bang Li <libang.linuxer@gmail.com>:
      mm/vmalloc: fix comments about vmap_area struct

Subsystem: mm/pagealloc

    Zi Yan <ziy@nvidia.com>:
      mm: page_alloc: avoid merging non-fallbackable pageblocks with others

    Peter Collingbourne <pcc@google.com>:
      mm/mmzone.c: use try_cmpxchg() in page_cpupid_xchg_last()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mmzone.h: remove unused macros

    Nicolas Saenz Julienne <nsaenzju@redhat.com>:
      mm/page_alloc: don't pass pfn to free_unref_page_commit()

    David Hildenbrand <david@redhat.com>:
    Patch series "mm: enforce pageblock_order < MAX_ORDER":
      cma: factor out minimum alignment requirement
      mm: enforce pageblock_order < MAX_ORDER

    Nathan Chancellor <nathan@kernel.org>:
      mm/page_alloc: mark pagesets as __maybe_unused

    Alistair Popple <apopple@nvidia.com>:
      mm/pages_alloc.c: don't create ZONE_MOVABLE beyond the end of a node

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Follow-up on high-order PCP caching", v2:
      mm/page_alloc: fetch the correct pcp buddy during bulk free
      mm/page_alloc: track range of active PCP lists during bulk free
      mm/page_alloc: simplify how many pages are selected per pcp list during bulk free
      mm/page_alloc: drain the requested list first during bulk free
      mm/page_alloc: free pages in a single pass during bulk free
      mm/page_alloc: limit number of high-order pages on PCP during bulk free
      mm/page_alloc: do not prefetch buddies during bulk free

    Oscar Salvador <osalvador@suse.de>:
      arch/x86/mm/numa: Do not initialize nodes twice

    Suren Baghdasaryan <surenb@google.com>:
      mm: count time in drain_all_pages during direct reclaim as memory pressure

    Eric Dumazet <edumazet@google.com>:
      mm/page_alloc: call check_new_pages() while zone spinlock is not held

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: check high-order pages for corruption during PCP operations

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/memory-failure.c: remove obsolete comment
      mm/hwpoison: fix error page recovered but reported "not recovered"

    Rik van Riel <riel@surriel.com>:
      mm: invalidate hwpoison page cache page in fault path

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "A few cleanup and fixup patches for memory failure", v3:
      mm/memory-failure.c: minor clean up for memory_failure_dev_pagemap
      mm/memory-failure.c: catch unexpected -EFAULT from vma_address()
      mm/memory-failure.c: rework the signaling logic in kill_proc
      mm/memory-failure.c: fix race with changing page more robustly
      mm/memory-failure.c: remove PageSlab check in hwpoison_filter_dev
      mm/memory-failure.c: rework the try_to_unmap logic in hwpoison_user_mappings()
      mm/memory-failure.c: remove obsolete comment in __soft_offline_page
      mm/memory-failure.c: remove unnecessary PageTransTail check
      mm/hwpoison-inject: support injecting hwpoison to free page

    luofei <luofei@unicloud.com>:
      mm/hwpoison: avoid the impact of hwpoison_filter() return value on mce handler
      mm/hwpoison: add in-use hugepage hwpoison filter judgement

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "A few fixup patches for memory failure", v2:
      mm/memory-failure.c: fix race with changing page compound again
      mm/memory-failure.c: avoid calling invalidate_inode_page() with unexpected pages
      mm/memory-failure.c: make non-LRU movable pages unhandlable

    Vlastimil Babka <vbabka@suse.cz>:
      mm, fault-injection: declare should_fail_alloc_page()

Subsystem: mm/mlock

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mlock: fix potential imbalanced rlimit ucounts adjustment

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Free the 2nd vmemmap page associated with each HugeTLB page", v7:
      mm: hugetlb: free the 2nd vmemmap page associated with each HugeTLB page
      mm: hugetlb: replace hugetlb_free_vmemmap_enabled with a static_key
      mm: sparsemem: use page table lock to protect kernel pmd operations
      selftests: vm: add a hugetlb test case
      mm: sparsemem: move vmemmap related to HugeTLB to CONFIG_HUGETLB_PAGE_FREE_VMEMMAP

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/hugetlb: generalize ARCH_WANT_GENERAL_HUGETLB

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: clean up potential spectre issue warnings

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: use helper macro __ATTR_RW

    David Howells <dhowells@redhat.com>:
      mm/hugetlb.c: export PageHeadHuge()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: remove unneeded local variable follflags

Subsystem: mm/userfaultfd

    Nadav Amit <namit@vmware.com>:
      userfaultfd: provide unmasked address on page-fault

    Guo Zhengkui <guozhengkui@vivo.com>:
      userfaultfd/selftests: fix uninitialized_var.cocci warning

Subsystem: mm/vmscan

    Hugh Dickins <hughd@google.com>:
      mm/fs: delete PF_SWAPWRITE
      mm: __isolate_lru_page_prepare() in isolate_migratepages_block()

    Waiman Long <longman@redhat.com>:
      mm/list_lru: optimize memcg_reparent_list_lru_node()

    Marcelo Tosatti <mtosatti@redhat.com>:
      mm: lru_cache_disable: replace work queue synchronization with synchronize_rcu

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm: workingset: replace IRQ-off check with a lockdep assert.

    Charan Teja Kalla <quic_charante@quicinc.com>:
      mm: vmscan: fix documentation for page_check_references()

Subsystem: mm/compaction

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: compaction: cleanup the compaction trace events

Subsystem: mm/mempolicy

    Hugh Dickins <hughd@google.com>:
      mempolicy: mbind_range() set_policy() after vma_merge()

Subsystem: mm/oom-kill

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/oom_kill: remove unneeded is_memcg_oom check

Subsystem: mm/migration

    Huang Ying <ying.huang@intel.com>:
      mm,migrate: fix establishing demotion target

    "andrew.yang" <andrew.yang@mediatek.com>:
      mm/migrate: fix race between lock page and clear PG_Isolated

Subsystem: mm/thp

    Hugh Dickins <hughd@google.com>:
      mm/thp: refix __split_huge_pmd_locked() for migration PMD

Subsystem: mm/cma

    Hari Bathini <hbathini@linux.ibm.com>:
    Patch series "powerpc/fadump: handle CMA activation failure appropriately", v3:
      mm/cma: provide option to opt out from exposing pages on activation failure
      powerpc/fadump: opt out from freeing pages on cma activation failure

Subsystem: mm/autonuma

    Huang Ying <ying.huang@intel.com>:
    Patch series "NUMA balancing: optimize memory placement for memory tiering system", v13:
      NUMA Balancing: add page promotion counter
      NUMA balancing: optimize page placement for memory tiering system
      memory tiering: skip to scan fast memory

Subsystem: mm/psi

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: page_io: fix psi memory pressure error on cold swapins

Subsystem: mm/ksm

    Yang Yang <yang.yang29@zte.com.cn>:
      mm/vmstat: add event for ksm swapping in copy

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/ksm: use helper macro __ATTR_RW

Subsystem: mm/page-poison

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/hwpoison: check the subpage, not the head page

Subsystem: mm/madvise

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/madvise: use vma_lookup() instead of find_vma()

    Charan Teja Kalla <quic_charante@quicinc.com>:
    Patch series "mm: madvise: return correct bytes processed with:
      mm: madvise: return correct bytes advised with process_madvise
      mm: madvise: skip unmapped vma holes passed to process_madvise

Subsystem: mm/memory-hotplug

    Michal Hocko <mhocko@suse.com>:
    Patch series "mm, memory_hotplug: handle unitialized numa node gracefully":
      mm, memory_hotplug: make arch_alloc_nodedata independent on CONFIG_MEMORY_HOTPLUG
      mm: handle uninitialized numa nodes gracefully
      mm, memory_hotplug: drop arch_free_nodedata
      mm, memory_hotplug: reorganize new pgdat initialization
      mm: make free_area_init_node aware of memory less nodes

    Wei Yang <richard.weiyang@gmail.com>:
      memcg: do not tweak node in alloc_mem_cgroup_per_node_info

    David Hildenbrand <david@redhat.com>:
      drivers/base/memory: add memory block to memory group after registration succeeded
      drivers/base/node: consolidate node device subsystem initialization in node_dev_init()

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "A few cleanup patches around memory_hotplug":
      mm/memory_hotplug: remove obsolete comment of __add_pages
      mm/memory_hotplug: avoid calling zone_intersects() for ZONE_NORMAL
      mm/memory_hotplug: clean up try_offline_node
      mm/memory_hotplug: fix misplaced comment in offline_pages

    David Hildenbrand <david@redhat.com>:
    Patch series "drivers/base/memory: determine and store zone for single-zone memory blocks", v2:
      drivers/base/node: rename link_mem_sections() to register_memory_block_under_node()
      drivers/base/memory: determine and store zone for single-zone memory blocks
      drivers/base/memory: clarify adding and removing of memory blocks

    Oscar Salvador <osalvador@suse.de>:
      mm: only re-generate demotion targets when a numa node changes its N_CPU state

Subsystem: mm/rmap

    Hugh Dickins <hughd@google.com>:
      mm/thp: ClearPageDoubleMap in first page_add_file_rmap()

Subsystem: mm/zswap

    "Maciej S. Szmigiero" <maciej.szmigiero@oracle.com>:
      mm/zswap.c: allow handling just same-value filled pages

Subsystem: mm/uaccess

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm: remove usercopy_warn()
      mm: uninline copy_overflow()

    Randy Dunlap <rdunlap@infradead.org>:
      mm/usercopy: return 1 from hardened_usercopy __setup() handler

Subsystem: mm/ioremap

    Vlastimil Babka <vbabka@suse.cz>:
      mm/early_ioremap: declare early_memremap_pgprot_adjust()

Subsystem: mm/highmem

    Ira Weiny <ira.weiny@intel.com>:
      highmem: document kunmap_local()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/highmem: remove unnecessary done label

Subsystem: mm/cleanups

    "Dr. David Alan Gilbert" <linux@treblig.org>:
      mm/page_table_check.c: use strtobool for param parsing

Subsystem: mm/kfence

    tangmeng <tangmeng@uniontech.com>:
      mm/kfence: remove unnecessary CONFIG_KFENCE option

    Tianchen Ding <dtcccc@linux.alibaba.com>:
    Patch series "provide the flexibility to enable KFENCE", v3:
      kfence: allow re-enabling KFENCE after system startup
      kfence: alloc kfence_pool after system startup

    Peng Liu <liupeng256@huawei.com>:
    Patch series "kunit: fix a UAF bug and do some optimization", v2:
      kunit: fix UAF when run kfence test case test_gfpzero
      kunit: make kunit_test_timeout compatible with comment
      kfence: test: try to avoid test_gfpzero trigger rcu_stall

    Marco Elver <elver@google.com>:
      kfence: allow use of a deferrable timer

Subsystem: mm/hmm

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hmm.c: remove unneeded local variable ret

Subsystem: mm/damon

    SeongJae Park <sj@kernel.org>:
    Patch series "Remove the type-unclear target id concept":
      mm/damon/dbgfs/init_regions: use target index instead of target id
      Docs/admin-guide/mm/damon/usage: update for changed initail_regions file input
      mm/damon/core: move damon_set_targets() into dbgfs
      mm/damon: remove the target id concept

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/damon: remove redundant page validation

    SeongJae Park <sj@kernel.org>:
    Patch series "Allow DAMON user code independent of monitoring primitives":
      mm/damon: rename damon_primitives to damon_operations
      mm/damon: let monitoring operations can be registered and selected
      mm/damon/paddr,vaddr: register themselves to DAMON in subsys_initcall
      mm/damon/reclaim: use damon_select_ops() instead of damon_{v,p}a_set_operations()
      mm/damon/dbgfs: use damon_select_ops() instead of damon_{v,p}a_set_operations()
      mm/damon/dbgfs: use operations id for knowing if the target has pid
      mm/damon/dbgfs-test: fix is_target_id() change
      mm/damon/paddr,vaddr: remove damon_{p,v}a_{target_valid,set_operations}()

    tangmeng <tangmeng@uniontech.com>:
      mm/damon: remove unnecessary CONFIG_DAMON option

    SeongJae Park <sj@kernel.org>:
    Patch series "Docs/damon: Update documents for better consistency":
      Docs/vm/damon: call low level monitoring primitives the operations
      Docs/vm/damon/design: update DAMON-Idle Page Tracking interference handling
      Docs/damon: update outdated term 'regions update interval'
    Patch series "Introduce DAMON sysfs interface", v3:
      mm/damon/core: allow non-exclusive DAMON start/stop
      mm/damon/core: add number of each enum type values
      mm/damon: implement a minimal stub for sysfs-based DAMON interface
      mm/damon/sysfs: link DAMON for virtual address spaces monitoring
      mm/damon/sysfs: support the physical address space monitoring
      mm/damon/sysfs: support DAMON-based Operation Schemes
      mm/damon/sysfs: support DAMOS quotas
      mm/damon/sysfs: support schemes prioritization
      mm/damon/sysfs: support DAMOS watermarks
      mm/damon/sysfs: support DAMOS stats
      selftests/damon: add a test for DAMON sysfs interface
      Docs/admin-guide/mm/damon/usage: document DAMON sysfs interface
      Docs/ABI/testing: add DAMON sysfs interface ABI document

    Xin Hao <xhao@linux.alibaba.com>:
      mm/damon/sysfs: remove repeat container_of() in damon_sysfs_kdamond_release()

 Documentation/ABI/testing/sysfs-kernel-mm-damon  |  274 ++
 Documentation/admin-guide/cgroup-v1/memory.rst   |    2 
 Documentation/admin-guide/cgroup-v2.rst          |    5 
 Documentation/admin-guide/kernel-parameters.txt  |    2 
 Documentation/admin-guide/mm/damon/usage.rst     |  380 +++
 Documentation/admin-guide/mm/zswap.rst           |   22 
 Documentation/admin-guide/sysctl/kernel.rst      |   31 
 Documentation/core-api/mm-api.rst                |   19 
 Documentation/dev-tools/kfence.rst               |   12 
 Documentation/filesystems/porting.rst            |    6 
 Documentation/filesystems/vfs.rst                |   16 
 Documentation/vm/damon/design.rst                |   43 
 Documentation/vm/damon/faq.rst                   |    2 
 MAINTAINERS                                      |    1 
 arch/arm/Kconfig                                 |    4 
 arch/arm64/kernel/setup.c                        |    3 
 arch/arm64/mm/hugetlbpage.c                      |    1 
 arch/hexagon/mm/init.c                           |    2 
 arch/ia64/kernel/topology.c                      |   10 
 arch/ia64/mm/discontig.c                         |   11 
 arch/mips/kernel/topology.c                      |    5 
 arch/nds32/mm/init.c                             |    1 
 arch/openrisc/mm/init.c                          |    2 
 arch/powerpc/include/asm/fadump-internal.h       |    5 
 arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h |    4 
 arch/powerpc/kernel/fadump.c                     |    8 
 arch/powerpc/kernel/sysfs.c                      |   17 
 arch/riscv/Kconfig                               |    4 
 arch/riscv/kernel/setup.c                        |    3 
 arch/s390/kernel/numa.c                          |    7 
 arch/sh/kernel/topology.c                        |    5 
 arch/sparc/kernel/sysfs.c                        |   12 
 arch/sparc/mm/hugetlbpage.c                      |    1 
 arch/x86/Kconfig                                 |    4 
 arch/x86/kernel/cpu/mce/core.c                   |    8 
 arch/x86/kernel/topology.c                       |    5 
 arch/x86/mm/numa.c                               |   33 
 block/bdev.c                                     |    2 
 block/bfq-iosched.c                              |    2 
 drivers/base/init.c                              |    1 
 drivers/base/memory.c                            |  149 +
 drivers/base/node.c                              |   48 
 drivers/block/drbd/drbd_int.h                    |    3 
 drivers/block/drbd/drbd_req.c                    |    3 
 drivers/dax/super.c                              |    2 
 drivers/of/of_reserved_mem.c                     |    9 
 drivers/tty/tty_io.c                             |    2 
 drivers/virtio/virtio_mem.c                      |    9 
 fs/9p/vfs_inode.c                                |    2 
 fs/adfs/super.c                                  |    2 
 fs/affs/super.c                                  |    2 
 fs/afs/super.c                                   |    2 
 fs/befs/linuxvfs.c                               |    2 
 fs/bfs/inode.c                                   |    2 
 fs/btrfs/inode.c                                 |    2 
 fs/buffer.c                                      |    8 
 fs/ceph/addr.c                                   |   22 
 fs/ceph/inode.c                                  |    2 
 fs/ceph/super.c                                  |    1 
 fs/ceph/super.h                                  |    1 
 fs/cifs/cifsfs.c                                 |    2 
 fs/coda/inode.c                                  |    2 
 fs/dcache.c                                      |    3 
 fs/ecryptfs/super.c                              |    2 
 fs/efs/super.c                                   |    2 
 fs/erofs/super.c                                 |    2 
 fs/exfat/super.c                                 |    2 
 fs/ext2/ialloc.c                                 |    5 
 fs/ext2/super.c                                  |    2 
 fs/ext4/super.c                                  |    2 
 fs/f2fs/compress.c                               |    4 
 fs/f2fs/data.c                                   |    3 
 fs/f2fs/f2fs.h                                   |    6 
 fs/f2fs/segment.c                                |    8 
 fs/f2fs/super.c                                  |   14 
 fs/fat/inode.c                                   |    2 
 fs/freevxfs/vxfs_super.c                         |    2 
 fs/fs-writeback.c                                |   40 
 fs/fuse/control.c                                |   17 
 fs/fuse/dev.c                                    |    8 
 fs/fuse/file.c                                   |   17 
 fs/fuse/inode.c                                  |    2 
 fs/gfs2/super.c                                  |    2 
 fs/hfs/super.c                                   |    2 
 fs/hfsplus/super.c                               |    2 
 fs/hostfs/hostfs_kern.c                          |    2 
 fs/hpfs/super.c                                  |    2 
 fs/hugetlbfs/inode.c                             |    2 
 fs/inode.c                                       |    2 
 fs/isofs/inode.c                                 |    2 
 fs/jffs2/super.c                                 |    2 
 fs/jfs/super.c                                   |    2 
 fs/minix/inode.c                                 |    2 
 fs/namespace.c                                   |    2 
 fs/nfs/inode.c                                   |    2 
 fs/nfs/write.c                                   |   14 
 fs/nilfs2/segbuf.c                               |   16 
 fs/nilfs2/super.c                                |    2 
 fs/ntfs/inode.c                                  |    6 
 fs/ntfs3/super.c                                 |    2 
 fs/ocfs2/alloc.c                                 |    2 
 fs/ocfs2/aops.c                                  |    2 
 fs/ocfs2/cluster/nodemanager.c                   |    2 
 fs/ocfs2/dir.c                                   |    4 
 fs/ocfs2/dlmfs/dlmfs.c                           |    2 
 fs/ocfs2/file.c                                  |   13 
 fs/ocfs2/inode.c                                 |    2 
 fs/ocfs2/localalloc.c                            |    6 
 fs/ocfs2/namei.c                                 |    2 
 fs/ocfs2/ocfs2.h                                 |    4 
 fs/ocfs2/quota_global.c                          |    2 
 fs/ocfs2/stack_user.c                            |   18 
 fs/ocfs2/super.c                                 |    2 
 fs/ocfs2/xattr.c                                 |    2 
 fs/openpromfs/inode.c                            |    2 
 fs/orangefs/super.c                              |    2 
 fs/overlayfs/super.c                             |    2 
 fs/proc/inode.c                                  |    2 
 fs/qnx4/inode.c                                  |    2 
 fs/qnx6/inode.c                                  |    2 
 fs/reiserfs/super.c                              |    2 
 fs/romfs/super.c                                 |    2 
 fs/squashfs/super.c                              |    2 
 fs/sysv/inode.c                                  |    2 
 fs/ubifs/super.c                                 |    2 
 fs/udf/super.c                                   |    2 
 fs/ufs/super.c                                   |    2 
 fs/userfaultfd.c                                 |    5 
 fs/vboxsf/super.c                                |    2 
 fs/xfs/libxfs/xfs_btree.c                        |    2 
 fs/xfs/xfs_buf.c                                 |    3 
 fs/xfs/xfs_icache.c                              |    2 
 fs/zonefs/super.c                                |    2 
 include/linux/backing-dev-defs.h                 |    8 
 include/linux/backing-dev.h                      |   50 
 include/linux/cma.h                              |   14 
 include/linux/damon.h                            |   95 
 include/linux/fault-inject.h                     |    2 
 include/linux/fs.h                               |   21 
 include/linux/gfp.h                              |   10 
 include/linux/highmem-internal.h                 |   10 
 include/linux/hugetlb.h                          |    8 
 include/linux/kthread.h                          |   22 
 include/linux/list_lru.h                         |   45 
 include/linux/memcontrol.h                       |   46 
 include/linux/memory.h                           |   12 
 include/linux/memory_hotplug.h                   |  132 -
 include/linux/migrate.h                          |    8 
 include/linux/mm.h                               |   11 
 include/linux/mmzone.h                           |   22 
 include/linux/nfs_fs_sb.h                        |    1 
 include/linux/node.h                             |   25 
 include/linux/page-flags.h                       |   96 
 include/linux/pageblock-flags.h                  |    7 
 include/linux/pagemap.h                          |    7 
 include/linux/sched.h                            |    1 
 include/linux/sched/sysctl.h                     |   10 
 include/linux/shmem_fs.h                         |    1 
 include/linux/slab.h                             |    3 
 include/linux/swap.h                             |    6 
 include/linux/thread_info.h                      |    5 
 include/linux/uaccess.h                          |    2 
 include/linux/vm_event_item.h                    |    3 
 include/linux/vmalloc.h                          |    4 
 include/linux/xarray.h                           |    9 
 include/ras/ras_event.h                          |    1 
 include/trace/events/compaction.h                |   26 
 include/trace/events/writeback.h                 |   28 
 include/uapi/linux/userfaultfd.h                 |    8 
 ipc/mqueue.c                                     |    2 
 kernel/dma/contiguous.c                          |    4 
 kernel/sched/core.c                              |   21 
 kernel/sysctl.c                                  |    2 
 lib/Kconfig.kfence                               |   12 
 lib/kunit/try-catch.c                            |    3 
 lib/xarray.c                                     |   10 
 mm/Kconfig                                       |    6 
 mm/backing-dev.c                                 |   57 
 mm/cma.c                                         |   31 
 mm/cma.h                                         |    1 
 mm/compaction.c                                  |   60 
 mm/damon/Kconfig                                 |   19 
 mm/damon/Makefile                                |    7 
 mm/damon/core-test.h                             |   23 
 mm/damon/core.c                                  |  190 +
 mm/damon/dbgfs-test.h                            |  103 
 mm/damon/dbgfs.c                                 |  264 +-
 mm/damon/ops-common.c                            |  133 +
 mm/damon/ops-common.h                            |   16 
 mm/damon/paddr.c                                 |   62 
 mm/damon/prmtv-common.c                          |  133 -
 mm/damon/prmtv-common.h                          |   16 
 mm/damon/reclaim.c                               |   11 
 mm/damon/sysfs.c                                 | 2632 ++++++++++++++++++++++-
 mm/damon/vaddr-test.h                            |    8 
 mm/damon/vaddr.c                                 |   67 
 mm/early_ioremap.c                               |    1 
 mm/fadvise.c                                     |    5 
 mm/filemap.c                                     |   17 
 mm/gup.c                                         |  103 
 mm/highmem.c                                     |    9 
 mm/hmm.c                                         |    3 
 mm/huge_memory.c                                 |   41 
 mm/hugetlb.c                                     |   23 
 mm/hugetlb_vmemmap.c                             |   74 
 mm/hwpoison-inject.c                             |    7 
 mm/internal.h                                    |   19 
 mm/kfence/Makefile                               |    2 
 mm/kfence/core.c                                 |  147 +
 mm/kfence/kfence_test.c                          |    3 
 mm/ksm.c                                         |    6 
 mm/list_lru.c                                    |  690 ++----
 mm/maccess.c                                     |    6 
 mm/madvise.c                                     |   18 
 mm/memcontrol.c                                  |  549 ++--
 mm/memory-failure.c                              |  148 -
 mm/memory.c                                      |  116 -
 mm/memory_hotplug.c                              |  136 -
 mm/mempolicy.c                                   |   29 
 mm/memremap.c                                    |    3 
 mm/migrate.c                                     |  128 -
 mm/mlock.c                                       |    1 
 mm/mmap.c                                        |    5 
 mm/mmzone.c                                      |    7 
 mm/mprotect.c                                    |   13 
 mm/mremap.c                                      |    4 
 mm/oom_kill.c                                    |    3 
 mm/page-writeback.c                              |   12 
 mm/page_alloc.c                                  |  429 +--
 mm/page_io.c                                     |    7 
 mm/page_table_check.c                            |   10 
 mm/ptdump.c                                      |   16 
 mm/readahead.c                                   |  124 +
 mm/rmap.c                                        |   15 
 mm/shmem.c                                       |   46 
 mm/slab.c                                        |   39 
 mm/slab.h                                        |   25 
 mm/slob.c                                        |    6 
 mm/slub.c                                        |   42 
 mm/sparse-vmemmap.c                              |   70 
 mm/sparse.c                                      |    2 
 mm/swap.c                                        |   25 
 mm/swapfile.c                                    |    1 
 mm/usercopy.c                                    |   16 
 mm/userfaultfd.c                                 |    3 
 mm/vmalloc.c                                     |  102 
 mm/vmscan.c                                      |  138 -
 mm/vmstat.c                                      |   19 
 mm/workingset.c                                  |    7 
 mm/zswap.c                                       |   15 
 net/socket.c                                     |    2 
 net/sunrpc/rpc_pipe.c                            |    2 
 scripts/spelling.txt                             |   16 
 tools/testing/selftests/cgroup/cgroup_util.c     |   15 
 tools/testing/selftests/cgroup/cgroup_util.h     |    1 
 tools/testing/selftests/cgroup/test_memcontrol.c |   78 
 tools/testing/selftests/damon/Makefile           |    1 
 tools/testing/selftests/damon/sysfs.sh           |  306 ++
 tools/testing/selftests/vm/.gitignore            |    1 
 tools/testing/selftests/vm/Makefile              |    7 
 tools/testing/selftests/vm/hugepage-vmemmap.c    |  144 +
 tools/testing/selftests/vm/run_vmtests.sh        |   11 
 tools/testing/selftests/vm/userfaultfd.c         |    2 
 tools/testing/selftests/x86/Makefile             |    6 
 264 files changed, 7205 insertions(+), 3090 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-03-23 23:04 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-03-23 23:04 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches


Various misc subsystems, before getting into the post-linux-next material.

This is all based on v5.17.  I tested applying and compiling against
today's 1bc191051dca28fa6.  One patch required an extra whack, all
looks good.


41 patches, based on f443e374ae131c168a065ea1748feac6b2e76613.

Subsystems affected by this patch series:

  procfs
  misc
  core-kernel
  lib
  checkpatch
  init
  pipe
  minix
  fat
  cgroups
  kexec
  kdump
  taskstats
  panic
  kcov
  resource
  ubsan

Subsystem: procfs

    Hao Lee <haolee.swjtu@gmail.com>:
      proc: alloc PATH_MAX bytes for /proc/${pid}/fd/ symlinks

    David Hildenbrand <david@redhat.com>:
      proc/vmcore: fix possible deadlock on concurrent mmap and read

    Yang Li <yang.lee@linux.alibaba.com>:
      proc/vmcore: fix vmcore_alloc_buf() kernel-doc comment

Subsystem: misc

    Bjorn Helgaas <bhelgaas@google.com>:
      linux/types.h: remove unnecessary __bitwise__
      Documentation/sparse: add hints about __CHECKER__

Subsystem: core-kernel

    Miaohe Lin <linmiaohe@huawei.com>:
      kernel/ksysfs.c: use helper macro __ATTR_RW

Subsystem: lib

    Kees Cook <keescook@chromium.org>:
      Kconfig.debug: make DEBUG_INFO selectable from a choice

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      include: drop pointless __compiler_offsetof indirection

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      ilog2: force inlining of __ilog2_u32() and __ilog2_u64()

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      bitfield: add explicit inclusions to the example

    Feng Tang <feng.tang@intel.com>:
      lib/Kconfig.debug: add ARCH dependency for FUNCTION_ALIGN option

    Randy Dunlap <rdunlap@infradead.org>:
      lib: bitmap: fix many kernel-doc warnings

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: prefer MODULE_LICENSE("GPL") over MODULE_LICENSE("GPL v2")
      checkpatch: add --fix option for some TRAILING_STATEMENTS
      checkpatch: add early_param exception to blank line after struct/function test

    Sagar Patel <sagarmp@cs.unc.edu>:
      checkpatch: use python3 to find codespell dictionary

Subsystem: init

    Mark-PK Tsai <mark-pk.tsai@mediatek.com>:
      init: use ktime_us_delta() to make initcall_debug log more precise

    Randy Dunlap <rdunlap@infradead.org>:
      init.h: improve __setup and early_param documentation
      init/main.c: return 1 from handled __setup() functions

Subsystem: pipe

    Andrei Vagin <avagin@gmail.com>:
      fs/pipe: use kvcalloc to allocate a pipe_buffer array
      fs/pipe.c: local vars have to match types of proper pipe_inode_info fields

Subsystem: minix

    Qinghua Jin <qhjin.dev@gmail.com>:
      minix: fix bug when opening a file with O_DIRECT

Subsystem: fat

    Helge Deller <deller@gmx.de>:
      fat: use pointer to simple type in put_user()

Subsystem: cgroups

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      cgroup: use irqsave in cgroup_rstat_flush_locked().
cgroup: add a comment to cgroup_rstat_flush_locked().

Subsystem: kexec

    Jisheng Zhang <jszhang@kernel.org>:
    Patch series "kexec: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef", v2:
      kexec: make crashk_res, crashk_low_res and crash_notes symbols always visible
      riscv: mm: init: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef
      x86/setup: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef
      arm64: mm: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef

Subsystem: kdump

    Tiezhu Yang <yangtiezhu@loongson.cn>:
    Patch series "Update doc and fix some issues about kdump", v2:
      docs: kdump: update description about sysfs file system support
      docs: kdump: add scp example to write out the dump file
      panic: unset panic_on_warn inside panic()
      ubsan: no need to unset panic_on_warn in ubsan_epilogue()
      kasan: no need to unset panic_on_warn in end_report()

Subsystem: taskstats

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      taskstats: remove unneeded dead assignment

Subsystem: panic

    "Guilherme G. Piccoli" <gpiccoli@igalia.com>:
    Patch series "Some improvements on panic_print":
      docs: sysctl/kernel: add missing bit to panic_print
      panic: add option to dump all CPUs backtraces in panic_print
      panic: move panic_print before kmsg dumpers

Subsystem: kcov

    Aleksandr Nogikh <nogikh@google.com>:
    Patch series "kcov: improve mmap processing", v3:
      kcov: split ioctl handling into locked and unlocked parts
      kcov: properly handle subsequent mmap calls

Subsystem: resource

    Miaohe Lin <linmiaohe@huawei.com>:
      kernel/resource: fix kfree() of bootmem memory again

Subsystem: ubsan

    Marco Elver <elver@google.com>:
      Revert "ubsan, kcsan: Don't combine sanitizer with kcov on clang"

 Documentation/admin-guide/kdump/kdump.rst       |   10 +
 Documentation/admin-guide/kernel-parameters.txt |    5 
 Documentation/admin-guide/sysctl/kernel.rst     |    2 
 Documentation/dev-tools/sparse.rst              |    2 
 arch/arm64/mm/init.c                            |    9 -
 arch/riscv/mm/init.c                            |    6 -
 arch/x86/kernel/setup.c                         |   10 -
 fs/fat/dir.c                                    |    2 
 fs/minix/inode.c                                |    3 
 fs/pipe.c                                       |   13 +-
 fs/proc/base.c                                  |    8 -
 fs/proc/vmcore.c                                |   43 +++----
 include/linux/bitfield.h                        |    3 
 include/linux/compiler_types.h                  |    3 
 include/linux/init.h                            |   11 +
 include/linux/kexec.h                           |   12 +-
 include/linux/log2.h                            |    4 
 include/linux/stddef.h                          |    6 -
 include/uapi/linux/types.h                      |    6 -
 init/main.c                                     |   14 +-
 kernel/cgroup/rstat.c                           |   13 +-
 kernel/kcov.c                                   |  102 ++++++++---------
 kernel/ksysfs.c                                 |    3 
 kernel/panic.c                                  |   37 ++++--
 kernel/resource.c                               |   41 +-----
 kernel/taskstats.c                              |    5 
 lib/Kconfig.debug                               |  142 ++++++++++++------------
 lib/Kconfig.kcsan                               |   11 -
 lib/Kconfig.ubsan                               |   12 --
 lib/bitmap.c                                    |   24 ++--
 lib/ubsan.c                                     |   10 -
 mm/kasan/report.c                               |   10 -
 scripts/checkpatch.pl                           |   31 ++++-
 tools/include/linux/types.h                     |    5 
 34 files changed, 313 insertions(+), 305 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-03-25  1:07 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-03-25  1:07 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches


This is the material which was staged after willystuff in linux-next. 
Everything applied seamlessly on your latest, all looks well.



114 patches, based on 52deda9551a01879b3562e7b41748e85c591f14c.

Subsystems affected by this patch series:

  mm/debug
  mm/selftests
  mm/pagecache
  mm/thp
  mm/rmap
  mm/migration
  mm/kasan
  mm/hugetlb
  mm/pagemap
  mm/madvise
  selftests

Subsystem: mm/debug

    Sean Anderson <seanga2@gmail.com>:
      tools/vm/page_owner_sort.c: sort by stacktrace before culling
      tools/vm/page_owner_sort.c: support sorting by stack trace

    Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
      tools/vm/page_owner_sort.c: add switch between culling by stacktrace and txt

    Chongxi Zhao <zhaochongxi2019@email.szu.edu.cn>:
      tools/vm/page_owner_sort.c: support sorting pid and time

    Shenghong Han <hanshenghong2019@email.szu.edu.cn>:
      tools/vm/page_owner_sort.c: two trivial fixes

    Yixuan Cao <caoyixuan2019@email.szu.edu.cn>:
      tools/vm/page_owner_sort.c: delete invalid duplicate code

    Shenghong Han <hanshenghong2019@email.szu.edu.cn>:
      Documentation/vm/page_owner.rst: update the documentation

    Shuah Khan <skhan@linuxfoundation.org>:
      Documentation/vm/page_owner.rst: fix unexpected indentation warns

    Waiman Long <longman@redhat.com>:
    Patch series "mm/page_owner: Extend page_owner to show memcg information", v4:
      lib/vsprintf: avoid redundant work with 0 size
      mm/page_owner: use scnprintf() to avoid excessive buffer overrun check
      mm/page_owner: print memcg information
      mm/page_owner: record task command name

    Yixuan Cao <caoyixuan2019@email.szu.edu.cn>:
      mm/page_owner.c: record tgid
      tools/vm/page_owner_sort.c: fix the instructions for use

    Jiajian Ye <yejiajian2018@email.szu.edu.cn>:
      tools/vm/page_owner_sort.c: fix comments
      tools/vm/page_owner_sort.c: add a security check
      tools/vm/page_owner_sort.c: support sorting by tgid and update documentation
      tools/vm/page_owner_sort: fix three trivival places
      tools/vm/page_owner_sort: support for sorting by task command name
      tools/vm/page_owner_sort.c: support for selecting by PID, TGID or task command name
      tools/vm/page_owner_sort.c: support for user-defined culling rules

    Christoph Hellwig <hch@lst.de>:
      mm: unexport page_init_poison

Subsystem: mm/selftests

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      selftest/vm: add util.h and and move helper functions there

    Mike Rapoport <rppt@kernel.org>:
      selftest/vm: add helpers to detect PAGE_SIZE and PAGE_SHIFT

Subsystem: mm/pagecache

    Hugh Dickins <hughd@google.com>:
      mm: delete __ClearPageWaiters()
      mm: filemap_unaccount_folio() large skip mapcount fixup

Subsystem: mm/thp

    Hugh Dickins <hughd@google.com>:
      mm/thp: fix NR_FILE_MAPPED accounting in page_*_file_rmap()

Subsystem: mm/rmap

Subsystem: mm/migration

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/migration: Add trace events", v3:
      mm/migration: add trace events for THP migrations
      mm/migration: add trace events for base page and HugeTLB migrations

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan, vmalloc, arm64: add vmalloc tagging support for SW/HW_TAGS", v6:
      kasan, page_alloc: deduplicate should_skip_kasan_poison
      kasan, page_alloc: move tag_clear_highpage out of kernel_init_free_pages
      kasan, page_alloc: merge kasan_free_pages into free_pages_prepare
      kasan, page_alloc: simplify kasan_poison_pages call site
      kasan, page_alloc: init memory of skipped pages on free
      kasan: drop skip_kasan_poison variable in free_pages_prepare
      mm: clarify __GFP_ZEROTAGS comment
      kasan: only apply __GFP_ZEROTAGS when memory is zeroed
      kasan, page_alloc: refactor init checks in post_alloc_hook
      kasan, page_alloc: merge kasan_alloc_pages into post_alloc_hook
      kasan, page_alloc: combine tag_clear_highpage calls in post_alloc_hook
      kasan, page_alloc: move SetPageSkipKASanPoison in post_alloc_hook
      kasan, page_alloc: move kernel_init_free_pages in post_alloc_hook
      kasan, page_alloc: rework kasan_unpoison_pages call site
      kasan: clean up metadata byte definitions
      kasan: define KASAN_VMALLOC_INVALID for SW_TAGS
      kasan, x86, arm64, s390: rename functions for modules shadow
      kasan, vmalloc: drop outdated VM_KASAN comment
      kasan: reorder vmalloc hooks
      kasan: add wrappers for vmalloc hooks
      kasan, vmalloc: reset tags in vmalloc functions
      kasan, fork: reset pointer tags of vmapped stacks
      kasan, arm64: reset pointer tags of vmapped stacks
      kasan, vmalloc: add vmalloc tagging for SW_TAGS
      kasan, vmalloc, arm64: mark vmalloc mappings as pgprot_tagged
      kasan, vmalloc: unpoison VM_ALLOC pages after mapping
      kasan, mm: only define ___GFP_SKIP_KASAN_POISON with HW_TAGS
      kasan, page_alloc: allow skipping unpoisoning for HW_TAGS
      kasan, page_alloc: allow skipping memory init for HW_TAGS
      kasan, vmalloc: add vmalloc tagging for HW_TAGS
      kasan, vmalloc: only tag normal vmalloc allocations
      kasan, arm64: don't tag executable vmalloc allocations
      kasan: mark kasan_arg_stacktrace as __initdata
      kasan: clean up feature flags for HW_TAGS mode
      kasan: add kasan.vmalloc command line flag
      kasan: allow enabling KASAN_VMALLOC and SW/HW_TAGS
      arm64: select KASAN_VMALLOC for SW/HW_TAGS modes
      kasan: documentation updates
      kasan: improve vmalloc tests
      kasan: test: support async (again) and asymm modes for HW_TAGS

    tangmeng <tangmeng@uniontech.com>:
      mm/kasan: remove unnecessary CONFIG_KASAN option

    Peter Collingbourne <pcc@google.com>:
      kasan: update function name in comments

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: print virtual mapping info in reports
    Patch series "kasan: report clean-ups and improvements":
      kasan: drop addr check from describe_object_addr
      kasan: more line breaks in reports
      kasan: rearrange stack frame info in reports
      kasan: improve stack frame info in reports
      kasan: print basic stack frame info for SW_TAGS
      kasan: simplify async check in end_report()
      kasan: simplify kasan_update_kunit_status() and call sites
      kasan: check CONFIG_KASAN_KUNIT_TEST instead of CONFIG_KUNIT
      kasan: move update_kunit_status to start_report
      kasan: move disable_trace_on_warning to start_report
      kasan: split out print_report from __kasan_report
      kasan: simplify kasan_find_first_bad_addr call sites
      kasan: restructure kasan_report
      kasan: merge __kasan_report into kasan_report
      kasan: call print_report from kasan_report_invalid_free
      kasan: move and simplify kasan_report_async
      kasan: rename kasan_access_info to kasan_report_info
      kasan: add comment about UACCESS regions to kasan_report
      kasan: respect KASAN_BIT_REPORTED in all reporting routines
      kasan: reorder reporting functions
      kasan: move and hide kasan_save_enable/restore_multi_shot
      kasan: disable LOCKDEP when printing reports

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "Add hugetlb MADV_DONTNEED support", v3:
      mm: enable MADV_DONTNEED for hugetlb mappings
      selftests/vm: add hugetlb madvise MADV_DONTNEED MADV_REMOVE test
      userfaultfd/selftests: enable hugetlb remap and remove event testing

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/huge_memory: make is_transparent_hugepage() static

Subsystem: mm/pagemap

    David Hildenbrand <david@redhat.com>:
    Patch series "mm: COW fixes part 1: fix the COW security issue for THP and swap", v3:
      mm: optimize do_wp_page() for exclusive pages in the swapcache
      mm: optimize do_wp_page() for fresh pages in local LRU pagevecs
      mm: slightly clarify KSM logic in do_swap_page()
      mm: streamline COW logic in do_swap_page()
      mm/huge_memory: streamline COW logic in do_huge_pmd_wp_page()
      mm/khugepaged: remove reuse_swap_page() usage
      mm/swapfile: remove stale reuse_swap_page()
      mm/huge_memory: remove stale page_trans_huge_mapcount()
      mm/huge_memory: remove stale locking logic from __split_huge_pmd()

    Hugh Dickins <hughd@google.com>:
      mm: warn on deleting redirtied only if accounted
      mm: unmap_mapping_range_tree() with i_mmap_rwsem shared

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm: generalize ARCH_HAS_FILTER_PGPROT

Subsystem: mm/madvise

    Mauricio Faria de Oliveira <mfo@canonical.com>:
      mm: fix race between MADV_FREE reclaim and blkdev direct IO read

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: madvise: MADV_DONTNEED_LOCKED

Subsystem: selftests

    Muhammad Usama Anjum <usama.anjum@collabora.com>:
      selftests: vm: remove dependecy from internal kernel macros

    Kees Cook <keescook@chromium.org>:
      selftests: kselftest framework: provide "finished" helper

 Documentation/dev-tools/kasan.rst             |   17 
 Documentation/vm/page_owner.rst               |   72 ++
 arch/alpha/include/uapi/asm/mman.h            |    2 
 arch/arm64/Kconfig                            |    2 
 arch/arm64/include/asm/vmalloc.h              |    6 
 arch/arm64/include/asm/vmap_stack.h           |    5 
 arch/arm64/kernel/module.c                    |    5 
 arch/arm64/mm/pageattr.c                      |    2 
 arch/arm64/net/bpf_jit_comp.c                 |    3 
 arch/mips/include/uapi/asm/mman.h             |    2 
 arch/parisc/include/uapi/asm/mman.h           |    2 
 arch/powerpc/mm/book3s64/trace.c              |    1 
 arch/s390/kernel/module.c                     |    2 
 arch/x86/Kconfig                              |    3 
 arch/x86/kernel/module.c                      |    2 
 arch/x86/mm/init.c                            |    1 
 arch/xtensa/include/uapi/asm/mman.h           |    2 
 include/linux/gfp.h                           |   53 +-
 include/linux/huge_mm.h                       |    6 
 include/linux/kasan.h                         |  136 +++--
 include/linux/mm.h                            |    5 
 include/linux/page-flags.h                    |    2 
 include/linux/pagemap.h                       |    3 
 include/linux/swap.h                          |    4 
 include/linux/vmalloc.h                       |   18 
 include/trace/events/huge_memory.h            |    1 
 include/trace/events/migrate.h                |   31 +
 include/trace/events/mmflags.h                |   18 
 include/trace/events/thp.h                    |   27 +
 include/uapi/asm-generic/mman-common.h        |    2 
 kernel/fork.c                                 |   13 
 kernel/scs.c                                  |   16 
 lib/Kconfig.kasan                             |   18 
 lib/test_kasan.c                              |  239 ++++++++-
 lib/vsprintf.c                                |    8 
 mm/Kconfig                                    |    3 
 mm/debug.c                                    |    1 
 mm/filemap.c                                  |   63 +-
 mm/huge_memory.c                              |  109 ----
 mm/kasan/Makefile                             |    2 
 mm/kasan/common.c                             |    4 
 mm/kasan/hw_tags.c                            |  243 +++++++---
 mm/kasan/kasan.h                              |   76 ++-
 mm/kasan/report.c                             |  516 +++++++++++----------
 mm/kasan/report_generic.c                     |   34 -
 mm/kasan/report_hw_tags.c                     |    1 
 mm/kasan/report_sw_tags.c                     |   16 
 mm/kasan/report_tags.c                        |    2 
 mm/kasan/shadow.c                             |   76 +--
 mm/khugepaged.c                               |   11 
 mm/madvise.c                                  |   57 +-
 mm/memory.c                                   |  129 +++--
 mm/memremap.c                                 |    2 
 mm/migrate.c                                  |    4 
 mm/page-writeback.c                           |   18 
 mm/page_alloc.c                               |  270 ++++++-----
 mm/page_owner.c                               |   86 ++-
 mm/rmap.c                                     |   62 +-
 mm/swap.c                                     |    4 
 mm/swapfile.c                                 |  104 ----
 mm/vmalloc.c                                  |  167 ++++--
 tools/testing/selftests/kselftest.h           |   10 
 tools/testing/selftests/vm/.gitignore         |    1 
 tools/testing/selftests/vm/Makefile           |    1 
 tools/testing/selftests/vm/gup_test.c         |    3 
 tools/testing/selftests/vm/hugetlb-madvise.c  |  410 ++++++++++++++++
 tools/testing/selftests/vm/ksm_tests.c        |   38 -
 tools/testing/selftests/vm/memfd_secret.c     |    2 
 tools/testing/selftests/vm/run_vmtests.sh     |   15 
 tools/testing/selftests/vm/transhuge-stress.c |   41 -
 tools/testing/selftests/vm/userfaultfd.c      |   72 +-
 tools/testing/selftests/vm/util.h             |   75 ++-
 tools/vm/page_owner_sort.c                    |  628 +++++++++++++++++++++-----
 73 files changed, 2797 insertions(+), 1288 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-04-01 18:20 Andrew Morton
  2022-04-01 18:27 ` incoming Andrew Morton
  0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2022-04-01 18:20 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches

16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696.

Subsystems affected by this patch series:

  mm/madvise
  ofs2
  nilfs2
  mm/mlock
  mm/mfence
  mailmap
  mm/memory-failure
  mm/kasan
  mm/debug
  mm/kmemleak
  mm/damon

Subsystem: mm/madvise

    Charan Teja Kalla <quic_charante@quicinc.com>:
      Revert "mm: madvise: skip unmapped vma holes passed to process_madvise"

Subsystem: ofs2

    Joseph Qi <joseph.qi@linux.alibaba.com>:
      ocfs2: fix crash when mount with quota enabled

Subsystem: nilfs2

    Ryusuke Konishi <konishi.ryusuke@gmail.com>:
    Patch series "nilfs2 lockdep warning fixes":
      nilfs2: fix lockdep warnings in page operations for btree nodes
      nilfs2: fix lockdep warnings during disk space reclamation
      nilfs2: get rid of nilfs_mapping_init()

Subsystem: mm/mlock

    Hugh Dickins <hughd@google.com>:
      mm/munlock: add lru_add_drain() to fix memcg_stat_test
      mm/munlock: update Documentation/vm/unevictable-lru.rst

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm/munlock: protect the per-CPU pagevec by a local_lock_t

Subsystem: mm/kfence

    Muchun Song <songmuchun@bytedance.com>:
      mm: kfence: fix objcgs vector allocation

Subsystem: mailmap

    Kirill Tkhai <kirill.tkhai@openvz.org>:
      mailmap: update Kirill's email

Subsystem: mm/memory-failure

    Rik van Riel <riel@surriel.com>:
      mm,hwpoison: unmap poisoned page before invalidation

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP

Subsystem: mm/debug

    Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
      tools/vm/page_owner_sort.c: remove -c option
      doc/vm/page_owner.rst: remove content related to -c option

Subsystem: mm/kmemleak

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
      mm/kmemleak: reset tag when compare object pointer

Subsystem: mm/damon

    Jonghyeon Kim <tome01@ajou.ac.kr>:
      mm/damon: prevent activated scheme from sleeping by deactivated schemes

 .mailmap                             |    1 
 Documentation/vm/page_owner.rst      |    1 
 Documentation/vm/unevictable-lru.rst |  473 +++++++++++++++--------------------
 fs/nilfs2/btnode.c                   |   23 +
 fs/nilfs2/btnode.h                   |    1 
 fs/nilfs2/btree.c                    |   27 +
 fs/nilfs2/dat.c                      |    4 
 fs/nilfs2/gcinode.c                  |    7 
 fs/nilfs2/inode.c                    |  167 +++++++++++-
 fs/nilfs2/mdt.c                      |   45 ++-
 fs/nilfs2/mdt.h                      |    6 
 fs/nilfs2/nilfs.h                    |   16 -
 fs/nilfs2/page.c                     |   16 -
 fs/nilfs2/page.h                     |    1 
 fs/nilfs2/segment.c                  |    9 
 fs/nilfs2/super.c                    |    5 
 fs/ocfs2/quota_global.c              |   23 -
 fs/ocfs2/quota_local.c               |    2 
 include/linux/gfp.h                  |    4 
 mm/damon/core.c                      |    5 
 mm/gup.c                             |   10 
 mm/internal.h                        |    6 
 mm/kfence/core.c                     |   11 
 mm/kfence/kfence.h                   |    3 
 mm/kmemleak.c                        |    9 
 mm/madvise.c                         |    9 
 mm/memory.c                          |   12 
 mm/migrate.c                         |    2 
 mm/mlock.c                           |   46 ++-
 mm/page_alloc.c                      |    1 
 mm/rmap.c                            |    4 
 mm/swap.c                            |    4 
 tools/vm/page_owner_sort.c           |    6 
 33 files changed, 560 insertions(+), 399 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* Re: incoming
  2022-04-01 18:20 incoming Andrew Morton
@ 2022-04-01 18:27 ` Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-04-01 18:27 UTC (permalink / raw)
  To: Linus Torvalds, linux-mm, mm-commits, patches

Argh, messed up in-reply-to.  Let me redo...

^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-04-01 18:27 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-04-01 18:27 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches

16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696.

Subsystems affected by this patch series:

  mm/madvise
  ofs2
  nilfs2
  mm/mlock
  mm/mfence
  mailmap
  mm/memory-failure
  mm/kasan
  mm/debug
  mm/kmemleak
  mm/damon

Subsystem: mm/madvise

    Charan Teja Kalla <quic_charante@quicinc.com>:
      Revert "mm: madvise: skip unmapped vma holes passed to process_madvise"

Subsystem: ofs2

    Joseph Qi <joseph.qi@linux.alibaba.com>:
      ocfs2: fix crash when mount with quota enabled

Subsystem: nilfs2

    Ryusuke Konishi <konishi.ryusuke@gmail.com>:
    Patch series "nilfs2 lockdep warning fixes":
      nilfs2: fix lockdep warnings in page operations for btree nodes
      nilfs2: fix lockdep warnings during disk space reclamation
      nilfs2: get rid of nilfs_mapping_init()

Subsystem: mm/mlock

    Hugh Dickins <hughd@google.com>:
      mm/munlock: add lru_add_drain() to fix memcg_stat_test
      mm/munlock: update Documentation/vm/unevictable-lru.rst

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm/munlock: protect the per-CPU pagevec by a local_lock_t

Subsystem: mm/kfence

    Muchun Song <songmuchun@bytedance.com>:
      mm: kfence: fix objcgs vector allocation

Subsystem: mailmap

    Kirill Tkhai <kirill.tkhai@openvz.org>:
      mailmap: update Kirill's email

Subsystem: mm/memory-failure

    Rik van Riel <riel@surriel.com>:
      mm,hwpoison: unmap poisoned page before invalidation

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP

Subsystem: mm/debug

    Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
      tools/vm/page_owner_sort.c: remove -c option
      doc/vm/page_owner.rst: remove content related to -c option

Subsystem: mm/kmemleak

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
      mm/kmemleak: reset tag when compare object pointer

Subsystem: mm/damon

    Jonghyeon Kim <tome01@ajou.ac.kr>:
      mm/damon: prevent activated scheme from sleeping by deactivated schemes

 .mailmap                             |    1 
 Documentation/vm/page_owner.rst      |    1 
 Documentation/vm/unevictable-lru.rst |  473 +++++++++++++++--------------------
 fs/nilfs2/btnode.c                   |   23 +
 fs/nilfs2/btnode.h                   |    1 
 fs/nilfs2/btree.c                    |   27 +
 fs/nilfs2/dat.c                      |    4 
 fs/nilfs2/gcinode.c                  |    7 
 fs/nilfs2/inode.c                    |  167 +++++++++++-
 fs/nilfs2/mdt.c                      |   45 ++-
 fs/nilfs2/mdt.h                      |    6 
 fs/nilfs2/nilfs.h                    |   16 -
 fs/nilfs2/page.c                     |   16 -
 fs/nilfs2/page.h                     |    1 
 fs/nilfs2/segment.c                  |    9 
 fs/nilfs2/super.c                    |    5 
 fs/ocfs2/quota_global.c              |   23 -
 fs/ocfs2/quota_local.c               |    2 
 include/linux/gfp.h                  |    4 
 mm/damon/core.c                      |    5 
 mm/gup.c                             |   10 
 mm/internal.h                        |    6 
 mm/kfence/core.c                     |   11 
 mm/kfence/kfence.h                   |    3 
 mm/kmemleak.c                        |    9 
 mm/madvise.c                         |    9 
 mm/memory.c                          |   12 
 mm/migrate.c                         |    2 
 mm/mlock.c                           |   46 ++-
 mm/page_alloc.c                      |    1 
 mm/rmap.c                            |    4 
 mm/swap.c                            |    4 
 tools/vm/page_owner_sort.c           |    6 
 33 files changed, 560 insertions(+), 399 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-04-08 20:08 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-04-08 20:08 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches

9 patches, based on d00c50b35101b862c3db270ffeba53a63a1063d9.

Subsystems affected by this patch series:

  mm/migration
  mm/highmem
  lz4
  mm/sparsemem
  mm/mremap
  mm/mempolicy
  mailmap
  mm/memcg
  MAINTAINERS

Subsystem: mm/migration

    Zi Yan <ziy@nvidia.com>:
      mm: migrate: use thp_order instead of HPAGE_PMD_ORDER for new page allocation.

Subsystem: mm/highmem

    Max Filippov <jcmvbkbc@gmail.com>:
      highmem: fix checks in __kmap_local_sched_{in,out}

Subsystem: lz4

    Guo Xuenan <guoxuenan@huawei.com>:
      lz4: fix LZ4_decompress_safe_partial read out of bound

Subsystem: mm/sparsemem

    Waiman Long <longman@redhat.com>:
      mm/sparsemem: fix 'mem_section' will never be NULL gcc 12 warning

Subsystem: mm/mremap

    Paolo Bonzini <pbonzini@redhat.com>:
      mmmremap.c: avoid pointless invalidate_range_start/end on mremap(old_size=0)

Subsystem: mm/mempolicy

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mempolicy: fix mpol_new leak in shared_policy_replace

Subsystem: mailmap

    Vasily Averin <vasily.averin@linux.dev>:
      mailmap: update Vasily Averin's email address

Subsystem: mm/memcg

    Andrew Morton <akpm@linux-foundation.org>:
      mm/list_lru.c: revert "mm/list_lru: optimize memcg_reparent_list_lru_node()"

Subsystem: MAINTAINERS

    Tom Rix <trix@redhat.com>:
      MAINTAINERS: add Tom as clang reviewer

 .mailmap                 |    4 ++++
 MAINTAINERS              |    1 +
 include/linux/mmzone.h   |   11 +++++++----
 lib/lz4/lz4_decompress.c |    8 ++++++--
 mm/highmem.c             |    4 ++--
 mm/list_lru.c            |    6 ------
 mm/mempolicy.c           |    3 ++-
 mm/migrate.c             |    2 +-
 mm/mremap.c              |    3 +++
 9 files changed, 26 insertions(+), 16 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-04-15  2:12 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-04-15  2:12 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches

14 patches, based on 115acbb56978941bb7537a97dfc303da286106c1.

Subsystems affected by this patch series:

  MAINTAINERS
  mm/tmpfs
  m/secretmem
  mm/kasan
  mm/kfence
  mm/pagealloc
  mm/zram
  mm/compaction
  mm/hugetlb
  binfmt
  mm/vmalloc
  mm/kmemleak

Subsystem: MAINTAINERS

    Joe Perches <joe@perches.com>:
      MAINTAINERS: Broadcom internal lists aren't maintainers

Subsystem: mm/tmpfs

    Hugh Dickins <hughd@google.com>:
      tmpfs: fix regressions from wider use of ZERO_PAGE

Subsystem: m/secretmem

    Axel Rasmussen <axelrasmussen@google.com>:
      mm/secretmem: fix panic when growing a memfd_secret

Subsystem: mm/kasan

    Zqiang <qiang1.zhang@intel.com>:
      irq_work: use kasan_record_aux_stack_noalloc() record callstack

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      kasan: fix hw tags enablement when KUNIT tests are disabled

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      mm, kfence: support kmem_dump_obj() for KFENCE objects

Subsystem: mm/pagealloc

    Juergen Gross <jgross@suse.com>:
      mm, page_alloc: fix build_zonerefs_node()

Subsystem: mm/zram

    Minchan Kim <minchan@kernel.org>:
      mm: fix unexpected zeroed page mapping with zram swap

Subsystem: mm/compaction

    Charan Teja Kalla <quic_charante@quicinc.com>:
      mm: compaction: fix compiler warning when CONFIG_COMPACTION=n

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: do not demote poisoned hugetlb pages

Subsystem: binfmt

    Andrew Morton <akpm@linux-foundation.org>:
      revert "fs/binfmt_elf: fix PT_LOAD p_align values for loaders"
      revert "fs/binfmt_elf: use PT_LOAD p_align values for static PIE"

Subsystem: mm/vmalloc

    Omar Sandoval <osandov@fb.com>:
      mm/vmalloc: fix spinning drain_vmap_work after reading from /proc/vmcore

Subsystem: mm/kmemleak

    Patrick Wang <patrick.wang.shcn@gmail.com>:
      mm: kmemleak: take a full lowmem check in kmemleak_*_phys()

 MAINTAINERS                     |   64 ++++++++++++++++++++--------------------
 arch/x86/include/asm/io.h       |    2 -
 arch/x86/kernel/crash_dump_64.c |    1 
 fs/binfmt_elf.c                 |    6 +--
 include/linux/kfence.h          |   24 +++++++++++++++
 kernel/irq_work.c               |    2 -
 mm/compaction.c                 |   10 +++---
 mm/filemap.c                    |    6 ---
 mm/hugetlb.c                    |   17 ++++++----
 mm/kasan/hw_tags.c              |    5 +--
 mm/kasan/kasan.h                |   10 +++---
 mm/kfence/core.c                |   21 -------------
 mm/kfence/kfence.h              |   21 +++++++++++++
 mm/kfence/report.c              |   47 +++++++++++++++++++++++++++++
 mm/kmemleak.c                   |    8 ++---
 mm/page_alloc.c                 |    2 -
 mm/page_io.c                    |   54 ---------------------------------
 mm/secretmem.c                  |   17 ++++++++++
 mm/shmem.c                      |   31 ++++++++++++-------
 mm/slab.c                       |    2 -
 mm/slab.h                       |    2 -
 mm/slab_common.c                |    9 +++++
 mm/slob.c                       |    2 -
 mm/slub.c                       |    2 -
 mm/vmalloc.c                    |   11 ------
 25 files changed, 207 insertions(+), 169 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-04-21 23:35 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-04-21 23:35 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches

13 patches, based on b253435746d9a4a701b5f09211b9c14d3370d0da.

Subsystems affected by this patch series:

  mm/memory-failure
  mm/memcg
  mm/userfaultfd
  mm/hugetlbfs
  mm/mremap
  mm/oom-kill
  mm/kasan
  kcov
  mm/hmm

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/hwpoison: fix race between hugetlb free/demotion and memory_failure_hugetlb()

    Xu Yu <xuyu@linux.alibaba.com>:
      mm/memory-failure.c: skip huge_zero_page in memory_failure()

Subsystem: mm/memcg

    Shakeel Butt <shakeelb@google.com>:
      memcg: sync flush only if periodic flush is delayed

Subsystem: mm/userfaultfd

    Nadav Amit <namit@vmware.com>:
      userfaultfd: mark uffd_wp regardless of VM_WRITE flag

Subsystem: mm/hugetlbfs

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm, hugetlb: allow for "high" userspace addresses

Subsystem: mm/mremap

    Sidhartha Kumar <sidhartha.kumar@oracle.com>:
      selftest/vm: verify mmap addr in mremap_test
      selftest/vm: verify remap destination address in mremap_test
      selftest/vm: support xfail in mremap_test
      selftest/vm: add skip support to mremap_test

Subsystem: mm/oom-kill

    Nico Pache <npache@redhat.com>:
      oom_kill.c: futex: delay the OOM reaper to allow time for proper futex cleanup

Subsystem: mm/kasan

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      MAINTAINERS: add Vincenzo Frascino to KASAN reviewers

Subsystem: kcov

    Aleksandr Nogikh <nogikh@google.com>:
      kcov: don't generate a warning on vm_insert_page()'s failure

Subsystem: mm/hmm

    Alistair Popple <apopple@nvidia.com>:
      mm/mmu_notifier.c: fix race in mmu_interval_notifier_remove()

 MAINTAINERS                               |    1 
 fs/hugetlbfs/inode.c                      |    9 -
 include/linux/hugetlb.h                   |    6 +
 include/linux/memcontrol.h                |    5 
 include/linux/mm.h                        |    8 +
 include/linux/sched.h                     |    1 
 include/linux/sched/mm.h                  |    8 +
 kernel/kcov.c                             |    7 -
 mm/hugetlb.c                              |   10 +
 mm/memcontrol.c                           |   12 ++
 mm/memory-failure.c                       |  158 ++++++++++++++++++++++--------
 mm/mmap.c                                 |    8 -
 mm/mmu_notifier.c                         |   14 ++
 mm/oom_kill.c                             |   54 +++++++---
 mm/userfaultfd.c                          |   15 +-
 mm/workingset.c                           |    2 
 tools/testing/selftests/vm/mremap_test.c  |   85 +++++++++++++++-
 tools/testing/selftests/vm/run_vmtests.sh |   11 +-
 18 files changed, 327 insertions(+), 87 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

* incoming
@ 2022-04-27 19:41 Andrew Morton
  0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-04-27 19:41 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches

2 patches, based on d615b5416f8a1afeb82d13b238f8152c572d59c0.

Subsystems affected by this patch series:

  mm/kasan
  mm/debug

Subsystem: mm/kasan

    Zqiang <qiang1.zhang@intel.com>:
      kasan: prevent cpu_quarantine corruption when CPU offline and cache shrink occur at same time

Subsystem: mm/debug

    Akira Yokosawa <akiyks@gmail.com>:
      docs: vm/page_owner: use literal blocks for param description

 Documentation/vm/page_owner.rst |    5 +++--
 mm/kasan/quarantine.c           |    7 +++++++
 2 files changed, 10 insertions(+), 2 deletions(-)


^ permalink raw reply	[flat|nested] 232+ messages in thread

end of thread, other threads:[~2022-04-27 19:43 UTC | newest]

Thread overview: 232+ messages (download: mbox.gz follow: Atom feed
-- links below jump to the message on this page --
2016-11-30 23:53 incoming Andrew Morton
  -- strict thread matches above, loose matches on Subject: below --
2022-04-27 19:41 incoming Andrew Morton
2022-04-21 23:35 incoming Andrew Morton
2022-04-15  2:12 incoming Andrew Morton
2022-04-08 20:08 incoming Andrew Morton
2022-04-01 18:27 incoming Andrew Morton
2022-04-01 18:20 incoming Andrew Morton
2022-04-01 18:27 ` incoming Andrew Morton
2022-03-25  1:07 incoming Andrew Morton
2022-03-23 23:04 incoming Andrew Morton
2022-03-22 21:38 incoming Andrew Morton
2022-03-16 23:14 incoming Andrew Morton
2022-03-05  4:28 incoming Andrew Morton
2022-02-26  3:10 incoming Andrew Morton
2022-02-12  0:27 incoming Andrew Morton
2022-02-12  2:02 ` incoming Linus Torvalds
2022-02-12  5:24   ` incoming Andrew Morton
2022-02-04  4:48 incoming Andrew Morton
2022-01-29 21:40 incoming Andrew Morton
2022-01-29  2:13 incoming Andrew Morton
2022-01-29  4:25 ` incoming Matthew Wilcox
2022-01-29  6:23   ` incoming Andrew Morton
2022-01-22  6:10 incoming Andrew Morton
2022-01-20  2:07 incoming Andrew Morton
2022-01-14 22:02 incoming Andrew Morton
2021-12-31  4:12 incoming Andrew Morton
2021-12-25  5:11 incoming Andrew Morton
2021-12-10 22:45 incoming Andrew Morton
2021-11-20  0:42 incoming Andrew Morton
2021-11-11  4:32 incoming Andrew Morton
2021-11-09  2:30 incoming Andrew Morton
2021-11-05 20:34 incoming Andrew Morton
2021-10-28 21:35 incoming Andrew Morton
2021-10-18 22:14 incoming Andrew Morton
2021-09-24 22:42 incoming Andrew Morton
2021-09-10  3:09 incoming Andrew Morton
2021-09-10 17:11 ` incoming Kees Cook
2021-09-10 20:13   ` incoming Kees Cook
2021-09-09  1:08 incoming Andrew Morton
2021-09-08 22:17 incoming Andrew Morton
2021-09-08  2:52 incoming Andrew Morton
2021-09-08  8:57 ` incoming Vlastimil Babka
2021-09-02 21:48 incoming Andrew Morton
2021-09-02 21:49 ` incoming Andrew Morton
2021-08-25 19:17 incoming Andrew Morton
2021-08-20  2:03 incoming Andrew Morton
2021-08-13 23:53 incoming Andrew Morton
2021-07-29 21:52 incoming Andrew Morton
2021-07-23 22:49 incoming Andrew Morton
2021-07-15  4:26 incoming Andrew Morton
2021-07-08  0:59 incoming Andrew Morton
2021-07-01  1:46 incoming Andrew Morton
2021-07-03  0:28 ` incoming Linus Torvalds
2021-07-03  1:06   ` incoming Linus Torvalds
2021-06-29  2:32 incoming Andrew Morton
2021-06-25  1:38 incoming Andrew Morton
2021-06-16  1:22 incoming Andrew Morton
2021-06-05  3:00 incoming Andrew Morton
2021-05-23  0:41 incoming Andrew Morton
2021-05-15  0:26 incoming Andrew Morton
2021-05-07  1:01 incoming Andrew Morton
2021-05-07  7:12 ` incoming Linus Torvalds
2021-05-05  1:32 incoming Andrew Morton
2021-05-05  1:47 ` incoming Linus Torvalds
2021-05-05  3:16   ` incoming Andrew Morton
2021-05-05 17:10     ` incoming Linus Torvalds
2021-05-05 17:44       ` incoming Andrew Morton
2021-05-06  3:19         ` incoming Anshuman Khandual
2021-04-30  5:52 incoming Andrew Morton
2021-04-23 21:28 incoming Andrew Morton
2021-04-16 22:45 incoming Andrew Morton
2021-04-09 20:26 incoming Andrew Morton
2021-03-25  4:36 incoming Andrew Morton
2021-03-13  5:06 incoming Andrew Morton
2021-02-26  1:14 incoming Andrew Morton
2021-02-26 17:55 ` incoming Linus Torvalds
2021-02-26 19:16   ` incoming Andrew Morton
2021-02-24 19:58 incoming Andrew Morton
2021-02-24 21:30 ` incoming Linus Torvalds
2021-02-24 21:37   ` incoming Linus Torvalds
2021-02-25  8:53     ` incoming Arnd Bergmann
2021-02-25  9:12       ` incoming Andrey Ryabinin
2021-02-25 11:07         ` incoming Walter Wu
2021-02-13  4:52 incoming Andrew Morton
2021-02-09 21:41 incoming Andrew Morton
2021-02-10 19:30 ` incoming Linus Torvalds
2021-02-05  2:31 incoming Andrew Morton
2021-01-24  5:00 incoming Andrew Morton
2021-01-12 23:48 incoming Andrew Morton
2021-01-15 23:32 ` incoming Linus Torvalds
2020-12-29 23:13 incoming Andrew Morton
2020-12-22 19:58 incoming Andrew Morton
2020-12-22 21:43 ` incoming Linus Torvalds
2020-12-18 22:00 incoming Andrew Morton
2020-12-16  4:41 incoming Andrew Morton
2020-12-15 20:32 incoming Andrew Morton
2020-12-15 21:00 ` incoming Linus Torvalds
2020-12-15 22:48 ` incoming Linus Torvalds
2020-12-15 22:49   ` incoming Linus Torvalds
2020-12-15 22:55     ` incoming Andrew Morton
2020-12-15  3:02 incoming Andrew Morton
2020-12-15  3:25 ` incoming Linus Torvalds
2020-12-15  3:30   ` incoming Linus Torvalds
2020-12-15 14:04     ` incoming Konstantin Ryabitsev
2020-12-11 21:35 incoming Andrew Morton
2020-12-06  6:14 incoming Andrew Morton
2020-11-22  6:16 incoming Andrew Morton
2020-11-14  6:51 incoming Andrew Morton
2020-11-02  1:06 incoming Andrew Morton
2020-10-17 23:13 incoming Andrew Morton
2020-10-16  2:40 incoming Andrew Morton
2020-10-16  3:03 ` incoming Andrew Morton
2020-10-13 23:46 incoming Andrew Morton
2020-10-11  6:15 incoming Andrew Morton
2020-10-03  5:20 incoming Andrew Morton
2020-09-26  4:17 incoming Andrew Morton
2020-09-19  4:19 incoming Andrew Morton
2020-09-04 23:34 incoming Andrew Morton
2020-08-21  0:41 incoming Andrew Morton
2020-08-15  0:29 incoming Andrew Morton
2020-08-12  1:29 incoming Andrew Morton
2020-08-07  6:16 incoming Andrew Morton
2020-07-24  4:14 incoming Andrew Morton
2020-07-03 22:14 incoming Andrew Morton
2020-06-26  3:28 incoming Andrew Morton
2020-06-12  0:30 incoming Andrew Morton
2020-06-11  1:40 incoming Andrew Morton
2020-06-09  4:29 incoming Andrew Morton
2020-06-08  4:35 incoming Andrew Morton
2020-06-04 23:45 incoming Andrew Morton
2020-06-03 22:55 incoming Andrew Morton
2020-06-02 20:09 incoming Andrew Morton
2020-06-02  4:44 incoming Andrew Morton
2020-06-02 20:08 ` incoming Andrew Morton
     [not found]   ` <CAHk-=wgRV=SaiMn3L5u5mG0WfvB2VfEQadtudzDV3KRz5HnFrQ@mail.gmail.com>
2020-06-02 21:38     ` incoming Andrew Morton
2020-05-28  5:20 incoming Andrew Morton
     [not found] ` <CAHk-=whQSWcE1WvKxptHdyc9BUXQyxxyAH954=Jb_YSBrNJYDQ@mail.gmail.com>
2020-05-29 20:31   ` incoming Andrew Morton
     [not found]     ` <CAHk-=wiU-vQVURz62dzitbh2Pk+m_+ipaJU6=z=ES3cd_wKSLQ@mail.gmail.com>
2020-05-29 21:12       ` incoming Andrew Morton
2020-05-14  0:50 incoming Andrew Morton
2020-05-08  1:35 incoming Andrew Morton
2020-04-21  1:13 incoming Andrew Morton
2020-04-12  7:41 incoming Andrew Morton
2020-04-10 21:30 incoming Andrew Morton
2020-04-07  3:02 incoming Andrew Morton
2020-04-02  4:01 incoming Andrew Morton
2020-03-29  2:14 incoming Andrew Morton
2020-03-22  1:19 incoming Andrew Morton
2020-03-06  6:27 incoming Andrew Morton
2020-02-21  4:00 incoming Andrew Morton
2020-02-21  4:03 ` incoming Andrew Morton
2020-02-04  1:33 incoming Andrew Morton
     [not found] ` <CAHk-=whog86e4fRY_sxHqAos6spwAi_4aFF49S7h5C4XAZM2qw@mail.gmail.com>
2020-02-04  2:46   ` incoming Andrew Morton
2020-01-31  6:10 incoming Andrew Morton
2020-01-14  0:28 incoming Andrew Morton
2018-02-06 23:34 incoming Andrew Morton
2018-02-01  0:13 incoming Andrew Morton
2018-02-01  0:25 ` incoming Andrew Morton
2018-01-19  0:33 incoming Andrew Morton
2018-01-13  0:52 incoming Andrew Morton
2018-01-05  0:17 incoming Andrew Morton
2017-12-14 23:32 incoming Andrew Morton
2017-11-30  0:09 incoming Andrew Morton
2017-11-17 23:25 incoming Andrew Morton
2017-11-16  1:29 incoming Andrew Morton
2017-11-09 21:38 incoming Andrew Morton
2017-11-02 22:59 incoming Andrew Morton
2017-10-13 22:57 incoming Andrew Morton
2017-10-03 23:14 incoming Andrew Morton
2017-09-13 23:28 incoming Andrew Morton
2017-09-08 23:10 incoming Andrew Morton
     [not found] ` <CA+55aFwRXB5_kSuN7o+tqN6Eft6w5oZuLG3B8Rns=0ZZa2ihgA@mail.gmail.com>
     [not found]   ` <CA+55aFw+z3HDT4s1C41j=d5_0QTSu8NLSSpnk_jxZ39w34xgnA@mail.gmail.com>
2017-09-09 18:09     ` incoming Andrew Morton
2017-09-06 23:17 incoming Andrew Morton
2017-08-31 23:15 incoming Andrew Morton
2017-08-25 22:55 incoming Andrew Morton
2017-08-18 22:15 incoming Andrew Morton
2017-08-10 22:23 incoming Andrew Morton
2017-08-02 20:31 incoming Andrew Morton
2017-07-14 21:46 incoming Andrew Morton
2017-07-12 21:32 incoming Andrew Morton
2017-07-10 22:46 incoming Andrew Morton
2017-07-06 22:34 incoming Andrew Morton
2017-06-23 22:08 incoming Andrew Morton
2017-06-16 21:02 incoming Andrew Morton
2017-06-02 21:45 incoming Andrew Morton
2017-05-12 22:45 incoming Andrew Morton
2017-05-08 22:53 incoming Andrew Morton
2017-05-03 21:50 incoming Andrew Morton
2017-04-20 21:37 incoming Andrew Morton
2017-04-13 21:56 incoming Andrew Morton
2017-04-07 23:04 incoming Andrew Morton
2017-03-31 22:11 incoming Andrew Morton
2017-03-16 23:40 incoming Andrew Morton
2017-03-10  0:15 incoming Andrew Morton
2017-02-27 22:25 incoming Andrew Morton
2017-02-24 22:55 incoming Andrew Morton
2017-02-22 23:38 incoming Andrew Morton
2017-02-18 11:42 incoming Andrew Morton
2017-02-08 22:30 incoming Andrew Morton
2017-01-24 23:17 incoming Andrew Morton
2017-01-11  0:57 incoming Andrew Morton
2016-12-20  0:22 incoming Andrew Morton
2016-12-14 23:04 incoming Andrew Morton
2016-12-13  0:40 incoming Andrew Morton
2016-12-07 22:44 incoming Andrew Morton
2016-12-03  1:26 incoming Andrew Morton
2016-11-10 18:45 incoming Andrew Morton
2016-10-11 20:49 incoming Andrew Morton
2016-10-07 23:53 incoming Andrew Morton
2016-09-30 22:11 incoming Andrew Morton
2016-09-28 22:22 incoming Andrew Morton
2016-09-19 21:43 incoming Andrew Morton
2016-09-01 23:14 incoming Andrew Morton
2016-08-25 22:16 incoming Andrew Morton
2016-08-11 22:32 incoming Andrew Morton
2016-08-04 22:31 incoming Andrew Morton
2016-08-03 20:45 incoming Andrew Morton
2016-08-02 21:01 incoming Andrew Morton
2016-07-28 22:42 incoming Andrew Morton
2016-07-26 22:16 incoming Andrew Morton
2016-07-20 22:44 incoming Andrew Morton
2016-07-14 19:06 incoming Andrew Morton
2016-06-24 21:48 incoming Andrew Morton
2016-06-08 22:33 incoming Andrew Morton
2016-06-03 21:51 incoming Andrew Morton
2016-05-27 21:26 incoming Andrew Morton
2016-05-26 22:15 incoming Andrew Morton
2016-05-23 23:21 incoming Andrew Morton
2016-05-20 23:55 incoming Andrew Morton
2016-05-20  0:07 incoming Andrew Morton
2016-05-12 22:41 incoming Andrew Morton
2016-05-09 23:28 incoming Andrew Morton
2016-05-05 23:21 incoming Andrew Morton

This is a public inbox, see mirroring instructions
for how to clone and mirror all data and code used for this inbox